--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Apr 12 00:46:37 WEST 2018
codeml.models=1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=
tcoffee.dir=
tcoffee.minScore=3
input.fasta=
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1980.50 -1997.15
2 -1980.38 -1998.75
--------------------------------------
TOTAL -1980.44 -1998.24
--------------------------------------
Model parameter summaries over the runs sampled in files
"/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Summaries are based on a total of 15002 samples from 2 runs)
(Each run produced 10001 samples of which 7501 samples were included)
95% Cred. Interval
----------------------
Parameter Mean Variance Lower Upper Median PSRF *
---------------------------------------------------------------------------------------------
TL{all} 0.265317 0.000885 0.212000 0.329000 0.263000 1.000
r(A<->C){all} 0.101350 0.000840 0.051181 0.164004 0.098791 1.000
r(A<->G){all} 0.168862 0.001157 0.109084 0.242242 0.166530 1.000
r(A<->T){all} 0.210862 0.002079 0.129527 0.306510 0.208112 1.000
r(C<->G){all} 0.094341 0.000483 0.056313 0.141940 0.092704 1.000
r(C<->T){all} 0.340278 0.002551 0.245988 0.442625 0.338700 1.000
r(G<->T){all} 0.084306 0.000597 0.042649 0.137257 0.082479 1.002
pi(A){all} 0.216659 0.000197 0.189988 0.244904 0.216516 1.000
pi(C){all} 0.261869 0.000218 0.233643 0.291465 0.261522 1.000
pi(G){all} 0.316085 0.000245 0.286490 0.346889 0.315873 1.000
pi(T){all} 0.205388 0.000185 0.179485 0.232576 0.205199 1.000
alpha{1,2} 28.084679 2735.050281 0.173688 179.276444 0.846342 1.003
alpha{3} 100.482318 3261.914324 7.034359 194.807984 99.861952 1.000
pinvar{all} 0.694802 0.009037 0.471945 0.815786 0.712470 1.003
---------------------------------------------------------------------------------------------
* Convergence diagnostic (PSRF = Potential scale reduction factor [Gelman
and Rubin, 1992], uncorrected) should approach 1 as runs converge. The
values may be unreliable if you have a small number of samples. PSRF should
only be used as a rough guide to convergence since all the assumptions
that allow one to interpret it as a scale reduction factor are not met in
the phylogenetic context.
--- CODEML SUMMARY
Model 8: beta&w>1 -1807.692703
Model 7: beta -1836.888718
Model 1: NearlyNeutral -1836.836979
Model 2: PositiveSelection -1807.692074
Model 2 vs 1 58.28980999999976
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3)
Pr(w>1) post mean +- SE for w
28 L 0.954* 7.852
29 R 1.000** 8.181
31 S 0.803 6.768
46 D 0.973* 7.987
50 H 0.682 5.897
55 F 1.000** 8.179
56 L 0.549 4.940
75 V 0.999** 8.175
85 L 1.000** 8.181
92 R 0.931 7.686
104 G 0.953* 7.841
122 A 0.773 6.548
138 S 0.925 7.641
205 E 0.585 5.201
245 H 0.720 6.169
246 S 0.963* 7.915
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3)
Pr(w>1) post mean +- SE for w
28 L 0.957* 7.475 +- 2.185
29 R 1.000** 7.800 +- 1.733
31 S 0.823 6.506 +- 3.010
46 D 0.974* 7.601 +- 2.024
50 H 0.717 5.702 +- 3.311
55 F 1.000** 7.799 +- 1.736
56 L 0.609 4.832 +- 3.349
75 V 0.999** 7.794 +- 1.744
85 L 1.000** 7.800 +- 1.733
92 R 0.935 7.304 +- 2.363
104 G 0.957* 7.489 +- 2.189
122 A 0.796 6.305 +- 3.109
138 S 0.931 7.297 +- 2.396
205 E 0.635 5.080 +- 3.402
245 H 0.747 5.870 +- 3.203
246 S 0.966* 7.559 +- 2.107
Model 8 vs 7 58.39202999999998
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3)
Pr(w>1) post mean +- SE for w
28 L 0.955* 7.817
29 R 1.000** 8.141
31 S 0.805 6.746
46 D 0.973* 7.950
50 H 0.684 5.888
55 F 1.000** 8.139
56 L 0.553 4.948
75 V 0.999** 8.135
85 L 1.000** 8.141
92 R 0.932 7.654
104 G 0.953* 7.805
122 A 0.774 6.530
138 S 0.925 7.608
205 E 0.588 5.202
245 H 0.723 6.162
246 S 0.963* 7.878
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3)
Pr(w>1) post mean +- SE for w
14 R 0.607 3.608 +- 2.669
18 A 0.521 3.120 +- 2.659
22 R 0.648 3.846 +- 2.652
23 P 0.604 3.590 +- 2.670
24 R 0.529 3.168 +- 2.663
28 L 0.992** 5.888 +- 1.485
29 R 1.000** 5.940 +- 1.431
31 S 0.939 5.562 +- 1.817
44 Y 0.749 4.364 +- 2.329
46 D 0.996** 5.914 +- 1.457
50 H 0.903 5.322 +- 1.965
55 F 1.000** 5.940 +- 1.431
56 L 0.898 5.246 +- 1.910
75 V 1.000** 5.939 +- 1.432
78 S 0.781 4.551 +- 2.275
85 L 1.000** 5.940 +- 1.431
86 L 0.735 4.283 +- 2.352
88 Q 0.590 3.478 +- 2.465
89 K 0.523 3.121 +- 2.458
92 R 0.988* 5.861 +- 1.508
99 H 0.630 3.693 +- 2.452
102 G 0.549 3.261 +- 2.470
104 G 0.989* 5.872 +- 1.515
122 A 0.930 5.502 +- 1.859
131 N 0.645 3.773 +- 2.441
138 S 0.983* 5.833 +- 1.552
153 G 0.668 3.903 +- 2.424
184 R 0.678 3.966 +- 2.425
201 A 0.569 3.394 +- 2.672
205 E 0.872 5.120 +- 2.066
209 R 0.725 4.225 +- 2.361
245 H 0.940 5.531 +- 1.756
246 S 0.990* 5.879 +- 1.512
247 G 0.704 4.159 +- 2.574
>C1
MVCLKLPGGSSLAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGT
ERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQK
RGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY
TCQVEHPSVTSALTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGHSGLQPTGFLS
>C2
MVCLRLPGGSYVAALTVTLMVLSSPLALVGDTRPRFLELVKHECHFFNGT
ERVRYLDRYIHNQEEVVRFDSDVGEYRAVTELGRPDAEYWNSQKDYVEQK
RGQVDNYCRHNYGVFESFTVQRRVQPKMTVYPAKTQPLQHHNLLVCSVSG
FYPGSIEVRWFRNNQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
TCQVEHPSVTTPITVQWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGGSGLQPTGLLS
>C3
MVCLRLPGGFCMAALTVTLMVLSSPLALAGDTRPRFLEQAKSECHFFNGT
ERVRYLQRYFYNQEEYVRFDSDVGEYRAVTELGRPSAEYWNSQKELLEQK
RGQVDNYCRHNYRVGESFTVQRRVQPKVTVYPAKTQPLQHHSLLVCSVSG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
TCQVEHPSVMSPLTVQWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGRSGLQPTGLLS
>C4
MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTRPRFLEQVKSECHFFNGT
ERVRFLERHFYNQEEFVRFDSDVGEYRAVSELGRPVAESWNSQKDLLEQK
RGQVDNYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHTLLVCSVSG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY
TCQVEHPSVTSPLTVQWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGHSGLQPTGLLS
>C5
MVCLKLPGGSYMAALTVTLMVLSSPLALAGDTQPRFLEQFKSECHFFNGT
ERVRYLQRYFYNQEEYVRYDSDVGEYRAVTELGRPDAKYWNSQKDILEQR
RARVDNYCRHNYGVGESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGHSGLHPTGLLS
>C6
MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTRSRFLELVKSECHFFNGT
ERVRFLERYFYNQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDYVEQK
RGQVDNYCRHNYRVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVNG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY
TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGHSGLQPTGFLS
>C7
MAALTVTLMVLSSPLALAGDTRPHFLEQGKSECHFFNGTERVRFLERHFY
NQEEYLRFDSDVGEYRAVSELGRPTAESWNSQKDYLEQKRGQVDNYCRHN
YGVGESFTVQRRVQPKVTVYPAKTQPLQHHTLLVCSVNGFYPGSIEVRWF
RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVYTCQVEHPSVTS
PLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGLLSooo
oooooooooooooooo
>C8
MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTRPRFLEYSTSECHFFNGT
ERVRYLDRYFYNQEETLRFDSDVGEYRAVTELGRPDAEYWNSQKDILEDQ
RASVDNYCRYNYGVGESFTVQRRVQPKVTVYPAKTQPLQHHNLLVCSVNG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
TCQVEHPSVTSPLTVEWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGHTGLQPTGLLS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=8, Len=277
C1 MVCLKLPGGSSLAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGT
C2 MVCLRLPGGSYVAALTVTLMVLSSPLALVGDTRPRFLELVKHECHFFNGT
C3 MVCLRLPGGFCMAALTVTLMVLSSPLALAGDTRPRFLEQAKSECHFFNGT
C4 MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTRPRFLEQVKSECHFFNGT
C5 MVCLKLPGGSYMAALTVTLMVLSSPLALAGDTQPRFLEQFKSECHFFNGT
C6 MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTRSRFLELVKSECHFFNGT
C7 -----------MAALTVTLMVLSSPLALAGDTRPHFLEQGKSECHFFNGT
C8 MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTRPRFLEYSTSECHFFNGT
:************ **:.***:.:*** . ********
C1 ERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQK
C2 ERVRYLDRYIHNQEEVVRFDSDVGEYRAVTELGRPDAEYWNSQKDYVEQK
C3 ERVRYLQRYFYNQEEYVRFDSDVGEYRAVTELGRPSAEYWNSQKELLEQK
C4 ERVRFLERHFYNQEEFVRFDSDVGEYRAVSELGRPVAESWNSQKDLLEQK
C5 ERVRYLQRYFYNQEEYVRYDSDVGEYRAVTELGRPDAKYWNSQKDILEQR
C6 ERVRFLERYFYNQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDYVEQK
C7 ERVRFLERHFYNQEEYLRFDSDVGEYRAVSELGRPTAESWNSQKDYLEQK
C8 ERVRYLDRYFYNQEETLRFDSDVGEYRAVTELGRPDAEYWNSQKDILEDQ
****:*:*:::**** :*:**********:***** *: *****: :*::
C1 RGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSG
C2 RGQVDNYCRHNYGVFESFTVQRRVQPKMTVYPAKTQPLQHHNLLVCSVSG
C3 RGQVDNYCRHNYRVGESFTVQRRVQPKVTVYPAKTQPLQHHSLLVCSVSG
C4 RGQVDNYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHTLLVCSVSG
C5 RARVDNYCRHNYGVGESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNG
C6 RGQVDNYCRHNYRVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVNG
C7 RGQVDNYCRHNYGVGESFTVQRRVQPKVTVYPAKTQPLQHHTLLVCSVNG
C8 RASVDNYCRYNYGVGESFTVQRRVQPKVTVYPAKTQPLQHHNLLVCSVNG
*. ******:** * *********:*::****:********.******.*
C1 FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY
C2 FYPGSIEVRWFRNNQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
C3 FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
C4 FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY
C5 FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
C6 FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY
C7 FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
C8 FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
*************.******************************:*****
C1 TCQVEHPSVTSALTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
C2 TCQVEHPSVTTPITVQWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
C3 TCQVEHPSVMSPLTVQWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
C4 TCQVEHPSVTSPLTVQWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
C5 TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
C6 TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
C7 TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
C8 TCQVEHPSVTSPLTVEWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
********* :.:**:***:******************************
C1 RNQKGHSGLQPTGFLS-----------
C2 RNQKGGSGLQPTGLLS-----------
C3 RNQKGRSGLQPTGLLS-----------
C4 RNQKGHSGLQPTGLLS-----------
C5 RNQKGHSGLHPTGLLS-----------
C6 RNQKGHSGLQPTGFLS-----------
C7 RNQKGLLSooooooooooooooooooo
C8 RNQKGHTGLQPTGLLS-----------
***** .
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15224]
Library Relaxation: Multi_proc [8]
[Relax Library][TOT= 1][100 %][ELAPSED TIME: 0 sec.]] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15224]
Library Relaxation: Multi_proc [8]
] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15224]
Library Relaxation: Multi_proc [8]
] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15224]
Library Relaxation: Multi_proc [8]
] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15224]
Library Relaxation: Multi_proc [8]
] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15224]
Library Relaxation: Multi_proc [8]
] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15224]
Library Relaxation: Multi_proc [8]
] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15224]
Library Relaxation: Multi_proc [8]
] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15224]
Library Relaxation: Multi_proc [8]
Relaxation Summary: [15224]--->[15148]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.612 Mb, Max= 31.087 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
LAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGTERVRYLDRYFH
NQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHN
YGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWF
RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTS
ALTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQP
TGFLS
>C2
VAALTVTLMVLSSPLALVGDTRPRFLELVKHECHFFNGTERVRYLDRYIH
NQEEVVRFDSDVGEYRAVTELGRPDAEYWNSQKDYVEQKRGQVDNYCRHN
YGVFESFTVQRRVQPKMTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWF
RNNQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVYTCQVEHPSVTT
PITVQWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGGSGLQP
TGLLS
>C3
MAALTVTLMVLSSPLALAGDTRPRFLEQAKSECHFFNGTERVRYLQRYFY
NQEEYVRFDSDVGEYRAVTELGRPSAEYWNSQKELLEQKRGQVDNYCRHN
YRVGESFTVQRRVQPKVTVYPAKTQPLQHHSLLVCSVSGFYPGSIEVRWF
RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVYTCQVEHPSVMS
PLTVQWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGRSGLQP
TGLLS
>C4
MAALTVTLMVLSSPLALAGDTRPRFLEQVKSECHFFNGTERVRFLERHFY
NQEEFVRFDSDVGEYRAVSELGRPVAESWNSQKDLLEQKRGQVDNYCRYN
YGVVESFTVQRRVQPKVTVYPSKTQPLQHHTLLVCSVSGFYPGSIEVRWF
RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTS
PLTVQWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQP
TGLLS
>C5
MAALTVTLMVLSSPLALAGDTQPRFLEQFKSECHFFNGTERVRYLQRYFY
NQEEYVRYDSDVGEYRAVTELGRPDAKYWNSQKDILEQRRARVDNYCRHN
YGVGESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWF
RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVYTCQVEHPSVTS
PLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLHP
TGLLS
>C6
MAALTVTLMVLSSPLALAGDTRSRFLELVKSECHFFNGTERVRFLERYFY
NQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDYVEQKRGQVDNYCRHN
YRVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWF
RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTS
PLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQP
TGFLS
>C7
MAALTVTLMVLSSPLALAGDTRPHFLEQGKSECHFFNGTERVRFLERHFY
NQEEYLRFDSDVGEYRAVSELGRPTAESWNSQKDYLEQKRGQVDNYCRHN
YGVGESFTVQRRVQPKVTVYPAKTQPLQHHTLLVCSVNGFYPGSIEVRWF
RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVYTCQVEHPSVTS
PLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGLLSooo
ooooo
>C8
MAALTVTLMVLSSPLALAGDTRPRFLEYSTSECHFFNGTERVRYLDRYFY
NQEETLRFDSDVGEYRAVTELGRPDAEYWNSQKDILEDQRASVDNYCRYN
YGVGESFTVQRRVQPKVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWF
RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVYTCQVEHPSVTS
PLTVEWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHTGLQP
TGLLS
CLUSTAL W (1.83) multiple sequence alignment
C1 LAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGTERVRYLDRYFH
C2 VAALTVTLMVLSSPLALVGDTRPRFLELVKHECHFFNGTERVRYLDRYIH
C3 MAALTVTLMVLSSPLALAGDTRPRFLEQAKSECHFFNGTERVRYLQRYFY
C4 MAALTVTLMVLSSPLALAGDTRPRFLEQVKSECHFFNGTERVRFLERHFY
C5 MAALTVTLMVLSSPLALAGDTQPRFLEQFKSECHFFNGTERVRYLQRYFY
C6 MAALTVTLMVLSSPLALAGDTRSRFLELVKSECHFFNGTERVRFLERYFY
C7 MAALTVTLMVLSSPLALAGDTRPHFLEQGKSECHFFNGTERVRFLERHFY
C8 MAALTVTLMVLSSPLALAGDTRPRFLEYSTSECHFFNGTERVRYLDRYFY
:************ **:.***:.:*** . ************:*:*:::
C1 NQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHN
C2 NQEEVVRFDSDVGEYRAVTELGRPDAEYWNSQKDYVEQKRGQVDNYCRHN
C3 NQEEYVRFDSDVGEYRAVTELGRPSAEYWNSQKELLEQKRGQVDNYCRHN
C4 NQEEFVRFDSDVGEYRAVSELGRPVAESWNSQKDLLEQKRGQVDNYCRYN
C5 NQEEYVRYDSDVGEYRAVTELGRPDAKYWNSQKDILEQRRARVDNYCRHN
C6 NQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDYVEQKRGQVDNYCRHN
C7 NQEEYLRFDSDVGEYRAVSELGRPTAESWNSQKDYLEQKRGQVDNYCRHN
C8 NQEETLRFDSDVGEYRAVTELGRPDAEYWNSQKDILEDQRASVDNYCRYN
**** :*:**********:***** *: *****: :*::*. ******:*
C1 YGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWF
C2 YGVFESFTVQRRVQPKMTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWF
C3 YRVGESFTVQRRVQPKVTVYPAKTQPLQHHSLLVCSVSGFYPGSIEVRWF
C4 YGVVESFTVQRRVQPKVTVYPSKTQPLQHHTLLVCSVSGFYPGSIEVRWF
C5 YGVGESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWF
C6 YRVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWF
C7 YGVGESFTVQRRVQPKVTVYPAKTQPLQHHTLLVCSVNGFYPGSIEVRWF
C8 YGVGESFTVQRRVQPKVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWF
* * *********:*::****:********.******.************
C1 RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTS
C2 RNNQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVYTCQVEHPSVTT
C3 RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVYTCQVEHPSVMS
C4 RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTS
C5 RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVYTCQVEHPSVTS
C6 RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTS
C7 RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVYTCQVEHPSVTS
C8 RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVYTCQVEHPSVTS
**.******************************:************** :
C1 ALTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYNQKGH
C2 PITVQWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYNQKGG
C3 PLTVQWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYNQKGR
C4 PLTVQWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYNQKGH
C5 PLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYNQKGH
C6 PLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYNQKGH
C7 PLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYNQKGL
C8 PLTVEWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYNQKGH
.:**:***:*********************************
>C1
LAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGTERVRYLDRYFH
NQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHN
YGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWF
RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTS
ALTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYNQKGH
>C2
VAALTVTLMVLSSPLALVGDTRPRFLELVKHECHFFNGTERVRYLDRYIH
NQEEVVRFDSDVGEYRAVTELGRPDAEYWNSQKDYVEQKRGQVDNYCRHN
YGVFESFTVQRRVQPKMTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWF
RNNQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVYTCQVEHPSVTT
PITVQWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYNQKGG
>C3
MAALTVTLMVLSSPLALAGDTRPRFLEQAKSECHFFNGTERVRYLQRYFY
NQEEYVRFDSDVGEYRAVTELGRPSAEYWNSQKELLEQKRGQVDNYCRHN
YRVGESFTVQRRVQPKVTVYPAKTQPLQHHSLLVCSVSGFYPGSIEVRWF
RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVYTCQVEHPSVMS
PLTVQWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYNQKGR
>C4
MAALTVTLMVLSSPLALAGDTRPRFLEQVKSECHFFNGTERVRFLERHFY
NQEEFVRFDSDVGEYRAVSELGRPVAESWNSQKDLLEQKRGQVDNYCRYN
YGVVESFTVQRRVQPKVTVYPSKTQPLQHHTLLVCSVSGFYPGSIEVRWF
RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTS
PLTVQWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYNQKGH
>C5
MAALTVTLMVLSSPLALAGDTQPRFLEQFKSECHFFNGTERVRYLQRYFY
NQEEYVRYDSDVGEYRAVTELGRPDAKYWNSQKDILEQRRARVDNYCRHN
YGVGESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWF
RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVYTCQVEHPSVTS
PLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYNQKGH
>C6
MAALTVTLMVLSSPLALAGDTRSRFLELVKSECHFFNGTERVRFLERYFY
NQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDYVEQKRGQVDNYCRHN
YRVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWF
RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTS
PLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYNQKGH
>C7
MAALTVTLMVLSSPLALAGDTRPHFLEQGKSECHFFNGTERVRFLERHFY
NQEEYLRFDSDVGEYRAVSELGRPTAESWNSQKDYLEQKRGQVDNYCRHN
YGVGESFTVQRRVQPKVTVYPAKTQPLQHHTLLVCSVNGFYPGSIEVRWF
RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVYTCQVEHPSVTS
PLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYNQKGL
>C8
MAALTVTLMVLSSPLALAGDTRPRFLEYSTSECHFFNGTERVRYLDRYFY
NQEETLRFDSDVGEYRAVTELGRPDAEYWNSQKDILEDQRASVDNYCRYN
YGVGESFTVQRRVQPKVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWF
RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVYTCQVEHPSVTS
PLTVEWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYNQKGH
input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln I:255 S:98 BS:243
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# PW_SEQ_DISTANCES
BOT 0 1 89.10 C1 C2 89.10
TOP 1 0 89.10 C2 C1 89.10
BOT 0 2 89.85 C1 C3 89.85
TOP 2 0 89.85 C3 C1 89.85
BOT 0 3 91.73 C1 C4 91.73
TOP 3 0 91.73 C4 C1 91.73
BOT 0 4 90.23 C1 C5 90.23
TOP 4 0 90.23 C5 C1 90.23
BOT 0 5 92.86 C1 C6 92.86
TOP 5 0 92.86 C6 C1 92.86
BOT 0 6 87.45 C1 C7 87.45
TOP 6 0 87.45 C7 C1 87.45
BOT 0 7 90.60 C1 C8 90.60
TOP 7 0 90.60 C8 C1 90.60
BOT 1 2 90.98 C2 C3 90.98
TOP 2 1 90.98 C3 C2 90.98
BOT 1 3 89.47 C2 C4 89.47
TOP 3 1 89.47 C4 C2 89.47
BOT 1 4 89.10 C2 C5 89.10
TOP 4 1 89.10 C5 C2 89.10
BOT 1 5 90.60 C2 C6 90.60
TOP 5 1 90.60 C6 C2 90.60
BOT 1 6 85.49 C2 C7 85.49
TOP 6 1 85.49 C7 C2 85.49
BOT 1 7 89.47 C2 C8 89.47
TOP 7 1 89.47 C8 C2 89.47
BOT 2 3 92.48 C3 C4 92.48
TOP 3 2 92.48 C4 C3 92.48
BOT 2 4 91.73 C3 C5 91.73
TOP 4 2 91.73 C5 C3 91.73
BOT 2 5 92.11 C3 C6 92.11
TOP 5 2 92.11 C6 C3 92.11
BOT 2 6 89.02 C3 C7 89.02
TOP 6 2 89.02 C7 C3 89.02
BOT 2 7 91.35 C3 C8 91.35
TOP 7 2 91.35 C8 C3 91.35
BOT 3 4 91.35 C4 C5 91.35
TOP 4 3 91.35 C5 C4 91.35
BOT 3 5 92.86 C4 C6 92.86
TOP 5 3 92.86 C6 C4 92.86
BOT 3 6 90.98 C4 C7 90.98
TOP 6 3 90.98 C7 C4 90.98
BOT 3 7 90.98 C4 C8 90.98
TOP 7 3 90.98 C8 C4 90.98
BOT 4 5 92.11 C5 C6 92.11
TOP 5 4 92.11 C6 C5 92.11
BOT 4 6 88.63 C5 C7 88.63
TOP 6 4 88.63 C7 C5 88.63
BOT 4 7 93.23 C5 C8 93.23
TOP 7 4 93.23 C8 C5 93.23
BOT 5 6 89.80 C6 C7 89.80
TOP 6 5 89.80 C7 C6 89.80
BOT 5 7 91.73 C6 C8 91.73
TOP 7 5 91.73 C8 C6 91.73
BOT 6 7 88.24 C7 C8 88.24
TOP 7 6 88.24 C8 C7 88.24
AVG 0 C1 * 90.26
AVG 1 C2 * 89.17
AVG 2 C3 * 91.07
AVG 3 C4 * 91.41
AVG 4 C5 * 90.91
AVG 5 C6 * 91.72
AVG 6 C7 * 88.52
AVG 7 C8 * 90.80
TOT TOT * 90.48
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGTGTGTCTGAAGCTCCCTGGAGGCTCCAGCTTGGCAGCGTTGACAGT
C2 ATGGTGTGTCTGAGGCTCCCTGGAGGCTCCTACGTGGCAGCGCTGACAGT
C3 ATGGTGTGTCTGAGGCTCCCTGGAGGCTTCTGCATGGCAGCGCTGACAGT
C4 ATGGTGTGTCTGAAGCTCCCTGGAGGCTCCTGCATGGCAGCTCTGACAGT
C5 ATGGTGTGTCTGAAGCTCCCTGGAGGCTCCTATATGGCAGCTCTGACAGT
C6 ATGGTGTGTTTGAAGCTCCCTGGAGGCTCCTGCATGGCAGCGCTGACAGT
C7 ---------------------------------ATGGCAGCTCTGACAGT
C8 ATGGTGTGTCTGAAGCTCCCTGGAGGCTCCTGCATGGCAGCTCTGACAGT
******* *******
C1 GACACTGATGGTGCTGAGCTCCCGACTGGCTTTCGCTGGGGACACCCGAC
C2 GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGTTGGGGACACCCGAC
C3 GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC
C4 GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC
C5 GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACTCAAC
C6 GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAT
C7 GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC
C8 GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC
*********************** ********* * ********* *.*
C1 CACGTTTCTTGGAGCTGCGTAAGTCTGAGTGTCATTTCTTCAATGGGACG
C2 CACGTTTCTTGGAGCTGGTTAAGCATGAGTGTCATTTCTTCAACGGGACG
C3 CACGTTTCTTGGAGCAGGCTAAGTCTGAGTGTCATTTCTTCAACGGGACG
C4 CACGTTTCTTGGAGCAGGTTAAGTCTGAGTGTCATTTCTTCAACGGGACG
C5 CACGTTTCTTGGAGCAGTTTAAGTCTGAGTGTCACTTCTTCAACGGGACG
C6 CACGTTTCTTGGAGCTGGTTAAGTCTGAGTGTCATTTCTTCAATGGGACG
C7 CACATTTCTTGGAGCAGGGTAAGTCTGAGTGTCATTTCTTCAATGGGACG
C8 CACGTTTCTTGGAGTATTCTACATCTGAGTGTCACTTCTTCAACGGGACG
***.********** : **.. .********* ******** ******
C1 GAGCGGGTGCGGTACCTGGACAGATACTTCCATAACCAGGAGGAGTTCCT
C2 GAGCGGGTGCGGTACCTGGACAGATACATCCATAACCAGGAGGAGGTCGT
C3 GAGCGGGTGCGGTACCTGCAGAGATACTTCTATAACCAGGAGGAGTATGT
C4 GAGCGGGTGCGGTTCCTGGAGAGACACTTCTATAACCAGGAGGAGTTCGT
C5 GAGCGGGTGCGGTACCTGCAGAGATACTTCTATAACCAGGAGGAGTACGT
C6 GAGCGGGTGCGGTTCCTGGAGAGATACTTCTATAACCAGGAGGAGTACGT
C7 GAGCGGGTGCGGTTCCTGGAGAGACACTTCTATAACCAGGAGGAGTACCT
C8 GAGCGGGTGCGGTACCTGGATAGATACTTCTACAACCAGGAGGAGACCCT
*************:**** * *** **:** * ************ *
C1 GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
C2 GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
C3 GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
C4 GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGTCGGAGCTGGGGC
C5 GCGCTACGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
C6 GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
C7 GCGCTTCGACAGCGACGTAGGGGAGTACCGGGCGGTGTCGGAGCTGGGGC
C8 GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
*****:************.******************:************
C1 GGCCTGTCGCCGAGTCCTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAG
C2 GGCCTGACGCCGAGTACTGGAACAGCCAGAAGGACTACGTGGAGCAGAAG
C3 GGCCTAGCGCAGAGTACTGGAACAGCCAGAAGGAACTCCTGGAGCAGAAG
C4 GGCCTGTCGCCGAGTCCTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAG
C5 GGCCTGACGCCAAGTACTGGAACAGCCAGAAGGACATCCTGGAGCAGAGG
C6 GGCCTGATGCCGAGTACTGGAACAGCCAGAAGGACTACGTGGAGCAGAAG
C7 GGCCTACCGCCGAGTCCTGGAACAGCCAGAAGGACTACCTGGAGCAGAAG
C8 GGCCTGACGCCGAGTACTGGAACAGCCAGAAGGACATCCTGGAAGACCAG
*****. **..***.******************. :* ****. * ..*
C1 CGGGGCCGGGTGGACAATTACTGCAGACACAACTACGGGGTTGGTGAGAG
C2 CGGGGCCAGGTGGACAACTACTGCAGACACAACTACGGGGTTTTTGAGAG
C3 CGGGGCCAGGTGGACAACTACTGCAGACACAACTACCGGGTTGGCGAGAG
C4 CGGGGCCAGGTGGACAACTACTGCAGATACAACTACGGGGTTGTGGAGAG
C5 CGGGCCCGGGTGGACAACTACTGCAGACACAACTACGGGGTTGGTGAGAG
C6 CGGGGCCAGGTGGACAATTACTGCAGACACAACTACAGGGTTGGTGAGAG
C7 CGGGGCCAGGTGGACAACTACTGCAGACACAACTACGGGGTTGGTGAGAG
C8 CGGGCCTCGGTGGACAATTACTGCAGATACAACTACGGGGTTGGTGAGAG
**** * ********* ********* ******** ***** *****
C1 CTTCACAGTGCAGCGGCGAGTCCATCCTCAGGTGACTGTGTATCCTGCAA
C2 CTTCACAGTGCAGCGGAGAGTCCAACCTAAGATGACTGTGTATCCTGCAA
C3 CTTCACAGTGCAGCGGAGAGTCCAACCTAAGGTGACTGTGTATCCTGCAA
C4 CTTCACAGTGCAGCGGCGAGTCCAACCTAAGGTGACTGTGTATCCTTCAA
C5 CTTCACAGTGCAGCGGCGAGTCCAACCTAAGGTGACTGTGTATCCTTCAA
C6 CTTCACAGTGCAGCGGCGAGTCCATCCTCAGGTGACTGTGTATCCTGCAA
C7 CTTCACAGTGCAGCGGCGAGTCCAACCTAAGGTGACTGTGTATCCTGCAA
C8 CTTCACAGTGCAGCGGCGAGTCCAACCTAAGGTGACTGTGTATCCTGCAA
****************.*******:***.**.************** ***
C1 AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAGTGGT
C2 AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAGTGGT
C3 AGACCCAGCCCCTGCAGCACCACAGCCTCCTGGTCTGCTCTGTGAGTGGG
C4 AGACCCAGCCTCTGCAGCACCACACCCTCCTGGTCTGCTCTGTGAGTGGT
C5 AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAATGGT
C6 AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAATGGT
C7 AGACCCAGCCCCTGCAGCACCACACCCTCCTGGTCTGCTCTGTGAACGGT
C8 AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAATGGT
********** ************* ********************. **
C1 TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
C2 TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACAACCAGGAAGA
C3 TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
C4 TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
C5 TTCTACCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
C6 TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAATGGCCAGGAAGA
C7 TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAATGGCCAGGAAGA
C8 TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
***** ******************************** ..*********
C1 GAAGGCTGGGGTGGTGTCCACGGGCCTGATCCAGAATGGAGACTGGACCT
C2 GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCT
C3 GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCT
C4 GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCT
C5 GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCT
C6 GAAGGCTGGGGTGGTGTCCACGGGCCTGATCCAGAATGGAGACTGGACCT
C7 GAAGGCTGGGGTGGTCTCCACAGGCCTGATCCAGAATGGAGACTGGACCT
C8 GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCT
*************** *****.****************************
C1 TCCAGACCCTGGTGATGCTAGAAACAGTTCCTCGGAGTGGAGAGGTTTAC
C2 TCCAGACCCTGGTGATGCTGGAAACCGTTCCTCAGAGTGGAGAGGTTTAC
C3 TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCAGAGTGGAGAGGTTTAC
C4 TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCGGAGTGGAGAGGTTTAC
C5 TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCAGAGTGGAGAGGTTTAC
C6 TCCAGACCCTGGTGATGCTAGAAACAGTTCCTCGGAGTGGAGAGGTTTAC
C7 TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCAGAGTGGAGAGGTTTAC
C8 TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCAGAGTGGAGAGGTTTAC
*******************.*****.*******.****************
C1 ACTTGCCAAGTGGAGCACCCAAGCGTAACGAGCGCTCTCACAGTGGAATG
C2 ACCTGCCAAGTGGAGCACCCAAGTGTGACGACCCCTATCACAGTGCAATG
C3 ACCTGCCAAGTGGAGCACCCAAGCGTGATGAGCCCTCTCACAGTGCAATG
C4 ACCTGCCAAGTGGAGCACCCAAGCGTGACGAGCCCTCTCACAGTGCAATG
C5 ACCTGCCAAGTGGAGCACCCAAGCGTGACGAGCCCTCTCACAGTGGAATG
C6 ACCTGCCAAGTGGAGCACCCAAGCGTAACGAGCCCTCTCACAGTGGAATG
C7 ACCTGCCAAGTGGAGCACCCAAGCGTGACCAGCCCTCTCACAGTGGAATG
C8 ACCTGCCAAGTGGAGCACCCAAGCGTGACCAGCCCTCTCACAGTGGAATG
** ******************** **.* * * **.******** ****
C1 GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
C2 GAGAGCACAGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
C3 GAGAGCACAGTCTGAATCTGCACAGAGTAAGATGCTGAGTGGAGTCGGGG
C4 GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
C5 GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
C6 GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
C7 GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
C8 GAGAGCACAGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
********.****************** **********************
C1 GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTGTTCATCTACTTC
C2 GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCAGGGCTGTTCATCTACTTC
C3 GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCAGGGCTGTTCATCTACTTC
C4 GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTGTTCATCTACTTC
C5 GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCTGGGCTGTTCATCTACTTC
C6 GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTGTTCATCTACTTC
C7 GTTTTGTGCTGGGCCTGCTCTTCCTTGGGGCTGGGCTGTTCATCTACTTC
C8 GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTGTTCATCTACTTC
* ***************************** ******************
C1 AGGAATCAGAAAGGACACTCTGGACTTCAGCCAACAGGATTCCTGAGC--
C2 AGGAATCAGAAAGGAGGCTCTGGACTTCAGCCAACAGGACTCCTGAGC--
C3 AGGAATCAGAAAGGACGCTCTGGACTTCAGCCAACAGGACTCCTGAGC--
C4 AGGAATCAGAAAGGACACTCTGGACTTCAGCCAACAGGACTCCTGAGC--
C5 AGGAATCAGAAAGGACACTCTGGACTTCACCCAACAGGACTCCTGAGC--
C6 AGGAATCAGAAAGGACACTCTGGACTTCAGCCAACAGGATTCCTGAGC--
C7 AGGAATCAGAAAGGACTCCTGAGC--------------------------
C8 AGGAATCAGAAAGGACACACTGGACTTCAGCCAACAGGACTCCTGAGC--
*************** * .*.
C1 -------------------------------
C2 -------------------------------
C3 -------------------------------
C4 -------------------------------
C5 -------------------------------
C6 -------------------------------
C7 -------------------------------
C8 -------------------------------
>C1
ATGGTGTGTCTGAAGCTCCCTGGAGGCTCCAGCTTGGCAGCGTTGACAGT
GACACTGATGGTGCTGAGCTCCCGACTGGCTTTCGCTGGGGACACCCGAC
CACGTTTCTTGGAGCTGCGTAAGTCTGAGTGTCATTTCTTCAATGGGACG
GAGCGGGTGCGGTACCTGGACAGATACTTCCATAACCAGGAGGAGTTCCT
GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
GGCCTGTCGCCGAGTCCTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAG
CGGGGCCGGGTGGACAATTACTGCAGACACAACTACGGGGTTGGTGAGAG
CTTCACAGTGCAGCGGCGAGTCCATCCTCAGGTGACTGTGTATCCTGCAA
AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAGTGGT
TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
GAAGGCTGGGGTGGTGTCCACGGGCCTGATCCAGAATGGAGACTGGACCT
TCCAGACCCTGGTGATGCTAGAAACAGTTCCTCGGAGTGGAGAGGTTTAC
ACTTGCCAAGTGGAGCACCCAAGCGTAACGAGCGCTCTCACAGTGGAATG
GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTGTTCATCTACTTC
AGGAATCAGAAAGGACACTCTGGACTTCAGCCAACAGGATTCCTGAGC--
-------------------------------
>C2
ATGGTGTGTCTGAGGCTCCCTGGAGGCTCCTACGTGGCAGCGCTGACAGT
GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGTTGGGGACACCCGAC
CACGTTTCTTGGAGCTGGTTAAGCATGAGTGTCATTTCTTCAACGGGACG
GAGCGGGTGCGGTACCTGGACAGATACATCCATAACCAGGAGGAGGTCGT
GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
GGCCTGACGCCGAGTACTGGAACAGCCAGAAGGACTACGTGGAGCAGAAG
CGGGGCCAGGTGGACAACTACTGCAGACACAACTACGGGGTTTTTGAGAG
CTTCACAGTGCAGCGGAGAGTCCAACCTAAGATGACTGTGTATCCTGCAA
AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAGTGGT
TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACAACCAGGAAGA
GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCT
TCCAGACCCTGGTGATGCTGGAAACCGTTCCTCAGAGTGGAGAGGTTTAC
ACCTGCCAAGTGGAGCACCCAAGTGTGACGACCCCTATCACAGTGCAATG
GAGAGCACAGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCAGGGCTGTTCATCTACTTC
AGGAATCAGAAAGGAGGCTCTGGACTTCAGCCAACAGGACTCCTGAGC--
-------------------------------
>C3
ATGGTGTGTCTGAGGCTCCCTGGAGGCTTCTGCATGGCAGCGCTGACAGT
GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC
CACGTTTCTTGGAGCAGGCTAAGTCTGAGTGTCATTTCTTCAACGGGACG
GAGCGGGTGCGGTACCTGCAGAGATACTTCTATAACCAGGAGGAGTATGT
GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
GGCCTAGCGCAGAGTACTGGAACAGCCAGAAGGAACTCCTGGAGCAGAAG
CGGGGCCAGGTGGACAACTACTGCAGACACAACTACCGGGTTGGCGAGAG
CTTCACAGTGCAGCGGAGAGTCCAACCTAAGGTGACTGTGTATCCTGCAA
AGACCCAGCCCCTGCAGCACCACAGCCTCCTGGTCTGCTCTGTGAGTGGG
TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCT
TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCAGAGTGGAGAGGTTTAC
ACCTGCCAAGTGGAGCACCCAAGCGTGATGAGCCCTCTCACAGTGCAATG
GAGAGCACAGTCTGAATCTGCACAGAGTAAGATGCTGAGTGGAGTCGGGG
GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCAGGGCTGTTCATCTACTTC
AGGAATCAGAAAGGACGCTCTGGACTTCAGCCAACAGGACTCCTGAGC--
-------------------------------
>C4
ATGGTGTGTCTGAAGCTCCCTGGAGGCTCCTGCATGGCAGCTCTGACAGT
GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC
CACGTTTCTTGGAGCAGGTTAAGTCTGAGTGTCATTTCTTCAACGGGACG
GAGCGGGTGCGGTTCCTGGAGAGACACTTCTATAACCAGGAGGAGTTCGT
GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGTCGGAGCTGGGGC
GGCCTGTCGCCGAGTCCTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAG
CGGGGCCAGGTGGACAACTACTGCAGATACAACTACGGGGTTGTGGAGAG
CTTCACAGTGCAGCGGCGAGTCCAACCTAAGGTGACTGTGTATCCTTCAA
AGACCCAGCCTCTGCAGCACCACACCCTCCTGGTCTGCTCTGTGAGTGGT
TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCT
TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCGGAGTGGAGAGGTTTAC
ACCTGCCAAGTGGAGCACCCAAGCGTGACGAGCCCTCTCACAGTGCAATG
GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTGTTCATCTACTTC
AGGAATCAGAAAGGACACTCTGGACTTCAGCCAACAGGACTCCTGAGC--
-------------------------------
>C5
ATGGTGTGTCTGAAGCTCCCTGGAGGCTCCTATATGGCAGCTCTGACAGT
GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACTCAAC
CACGTTTCTTGGAGCAGTTTAAGTCTGAGTGTCACTTCTTCAACGGGACG
GAGCGGGTGCGGTACCTGCAGAGATACTTCTATAACCAGGAGGAGTACGT
GCGCTACGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
GGCCTGACGCCAAGTACTGGAACAGCCAGAAGGACATCCTGGAGCAGAGG
CGGGCCCGGGTGGACAACTACTGCAGACACAACTACGGGGTTGGTGAGAG
CTTCACAGTGCAGCGGCGAGTCCAACCTAAGGTGACTGTGTATCCTTCAA
AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAATGGT
TTCTACCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCT
TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCAGAGTGGAGAGGTTTAC
ACCTGCCAAGTGGAGCACCCAAGCGTGACGAGCCCTCTCACAGTGGAATG
GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCTGGGCTGTTCATCTACTTC
AGGAATCAGAAAGGACACTCTGGACTTCACCCAACAGGACTCCTGAGC--
-------------------------------
>C6
ATGGTGTGTTTGAAGCTCCCTGGAGGCTCCTGCATGGCAGCGCTGACAGT
GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAT
CACGTTTCTTGGAGCTGGTTAAGTCTGAGTGTCATTTCTTCAATGGGACG
GAGCGGGTGCGGTTCCTGGAGAGATACTTCTATAACCAGGAGGAGTACGT
GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
GGCCTGATGCCGAGTACTGGAACAGCCAGAAGGACTACGTGGAGCAGAAG
CGGGGCCAGGTGGACAATTACTGCAGACACAACTACAGGGTTGGTGAGAG
CTTCACAGTGCAGCGGCGAGTCCATCCTCAGGTGACTGTGTATCCTGCAA
AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAATGGT
TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAATGGCCAGGAAGA
GAAGGCTGGGGTGGTGTCCACGGGCCTGATCCAGAATGGAGACTGGACCT
TCCAGACCCTGGTGATGCTAGAAACAGTTCCTCGGAGTGGAGAGGTTTAC
ACCTGCCAAGTGGAGCACCCAAGCGTAACGAGCCCTCTCACAGTGGAATG
GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTGTTCATCTACTTC
AGGAATCAGAAAGGACACTCTGGACTTCAGCCAACAGGATTCCTGAGC--
-------------------------------
>C7
---------------------------------ATGGCAGCTCTGACAGT
GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC
CACATTTCTTGGAGCAGGGTAAGTCTGAGTGTCATTTCTTCAATGGGACG
GAGCGGGTGCGGTTCCTGGAGAGACACTTCTATAACCAGGAGGAGTACCT
GCGCTTCGACAGCGACGTAGGGGAGTACCGGGCGGTGTCGGAGCTGGGGC
GGCCTACCGCCGAGTCCTGGAACAGCCAGAAGGACTACCTGGAGCAGAAG
CGGGGCCAGGTGGACAACTACTGCAGACACAACTACGGGGTTGGTGAGAG
CTTCACAGTGCAGCGGCGAGTCCAACCTAAGGTGACTGTGTATCCTGCAA
AGACCCAGCCCCTGCAGCACCACACCCTCCTGGTCTGCTCTGTGAACGGT
TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAATGGCCAGGAAGA
GAAGGCTGGGGTGGTCTCCACAGGCCTGATCCAGAATGGAGACTGGACCT
TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCAGAGTGGAGAGGTTTAC
ACCTGCCAAGTGGAGCACCCAAGCGTGACCAGCCCTCTCACAGTGGAATG
GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
GTTTTGTGCTGGGCCTGCTCTTCCTTGGGGCTGGGCTGTTCATCTACTTC
AGGAATCAGAAAGGACTCCTGAGC--------------------------
-------------------------------
>C8
ATGGTGTGTCTGAAGCTCCCTGGAGGCTCCTGCATGGCAGCTCTGACAGT
GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC
CACGTTTCTTGGAGTATTCTACATCTGAGTGTCACTTCTTCAACGGGACG
GAGCGGGTGCGGTACCTGGATAGATACTTCTACAACCAGGAGGAGACCCT
GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
GGCCTGACGCCGAGTACTGGAACAGCCAGAAGGACATCCTGGAAGACCAG
CGGGCCTCGGTGGACAATTACTGCAGATACAACTACGGGGTTGGTGAGAG
CTTCACAGTGCAGCGGCGAGTCCAACCTAAGGTGACTGTGTATCCTGCAA
AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAATGGT
TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCT
TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCAGAGTGGAGAGGTTTAC
ACCTGCCAAGTGGAGCACCCAAGCGTGACCAGCCCTCTCACAGTGGAATG
GAGAGCACAGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTGTTCATCTACTTC
AGGAATCAGAAAGGACACACTGGACTTCAGCCAACAGGACTCCTGAGC--
-------------------------------
>C1
MVCLKLPGGSSLAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGT
ERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQK
RGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY
TCQVEHPSVTSALTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGHSGLQPTGFLS
>C2
MVCLRLPGGSYVAALTVTLMVLSSPLALVGDTRPRFLELVKHECHFFNGT
ERVRYLDRYIHNQEEVVRFDSDVGEYRAVTELGRPDAEYWNSQKDYVEQK
RGQVDNYCRHNYGVFESFTVQRRVQPKMTVYPAKTQPLQHHNLLVCSVSG
FYPGSIEVRWFRNNQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
TCQVEHPSVTTPITVQWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGGSGLQPTGLLS
>C3
MVCLRLPGGFCMAALTVTLMVLSSPLALAGDTRPRFLEQAKSECHFFNGT
ERVRYLQRYFYNQEEYVRFDSDVGEYRAVTELGRPSAEYWNSQKELLEQK
RGQVDNYCRHNYRVGESFTVQRRVQPKVTVYPAKTQPLQHHSLLVCSVSG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
TCQVEHPSVMSPLTVQWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGRSGLQPTGLLS
>C4
MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTRPRFLEQVKSECHFFNGT
ERVRFLERHFYNQEEFVRFDSDVGEYRAVSELGRPVAESWNSQKDLLEQK
RGQVDNYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHTLLVCSVSG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY
TCQVEHPSVTSPLTVQWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGHSGLQPTGLLS
>C5
MVCLKLPGGSYMAALTVTLMVLSSPLALAGDTQPRFLEQFKSECHFFNGT
ERVRYLQRYFYNQEEYVRYDSDVGEYRAVTELGRPDAKYWNSQKDILEQR
RARVDNYCRHNYGVGESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGHSGLHPTGLLS
>C6
MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTRSRFLELVKSECHFFNGT
ERVRFLERYFYNQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDYVEQK
RGQVDNYCRHNYRVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVNG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY
TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGHSGLQPTGFLS
>C7
oooooooooooMAALTVTLMVLSSPLALAGDTRPHFLEQGKSECHFFNGT
ERVRFLERHFYNQEEYLRFDSDVGEYRAVSELGRPTAESWNSQKDYLEQK
RGQVDNYCRHNYGVGESFTVQRRVQPKVTVYPAKTQPLQHHTLLVCSVNG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGLLSoooooooo
>C8
MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTRPRFLEYSTSECHFFNGT
ERVRYLDRYFYNQEETLRFDSDVGEYRAVTELGRPDAEYWNSQKDILEDQ
RASVDNYCRYNYGVGESFTVQRRVQPKVTVYPAKTQPLQHHNLLVCSVNG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
TCQVEHPSVTSPLTVEWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGHTGLQPTGLLS
MrBayes v3.1.2
(Bayesian Analysis of Phylogeny)
by
John P. Huelsenbeck and Fredrik Ronquist
Section of Ecology, Behavior and Evolution
Division of Biological Sciences
University of California, San Diego
johnh@biomail.ucsd.edu
School of Computational Science
Florida State University
ronquist@csit.fsu.edu
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Executing file "/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 62
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated matrix
Matrix has 8 taxa and 831 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Setting default partition (does not divide up characters).
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Setting output file names to "/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p/t>"
Successfully read matrix
Exiting data block
Reading MrBayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Resetting model values to defaults (NB! Any existing model settings will be deleted!)
Reinitializing link table (linking all parameters)
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 3608949311
Seed = 1523489907
Swapseed = 1523489907
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is uniformly dist-
ributed on the interval (0.00,200.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is uniformly dist-
ributed on the interval (0.00,200.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is uniformly dist-
ributed on the interval (0.00,200.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Topology 6 6 6
Brlens 7 7 7
------------------------
All parameters can be linked or unlinked across partitions
1 -- Parameter = Revmat
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = 1, 2, and 3
2 -- Parameter = Statefreq
Prior = Dirichlet
Partitions = 1, 2, and 3
3 -- Parameter = Shape
Prior = Uniform(0.00,200.00)
Partitions = 1 and 2
4 -- Parameter = Shape
Prior = Uniform(0.00,200.00)
Partition = 3
5 -- Parameter = Pinvar
Prior = Uniform(0.00,1.00)
Partitions = 1, 2, and 3
6 -- Parameter = Topology
Prior = All topologies equally probable a priori
Partitions = 1, 2, and 3
7 -- Parameter = Brlens
Prior = Branch lengths are Unconstrained:Exponential(10.0)
Partitions = 1, 2, and 3
Number of taxa = 8
Number of characters = 831
Compressing data matrix for division 1
Division 1 has 44 unique site patterns
Compressing data matrix for division 2
Division 2 has 39 unique site patterns
Compressing data matrix for division 3
Division 3 has 44 unique site patterns
The MCMC sampler will use the following moves:
With prob. Chain will change
4.00 % param. 1 (revmat) with Dirichlet proposal
4.00 % param. 2 (state frequencies) with Dirichlet proposal
4.00 % param. 3 (gamma shape) with multiplier
4.00 % param. 4 (gamma shape) with multiplier
4.00 % param. 5 (prop. invar. sites) with sliding window
60.00 % param. 6 (topology and branch lengths) with extending TBR
20.00 % param. 6 (topology and branch lengths) with LOCAL
Creating parsimony (bitset) matrix for division 1
Creating parsimony (bitset) matrix for division 2
Creating parsimony (bitset) matrix for division 3
Initializing conditional likelihoods for terminals
Initializing invariable-site conditional likelihoods
Initializing conditional likelihoods for internal nodes
Initial log likelihoods for run 1:
Chain 1 -- -2291.263105
Chain 2 -- -2316.350509
Chain 3 -- -2312.963111
Chain 4 -- -2313.115222
Initial log likelihoods for run 2:
Chain 1 -- -2305.130403
Chain 2 -- -2294.754429
Chain 3 -- -2305.236391
Chain 4 -- -2310.080126
Chain results:
1 -- [-2291.263] (-2307.095) (-2311.503) (-2306.212) * (-2291.248) (-2294.754) [-2301.509] (-2310.080)
100 -- (-2097.689) [-2116.813] (-2119.763) (-2137.816) * [-2082.058] (-2103.815) (-2110.407) (-2110.351) -- 0:00:00
200 -- [-2041.079] (-2053.664) (-2064.423) (-2048.945) * (-2047.639) (-2049.891) (-2062.919) [-2040.104] -- 0:00:00
300 -- (-2032.745) (-2021.013) (-2034.452) [-2010.999] * [-2014.988] (-2024.976) (-2048.373) (-2023.338) -- 0:00:00
400 -- (-2020.975) (-2024.543) (-2008.101) [-1992.515] * (-2017.819) [-1999.812] (-2027.015) (-2005.976) -- 0:00:00
500 -- (-2006.801) (-2010.988) (-2008.333) [-1987.383] * (-2013.101) [-1995.767] (-2009.315) (-2001.573) -- 0:00:00
600 -- (-2011.729) (-2001.248) (-1999.763) [-1989.978] * (-1999.430) [-1988.529] (-2007.505) (-2005.919) -- 0:00:00
700 -- (-2003.326) [-1999.169] (-1998.156) (-1995.166) * (-2000.656) (-1984.602) (-2011.453) [-1990.285] -- 0:00:00
800 -- (-2000.657) (-1998.907) [-2001.833] (-1991.611) * (-2002.962) (-1985.574) (-2001.625) [-1992.991] -- 0:00:00
900 -- [-2005.718] (-1999.347) (-1994.430) (-1993.780) * (-1997.805) [-1983.260] (-2002.735) (-1984.726) -- 0:00:00
1000 -- (-2004.658) (-2006.740) (-1987.497) [-1993.965] * [-1999.587] (-1979.865) (-2004.439) (-1989.764) -- 0:00:00
Average standard deviation of split frequencies: 0.088388
1100 -- (-1997.408) (-2002.218) (-1983.478) [-1992.111] * (-1994.979) [-1978.904] (-2002.536) (-1999.845) -- 0:00:00
1200 -- (-2002.851) (-2004.060) [-1981.174] (-1989.000) * (-1995.520) [-1979.168] (-1990.081) (-1986.768) -- 0:00:00
1300 -- (-1989.255) (-2003.633) [-1977.390] (-1986.846) * (-1999.346) (-1979.110) [-1991.343] (-1988.468) -- 0:00:00
1400 -- (-1992.268) (-2000.894) (-1977.746) [-1986.106] * (-2001.922) (-1988.700) (-1983.696) [-1987.650] -- 0:00:00
1500 -- (-1988.715) (-1992.637) [-1977.370] (-1984.410) * (-1995.155) (-1986.885) [-1985.338] (-1982.766) -- 0:00:00
1600 -- (-1995.665) (-1995.882) (-1978.240) [-1979.738] * (-1991.085) (-1987.611) (-1986.015) [-1982.289] -- 0:00:00
1700 -- (-2007.966) (-1998.681) (-1986.557) [-1982.050] * (-1990.720) [-1985.778] (-1984.824) (-1981.951) -- 0:00:00
1800 -- (-1997.413) (-1998.232) (-1981.985) [-1977.568] * (-1983.377) (-1989.995) [-1990.075] (-1984.168) -- 0:09:14
1900 -- (-2007.594) (-1995.739) (-1984.790) [-1981.015] * [-1984.130] (-1987.220) (-1986.529) (-1993.067) -- 0:08:45
2000 -- (-1994.959) [-1984.576] (-1988.328) (-1984.426) * (-1987.393) (-1988.942) [-1985.336] (-1987.349) -- 0:08:19
Average standard deviation of split frequencies: 0.039284
2100 -- (-1991.896) [-1985.112] (-1980.100) (-1986.242) * [-1984.399] (-1992.024) (-1979.771) (-1991.104) -- 0:07:55
2200 -- (-1990.821) [-1987.291] (-1986.645) (-1980.286) * (-1984.033) (-1993.354) [-1979.410] (-1993.460) -- 0:07:33
2300 -- (-1993.402) (-1987.634) [-1978.865] (-1987.583) * [-1982.680] (-1991.352) (-1983.125) (-1982.858) -- 0:07:13
2400 -- (-1997.588) (-1986.707) (-1979.526) [-1987.381] * (-1985.621) (-1988.804) [-1981.911] (-1981.057) -- 0:06:55
2500 -- (-1988.353) (-1988.232) [-1982.177] (-1985.381) * (-1981.598) (-1991.694) (-1993.775) [-1983.410] -- 0:06:39
2600 -- (-1991.598) (-2000.615) (-1978.279) [-1982.530] * (-1983.168) (-1986.509) (-1995.992) [-1983.216] -- 0:06:23
2700 -- (-1993.023) (-1997.303) (-1984.355) [-1981.670] * [-1985.026] (-1987.847) (-1990.036) (-1983.273) -- 0:06:09
2800 -- (-1992.422) (-1992.601) [-1991.251] (-1994.688) * (-1985.816) (-1987.212) (-1988.461) [-1982.010] -- 0:05:56
2900 -- (-1991.408) (-1987.167) [-1989.569] (-1995.137) * [-1988.062] (-1995.714) (-1992.900) (-1987.618) -- 0:05:43
3000 -- (-1982.931) (-1988.891) [-1987.776] (-1999.610) * (-1985.983) (-1987.699) (-1987.979) [-1983.855] -- 0:05:32
Average standard deviation of split frequencies: 0.047877
3100 -- [-1984.000] (-1988.764) (-1986.522) (-2004.669) * (-1984.061) [-1985.480] (-1994.876) (-1981.372) -- 0:05:21
3200 -- [-1984.938] (-1989.799) (-1990.072) (-1996.596) * (-1985.592) (-1977.132) (-1991.128) [-1981.905] -- 0:05:11
3300 -- (-1988.409) [-1983.326] (-1994.406) (-1999.252) * (-1979.577) (-1978.715) (-1999.533) [-1981.301] -- 0:05:02
3400 -- (-1983.614) [-1991.570] (-1995.198) (-1995.323) * (-1989.572) [-1979.613] (-1983.886) (-1984.272) -- 0:04:53
3500 -- (-1982.285) (-1991.253) [-1986.552] (-1993.460) * (-1990.096) (-1985.507) (-1986.079) [-1980.962] -- 0:04:44
3600 -- (-1984.553) (-2007.616) [-1983.209] (-1991.949) * (-1995.273) (-1983.698) (-1988.715) [-1980.138] -- 0:04:36
3700 -- [-1992.261] (-1992.392) (-1986.217) (-1989.707) * (-1990.486) [-1986.628] (-1992.331) (-1986.671) -- 0:04:29
3800 -- (-1988.605) [-1987.625] (-1986.542) (-1990.380) * (-1994.267) [-1984.074] (-1991.354) (-1985.839) -- 0:04:22
3900 -- (-1997.613) (-1985.584) [-1984.742] (-1993.301) * (-1993.316) [-1981.544] (-1986.855) (-1994.948) -- 0:04:15
4000 -- (-1992.181) (-1985.780) [-1983.556] (-1986.677) * (-1986.951) [-1981.707] (-1989.150) (-1991.059) -- 0:04:09
Average standard deviation of split frequencies: 0.045620
4100 -- (-1990.202) (-1985.826) (-1982.766) [-1986.443] * [-1994.520] (-1981.304) (-1993.163) (-1995.096) -- 0:04:02
4200 -- (-1990.011) (-1983.612) [-1980.186] (-1985.248) * (-1995.372) [-1981.107] (-1997.123) (-1995.397) -- 0:07:54
4300 -- (-2000.713) (-1989.787) [-1979.936] (-1984.736) * (-2002.290) [-1985.250] (-1988.684) (-1994.041) -- 0:07:43
4400 -- (-1987.609) (-1986.296) (-1983.550) [-1986.212] * (-2006.547) [-1983.049] (-1987.212) (-1993.856) -- 0:07:32
4500 -- (-1992.595) (-1989.608) (-1989.069) [-1985.234] * (-1993.147) [-1979.108] (-1987.250) (-1993.989) -- 0:07:22
4600 -- (-1993.954) (-1988.087) (-1988.887) [-1980.612] * [-1989.038] (-1986.834) (-1983.567) (-1992.097) -- 0:07:12
4700 -- (-1992.102) [-1982.068] (-1987.035) (-1984.512) * [-1991.703] (-1986.917) (-1990.553) (-1997.929) -- 0:07:03
4800 -- (-1995.091) [-1985.694] (-1987.282) (-1984.888) * [-1984.159] (-1983.674) (-1997.624) (-1995.603) -- 0:06:54
4900 -- (-1989.827) (-1986.565) (-1985.524) [-1981.205] * [-1987.362] (-1986.175) (-2001.695) (-1993.909) -- 0:06:46
5000 -- (-1989.853) (-1982.218) (-1990.204) [-1984.089] * (-1993.422) [-1994.016] (-1992.789) (-1992.311) -- 0:06:38
Average standard deviation of split frequencies: 0.011332
5100 -- (-1990.727) [-1979.587] (-1990.917) (-1990.389) * [-1983.174] (-1989.825) (-1997.008) (-1991.922) -- 0:06:30
5200 -- (-1993.084) [-1981.849] (-1986.010) (-1992.257) * [-1979.253] (-1999.100) (-1988.892) (-1993.659) -- 0:06:22
5300 -- (-1991.345) [-1982.980] (-1986.540) (-1991.384) * (-1986.203) (-1992.987) [-1984.658] (-1990.837) -- 0:06:15
5400 -- (-2005.549) (-1988.639) [-1986.730] (-1985.681) * [-1987.771] (-1991.807) (-1992.249) (-1987.833) -- 0:06:08
5500 -- [-1988.740] (-1981.747) (-1990.184) (-1987.919) * (-1987.350) (-1989.705) (-1985.277) [-1984.795] -- 0:06:01
5600 -- [-1982.307] (-1988.884) (-1989.181) (-1994.864) * (-1990.992) (-1985.960) [-1982.180] (-1986.190) -- 0:05:55
5700 -- [-1985.734] (-1983.628) (-1989.669) (-1987.655) * (-1992.122) (-1989.063) [-1979.685] (-1987.194) -- 0:05:48
5800 -- [-1980.985] (-1991.609) (-1995.433) (-1989.280) * (-1993.173) (-1988.342) [-1984.546] (-1989.578) -- 0:05:42
5900 -- (-1982.624) [-1991.506] (-1994.123) (-1986.818) * (-1990.967) (-1985.014) (-1989.859) [-1987.210] -- 0:05:36
6000 -- (-1983.392) (-1991.635) (-1993.957) [-1981.223] * [-1986.329] (-1982.529) (-1993.173) (-1987.295) -- 0:05:31
Average standard deviation of split frequencies: 0.017568
6100 -- (-1985.541) [-1984.623] (-1998.556) (-1983.763) * (-1984.361) [-1982.604] (-1997.152) (-1986.988) -- 0:05:25
6200 -- (-1982.773) (-1986.861) (-1995.727) [-1984.154] * (-1986.928) [-1976.201] (-1993.307) (-1994.250) -- 0:05:20
6300 -- (-1982.004) [-1986.683] (-1990.284) (-1984.866) * (-1979.659) [-1976.994] (-1994.563) (-1993.680) -- 0:05:15
6400 -- (-1980.205) (-1987.406) [-1982.238] (-1981.947) * [-1979.847] (-1981.506) (-2004.774) (-1994.842) -- 0:05:10
6500 -- [-1980.648] (-2000.655) (-1980.116) (-1984.950) * (-1993.087) [-1979.668] (-1999.702) (-1991.598) -- 0:05:05
6600 -- (-1980.896) (-1998.904) [-1978.036] (-1993.588) * (-1991.598) [-1981.022] (-1994.246) (-1999.714) -- 0:05:01
6700 -- [-1976.716] (-1998.677) (-1982.729) (-1994.566) * [-1986.541] (-1977.254) (-1991.588) (-1992.510) -- 0:07:24
6800 -- (-1979.938) (-2000.425) [-1979.721] (-1995.547) * (-1985.925) (-1982.635) [-1988.503] (-1989.855) -- 0:07:18
6900 -- [-1980.012] (-1998.227) (-1987.251) (-1997.037) * (-1985.824) [-1978.785] (-1986.038) (-1999.822) -- 0:07:11
7000 -- [-1980.193] (-1988.462) (-1989.284) (-1989.970) * (-1983.476) [-1980.340] (-1989.560) (-1992.572) -- 0:07:05
Average standard deviation of split frequencies: 0.020577
7100 -- (-1985.449) [-1987.595] (-1993.670) (-1993.183) * [-1985.503] (-1980.030) (-1985.553) (-1993.536) -- 0:06:59
7200 -- (-1985.000) (-1988.168) [-1984.804] (-2009.756) * [-1983.962] (-1986.795) (-1987.916) (-1990.728) -- 0:06:53
7300 -- (-1989.336) (-1983.645) [-1983.981] (-1996.519) * [-1983.774] (-1986.834) (-1985.376) (-1989.609) -- 0:06:47
7400 -- (-1993.049) (-1981.215) [-1984.438] (-1995.501) * (-1987.145) [-1982.789] (-1984.619) (-1994.386) -- 0:06:42
7500 -- (-1990.947) (-1980.596) (-1982.678) [-1991.124] * (-1979.700) [-1980.802] (-1987.668) (-1992.766) -- 0:06:37
7600 -- (-1995.702) [-1984.587] (-1989.259) (-1992.547) * (-1978.048) [-1984.120] (-1988.981) (-2003.014) -- 0:06:31
7700 -- (-1990.719) [-1982.697] (-1992.037) (-1988.633) * [-1977.183] (-1989.744) (-1986.918) (-1993.791) -- 0:06:26
7800 -- (-1981.114) (-1984.945) [-1979.599] (-1983.146) * [-1985.504] (-1995.768) (-1985.606) (-1993.900) -- 0:06:21
7900 -- (-1983.982) [-1979.429] (-1979.436) (-1985.636) * [-1986.172] (-1989.577) (-1982.400) (-1994.788) -- 0:06:16
8000 -- (-1980.892) [-1982.898] (-1987.108) (-1988.910) * (-1991.026) (-1997.573) [-1982.566] (-1987.116) -- 0:06:12
Average standard deviation of split frequencies: 0.024840
8100 -- [-1980.660] (-1978.362) (-1989.756) (-1989.272) * [-1995.389] (-1996.937) (-1983.086) (-1986.074) -- 0:06:07
8200 -- (-1984.594) [-1981.745] (-1987.046) (-1994.973) * (-2003.493) (-1988.066) [-1977.035] (-1986.673) -- 0:06:02
8300 -- [-1985.692] (-1986.921) (-1986.840) (-1987.445) * (-2005.414) (-1993.743) [-1979.174] (-1987.411) -- 0:05:58
8400 -- (-1981.532) [-1988.652] (-1989.807) (-1985.926) * (-2017.508) (-1994.923) [-1979.945] (-1998.937) -- 0:05:54
8500 -- (-1981.664) (-1992.675) (-1990.059) [-1985.582] * (-1994.798) (-1993.796) [-1981.489] (-2004.895) -- 0:05:49
8600 -- (-1989.057) (-1991.480) [-1987.435] (-1990.655) * (-2001.025) (-1987.570) [-1982.584] (-2015.608) -- 0:05:45
8700 -- (-2006.268) [-1993.075] (-1994.998) (-1994.783) * [-1985.128] (-1986.825) (-1978.054) (-2003.591) -- 0:05:41
8800 -- (-1999.631) [-1985.144] (-1983.887) (-1998.244) * (-1982.719) (-1990.107) [-1978.800] (-2003.071) -- 0:05:37
8900 -- (-1997.670) [-1979.203] (-1985.809) (-1994.374) * [-1988.188] (-1993.672) (-1985.556) (-2004.984) -- 0:05:34
9000 -- (-1989.558) [-1978.518] (-1989.574) (-1987.069) * (-1981.765) (-1988.125) [-1985.432] (-2000.665) -- 0:05:30
Average standard deviation of split frequencies: 0.024888
9100 -- (-1984.601) [-1981.555] (-1987.460) (-1987.998) * (-1993.016) [-1982.917] (-1986.460) (-1999.912) -- 0:05:26
9200 -- [-1979.719] (-1982.878) (-1989.476) (-1991.674) * (-1986.985) [-1984.287] (-1986.457) (-1998.456) -- 0:05:23
9300 -- (-1982.126) [-1979.774] (-1983.191) (-1999.341) * [-1983.527] (-1987.361) (-1989.328) (-2006.967) -- 0:05:19
9400 -- (-1981.909) [-1979.519] (-1979.111) (-2004.001) * [-1982.045] (-1985.717) (-1987.091) (-2012.366) -- 0:05:16
9500 -- (-1985.900) (-1986.859) [-1981.491] (-1994.865) * (-1985.880) (-1991.197) [-1990.786] (-2000.175) -- 0:05:12
9600 -- (-1988.655) (-1987.673) [-1989.951] (-1992.056) * [-1989.579] (-1992.842) (-1989.014) (-2004.923) -- 0:05:09
9700 -- (-1990.598) (-1989.550) [-1987.103] (-1994.046) * (-1987.387) (-2002.329) [-1987.332] (-2010.528) -- 0:05:06
9800 -- (-1989.494) (-1988.190) (-1992.335) [-1990.503] * [-1981.995] (-1997.394) (-1984.192) (-2008.782) -- 0:06:44
9900 -- (-1987.629) [-1984.712] (-1988.438) (-2007.277) * (-1982.034) (-1997.172) [-1983.028] (-2009.723) -- 0:06:40
10000 -- (-1991.640) [-1984.186] (-1988.140) (-2011.301) * (-1988.038) (-1997.804) [-1979.446] (-2009.189) -- 0:06:36
Average standard deviation of split frequencies: 0.025254
10100 -- [-1990.264] (-1989.054) (-1990.516) (-2002.811) * [-1985.904] (-1998.717) (-1985.395) (-2006.398) -- 0:06:32
10200 -- (-1993.036) [-1985.319] (-1986.665) (-2010.140) * (-1988.831) (-1995.431) [-1980.627] (-1999.323) -- 0:06:28
10300 -- (-1989.709) (-1988.622) [-1990.592] (-2008.592) * (-1988.210) (-1998.502) [-1984.774] (-1998.657) -- 0:06:24
10400 -- [-1994.280] (-1990.508) (-1997.964) (-2000.192) * (-1983.277) (-1988.194) [-1981.283] (-1999.219) -- 0:06:20
10500 -- (-1992.465) [-1991.354] (-1995.879) (-1999.213) * (-1984.654) (-1996.002) [-1982.746] (-1997.240) -- 0:06:16
10600 -- [-1989.390] (-1993.248) (-1988.170) (-1987.971) * (-1992.894) (-1999.242) (-1985.496) [-1992.739] -- 0:06:13
10700 -- (-1990.563) [-1990.238] (-1996.104) (-1989.738) * (-1987.561) [-1991.446] (-1987.010) (-1997.997) -- 0:06:09
10800 -- (-1995.013) (-1989.629) [-1994.571] (-1990.154) * (-1993.366) (-2000.874) [-1982.055] (-1993.204) -- 0:06:06
10900 -- (-2002.453) [-1985.688] (-1992.251) (-1985.885) * [-1985.843] (-1999.679) (-1985.585) (-1995.279) -- 0:06:02
11000 -- (-1991.126) [-1984.189] (-1990.363) (-1990.148) * (-1984.996) (-2001.262) [-1985.242] (-1991.757) -- 0:05:59
Average standard deviation of split frequencies: 0.031267
11100 -- (-2001.850) [-1984.033] (-1988.373) (-1994.465) * (-1993.224) (-2008.248) [-1983.956] (-1986.836) -- 0:05:56
11200 -- (-2000.494) [-1991.066] (-1989.862) (-2001.563) * [-1985.481] (-2002.289) (-1990.304) (-1990.410) -- 0:05:53
11300 -- (-1990.295) (-1984.762) [-1986.049] (-2004.548) * (-1988.911) (-1996.668) (-1988.175) [-1990.785] -- 0:05:49
11400 -- (-1983.291) [-1984.498] (-1990.907) (-2002.836) * (-1990.167) [-1994.272] (-1983.542) (-1985.382) -- 0:05:46
11500 -- (-1984.706) [-1986.784] (-1992.706) (-1994.132) * (-1993.926) (-1994.384) [-1979.702] (-1993.681) -- 0:05:43
11600 -- (-1985.730) (-1992.415) [-1989.367] (-1994.396) * (-1991.077) [-1984.346] (-1985.979) (-1989.650) -- 0:05:40
11700 -- (-1979.111) [-1986.588] (-1993.820) (-1998.635) * (-2001.117) (-1981.270) (-1985.373) [-1984.020] -- 0:05:37
11800 -- (-1980.903) [-1986.787] (-1991.578) (-2003.333) * (-1994.187) [-1979.189] (-1985.598) (-1992.241) -- 0:05:34
11900 -- [-1983.677] (-1986.400) (-1990.287) (-2000.973) * (-1996.452) [-1982.046] (-1987.443) (-1992.176) -- 0:05:32
12000 -- (-1985.357) [-1989.151] (-1991.351) (-1999.785) * (-2003.578) [-1981.654] (-1985.327) (-1996.810) -- 0:05:29
Average standard deviation of split frequencies: 0.032192
12100 -- (-1989.341) (-1989.661) [-1984.440] (-1999.242) * (-1999.256) [-1985.573] (-1993.978) (-1994.411) -- 0:05:26
12200 -- (-1984.738) (-1990.994) [-1990.316] (-1992.172) * [-1987.914] (-1986.249) (-1979.839) (-1991.111) -- 0:05:23
12300 -- [-1987.636] (-1987.385) (-1993.144) (-2000.939) * (-1991.196) [-1977.935] (-1983.221) (-1990.772) -- 0:05:21
12400 -- [-1980.887] (-1983.922) (-1994.184) (-1992.888) * (-1988.783) [-1980.154] (-1979.567) (-1991.132) -- 0:05:18
12500 -- [-1987.342] (-1985.247) (-1992.136) (-1994.426) * (-1996.944) [-1982.802] (-1980.954) (-1991.540) -- 0:05:16
12600 -- (-1992.590) [-1980.901] (-1986.675) (-2003.347) * (-2000.512) [-1982.208] (-1982.173) (-1990.566) -- 0:05:13
12700 -- (-1989.267) [-1983.924] (-1985.489) (-1997.564) * (-1998.247) (-1984.870) [-1981.886] (-1987.236) -- 0:05:10
12800 -- (-1997.721) (-1983.862) [-1985.297] (-2004.475) * (-1997.619) (-1989.255) [-1980.549] (-1987.257) -- 0:05:08
12900 -- (-1995.120) [-1981.921] (-1993.495) (-1998.941) * (-1989.870) [-1987.266] (-1982.139) (-1991.783) -- 0:05:06
13000 -- (-1989.155) [-1982.348] (-1990.257) (-1992.971) * (-1986.154) (-1983.410) [-1976.019] (-1985.521) -- 0:06:19
Average standard deviation of split frequencies: 0.029590
13100 -- (-1989.285) [-1986.435] (-1989.345) (-1988.669) * (-1986.452) (-1995.168) [-1977.678] (-1982.781) -- 0:06:16
13200 -- (-1986.486) [-1978.640] (-1990.771) (-1987.247) * [-1981.860] (-1985.478) (-1980.574) (-1985.465) -- 0:06:13
13300 -- (-1986.778) [-1978.166] (-1990.010) (-1992.028) * (-1986.653) (-1982.963) [-1986.339] (-1987.211) -- 0:06:10
13400 -- (-1998.954) [-1984.958] (-1987.060) (-1991.382) * [-1987.321] (-1987.205) (-1988.184) (-1993.675) -- 0:06:08
13500 -- [-1988.458] (-1983.492) (-1990.547) (-1987.177) * (-1985.864) (-1983.936) [-1984.474] (-1998.006) -- 0:06:05
13600 -- (-1982.885) [-1981.568] (-1995.539) (-1994.972) * (-1989.005) [-1981.391] (-1985.799) (-1995.674) -- 0:06:02
13700 -- [-1981.591] (-1989.415) (-1991.854) (-1990.119) * (-1990.475) [-1984.470] (-1990.639) (-2002.295) -- 0:05:59
13800 -- [-1978.944] (-1987.889) (-2000.162) (-1989.259) * (-1990.606) [-1981.476] (-1993.746) (-1992.670) -- 0:05:57
13900 -- (-1991.370) [-1983.386] (-1993.428) (-1999.616) * (-1992.374) [-1982.109] (-2001.762) (-1988.969) -- 0:05:54
14000 -- (-2000.813) [-1984.278] (-1985.596) (-2006.807) * (-1991.914) [-1984.351] (-1999.711) (-2000.428) -- 0:05:52
Average standard deviation of split frequencies: 0.029542
14100 -- (-1985.809) [-1979.359] (-1987.605) (-2002.472) * (-1990.730) [-1984.802] (-1998.640) (-1994.671) -- 0:05:49
14200 -- (-1980.983) (-1984.756) [-1989.195] (-2008.359) * (-1997.132) (-1990.421) [-1989.115] (-1993.996) -- 0:05:47
14300 -- [-1979.534] (-1990.669) (-1989.545) (-2000.106) * (-1999.206) [-1985.446] (-1997.340) (-1998.275) -- 0:05:44
14400 -- [-1982.036] (-1994.387) (-1986.934) (-1994.207) * (-1998.352) [-1986.884] (-2005.658) (-1998.391) -- 0:05:42
14500 -- [-1980.997] (-1997.636) (-1995.209) (-1994.052) * (-2001.487) (-1990.947) (-1999.504) [-1993.581] -- 0:05:39
14600 -- [-1979.771] (-1995.207) (-1997.725) (-1990.240) * (-2000.524) [-1991.096] (-1999.584) (-1995.523) -- 0:05:37
14700 -- [-1980.354] (-2004.993) (-1991.874) (-1987.526) * (-1994.211) (-1991.489) (-1996.897) [-1995.244] -- 0:05:35
14800 -- (-1980.871) (-1995.719) (-1989.047) [-1983.946] * (-1995.564) [-1984.035] (-1989.340) (-1996.403) -- 0:05:32
14900 -- [-1981.881] (-1997.115) (-1990.471) (-1986.862) * [-1990.016] (-1985.282) (-1990.409) (-1997.344) -- 0:05:30
15000 -- [-1986.102] (-1985.716) (-1991.120) (-1989.446) * (-2003.873) [-1980.245] (-1992.746) (-1998.745) -- 0:05:28
Average standard deviation of split frequencies: 0.028355
15100 -- (-1985.697) [-1984.582] (-1991.385) (-1990.276) * (-2004.451) [-1976.299] (-1988.292) (-1998.471) -- 0:05:26
15200 -- [-1983.301] (-1984.856) (-1986.508) (-1990.951) * (-1996.467) [-1980.160] (-1994.099) (-1998.533) -- 0:05:23
15300 -- (-1993.028) (-1991.095) [-1987.189] (-1988.430) * (-1990.806) [-1976.479] (-1996.150) (-2009.635) -- 0:05:21
15400 -- (-1986.452) [-1990.362] (-1984.395) (-1984.765) * (-1990.156) [-1978.524] (-1996.379) (-2007.698) -- 0:05:19
15500 -- (-1985.262) (-1992.117) [-1986.360] (-1987.563) * (-1989.085) [-1980.537] (-1989.478) (-2008.897) -- 0:05:17
15600 -- [-1980.574] (-2004.120) (-1991.135) (-1983.642) * (-1993.304) [-1983.684] (-1984.206) (-2012.129) -- 0:05:15
15700 -- [-1980.207] (-1995.267) (-1987.520) (-1986.367) * (-2000.178) [-1979.390] (-1982.357) (-2002.314) -- 0:05:13
15800 -- [-1981.204] (-1991.236) (-1982.801) (-1992.333) * (-1998.816) [-1978.822] (-1991.754) (-1998.564) -- 0:05:11
15900 -- [-1983.250] (-1994.576) (-1985.632) (-1993.885) * (-1999.008) [-1980.944] (-1983.808) (-2000.512) -- 0:05:09
16000 -- (-1983.438) (-1999.619) [-1985.906] (-1992.532) * (-2000.189) (-1983.880) [-1980.331] (-1999.263) -- 0:05:07
Average standard deviation of split frequencies: 0.025045
16100 -- (-1983.945) (-2002.525) [-1987.727] (-1996.570) * (-1997.852) [-1983.350] (-1986.463) (-1998.250) -- 0:05:05
16200 -- (-1988.777) (-2002.627) [-1989.816] (-1995.911) * (-1995.483) [-1983.506] (-1984.646) (-2004.500) -- 0:06:04
16300 -- [-1986.810] (-1990.123) (-1988.740) (-2000.784) * (-1989.380) [-1981.817] (-1985.936) (-1995.723) -- 0:06:02
16400 -- [-1983.770] (-1986.746) (-1990.821) (-2005.375) * (-1994.476) [-1981.111] (-1984.387) (-1990.409) -- 0:05:59
16500 -- (-1983.947) (-1992.358) (-1993.945) [-1992.196] * (-1993.516) (-1984.222) [-1983.008] (-1988.135) -- 0:05:57
16600 -- [-1992.322] (-1992.632) (-1995.502) (-1994.145) * (-1993.678) (-1984.613) [-1989.336] (-1992.019) -- 0:05:55
16700 -- (-1982.261) (-1995.604) [-1983.873] (-1992.735) * (-1994.684) (-1987.947) [-1981.792] (-1984.876) -- 0:05:53
16800 -- [-1986.536] (-1993.930) (-1989.416) (-1985.630) * (-1987.702) (-1993.872) [-1987.307] (-1988.178) -- 0:05:51
16900 -- [-1982.250] (-1985.144) (-2001.023) (-1987.711) * [-1995.942] (-1999.547) (-1991.838) (-1988.071) -- 0:05:49
17000 -- [-1979.478] (-1993.743) (-1991.050) (-1991.296) * (-1997.842) (-2007.583) (-1994.349) [-1987.369] -- 0:05:46
Average standard deviation of split frequencies: 0.022709
17100 -- [-1980.217] (-1993.671) (-2006.257) (-1984.383) * [-1994.040] (-2001.718) (-2013.159) (-1985.057) -- 0:05:44
17200 -- (-1983.561) (-2000.730) (-1990.891) [-1987.981] * [-1988.647] (-1996.123) (-2010.613) (-1988.227) -- 0:05:42
17300 -- (-1993.199) (-1993.090) [-1985.963] (-1988.429) * (-1989.687) (-2001.846) (-2004.789) [-1985.133] -- 0:05:40
17400 -- (-1990.982) (-1996.658) (-1992.029) [-1991.039] * (-1986.560) (-2000.515) (-2005.690) [-1987.207] -- 0:05:38
17500 -- (-1998.415) (-2002.302) [-1983.642] (-1986.056) * [-1987.916] (-1996.291) (-2000.901) (-1994.239) -- 0:05:36
17600 -- (-1998.584) (-1983.675) [-1987.320] (-1990.598) * (-1996.412) [-2000.115] (-2002.039) (-1994.402) -- 0:05:34
17700 -- (-1992.528) [-1980.172] (-1986.882) (-1991.891) * (-1997.419) (-1994.558) (-2002.504) [-1987.649] -- 0:05:32
17800 -- (-1994.899) [-1983.150] (-1993.847) (-1988.406) * (-1995.702) (-2002.574) (-2003.131) [-1985.717] -- 0:05:31
17900 -- (-2003.513) [-1979.284] (-1991.786) (-1984.885) * (-1990.899) (-1999.837) (-2006.646) [-1986.562] -- 0:05:29
18000 -- (-2000.152) [-1986.678] (-1989.585) (-1985.836) * (-2001.929) (-1989.945) (-2005.276) [-1988.383] -- 0:05:27
Average standard deviation of split frequencies: 0.020054
18100 -- (-2001.018) [-1983.058] (-1995.837) (-1990.359) * (-2000.109) [-1989.842] (-2002.181) (-1993.579) -- 0:05:25
18200 -- (-1991.146) [-1981.276] (-1989.961) (-2000.557) * (-1990.570) [-1985.482] (-1993.790) (-1993.195) -- 0:05:23
18300 -- (-1984.783) (-1983.033) [-1984.216] (-2001.105) * (-1991.477) (-1989.009) [-1990.537] (-1997.718) -- 0:05:21
18400 -- (-1992.966) (-1986.794) [-1982.577] (-1996.745) * (-1994.911) (-1992.286) [-1987.657] (-1994.959) -- 0:05:20
18500 -- (-1988.235) (-1990.845) [-1982.719] (-2009.687) * (-1997.218) (-1994.459) (-1990.234) [-1991.468] -- 0:05:18
18600 -- (-1985.782) (-1990.571) [-1984.424] (-1987.642) * (-1991.314) (-1993.433) [-1986.839] (-1996.138) -- 0:05:16
18700 -- [-1990.369] (-1996.141) (-1988.466) (-1986.849) * (-1994.476) [-1983.262] (-1990.842) (-1992.894) -- 0:05:14
18800 -- (-1988.967) (-1997.167) (-1991.222) [-1982.236] * (-1997.099) (-1989.176) [-1988.408] (-1990.384) -- 0:05:13
18900 -- (-1991.391) (-1997.170) (-2003.973) [-1991.729] * (-1998.378) [-1979.833] (-1985.124) (-1991.409) -- 0:05:11
19000 -- (-1998.465) [-1991.808] (-1990.195) (-1987.848) * (-2001.283) (-1993.729) (-1987.803) [-1986.360] -- 0:05:09
Average standard deviation of split frequencies: 0.021045
19100 -- (-1997.348) [-1984.913] (-1987.774) (-1985.856) * [-1994.472] (-1986.258) (-1988.636) (-1990.258) -- 0:05:08
19200 -- (-2000.607) (-1991.309) (-1987.005) [-1983.919] * (-1988.705) [-1977.790] (-1991.771) (-1987.858) -- 0:05:06
19300 -- (-1999.096) (-1993.768) [-1982.570] (-1984.399) * (-1989.857) (-1985.834) [-1991.731] (-1987.709) -- 0:05:04
19400 -- (-1996.066) (-1997.506) [-1981.170] (-1983.932) * (-1990.985) [-1985.368] (-1994.778) (-1993.206) -- 0:05:53
19500 -- (-2006.701) (-1991.543) [-1983.353] (-1986.511) * (-1990.055) (-1988.720) [-1989.812] (-1995.896) -- 0:05:51
19600 -- (-1991.386) (-1996.937) [-1982.356] (-1991.108) * (-1993.854) (-1983.937) (-1994.181) [-1989.628] -- 0:05:50
19700 -- (-1999.812) (-1991.961) (-1989.591) [-1984.147] * (-1992.049) (-1984.306) [-1990.472] (-1985.486) -- 0:05:48
19800 -- (-2004.232) (-1990.728) (-1995.399) [-1982.488] * (-1995.178) [-1982.708] (-1989.363) (-1986.204) -- 0:05:46
19900 -- (-1993.559) (-1989.395) (-1988.637) [-1983.631] * (-1992.054) [-1984.954] (-1996.795) (-1986.628) -- 0:05:44
20000 -- [-1987.724] (-1987.282) (-1986.585) (-1986.089) * (-1991.037) [-1982.428] (-1995.397) (-1985.669) -- 0:05:43
Average standard deviation of split frequencies: 0.021407
20100 -- (-1995.628) [-1982.543] (-1984.536) (-1987.245) * (-1992.818) [-1983.300] (-2003.184) (-1991.898) -- 0:05:41
20200 -- (-1999.066) (-1984.359) (-1987.013) [-1985.755] * (-1997.030) [-1984.551] (-1991.293) (-1992.347) -- 0:05:39
20300 -- (-1987.530) (-1983.404) [-1986.358] (-1985.574) * (-1997.032) [-1988.960] (-1991.904) (-1990.472) -- 0:05:37
20400 -- (-1992.757) (-1988.626) [-1991.283] (-1990.796) * (-1996.858) [-1986.762] (-1993.698) (-1992.905) -- 0:05:36
20500 -- (-1992.054) (-1990.042) [-1994.539] (-1987.660) * [-1997.993] (-1983.653) (-1988.728) (-1994.267) -- 0:05:34
20600 -- (-1993.963) (-1987.523) [-1989.963] (-1988.065) * (-1999.533) [-1981.124] (-1993.419) (-1997.569) -- 0:05:32
20700 -- (-1994.730) (-1989.940) (-1997.176) [-1985.635] * (-1998.368) [-1984.459] (-1985.557) (-2000.449) -- 0:05:31
20800 -- (-1992.064) (-1994.708) (-1993.162) [-1981.306] * (-1998.055) [-1985.786] (-1986.689) (-2005.631) -- 0:05:29
20900 -- (-2002.635) [-1991.604] (-1996.300) (-1978.659) * (-2004.968) [-1987.606] (-1989.382) (-2000.101) -- 0:05:27
21000 -- (-1996.366) (-1994.231) (-1993.059) [-1983.477] * (-1995.805) (-1985.556) [-1979.704] (-1991.197) -- 0:05:26
Average standard deviation of split frequencies: 0.019059
21100 -- (-1992.118) (-1989.788) (-1996.983) [-1981.758] * [-1989.077] (-1988.944) (-1983.637) (-2004.146) -- 0:05:24
21200 -- [-1989.552] (-1989.663) (-1988.899) (-1986.596) * (-1988.586) (-1988.232) [-1980.508] (-1997.695) -- 0:05:23
21300 -- (-1991.804) (-1990.088) (-1988.423) [-1987.019] * (-1990.697) (-1982.599) [-1980.423] (-2002.708) -- 0:05:21
21400 -- (-1987.927) (-1993.474) (-1989.797) [-1984.597] * (-1989.584) [-1980.688] (-1981.577) (-2001.073) -- 0:05:20
21500 -- (-1994.182) (-2000.224) [-1986.081] (-1982.138) * (-1994.968) (-1982.024) [-1982.274] (-1997.433) -- 0:05:18
21600 -- (-1989.625) (-1993.576) (-1991.042) [-1983.040] * (-1988.381) [-1989.721] (-1981.487) (-1990.455) -- 0:05:17
21700 -- [-1987.513] (-1990.202) (-1982.176) (-1989.299) * (-1992.394) (-1995.346) (-1981.324) [-1987.204] -- 0:05:15
21800 -- (-1984.450) (-1996.742) (-1989.836) [-1983.350] * (-1991.233) (-1989.588) [-1983.378] (-1989.265) -- 0:05:14
21900 -- [-1986.959] (-1997.086) (-1988.521) (-1986.251) * (-1988.280) (-1985.400) [-1982.998] (-1991.412) -- 0:05:12
22000 -- [-1984.378] (-1994.210) (-1985.720) (-1983.778) * (-1991.514) (-1993.289) [-1991.047] (-1992.790) -- 0:05:11
Average standard deviation of split frequencies: 0.020081
22100 -- [-1982.356] (-1998.227) (-1982.561) (-1982.466) * (-1990.380) (-2000.429) (-1996.084) [-1988.834] -- 0:05:09
22200 -- (-1984.220) (-2003.576) [-1985.361] (-1983.726) * [-1993.908] (-2009.900) (-1994.338) (-1990.233) -- 0:05:08
22300 -- (-1984.283) (-2009.672) (-1989.498) [-1992.791] * [-1991.044] (-2001.473) (-1985.300) (-1988.386) -- 0:05:06
22400 -- [-1981.955] (-1998.878) (-1990.133) (-1990.425) * (-1990.289) (-2004.228) [-1982.542] (-1992.810) -- 0:05:05
22500 -- [-1982.277] (-1987.962) (-1992.020) (-1989.149) * (-1995.316) (-2006.203) [-1980.233] (-1996.670) -- 0:05:47
22600 -- (-1982.023) (-1982.768) (-1992.456) [-1991.512] * (-1997.411) (-1997.509) [-1983.551] (-1991.036) -- 0:05:45
22700 -- [-1977.731] (-1981.797) (-1995.434) (-1991.103) * (-1997.962) [-1987.519] (-1984.441) (-1995.560) -- 0:05:44
22800 -- (-1979.443) [-1976.009] (-1990.482) (-1992.443) * (-2001.489) (-1992.369) [-1985.441] (-1992.437) -- 0:05:42
22900 -- [-1978.156] (-1980.549) (-1997.328) (-1982.836) * (-1996.956) [-1984.738] (-1983.990) (-1999.633) -- 0:05:41
23000 -- [-1980.304] (-1980.048) (-2001.675) (-1993.822) * (-1998.251) [-1981.992] (-1987.058) (-1993.412) -- 0:05:39
Average standard deviation of split frequencies: 0.020900
23100 -- [-1986.246] (-1981.760) (-2000.529) (-1992.044) * (-1989.518) [-1983.986] (-1982.712) (-1994.119) -- 0:05:38
23200 -- (-1983.596) [-1981.996] (-2005.523) (-1989.758) * (-1991.448) (-1981.634) [-1992.770] (-2004.221) -- 0:05:36
23300 -- [-1981.972] (-1987.827) (-2005.252) (-1985.874) * (-1994.298) [-1980.503] (-1983.760) (-1994.663) -- 0:05:35
23400 -- [-1977.693] (-1985.118) (-1992.279) (-1993.665) * (-1993.119) (-1984.340) [-1983.199] (-2002.956) -- 0:05:33
23500 -- [-1978.103] (-1992.070) (-1989.232) (-1998.673) * (-1994.039) [-1979.978] (-1992.675) (-2004.428) -- 0:05:32
23600 -- [-1983.977] (-1992.342) (-1991.169) (-2002.427) * (-1995.537) [-1980.007] (-1990.336) (-2006.081) -- 0:05:30
23700 -- [-1984.692] (-1990.632) (-1993.161) (-2009.011) * (-1994.433) (-1988.268) [-1985.735] (-2005.579) -- 0:05:29
23800 -- (-1981.782) (-1991.878) [-1982.776] (-1997.529) * (-1990.417) [-1989.210] (-1987.638) (-2000.254) -- 0:05:28
23900 -- (-1989.822) (-1992.143) [-1985.720] (-2012.508) * (-1989.506) (-1987.105) [-1991.374] (-1999.533) -- 0:05:26
24000 -- (-1987.107) [-1984.071] (-1994.152) (-2007.801) * (-1992.931) (-1987.464) [-1984.520] (-2002.831) -- 0:05:25
Average standard deviation of split frequencies: 0.018417
24100 -- (-1991.221) [-1986.958] (-1987.089) (-2016.333) * (-1991.076) (-1991.893) [-1980.033] (-2005.244) -- 0:05:23
24200 -- (-1985.612) (-1989.357) [-1986.402] (-2006.036) * (-1988.585) (-1991.422) [-1980.951] (-2010.603) -- 0:05:22
24300 -- (-1990.576) (-1988.711) (-1985.395) [-1996.111] * [-1990.308] (-1989.571) (-1984.379) (-2000.915) -- 0:05:21
24400 -- (-1993.703) [-1980.814] (-1982.909) (-1994.554) * (-1992.081) (-1986.357) [-1979.683] (-1996.590) -- 0:05:19
24500 -- (-1989.913) (-1981.056) [-1985.780] (-2006.661) * (-1994.416) (-1988.841) [-1980.856] (-1995.037) -- 0:05:18
24600 -- (-1979.715) [-1979.258] (-1985.839) (-1993.538) * (-1992.820) (-1993.487) [-1978.671] (-1995.861) -- 0:05:17
24700 -- [-1979.087] (-1990.954) (-1981.554) (-1990.588) * (-1994.132) (-1989.203) [-1981.362] (-1991.676) -- 0:05:15
24800 -- [-1984.847] (-1994.978) (-1982.544) (-1992.284) * (-1992.869) (-1990.938) [-1980.557] (-1990.610) -- 0:05:14
24900 -- (-1987.171) [-1979.642] (-1990.382) (-1993.973) * (-1991.560) (-1994.263) [-1982.177] (-1994.189) -- 0:05:13
25000 -- (-1986.035) [-1977.945] (-1988.684) (-1991.038) * (-1996.571) (-1995.048) [-1981.040] (-1993.942) -- 0:05:12
Average standard deviation of split frequencies: 0.015500
25100 -- (-2000.958) [-1978.238] (-1991.151) (-1991.512) * (-2008.635) (-1988.551) [-1983.551] (-1997.248) -- 0:05:10
25200 -- (-1990.604) [-1983.689] (-1986.236) (-1989.597) * (-1999.612) (-1990.117) [-1979.361] (-1994.074) -- 0:05:09
25300 -- [-1981.761] (-1985.519) (-1986.673) (-1995.056) * (-2006.041) (-1987.651) [-1980.141] (-1991.328) -- 0:05:08
25400 -- (-1987.946) [-1985.774] (-1987.981) (-1983.521) * (-2004.593) (-1988.960) (-1979.440) [-1983.164] -- 0:05:06
25500 -- (-1986.543) [-1984.246] (-1985.132) (-1986.985) * (-1997.452) (-1986.801) [-1977.498] (-1987.349) -- 0:05:05
25600 -- (-1987.048) (-1995.887) [-1986.428] (-1994.689) * (-2002.329) (-1987.754) [-1980.720] (-1992.168) -- 0:05:04
25700 -- [-1982.612] (-1988.903) (-1978.438) (-1994.299) * (-1998.258) (-1985.996) [-1985.073] (-1987.092) -- 0:05:41
25800 -- [-1981.302] (-1988.015) (-1982.943) (-1988.210) * (-1995.106) [-1983.245] (-1992.418) (-1989.738) -- 0:05:39
25900 -- (-1980.781) (-1994.044) [-1986.926] (-1992.723) * (-1994.134) (-1992.918) (-1990.975) [-1986.507] -- 0:05:38
26000 -- [-1982.958] (-1994.596) (-1990.221) (-1987.514) * (-1999.892) (-1988.475) (-1986.554) [-1984.965] -- 0:05:37
Average standard deviation of split frequencies: 0.014946
26100 -- (-1984.340) (-1988.014) [-1985.930] (-1988.824) * (-1993.357) [-1989.118] (-1987.033) (-1986.470) -- 0:05:35
26200 -- (-1983.766) (-1992.212) (-1988.807) [-1989.291] * [-1990.961] (-1988.860) (-1987.467) (-1995.426) -- 0:05:34
26300 -- (-1988.243) (-1989.013) (-1987.320) [-1989.559] * (-1998.120) (-1984.475) [-1982.292] (-1999.338) -- 0:05:33
26400 -- (-1985.323) (-2000.220) (-1986.533) [-1985.023] * (-2004.653) (-1985.122) [-1980.315] (-1998.249) -- 0:05:31
26500 -- [-1983.137] (-2000.077) (-1984.478) (-1994.328) * (-1995.484) [-1988.950] (-1987.952) (-1990.216) -- 0:05:30
26600 -- (-1987.870) (-1996.767) [-1989.339] (-1995.810) * [-1989.580] (-1990.398) (-1986.677) (-1998.811) -- 0:05:29
26700 -- [-1982.528] (-1994.899) (-1990.110) (-1997.543) * (-1995.099) [-1982.437] (-1994.840) (-1999.636) -- 0:05:28
26800 -- (-1982.154) (-1993.536) (-1987.946) [-1991.662] * (-2004.380) (-1991.455) [-1981.364] (-1993.051) -- 0:05:26
26900 -- (-1983.851) (-1999.699) (-1989.413) [-1986.695] * (-1994.874) [-1986.759] (-1985.828) (-1998.467) -- 0:05:25
27000 -- [-1982.772] (-1996.031) (-1991.171) (-1995.618) * (-2000.548) (-1988.675) [-1988.561] (-2000.813) -- 0:05:24
Average standard deviation of split frequencies: 0.016341
27100 -- [-1983.707] (-1992.480) (-1988.983) (-1984.938) * (-1997.467) (-1991.402) [-1987.183] (-2001.233) -- 0:05:23
27200 -- (-1985.812) (-1994.998) (-1993.266) [-1988.620] * (-1993.037) [-1988.596] (-1985.389) (-2004.053) -- 0:05:21
27300 -- [-1984.571] (-1990.254) (-1989.630) (-1990.108) * (-1989.340) (-1986.108) [-1984.410] (-2010.119) -- 0:05:20
27400 -- [-1985.715] (-1989.119) (-1986.005) (-1990.634) * (-1997.063) (-1988.569) [-1981.817] (-1995.603) -- 0:05:19
27500 -- (-1986.500) (-1992.765) [-1985.351] (-1990.380) * (-1998.764) [-1988.256] (-1981.739) (-1996.173) -- 0:05:18
27600 -- [-1997.108] (-1988.996) (-1989.426) (-1988.391) * (-2001.126) (-1991.453) [-1987.917] (-1992.011) -- 0:05:17
27700 -- (-1992.970) [-1986.490] (-1982.502) (-1989.979) * (-1993.333) (-1991.533) [-1986.825] (-1991.558) -- 0:05:15
27800 -- (-1986.576) [-1981.478] (-1985.705) (-1990.863) * (-2001.195) (-1995.229) (-1983.620) [-1986.466] -- 0:05:14
27900 -- (-1983.498) [-1981.122] (-1982.886) (-1991.073) * (-2005.933) (-1992.489) [-1984.885] (-1988.241) -- 0:05:13
28000 -- (-1996.066) [-1984.865] (-1978.490) (-1988.200) * (-2007.728) [-1983.001] (-1988.634) (-1991.128) -- 0:05:12
Average standard deviation of split frequencies: 0.017714
28100 -- (-1984.922) (-1985.585) [-1978.810] (-1993.817) * (-2007.236) [-1984.645] (-1988.264) (-1991.817) -- 0:05:11
28200 -- (-1991.258) (-1993.772) [-1987.396] (-1994.426) * (-2002.346) [-1985.300] (-1990.991) (-1995.269) -- 0:05:10
28300 -- (-1991.609) (-1988.181) [-1982.635] (-1993.969) * (-2003.028) (-1991.142) [-1989.748] (-1994.418) -- 0:05:09
28400 -- [-1986.706] (-1998.771) (-1990.122) (-1986.520) * (-2000.820) [-1983.034] (-1989.287) (-1990.828) -- 0:05:07
28500 -- (-1986.887) (-2000.547) (-1989.027) [-1984.961] * (-2003.626) (-1985.858) [-1985.100] (-1989.599) -- 0:05:06
28600 -- (-1989.269) (-1991.959) (-1996.670) [-1986.831] * (-1997.634) (-1989.936) [-1986.853] (-1993.499) -- 0:05:05
28700 -- (-1993.812) [-1984.242] (-1994.247) (-1992.063) * (-2003.595) (-1983.650) (-1993.898) [-1987.475] -- 0:05:04
28800 -- [-1988.788] (-1988.636) (-1987.089) (-1993.047) * (-2000.486) [-1985.083] (-1984.813) (-1988.745) -- 0:05:03
28900 -- [-1986.754] (-1990.498) (-1985.150) (-1990.193) * (-1997.705) [-1984.559] (-1979.672) (-1990.262) -- 0:05:36
29000 -- (-1986.738) (-1993.429) [-1986.394] (-1988.536) * (-1996.125) (-1981.083) [-1983.146] (-1991.015) -- 0:05:34
Average standard deviation of split frequencies: 0.015221
29100 -- (-1981.659) (-1995.751) [-1985.899] (-1986.090) * (-1996.291) [-1988.047] (-1982.737) (-1985.647) -- 0:05:33
29200 -- (-1984.512) (-1995.383) [-1988.856] (-1991.904) * (-1999.503) [-1980.755] (-1985.826) (-1990.358) -- 0:05:32
29300 -- (-1984.295) (-1998.618) (-1985.537) [-1986.374] * [-1991.523] (-1982.280) (-1986.792) (-1988.383) -- 0:05:31
29400 -- [-1984.464] (-1999.707) (-1992.100) (-1990.969) * [-1987.166] (-1983.293) (-1983.214) (-1989.180) -- 0:05:30
29500 -- (-1981.325) (-1998.059) [-1988.049] (-1996.338) * (-1989.690) (-1988.310) [-1980.493] (-1988.308) -- 0:05:28
29600 -- (-1984.088) (-1990.443) [-1979.829] (-1996.791) * (-1989.378) [-1985.053] (-1980.458) (-1988.142) -- 0:05:27
29700 -- (-1986.739) (-1984.162) (-1979.931) [-1986.794] * (-1990.097) (-1984.326) [-1981.259] (-1994.319) -- 0:05:26
29800 -- (-1992.576) (-1988.730) (-1989.749) [-1985.494] * (-1988.453) (-1992.915) [-1980.204] (-1990.193) -- 0:05:25
29900 -- (-1979.834) [-1987.736] (-1987.208) (-1983.725) * (-1993.750) (-1992.658) [-1981.521] (-1990.537) -- 0:05:24
30000 -- (-1979.421) (-1992.092) [-1983.585] (-1989.561) * (-1997.814) (-1985.713) [-1981.185] (-1992.785) -- 0:05:23
Average standard deviation of split frequencies: 0.012962
30100 -- (-1985.925) (-1996.671) [-1983.102] (-1985.433) * (-1992.509) (-1986.845) (-1983.818) [-1990.543] -- 0:05:22
30200 -- (-1984.922) (-1988.051) [-1978.572] (-1992.423) * (-1995.030) (-1994.235) [-1979.929] (-1991.687) -- 0:05:21
30300 -- (-1986.603) (-1985.597) [-1976.587] (-1994.583) * (-1999.076) (-1991.812) [-1981.600] (-1995.299) -- 0:05:20
30400 -- (-1990.817) (-1985.493) (-1979.958) [-1984.283] * (-2015.024) (-1989.436) [-1984.998] (-1994.272) -- 0:05:18
30500 -- (-1993.356) (-1983.096) [-1983.227] (-1990.803) * (-2000.939) (-1986.251) [-1987.501] (-1994.386) -- 0:05:17
30600 -- (-1990.089) (-1982.969) [-1980.651] (-1989.831) * (-1993.987) (-1983.261) [-1982.135] (-1994.748) -- 0:05:16
30700 -- (-1993.489) (-1991.547) [-1981.973] (-1994.004) * (-1988.855) (-1988.687) [-1980.574] (-1988.764) -- 0:05:15
30800 -- (-1988.930) (-1983.908) [-1981.626] (-1989.140) * (-1988.504) (-1993.745) [-1981.281] (-1985.083) -- 0:05:14
30900 -- (-1995.616) (-1984.329) [-1983.491] (-1984.410) * (-1992.891) [-1990.537] (-1981.651) (-1989.733) -- 0:05:13
31000 -- (-1994.343) (-1981.576) [-1980.112] (-1983.983) * (-1989.718) (-1984.013) [-1985.314] (-1992.465) -- 0:05:12
Average standard deviation of split frequencies: 0.012519
31100 -- (-1994.922) (-1984.982) [-1983.311] (-1982.304) * [-1987.067] (-1988.178) (-1988.742) (-1990.006) -- 0:05:11
31200 -- (-2002.258) (-1982.705) [-1978.890] (-1982.218) * (-1989.315) [-1984.954] (-1984.533) (-1993.847) -- 0:05:10
31300 -- (-2011.040) [-1982.394] (-1979.367) (-1980.203) * [-1991.675] (-1995.341) (-1981.056) (-2004.206) -- 0:05:09
31400 -- (-2004.073) (-1979.815) [-1980.548] (-1985.886) * (-1992.987) (-1990.534) [-1982.900] (-2009.283) -- 0:05:08
31500 -- (-1990.202) [-1980.835] (-1999.084) (-1982.354) * (-1992.125) (-1988.481) [-1986.426] (-2007.061) -- 0:05:07
31600 -- (-1998.135) [-1986.462] (-1988.925) (-1989.043) * (-1984.520) (-1984.164) [-1984.863] (-2002.351) -- 0:05:06
31700 -- (-1994.710) [-1981.350] (-1978.571) (-1992.598) * (-1987.539) (-1989.763) [-1985.604] (-1996.603) -- 0:05:05
31800 -- (-1992.598) [-1984.103] (-1980.359) (-1995.668) * (-1993.214) (-1983.493) [-1984.022] (-1995.603) -- 0:05:04
31900 -- (-1993.154) (-1987.221) [-1983.382] (-1987.672) * (-1987.844) [-1983.470] (-1984.762) (-2007.348) -- 0:05:03
32000 -- (-1988.997) (-1985.414) (-1983.134) [-1987.317] * (-1993.288) [-1990.557] (-1995.810) (-2009.776) -- 0:05:02
Average standard deviation of split frequencies: 0.011317
32100 -- (-1987.799) (-1984.028) [-1983.250] (-1984.634) * (-1989.970) (-1996.573) (-1989.130) [-1999.469] -- 0:05:31
32200 -- (-1985.006) [-1986.429] (-1980.926) (-1979.729) * (-1987.741) (-1991.612) [-1985.036] (-1995.156) -- 0:05:30
32300 -- (-1980.202) (-1984.435) (-1992.206) [-1987.626] * [-1986.640] (-1989.666) (-1992.467) (-1994.591) -- 0:05:29
32400 -- [-1988.166] (-1986.890) (-1995.377) (-1984.436) * (-1983.742) (-1986.777) [-1980.888] (-1996.472) -- 0:05:28
32500 -- (-1999.292) (-1988.750) [-1989.395] (-1987.300) * (-1983.323) (-1987.225) [-1980.336] (-2002.173) -- 0:05:27
32600 -- (-1991.476) [-1977.911] (-1986.682) (-1987.700) * (-1995.297) [-1980.798] (-1986.431) (-2000.880) -- 0:05:26
32700 -- (-1995.897) (-1977.690) (-1991.589) [-1984.910] * (-1994.090) [-1984.614] (-1985.569) (-1996.930) -- 0:05:25
32800 -- (-1997.361) [-1979.830] (-1998.615) (-1988.267) * (-1988.606) [-1986.070] (-1981.803) (-1997.686) -- 0:05:24
32900 -- (-2003.201) (-1986.638) (-2000.559) [-1988.512] * (-1989.536) (-1985.091) (-1990.969) [-1988.100] -- 0:05:23
33000 -- (-2009.009) (-1982.663) (-1993.443) [-1986.037] * [-1987.217] (-1983.943) (-1996.749) (-1985.624) -- 0:05:22
Average standard deviation of split frequencies: 0.013388
33100 -- (-2006.630) [-1982.017] (-1984.841) (-1983.266) * (-1983.120) (-1990.366) (-1990.774) [-1991.699] -- 0:05:21
33200 -- [-1989.611] (-1992.000) (-1984.661) (-1987.908) * (-1988.819) [-1980.304] (-1991.344) (-1993.823) -- 0:05:20
33300 -- (-1998.361) (-1985.528) [-1982.528] (-1985.178) * [-1986.946] (-1983.506) (-1990.429) (-1992.430) -- 0:05:19
33400 -- (-2004.065) [-1981.417] (-1984.430) (-1991.531) * (-1996.627) [-1986.283] (-1993.251) (-1999.027) -- 0:05:18
33500 -- (-1999.902) (-1984.640) [-1987.940] (-1986.645) * (-1997.774) (-1988.995) [-1984.073] (-2005.058) -- 0:05:17
33600 -- (-2006.056) [-1981.509] (-1985.765) (-1995.049) * (-1995.694) (-1991.461) [-1983.074] (-1997.966) -- 0:05:16
33700 -- (-1995.215) [-1984.273] (-1989.447) (-1999.842) * (-1995.842) (-1979.732) [-1979.763] (-2001.089) -- 0:05:15
33800 -- (-1998.474) (-1988.489) [-1982.616] (-1995.842) * (-2006.393) (-1980.060) [-1982.634] (-1998.150) -- 0:05:14
33900 -- [-1993.436] (-1990.231) (-1989.834) (-1998.299) * (-2007.123) (-1982.144) [-1983.689] (-2004.107) -- 0:05:13
34000 -- (-1992.165) (-1994.293) [-1987.997] (-1988.143) * (-2003.310) (-1987.156) [-1988.742] (-1999.309) -- 0:05:12
Average standard deviation of split frequencies: 0.015389
34100 -- (-1994.596) (-1991.273) (-1983.946) [-1986.402] * (-1997.663) [-1982.049] (-1986.335) (-1992.769) -- 0:05:11
34200 -- (-1985.385) (-1990.406) [-1978.227] (-1989.310) * (-1999.421) (-1988.548) [-1982.706] (-1993.767) -- 0:05:10
34300 -- (-1988.553) (-1987.524) [-1981.412] (-1990.982) * (-2002.491) (-1991.001) [-1983.156] (-1997.791) -- 0:05:09
34400 -- (-1985.353) (-1984.213) [-1979.776] (-1989.749) * (-2002.352) (-1987.488) [-1985.403] (-1998.545) -- 0:05:08
34500 -- (-1988.398) [-1981.826] (-1983.350) (-1991.406) * (-2001.239) [-1978.082] (-1992.890) (-2009.999) -- 0:05:07
34600 -- (-1988.560) (-1980.803) [-1981.271] (-2007.529) * (-2002.990) [-1975.378] (-1989.699) (-1990.665) -- 0:05:06
34700 -- (-1995.091) (-1990.261) [-1985.360] (-2001.061) * (-1989.570) (-1981.367) [-1986.956] (-1997.061) -- 0:05:06
34800 -- (-1992.833) (-1989.591) [-1981.643] (-1991.115) * [-1985.103] (-1985.359) (-1983.967) (-2004.899) -- 0:05:05
34900 -- (-1992.053) [-1986.304] (-1980.918) (-2001.918) * (-1989.280) (-1989.449) [-1981.191] (-2001.694) -- 0:05:04
35000 -- (-1985.684) (-1985.973) [-1977.763] (-1995.028) * [-1987.982] (-1991.461) (-1981.493) (-2003.559) -- 0:05:03
Average standard deviation of split frequencies: 0.015688
35100 -- [-1982.549] (-1985.923) (-1982.616) (-1993.989) * (-1988.117) [-1987.806] (-1989.948) (-2002.870) -- 0:05:02
35200 -- [-1980.975] (-1986.954) (-1986.961) (-1996.137) * (-1992.325) [-1986.656] (-1992.803) (-1998.322) -- 0:05:01
35300 -- [-1979.100] (-1990.985) (-1981.990) (-1980.292) * (-1986.171) (-1996.256) [-1990.902] (-2003.458) -- 0:05:27
35400 -- [-1978.700] (-1990.992) (-1980.862) (-1987.572) * (-1993.937) [-1984.812] (-1996.717) (-2001.156) -- 0:05:26
35500 -- [-1979.219] (-1991.788) (-1983.540) (-1995.746) * (-1989.105) [-1982.488] (-1995.152) (-1999.922) -- 0:05:26
35600 -- (-1991.172) (-1992.791) [-1986.570] (-1995.519) * (-1988.353) [-1978.495] (-1999.708) (-1997.047) -- 0:05:25
35700 -- (-1991.137) (-1995.425) [-1987.150] (-2003.376) * (-1987.814) [-1986.067] (-1993.768) (-1998.813) -- 0:05:24
35800 -- (-1986.143) [-1983.269] (-1991.791) (-1997.021) * [-1995.912] (-1984.713) (-1987.641) (-1996.427) -- 0:05:23
35900 -- (-1985.986) [-1985.950] (-1986.673) (-2000.359) * (-2000.833) (-1981.291) [-1989.395] (-1990.741) -- 0:05:22
36000 -- [-1987.907] (-1986.140) (-1992.686) (-1997.461) * (-1997.404) [-1983.590] (-1987.997) (-1999.133) -- 0:05:21
Average standard deviation of split frequencies: 0.014537
36100 -- (-1982.426) [-1986.744] (-1985.282) (-1997.422) * (-1999.877) (-1983.255) [-1986.583] (-2007.127) -- 0:05:20
36200 -- (-1983.738) (-1985.901) [-1983.324] (-1999.205) * (-1995.129) [-1982.663] (-1985.971) (-1995.706) -- 0:05:19
36300 -- (-1979.805) [-1987.171] (-1984.364) (-1995.352) * (-1993.048) (-1982.716) [-1985.515] (-1991.167) -- 0:05:18
36400 -- (-1982.313) (-1991.039) [-1981.897] (-1997.285) * (-1992.404) [-1982.372] (-1990.881) (-1998.209) -- 0:05:17
36500 -- [-1984.731] (-1986.724) (-1980.884) (-1995.930) * (-2000.320) [-1981.551] (-1988.476) (-1987.032) -- 0:05:16
36600 -- (-1994.443) (-1986.609) [-1976.067] (-1986.282) * (-2004.552) [-1981.426] (-1991.525) (-1992.454) -- 0:05:15
36700 -- (-1989.643) (-1984.735) [-1980.033] (-2001.101) * (-2004.023) [-1983.340] (-1982.404) (-1997.642) -- 0:05:14
36800 -- (-1985.563) [-1981.808] (-1981.517) (-1999.527) * (-1991.061) [-1982.666] (-1986.980) (-1992.374) -- 0:05:14
36900 -- (-1988.831) (-1982.172) [-1983.159] (-1993.563) * (-1994.128) (-1984.624) [-1986.097] (-1991.226) -- 0:05:13
37000 -- [-1987.864] (-1991.145) (-1985.097) (-1992.451) * (-1995.392) (-1987.989) [-1983.747] (-1990.590) -- 0:05:12
Average standard deviation of split frequencies: 0.017741
37100 -- (-1984.292) [-1984.277] (-1987.126) (-2002.127) * (-1999.681) [-1982.471] (-1992.195) (-1990.228) -- 0:05:11
37200 -- (-1985.510) (-1986.405) [-1988.330] (-2008.202) * (-1991.710) (-1989.404) (-1986.823) [-1985.901] -- 0:05:10
37300 -- [-1979.507] (-1986.217) (-1981.635) (-1990.885) * (-2000.196) [-1983.547] (-1986.418) (-1991.742) -- 0:05:09
37400 -- [-1979.145] (-1985.255) (-1985.208) (-1993.226) * (-2000.984) (-1983.567) [-1985.893] (-1987.032) -- 0:05:08
37500 -- (-1987.150) [-1988.214] (-1982.657) (-1996.894) * (-1997.239) (-1983.992) [-1990.033] (-1997.009) -- 0:05:08
37600 -- [-1983.363] (-1983.253) (-1983.876) (-2001.531) * (-1991.415) [-1989.448] (-1993.383) (-1993.330) -- 0:05:07
37700 -- [-1985.673] (-1981.336) (-1986.852) (-1991.216) * (-1988.932) (-1993.191) [-1993.868] (-1994.032) -- 0:05:06
37800 -- (-1984.230) [-1983.929] (-1986.436) (-1991.266) * (-1988.090) [-1979.341] (-2003.609) (-1995.380) -- 0:05:05
37900 -- (-1996.535) [-1983.281] (-1991.876) (-1989.883) * (-1999.505) (-1977.951) (-1993.259) [-1988.515] -- 0:05:04
38000 -- (-1997.838) [-1983.932] (-1979.711) (-1999.411) * (-1999.468) [-1977.676] (-1985.388) (-1991.507) -- 0:05:03
Average standard deviation of split frequencies: 0.015541
38100 -- (-1992.008) (-1975.989) [-1983.264] (-1993.344) * (-2000.397) (-1979.882) [-1988.191] (-1995.011) -- 0:05:02
38200 -- (-1987.945) [-1980.109] (-1987.557) (-1993.706) * (-2002.778) [-1983.722] (-1986.283) (-1992.841) -- 0:05:02
38300 -- (-1986.005) (-1980.570) [-1989.106] (-1996.530) * (-1997.435) [-1980.761] (-1989.287) (-1993.161) -- 0:05:01
38400 -- (-1990.119) [-1983.943] (-1991.821) (-1996.364) * (-2004.934) [-1981.971] (-1990.014) (-1987.233) -- 0:05:25
38500 -- [-1989.235] (-1982.460) (-1983.136) (-1995.015) * (-1999.534) [-1983.092] (-1983.285) (-1990.177) -- 0:05:24
38600 -- (-1995.088) [-1989.720] (-1996.033) (-2009.294) * (-1997.401) (-1982.045) [-1978.993] (-1996.690) -- 0:05:23
38700 -- (-1996.401) [-1985.328] (-2002.244) (-2008.845) * (-1997.727) (-1980.594) [-1980.635] (-2009.765) -- 0:05:22
38800 -- (-1995.460) [-1987.216] (-1999.212) (-2000.743) * (-1986.014) [-1983.380] (-1987.797) (-1996.000) -- 0:05:22
38900 -- (-1998.674) [-1981.515] (-1990.782) (-2000.350) * (-1986.946) [-1984.877] (-1983.726) (-1998.427) -- 0:05:21
39000 -- (-1997.871) (-1983.759) (-1990.753) [-2000.922] * (-1985.518) [-1980.481] (-1981.639) (-2000.162) -- 0:05:20
Average standard deviation of split frequencies: 0.015805
39100 -- (-2005.666) (-1991.876) [-1985.108] (-1998.998) * [-1983.189] (-1981.565) (-1981.547) (-2016.988) -- 0:05:19
39200 -- [-2001.205] (-1992.486) (-1991.810) (-1993.541) * [-1982.813] (-1988.859) (-1982.195) (-2000.307) -- 0:05:18
39300 -- (-1996.206) (-1988.949) (-1989.347) [-1986.615] * (-1986.879) [-1986.775] (-1989.122) (-2012.315) -- 0:05:17
39400 -- (-1998.048) (-1992.180) (-1991.186) [-1984.710] * [-1988.666] (-1986.307) (-1989.638) (-1996.576) -- 0:05:16
39500 -- (-2001.983) (-1987.719) (-1987.071) [-1985.756] * (-1985.198) (-1988.702) [-1985.151] (-1994.571) -- 0:05:16
39600 -- (-2007.461) (-1990.677) (-1988.057) [-1984.787] * (-1986.873) (-1986.064) [-1990.527] (-1999.433) -- 0:05:15
39700 -- (-2000.227) [-1993.041] (-1994.112) (-1986.393) * (-1991.786) (-1990.874) [-1993.052] (-1994.191) -- 0:05:14
39800 -- (-2004.242) (-1988.583) [-1996.859] (-1985.303) * (-1989.225) [-1992.752] (-1987.374) (-1992.199) -- 0:05:13
39900 -- (-1998.952) (-1995.596) (-1995.187) [-1984.557] * (-1992.152) (-1994.869) (-1982.789) [-1985.732] -- 0:05:12
40000 -- (-1999.716) (-1992.824) (-1988.894) [-1987.369] * (-1995.407) (-1992.482) (-1982.635) [-1986.933] -- 0:05:12
Average standard deviation of split frequencies: 0.014431
40100 -- (-1996.171) (-1991.087) [-1989.688] (-1987.875) * (-1999.996) (-1983.922) [-1982.796] (-1986.282) -- 0:05:11
40200 -- (-1988.334) [-1986.316] (-1988.956) (-1992.878) * (-1997.183) (-1989.385) [-1985.034] (-1997.078) -- 0:05:10
40300 -- (-1990.917) (-1985.475) (-1995.059) [-1989.679] * (-1992.529) (-1988.422) [-1981.528] (-2000.477) -- 0:05:09
40400 -- (-1987.864) [-1986.876] (-1995.649) (-1988.968) * (-1986.426) [-1984.193] (-1981.765) (-2003.010) -- 0:05:08
40500 -- (-1991.264) (-1985.874) [-1985.714] (-1985.119) * [-1988.422] (-1983.859) (-1986.084) (-1998.274) -- 0:05:07
40600 -- (-1994.539) (-1984.936) [-1985.794] (-1992.992) * (-1991.946) (-1980.569) [-1984.775] (-2002.414) -- 0:05:07
40700 -- [-1995.508] (-1989.875) (-1987.309) (-2005.567) * (-1989.472) (-1984.431) [-1983.552] (-2006.058) -- 0:05:06
40800 -- (-2003.299) (-1986.640) [-1985.206] (-2000.010) * (-1998.030) (-1992.382) [-1992.382] (-2000.114) -- 0:05:05
40900 -- (-2000.957) [-1981.320] (-1981.869) (-1995.424) * (-1994.301) [-1982.384] (-1993.723) (-1995.630) -- 0:05:04
41000 -- (-2003.835) [-1979.401] (-1982.891) (-2006.844) * (-2001.097) [-1984.902] (-2001.264) (-1996.762) -- 0:05:04
Average standard deviation of split frequencies: 0.015038
41100 -- (-1992.901) [-1981.306] (-1986.890) (-2000.778) * (-2000.470) (-1984.629) [-1988.850] (-1995.728) -- 0:05:03
41200 -- (-1996.038) [-1980.957] (-1983.041) (-2007.921) * (-2001.391) (-1982.965) [-1989.635] (-1994.601) -- 0:05:02
41300 -- (-1992.365) [-1986.954] (-1982.900) (-2001.655) * (-1992.093) (-1983.109) [-1987.648] (-1993.266) -- 0:05:01
41400 -- (-1995.225) (-1990.293) [-1978.099] (-1995.456) * [-1988.583] (-1984.306) (-1985.717) (-1988.896) -- 0:05:01
41500 -- (-1991.706) (-1987.038) [-1976.485] (-1996.699) * [-1986.120] (-1984.148) (-1987.605) (-1992.360) -- 0:05:00
41600 -- (-1985.996) [-1980.581] (-1976.473) (-1993.450) * (-1989.783) (-1985.725) [-1979.761] (-2003.658) -- 0:05:22
41700 -- (-1984.851) [-1982.042] (-1987.447) (-1990.989) * (-1986.465) (-1983.814) [-1977.710] (-1995.528) -- 0:05:21
41800 -- (-1991.750) (-1984.144) (-1980.737) [-1987.290] * (-1989.610) (-1993.028) [-1983.048] (-2001.505) -- 0:05:20
41900 -- (-1990.980) (-1994.558) (-1987.320) [-1985.053] * (-1989.508) (-1992.101) [-1980.995] (-1998.383) -- 0:05:20
42000 -- (-1992.411) (-1988.581) (-1984.095) [-1984.123] * (-1990.061) (-1984.491) [-1982.647] (-1992.286) -- 0:05:19
Average standard deviation of split frequencies: 0.016623
42100 -- (-1988.660) (-1990.682) [-1980.797] (-1989.051) * (-1994.357) [-1986.553] (-1983.866) (-1994.478) -- 0:05:18
42200 -- (-2001.295) [-1983.232] (-1980.565) (-1993.141) * (-1989.239) (-1984.535) [-1987.295] (-2009.396) -- 0:05:17
42300 -- (-1995.211) [-1982.276] (-1990.061) (-1991.841) * (-1985.843) [-1989.250] (-1980.616) (-2011.067) -- 0:05:16
42400 -- (-1995.947) (-1984.596) [-1988.327] (-1990.046) * (-1985.574) [-1988.485] (-1981.735) (-2004.978) -- 0:05:16
42500 -- (-1989.688) (-1984.586) (-1995.423) [-1997.762] * (-1988.211) (-1989.102) [-1984.297] (-2002.351) -- 0:05:15
42600 -- (-1996.201) (-1987.613) (-1985.719) [-1996.699] * (-1987.765) (-1992.462) [-1983.066] (-2003.826) -- 0:05:14
42700 -- (-2003.582) (-1984.206) [-1990.808] (-1992.495) * [-1983.966] (-2000.402) (-1985.177) (-2000.077) -- 0:05:13
42800 -- (-1993.506) (-1988.705) [-1991.688] (-1992.261) * (-1989.399) (-1990.992) [-1981.778] (-2003.050) -- 0:05:13
42900 -- (-1992.920) [-1988.865] (-1988.686) (-1994.839) * (-1987.010) (-1989.900) [-1986.996] (-2002.813) -- 0:05:12
43000 -- (-1993.325) (-1988.444) [-1983.708] (-1997.278) * (-1988.563) (-1986.482) [-1978.979] (-2004.790) -- 0:05:11
Average standard deviation of split frequencies: 0.015901
43100 -- (-1993.592) (-1991.807) [-1984.126] (-2002.805) * (-1989.959) (-1982.030) [-1980.209] (-1998.254) -- 0:05:10
43200 -- (-1995.261) (-1996.994) [-1989.700] (-1989.061) * (-1999.202) (-1980.999) [-1978.376] (-1991.700) -- 0:05:10
43300 -- (-2009.722) [-1989.838] (-1987.576) (-1993.192) * (-1992.827) [-1981.764] (-1978.551) (-1991.179) -- 0:05:09
43400 -- (-2006.601) (-1987.670) [-1984.940] (-2004.295) * (-1987.824) (-1988.373) [-1982.530] (-1996.394) -- 0:05:08
43500 -- (-2004.817) [-1984.485] (-1982.790) (-2000.212) * (-1991.399) [-1977.987] (-1991.975) (-1991.678) -- 0:05:07
43600 -- (-2013.966) (-1982.593) [-1987.291] (-1991.112) * (-1989.955) (-1984.037) [-1991.062] (-2000.116) -- 0:05:07
43700 -- (-2000.772) (-1984.417) [-1989.202] (-1997.332) * (-1992.180) [-1986.335] (-1990.507) (-1998.465) -- 0:05:06
43800 -- (-2001.120) [-1977.573] (-1989.125) (-2000.390) * (-1989.644) [-1981.237] (-1990.156) (-1990.308) -- 0:05:05
43900 -- (-1999.845) [-1978.600] (-1993.542) (-1999.564) * (-1990.238) [-1980.930] (-1990.885) (-1995.189) -- 0:05:04
44000 -- (-1994.140) [-1974.785] (-1986.430) (-2003.225) * (-1988.867) (-1978.518) [-1991.171] (-2006.628) -- 0:05:04
Average standard deviation of split frequencies: 0.014344
44100 -- (-1991.286) [-1978.058] (-1997.013) (-2004.940) * (-1993.973) (-1980.382) [-1986.425] (-1995.912) -- 0:05:03
44200 -- (-1994.107) [-1980.142] (-1991.299) (-1992.867) * (-1994.427) (-1983.379) [-1984.971] (-1996.395) -- 0:05:02
44300 -- (-1997.592) [-1979.725] (-1992.322) (-1994.228) * (-1989.812) [-1985.373] (-1994.755) (-1993.484) -- 0:05:02
44400 -- (-1998.045) (-1985.165) (-1990.082) [-1989.681] * (-1992.355) (-1986.197) (-1988.224) [-1992.423] -- 0:05:01
44500 -- (-1995.442) [-1991.520] (-1985.006) (-1991.717) * (-1993.224) [-1985.299] (-1992.093) (-1996.382) -- 0:05:00
44600 -- [-1993.749] (-2001.923) (-1997.119) (-1992.406) * (-1993.502) (-1984.877) [-1987.087] (-2001.543) -- 0:04:59
44700 -- (-2003.998) (-1996.151) [-1983.956] (-1990.856) * (-1992.477) [-1980.992] (-1980.358) (-1996.605) -- 0:04:59
44800 -- (-1993.592) [-1990.485] (-1991.162) (-1993.489) * (-1993.246) (-1988.018) [-1978.792] (-1997.088) -- 0:05:19
44900 -- (-1987.824) (-1986.943) (-1993.588) [-1993.052] * (-1995.826) [-1986.781] (-1983.561) (-1998.584) -- 0:05:19
45000 -- (-1992.235) (-1988.757) [-1978.101] (-1991.965) * (-1996.746) (-1982.520) [-1981.208] (-2004.098) -- 0:05:18
Average standard deviation of split frequencies: 0.014601
45100 -- (-1995.262) (-1986.517) [-1979.199] (-1992.879) * (-1998.250) (-1983.524) [-1982.681] (-1990.173) -- 0:05:17
45200 -- (-1992.249) (-1981.392) [-1978.577] (-1985.131) * (-1992.437) (-1980.148) (-1985.152) [-1992.331] -- 0:05:16
45300 -- (-1989.843) (-1979.894) [-1978.661] (-1991.807) * (-1984.737) [-1977.218] (-1985.753) (-1989.950) -- 0:05:16
45400 -- (-1990.520) [-1980.164] (-1979.732) (-2009.440) * [-1987.243] (-1978.384) (-1990.713) (-1989.594) -- 0:05:15
45500 -- (-1992.046) (-1990.142) [-1983.084] (-1999.138) * (-1990.238) [-1984.890] (-1992.085) (-1987.215) -- 0:05:14
45600 -- (-1988.302) (-1984.406) [-1981.718] (-1991.251) * (-1996.036) [-1987.974] (-2001.438) (-1989.468) -- 0:05:13
45700 -- [-1993.561] (-1985.996) (-1983.675) (-1989.167) * (-1999.769) (-1991.881) (-1998.584) [-1989.137] -- 0:05:13
45800 -- (-1988.381) (-1991.973) [-1980.055] (-1988.301) * (-2002.294) (-1999.154) [-1997.665] (-1984.605) -- 0:05:12
45900 -- (-1990.482) (-1985.348) [-1980.856] (-1990.156) * (-2000.784) [-1986.703] (-1992.107) (-1986.591) -- 0:05:11
46000 -- [-1984.927] (-1987.952) (-1988.586) (-1998.062) * (-1999.153) [-1991.167] (-1995.836) (-1983.700) -- 0:05:11
Average standard deviation of split frequencies: 0.013722
46100 -- (-1986.478) (-1985.890) [-1986.146] (-2000.547) * (-1998.273) [-1986.393] (-1990.647) (-1982.743) -- 0:05:10
46200 -- (-1984.510) [-1986.539] (-1990.309) (-1997.821) * (-1994.366) (-1983.180) (-1996.738) [-1980.127] -- 0:05:09
46300 -- [-1985.001] (-1986.361) (-1987.916) (-1999.559) * (-1998.884) [-1984.623] (-1996.257) (-1984.057) -- 0:05:08
46400 -- [-1984.597] (-1987.261) (-1985.297) (-1999.323) * (-1998.235) [-1985.274] (-1993.437) (-1987.755) -- 0:05:08
46500 -- (-1997.201) (-1988.487) [-1981.189] (-1993.380) * (-1998.100) [-1987.650] (-1991.033) (-1996.659) -- 0:05:07
46600 -- (-1990.744) (-1998.344) [-1980.865] (-2002.701) * (-1991.795) [-1986.814] (-1997.739) (-1984.138) -- 0:05:06
46700 -- [-1985.375] (-1996.197) (-1984.294) (-1998.863) * (-1993.742) (-1986.691) [-1996.048] (-1987.707) -- 0:05:06
46800 -- (-1984.781) (-1990.515) [-1983.970] (-2001.278) * [-1992.950] (-1984.427) (-1997.489) (-1983.620) -- 0:05:05
46900 -- [-1980.286] (-1988.789) (-1984.786) (-1994.166) * [-1987.096] (-1987.854) (-1987.665) (-1986.944) -- 0:05:04
47000 -- (-1985.082) (-1986.747) [-1980.468] (-1993.162) * [-1985.778] (-2002.280) (-1989.475) (-1985.792) -- 0:05:04
Average standard deviation of split frequencies: 0.012841
47100 -- (-1983.960) (-1987.234) [-1981.418] (-1992.432) * [-1984.527] (-1997.021) (-1997.096) (-1992.054) -- 0:05:03
47200 -- (-1984.901) (-1984.578) [-1982.023] (-1995.774) * (-1986.742) (-2001.288) [-1985.751] (-1987.070) -- 0:05:02
47300 -- (-1985.265) (-1985.715) [-1982.969] (-1997.640) * (-1987.048) (-1996.999) [-1985.664] (-1986.423) -- 0:05:02
47400 -- (-1985.760) (-1985.971) [-1985.231] (-2000.268) * (-1991.329) (-2003.226) (-1984.296) [-1985.693] -- 0:05:01
47500 -- (-1990.523) (-1986.988) [-1982.095] (-2004.400) * (-1989.359) (-2000.138) [-1986.848] (-1992.686) -- 0:05:00
47600 -- (-1985.179) (-1990.694) [-1984.530] (-2003.409) * [-1991.048] (-1998.512) (-1993.985) (-1990.662) -- 0:05:00
47700 -- (-1987.357) (-1989.044) [-1987.625] (-1994.681) * (-1990.090) (-1999.208) (-1992.839) [-1989.346] -- 0:04:59
47800 -- [-1986.904] (-1997.584) (-1995.723) (-1995.709) * [-1990.365] (-1996.710) (-1989.267) (-1988.494) -- 0:04:58
47900 -- [-1982.503] (-2000.565) (-1986.804) (-1996.956) * (-2000.272) (-2006.884) [-1984.327] (-1992.160) -- 0:05:18
48000 -- [-1980.285] (-2009.391) (-1994.885) (-1995.839) * (-1996.401) (-2004.657) [-1979.643] (-1986.290) -- 0:05:17
Average standard deviation of split frequencies: 0.013711
48100 -- [-1984.251] (-2011.865) (-1989.135) (-2004.827) * (-2001.299) (-2015.221) [-1981.169] (-1987.205) -- 0:05:16
48200 -- (-1984.463) (-2015.173) [-1988.411] (-1999.597) * (-1997.885) (-2009.602) (-1981.198) [-1985.003] -- 0:05:15
48300 -- (-1986.353) (-1995.739) [-1998.997] (-2003.466) * (-1999.503) (-2007.844) [-1987.162] (-1985.844) -- 0:05:15
48400 -- (-1987.589) [-1981.367] (-1997.917) (-2001.018) * [-1988.324] (-1998.629) (-1985.757) (-1983.060) -- 0:05:14
48500 -- (-1987.675) [-1987.717] (-1990.856) (-1991.595) * (-1991.442) (-1999.178) (-1990.750) [-1982.173] -- 0:05:13
48600 -- (-1984.126) [-1985.732] (-1988.419) (-1995.086) * (-1992.637) (-1990.085) (-1988.583) [-1979.664] -- 0:05:13
48700 -- [-1984.080] (-1983.948) (-1984.599) (-1999.330) * (-1991.045) (-1992.767) (-1987.644) [-1985.887] -- 0:05:12
48800 -- (-1987.193) (-1984.946) [-1986.580] (-1994.508) * [-1989.835] (-1994.462) (-1986.577) (-1989.405) -- 0:05:11
48900 -- (-1986.974) [-1980.830] (-1985.990) (-1999.542) * (-1986.899) (-1997.923) (-1989.069) [-1985.600] -- 0:05:11
49000 -- (-1989.416) [-1978.984] (-1981.620) (-1995.352) * (-1990.005) (-1997.877) (-1992.048) [-1986.354] -- 0:05:10
Average standard deviation of split frequencies: 0.014783
49100 -- (-1992.967) [-1977.363] (-1983.980) (-1994.725) * (-1995.049) (-1992.102) (-1992.652) [-1987.184] -- 0:05:09
49200 -- (-1991.776) (-1983.469) [-1981.010] (-1991.170) * (-1998.262) (-1991.189) (-1989.027) [-1990.919] -- 0:05:09
49300 -- (-1989.186) [-1983.609] (-1981.710) (-1991.060) * (-1997.539) [-1988.517] (-1987.153) (-1987.659) -- 0:05:08
49400 -- (-2000.832) (-1988.704) [-1987.703] (-1988.936) * (-1996.451) [-1989.042] (-1986.049) (-1985.327) -- 0:05:07
49500 -- (-1998.034) (-1986.406) [-1982.807] (-1990.689) * (-1989.579) (-1994.186) (-1994.600) [-1983.131] -- 0:05:07
49600 -- (-1995.479) (-1988.586) [-1987.559] (-1989.779) * (-1992.145) (-1998.051) [-1987.400] (-1979.589) -- 0:05:06
49700 -- (-2006.524) (-1988.243) [-1976.977] (-1989.078) * (-1988.470) (-1993.088) (-1983.191) [-1984.445] -- 0:05:05
49800 -- (-2005.368) (-1992.480) [-1978.106] (-1985.042) * (-1992.571) (-1997.697) [-1981.759] (-1982.050) -- 0:05:05
49900 -- (-2004.282) (-1992.754) [-1978.379] (-1991.526) * (-1993.616) (-1995.461) [-1985.394] (-1984.094) -- 0:05:04
50000 -- (-1999.194) (-1989.764) [-1978.433] (-1989.544) * (-1991.658) (-2001.642) [-1983.926] (-1983.528) -- 0:05:04
Average standard deviation of split frequencies: 0.015045
50100 -- (-1990.098) (-1985.965) [-1975.311] (-1990.739) * (-1991.475) (-1996.251) (-1980.972) [-1984.773] -- 0:05:03
50200 -- (-1989.187) (-1982.368) (-1979.541) [-1987.442] * (-1998.718) (-1989.271) (-1981.062) [-1984.053] -- 0:05:02
50300 -- [-1982.351] (-1989.000) (-1986.918) (-1991.694) * (-2004.533) (-1992.682) (-1983.489) [-1987.557] -- 0:05:02
50400 -- (-1984.483) (-1988.862) [-1985.867] (-1991.343) * (-1992.592) (-1996.111) [-1980.669] (-1993.656) -- 0:05:01
50500 -- (-1988.696) [-1983.957] (-1985.271) (-1990.781) * (-1993.106) (-1999.585) [-1982.678] (-1990.515) -- 0:05:00
50600 -- (-1981.980) (-1980.041) [-1987.321] (-1994.765) * [-1990.928] (-2008.409) (-1982.086) (-1992.966) -- 0:05:00
50700 -- (-1980.862) [-1980.527] (-1991.060) (-1997.735) * (-1991.248) (-1997.953) [-1983.480] (-1999.431) -- 0:04:59
50800 -- (-1990.497) [-1977.877] (-1990.821) (-1991.792) * (-2001.697) [-1992.551] (-1980.941) (-1997.653) -- 0:04:58
50900 -- (-1986.528) [-1980.614] (-1992.516) (-1995.635) * (-1998.936) (-1989.683) [-1981.941] (-1994.193) -- 0:04:58
51000 -- (-1992.340) (-1989.900) [-1990.474] (-1993.388) * (-2002.017) (-1993.187) [-1982.706] (-1999.076) -- 0:04:57
Average standard deviation of split frequencies: 0.014994
51100 -- [-1981.339] (-1989.282) (-1989.822) (-1995.837) * (-2008.474) (-1990.226) [-1980.359] (-2004.022) -- 0:05:15
51200 -- [-1977.548] (-1991.766) (-1996.297) (-1991.143) * (-1997.230) (-1993.461) [-1980.561] (-1995.202) -- 0:05:15
51300 -- [-1981.081] (-1988.991) (-1993.864) (-1989.353) * (-1997.488) (-1996.017) (-1982.703) [-1992.750] -- 0:05:14
51400 -- [-1981.413] (-1989.327) (-1996.840) (-2002.505) * (-2002.653) (-1996.875) [-1981.353] (-1992.268) -- 0:05:13
51500 -- [-1985.966] (-1991.919) (-1997.126) (-2005.325) * (-2001.023) (-1989.880) [-1982.527] (-1999.699) -- 0:05:13
51600 -- (-1994.297) [-1985.451] (-2002.078) (-1993.845) * (-1992.785) [-1989.698] (-1983.942) (-1987.569) -- 0:05:12
51700 -- (-1996.893) [-1988.395] (-2005.727) (-2000.262) * (-2004.327) (-1990.120) (-1982.540) [-1985.851] -- 0:05:11
51800 -- (-1998.306) [-1982.235] (-1992.579) (-2002.433) * (-1997.825) [-1990.083] (-1988.182) (-1987.357) -- 0:05:11
51900 -- (-1999.085) [-1985.701] (-1983.302) (-1999.380) * (-1997.260) (-1990.827) (-1983.327) [-1981.882] -- 0:05:10
52000 -- (-1990.675) (-1980.004) [-1981.390] (-1996.664) * (-1998.508) (-1998.179) [-1987.230] (-1980.528) -- 0:05:09
Average standard deviation of split frequencies: 0.014209
52100 -- (-1994.034) [-1984.098] (-1982.227) (-1995.043) * (-1995.079) [-1992.914] (-1988.959) (-1983.194) -- 0:05:09
52200 -- (-1998.713) [-1987.559] (-1980.435) (-1986.606) * (-1991.106) (-1999.118) [-1985.142] (-1982.374) -- 0:05:08
52300 -- (-2007.457) (-1990.779) (-1980.626) [-1985.384] * (-1989.920) (-1997.914) [-1980.714] (-1985.441) -- 0:05:08
52400 -- (-1998.903) (-1991.670) [-1977.691] (-1988.666) * (-1998.485) (-2001.800) (-1985.379) [-1987.322] -- 0:05:07
52500 -- (-1999.511) (-2001.338) [-1978.969] (-1987.503) * (-1989.436) (-1995.038) (-1985.867) [-1981.971] -- 0:05:06
52600 -- (-1998.861) (-2002.168) [-1981.443] (-1986.281) * (-1990.975) [-1983.428] (-1986.009) (-1982.819) -- 0:05:06
52700 -- (-1999.461) (-1997.294) [-1980.805] (-1990.868) * (-1986.772) (-1984.237) (-1985.642) [-1984.136] -- 0:05:05
52800 -- (-2004.771) (-1989.794) [-1978.148] (-1996.142) * (-1987.006) (-1986.471) (-1986.030) [-1982.143] -- 0:05:04
52900 -- (-2004.754) (-1999.988) [-1979.666] (-1990.329) * [-1983.734] (-1985.639) (-1989.401) (-1983.863) -- 0:05:04
53000 -- (-2003.694) [-1991.514] (-1987.905) (-1996.085) * (-1986.778) (-1986.647) (-1988.118) [-1982.144] -- 0:05:03
Average standard deviation of split frequencies: 0.014937
53100 -- (-2014.123) (-1983.556) [-1991.594] (-2005.407) * (-1993.450) (-1992.298) [-1988.477] (-1981.854) -- 0:05:03
53200 -- (-2005.150) (-1989.049) (-1985.905) [-1994.669] * (-1990.639) (-1991.982) (-1991.152) [-1982.016] -- 0:05:02
53300 -- (-2004.893) [-1984.888] (-1991.718) (-1992.718) * (-1989.997) (-1994.273) (-1989.108) [-1982.204] -- 0:05:01
53400 -- (-2000.649) (-1982.286) [-1981.282] (-1991.952) * (-2003.951) (-1988.482) [-1990.474] (-1983.623) -- 0:05:01
53500 -- (-2006.986) (-1983.821) [-1990.477] (-1991.225) * (-2009.012) (-1994.267) (-1994.158) [-1982.788] -- 0:05:00
53600 -- (-2006.628) [-1985.555] (-1986.393) (-1993.282) * (-2003.741) (-1987.675) (-1991.293) [-1984.381] -- 0:05:00
53700 -- (-2016.750) (-1987.316) (-1983.308) [-1988.101] * (-2006.887) (-1986.514) (-2001.134) [-1982.630] -- 0:04:59
53800 -- (-1998.725) [-1984.971] (-1981.155) (-1985.521) * (-2007.247) [-1990.495] (-1998.358) (-1980.008) -- 0:04:58
53900 -- (-1997.586) (-1985.710) [-1985.779] (-1990.717) * (-2002.840) (-1990.010) (-1991.501) [-1977.438] -- 0:04:58
54000 -- (-1989.951) (-1980.858) (-1989.013) [-1987.484] * (-2005.640) (-1995.095) (-1997.559) [-1982.777] -- 0:04:57
Average standard deviation of split frequencies: 0.015177
54100 -- (-1990.270) [-1983.567] (-1982.478) (-1993.862) * (-2003.791) (-1990.943) (-1997.761) [-1986.401] -- 0:04:57
54200 -- (-2001.648) (-1989.914) [-1984.361] (-1989.548) * [-1996.919] (-1989.819) (-1993.786) (-1984.604) -- 0:04:56
54300 -- (-1995.529) [-1982.691] (-1985.809) (-1993.618) * (-2010.597) (-1993.340) (-1999.882) [-1983.722] -- 0:05:13
54400 -- (-1990.318) (-1980.599) [-1984.663] (-1997.293) * (-1995.882) (-1996.315) (-1990.673) [-1984.473] -- 0:05:12
54500 -- (-1997.996) [-1984.692] (-1987.019) (-2006.204) * (-1992.876) (-1993.461) [-1992.494] (-1987.015) -- 0:05:12
54600 -- (-1992.201) (-1987.514) [-1982.116] (-1995.505) * (-1994.233) (-1992.754) (-1993.868) [-1983.969] -- 0:05:11
54700 -- (-1994.489) (-1993.184) [-1981.927] (-1999.617) * (-1993.487) (-1996.182) (-1998.254) [-1980.312] -- 0:05:11
54800 -- (-1993.855) (-2001.541) [-1982.640] (-1990.769) * (-1995.876) [-1992.756] (-1992.985) (-1983.895) -- 0:05:10
54900 -- (-1992.119) (-1989.023) [-1987.974] (-1996.131) * (-2001.823) [-1995.598] (-1993.398) (-1992.072) -- 0:05:09
55000 -- (-2010.943) (-1992.944) [-1980.100] (-1991.831) * (-2002.373) (-1993.324) [-1991.798] (-1986.264) -- 0:05:09
Average standard deviation of split frequencies: 0.015616
55100 -- (-2012.117) (-1992.155) [-1979.969] (-1993.909) * (-2006.636) (-1991.244) (-1999.723) [-1986.907] -- 0:05:08
55200 -- (-2001.745) (-1992.958) [-1983.495] (-1991.850) * (-2000.650) [-1987.609] (-1995.808) (-1987.011) -- 0:05:08
55300 -- (-2007.599) [-1991.285] (-1989.362) (-1993.969) * (-2001.674) [-1984.854] (-1999.419) (-1987.440) -- 0:05:07
55400 -- (-2002.966) [-1984.453] (-1987.983) (-1992.819) * (-1998.598) [-1986.742] (-1995.262) (-1987.548) -- 0:05:06
55500 -- (-1987.922) (-1984.580) (-1982.887) [-1987.429] * (-1998.643) [-1987.815] (-1999.291) (-1988.417) -- 0:05:06
55600 -- (-1989.714) (-1985.746) (-1994.466) [-1985.195] * (-2001.008) (-1983.704) (-1999.537) [-1985.773] -- 0:05:05
55700 -- (-1988.497) [-1979.878] (-1993.606) (-1994.773) * (-2006.033) (-1988.789) (-2002.098) [-1980.505] -- 0:05:05
55800 -- (-1986.203) (-1986.290) [-1984.792] (-1994.934) * (-1994.347) (-1986.969) (-1997.897) [-1983.012] -- 0:05:04
55900 -- (-1986.124) [-1982.329] (-1996.115) (-1999.635) * (-1987.645) (-1987.162) (-1989.449) [-1991.461] -- 0:05:04
56000 -- (-1986.334) [-1984.067] (-1993.069) (-1994.820) * (-1992.046) (-1991.522) (-1990.931) [-1982.085] -- 0:05:03
Average standard deviation of split frequencies: 0.016556
56100 -- (-1986.965) [-1981.639] (-1982.554) (-1996.434) * (-1994.680) (-1988.210) (-1994.695) [-1981.798] -- 0:05:02
56200 -- (-1991.454) [-1982.780] (-1981.917) (-1996.247) * (-1990.129) [-1986.445] (-2004.764) (-1986.555) -- 0:05:02
56300 -- (-1989.302) (-1988.029) [-1982.911] (-1989.208) * (-2004.081) [-1986.303] (-2012.407) (-1985.331) -- 0:05:01
56400 -- [-1980.483] (-1985.073) (-1984.426) (-1988.139) * (-2013.705) (-1984.746) (-2010.161) [-1986.654] -- 0:05:01
56500 -- (-1986.702) (-1987.384) (-1985.670) [-1983.857] * (-2004.701) [-1982.854] (-1997.160) (-1990.211) -- 0:05:00
56600 -- (-1989.990) (-1985.320) (-1987.498) [-1986.215] * (-1997.605) [-1986.778] (-1995.329) (-1985.062) -- 0:05:00
56700 -- (-1985.172) (-1989.792) (-1991.370) [-1986.063] * (-2001.562) [-1987.887] (-1992.948) (-1989.059) -- 0:04:59
56800 -- (-1991.866) (-1988.218) (-1998.687) [-1987.401] * (-2000.373) (-1985.929) (-1988.456) [-1981.049] -- 0:04:58
56900 -- (-1992.976) (-1982.008) (-2009.567) [-1987.005] * (-1999.434) (-1986.170) (-1988.311) [-1978.553] -- 0:04:58
57000 -- [-1991.289] (-1984.823) (-1994.932) (-1987.331) * (-1999.391) (-1989.885) (-1989.431) [-1979.795] -- 0:04:57
Average standard deviation of split frequencies: 0.015776
57100 -- (-1998.914) [-1981.416] (-1994.859) (-1987.944) * (-2001.541) (-1996.427) (-1996.317) [-1979.783] -- 0:04:57
57200 -- (-2001.810) (-1985.197) (-1991.320) [-1993.021] * (-1998.079) (-2000.158) (-1991.467) [-1983.607] -- 0:04:56
57300 -- (-1990.373) [-1986.331] (-1986.012) (-1996.367) * (-1993.509) (-1994.347) (-1994.777) [-1984.587] -- 0:04:56
57400 -- (-1994.356) (-1988.448) [-1989.759] (-1986.630) * (-2002.695) [-1991.445] (-1994.342) (-1981.847) -- 0:05:12
57500 -- (-1993.973) (-1984.879) [-1987.277] (-1990.635) * (-1994.581) [-1986.082] (-1994.598) (-1987.961) -- 0:05:11
57600 -- [-1982.239] (-1994.016) (-1990.879) (-1995.375) * (-1997.529) [-1981.857] (-2005.230) (-1984.379) -- 0:05:10
57700 -- (-1981.381) (-1991.251) (-1985.931) [-1992.432] * (-1993.752) (-1985.809) (-1993.684) [-1980.217] -- 0:05:10
57800 -- (-1987.935) (-1998.278) [-1985.539] (-1987.784) * (-2001.008) (-1990.784) (-2001.252) [-1986.613] -- 0:05:09
57900 -- [-1989.470] (-1995.819) (-1984.878) (-1996.635) * (-2001.963) (-1990.187) (-1997.365) [-1986.805] -- 0:05:09
58000 -- (-1984.118) (-1993.643) [-1983.128] (-2002.073) * (-1992.865) [-1988.864] (-2001.954) (-1988.726) -- 0:05:08
Average standard deviation of split frequencies: 0.014365
58100 -- [-1980.029] (-1987.601) (-1985.067) (-1995.840) * [-1984.426] (-1989.583) (-2003.418) (-1989.402) -- 0:05:08
58200 -- [-1982.113] (-1986.198) (-1984.953) (-1987.831) * [-1985.445] (-1998.010) (-1994.793) (-1984.888) -- 0:05:07
58300 -- (-1981.000) [-1991.422] (-1991.962) (-1995.534) * [-1987.782] (-1989.398) (-1989.811) (-1987.298) -- 0:05:06
58400 -- [-1981.735] (-1993.713) (-1988.325) (-1988.770) * (-1986.959) [-1986.627] (-1997.657) (-1997.746) -- 0:05:06
58500 -- [-1983.896] (-1992.727) (-1994.854) (-1990.254) * (-1985.255) (-1988.199) [-1991.795] (-1996.940) -- 0:05:05
58600 -- (-1983.996) [-1988.928] (-1984.900) (-1990.062) * (-1982.010) [-1985.921] (-1995.144) (-1991.301) -- 0:05:05
58700 -- (-1988.416) [-1985.552] (-1987.872) (-1991.662) * [-1985.070] (-1988.524) (-1988.007) (-1997.017) -- 0:05:04
58800 -- (-1988.362) (-1988.844) [-1985.679] (-1991.947) * [-1993.436] (-1988.205) (-1992.169) (-1999.060) -- 0:05:04
58900 -- (-1996.070) (-1988.019) [-1987.327] (-1992.518) * [-1995.375] (-1987.660) (-1985.646) (-1999.036) -- 0:05:03
59000 -- (-2001.662) (-1991.058) (-1985.664) [-1989.989] * [-1992.149] (-1990.139) (-1987.293) (-1994.457) -- 0:05:03
Average standard deviation of split frequencies: 0.014788
59100 -- (-1996.728) [-1987.018] (-1993.738) (-1990.805) * (-1991.418) [-1989.351] (-1993.624) (-1990.283) -- 0:05:02
59200 -- (-1999.539) (-1988.795) [-1993.022] (-1990.170) * (-1995.401) [-1988.349] (-1995.590) (-1981.797) -- 0:05:01
59300 -- (-2003.287) (-1989.240) (-1988.786) [-1986.897] * (-1994.412) (-1989.813) (-1990.578) [-1984.838] -- 0:05:01
59400 -- (-1993.168) (-1995.737) [-1982.058] (-1987.344) * (-1999.355) (-1989.695) (-1994.103) [-1982.067] -- 0:05:00
59500 -- [-1983.279] (-1999.637) (-1988.460) (-1991.020) * (-1995.902) (-1988.243) (-1996.739) [-1979.245] -- 0:05:00
59600 -- [-1982.446] (-1994.380) (-1985.498) (-1996.889) * (-2000.070) (-1988.035) (-1987.417) [-1983.308] -- 0:04:59
59700 -- [-1983.845] (-1992.871) (-1993.250) (-1992.405) * (-1995.551) [-1994.269] (-1998.580) (-1987.297) -- 0:04:59
59800 -- [-1983.981] (-1994.107) (-1995.882) (-1992.374) * (-1991.501) (-1992.293) (-1995.188) [-1985.775] -- 0:04:58
59900 -- [-1982.712] (-1996.141) (-1994.087) (-1994.033) * (-1987.672) (-2000.192) (-1997.960) [-1979.077] -- 0:04:58
60000 -- (-1994.882) (-1991.120) (-1996.931) [-1990.932] * [-1984.452] (-1999.811) (-2000.081) (-1987.287) -- 0:04:57
Average standard deviation of split frequencies: 0.015231
60100 -- [-1987.165] (-1991.038) (-2001.598) (-1998.133) * [-1983.658] (-1989.928) (-1994.598) (-1998.663) -- 0:04:57
60200 -- [-1978.776] (-1992.182) (-1993.679) (-2008.261) * (-1986.793) [-1992.242] (-1996.541) (-1995.490) -- 0:04:56
60300 -- [-1978.301] (-1990.955) (-1992.787) (-2003.926) * (-1989.773) [-1991.537] (-1997.598) (-2001.601) -- 0:04:56
60400 -- [-1977.022] (-1990.827) (-1990.165) (-1993.895) * [-1987.437] (-1989.921) (-2002.572) (-1998.467) -- 0:04:55
60500 -- [-1987.188] (-1990.544) (-1992.789) (-1997.676) * [-1992.239] (-1991.115) (-1991.358) (-2000.526) -- 0:04:55
60600 -- [-1986.134] (-1988.548) (-1993.098) (-1999.082) * [-1989.905] (-1990.349) (-1991.422) (-1999.975) -- 0:05:10
60700 -- [-1983.304] (-1988.615) (-1999.054) (-1992.530) * (-1985.833) (-1991.110) [-1991.977] (-1994.035) -- 0:05:09
60800 -- [-1980.586] (-1988.997) (-2000.522) (-1990.378) * [-1991.141] (-1989.677) (-1990.592) (-1997.623) -- 0:05:08
60900 -- (-1983.034) [-1986.242] (-2006.770) (-1990.202) * (-1989.430) (-1991.916) [-1988.436] (-1995.661) -- 0:05:08
61000 -- (-1985.435) [-1985.861] (-1994.077) (-1986.263) * [-1986.960] (-1991.454) (-1994.543) (-1988.192) -- 0:05:07
Average standard deviation of split frequencies: 0.015405
61100 -- (-1989.022) [-1986.721] (-1995.699) (-1988.091) * (-1986.746) (-1993.670) (-1995.274) [-1990.696] -- 0:05:07
61200 -- [-1988.723] (-1993.980) (-1986.732) (-1993.357) * [-1979.094] (-1991.982) (-1995.640) (-1992.628) -- 0:05:06
61300 -- (-1988.615) (-1991.062) [-1990.490] (-1999.702) * [-1986.205] (-1993.093) (-1990.564) (-1993.821) -- 0:05:06
61400 -- [-1986.274] (-1993.575) (-2002.104) (-1989.476) * [-1984.084] (-2001.519) (-1991.181) (-1994.013) -- 0:05:05
61500 -- (-1988.833) (-1991.565) [-1988.244] (-1993.338) * [-1981.745] (-2001.110) (-1990.274) (-1994.050) -- 0:05:05
61600 -- [-1987.206] (-1993.673) (-1996.335) (-1997.065) * [-1979.078] (-1995.667) (-1990.004) (-1988.753) -- 0:05:04
61700 -- [-1984.620] (-2003.151) (-1994.493) (-1990.663) * (-1981.156) [-1992.667] (-1998.952) (-1981.621) -- 0:05:04
61800 -- (-1990.294) (-1992.429) [-1990.170] (-1991.077) * (-1982.590) (-2003.105) (-2002.196) [-1977.975] -- 0:05:03
61900 -- [-1990.255] (-2002.769) (-1990.736) (-1989.102) * [-1982.008] (-1997.717) (-1994.029) (-1986.061) -- 0:05:03
62000 -- (-1988.358) (-2001.899) (-1992.574) [-1983.794] * (-1986.281) (-1997.836) (-1994.324) [-1982.497] -- 0:05:02
Average standard deviation of split frequencies: 0.015174
62100 -- [-1986.928] (-1999.978) (-1991.313) (-1979.878) * (-1984.795) (-1997.856) (-1998.992) [-1986.427] -- 0:05:02
62200 -- (-1991.553) (-2001.679) (-1995.781) [-1986.220] * (-1978.963) (-1989.112) (-1986.424) [-1984.925] -- 0:05:01
62300 -- [-1985.399] (-1986.275) (-2000.758) (-1990.443) * (-1986.890) (-1991.849) (-1992.626) [-1993.515] -- 0:05:01
62400 -- [-1980.288] (-1993.547) (-1996.347) (-1989.530) * (-1983.688) (-1998.039) (-1993.839) [-1986.380] -- 0:05:00
62500 -- [-1980.706] (-1995.109) (-2001.804) (-1988.221) * [-1984.118] (-1993.735) (-1993.348) (-1985.162) -- 0:05:00
62600 -- (-1984.339) (-1994.708) (-1990.493) [-1987.207] * [-1984.027] (-1988.868) (-1998.469) (-1984.257) -- 0:04:59
62700 -- [-1979.882] (-1993.154) (-1995.393) (-1989.624) * (-1988.641) [-1993.752] (-2000.394) (-1988.763) -- 0:04:58
62800 -- [-1980.362] (-1989.490) (-1994.175) (-1983.806) * [-1985.759] (-1994.632) (-1993.850) (-1995.389) -- 0:04:58
62900 -- [-1984.655] (-1988.438) (-1991.900) (-1982.112) * (-1985.192) (-2000.008) [-1988.062] (-1989.631) -- 0:04:57
63000 -- (-1988.344) (-1991.270) (-2000.963) [-1984.321] * [-1982.823] (-2002.784) (-1988.153) (-1992.170) -- 0:04:57
Average standard deviation of split frequencies: 0.014279
63100 -- [-1982.404] (-1991.407) (-1993.325) (-1992.802) * (-1984.669) (-2007.459) (-1984.476) [-1982.970] -- 0:04:56
63200 -- [-1983.219] (-1993.720) (-1994.840) (-1986.884) * (-1989.479) (-2007.007) (-1989.089) [-1986.561] -- 0:04:56
63300 -- [-1980.773] (-1994.645) (-1997.249) (-1989.452) * (-1987.727) (-2003.942) [-1987.515] (-1987.555) -- 0:04:55
63400 -- (-1986.045) (-1998.583) (-1996.551) [-1984.772] * [-1986.302] (-2001.555) (-1993.212) (-1993.941) -- 0:04:55
63500 -- (-1987.849) (-2002.069) (-1993.547) [-1980.071] * [-1984.050] (-2007.946) (-1984.456) (-1993.893) -- 0:04:54
63600 -- (-1983.442) (-2002.560) (-1995.462) [-1982.927] * [-1980.119] (-2007.978) (-1984.875) (-1992.190) -- 0:04:54
63700 -- [-1986.751] (-2002.193) (-1994.706) (-1990.543) * [-1982.520] (-1992.761) (-1988.149) (-1992.061) -- 0:04:53
63800 -- (-1987.400) (-2001.980) (-1994.663) [-1980.898] * (-1993.737) (-1994.745) [-1986.976] (-1997.041) -- 0:05:08
63900 -- (-1989.807) (-2003.923) [-1990.160] (-1983.184) * (-1989.649) (-1995.415) (-1988.472) [-1987.426] -- 0:05:07
64000 -- [-1989.027] (-2007.867) (-1988.751) (-1983.761) * [-1985.508] (-1997.271) (-1995.958) (-1981.909) -- 0:05:07
Average standard deviation of split frequencies: 0.015331
64100 -- (-1989.645) (-1998.260) (-1994.631) [-1984.202] * (-1985.183) (-1994.970) (-1992.843) [-1984.677] -- 0:05:06
64200 -- (-1987.359) (-1996.637) (-2004.732) [-1984.527] * [-1979.396] (-1991.348) (-1994.590) (-1989.363) -- 0:05:06
64300 -- [-1989.209] (-1994.219) (-1996.560) (-1984.479) * [-1981.489] (-1992.106) (-1998.095) (-1987.894) -- 0:05:05
64400 -- [-1987.638] (-1996.533) (-1990.415) (-1984.671) * [-1987.177] (-1994.303) (-1996.360) (-1994.572) -- 0:05:05
64500 -- (-1989.932) (-1997.068) (-1991.220) [-1983.495] * [-1981.376] (-1994.121) (-1997.896) (-1991.254) -- 0:05:04
64600 -- (-1983.348) (-2002.684) [-1991.274] (-1984.206) * (-1984.736) [-1993.636] (-1996.072) (-2003.102) -- 0:05:04
64700 -- (-1980.162) (-2005.317) (-1998.543) [-1993.015] * (-1990.236) (-1992.318) (-1990.622) [-1996.033] -- 0:05:03
64800 -- [-1981.742] (-2002.352) (-1992.681) (-1993.230) * [-1984.447] (-1999.933) (-1985.202) (-1992.198) -- 0:05:03
64900 -- [-1981.802] (-1999.563) (-1997.771) (-1985.656) * (-1984.781) (-1996.065) [-1986.317] (-1990.738) -- 0:05:02
65000 -- [-1982.643] (-2004.274) (-1993.305) (-1982.644) * (-1983.618) (-1993.284) [-1982.073] (-1983.422) -- 0:05:02
Average standard deviation of split frequencies: 0.015080
65100 -- [-1982.154] (-1998.195) (-1997.162) (-1981.168) * (-1992.770) (-1995.232) [-1987.037] (-1980.277) -- 0:05:01
65200 -- [-1984.451] (-2002.114) (-2000.966) (-1992.931) * (-1980.000) (-2009.669) [-1986.939] (-1983.215) -- 0:05:01
65300 -- [-1981.391] (-1997.441) (-2001.512) (-1992.541) * (-1987.605) (-2007.023) (-1990.959) [-1983.071] -- 0:05:00
65400 -- [-1977.158] (-1992.474) (-1997.805) (-1990.269) * (-1990.311) (-2001.088) (-1988.906) [-1982.875] -- 0:05:00
65500 -- [-1985.198] (-1992.862) (-2002.125) (-1996.145) * (-1991.161) (-2001.489) (-1991.145) [-1979.021] -- 0:04:59
65600 -- (-1984.000) [-1991.459] (-2001.963) (-1993.438) * (-1985.008) (-1990.941) (-1989.441) [-1978.701] -- 0:04:59
65700 -- [-1983.955] (-1993.236) (-1992.131) (-1992.838) * [-1985.262] (-1996.998) (-1992.568) (-1983.635) -- 0:04:58
65800 -- [-1990.336] (-1993.248) (-1990.718) (-1990.604) * (-1990.653) (-2003.818) (-1996.048) [-1981.686] -- 0:04:58
65900 -- (-1990.953) (-1998.068) [-1988.566] (-1996.584) * (-1990.661) (-2004.520) (-1998.900) [-1983.073] -- 0:04:57
66000 -- [-1991.084] (-2004.074) (-1991.479) (-1994.072) * (-1989.106) (-1996.526) (-2004.016) [-1979.759] -- 0:04:57
Average standard deviation of split frequencies: 0.015682
66100 -- [-1992.173] (-1993.902) (-1993.928) (-1994.093) * (-1989.062) (-1995.058) (-1995.813) [-1984.049] -- 0:04:56
66200 -- (-1988.356) (-1998.584) [-1989.626] (-2000.396) * [-1990.379] (-1991.607) (-2002.897) (-1994.828) -- 0:04:56
66300 -- [-1986.853] (-1995.203) (-1986.227) (-2016.108) * [-1988.867] (-1991.693) (-2009.707) (-1987.546) -- 0:04:55
66400 -- (-1986.044) (-1994.069) [-1989.670] (-1997.376) * [-1984.261] (-1990.052) (-2003.273) (-1987.520) -- 0:04:55
66500 -- (-1980.641) (-1994.516) [-1990.213] (-1998.853) * (-1986.466) (-1992.895) (-1990.883) [-1984.739] -- 0:04:54
66600 -- [-1982.541] (-1988.753) (-1990.479) (-1986.003) * (-1992.036) (-1984.666) (-1993.344) [-1984.594] -- 0:04:54
66700 -- (-1982.322) (-1987.809) (-1989.789) [-1987.003] * (-1984.894) (-1986.429) (-1993.909) [-1981.281] -- 0:04:53
66800 -- [-1981.563] (-1987.923) (-1991.731) (-1983.854) * (-1978.496) [-1987.083] (-1996.863) (-1986.217) -- 0:04:53
66900 -- (-1988.829) (-1996.249) (-1995.355) [-1982.865] * (-1988.436) (-1985.344) (-1993.155) [-1982.070] -- 0:05:06
67000 -- (-1991.472) (-1990.683) (-1998.372) [-1987.493] * (-1988.252) (-1984.758) (-1994.905) [-1980.640] -- 0:05:06
Average standard deviation of split frequencies: 0.012627
67100 -- [-1982.536] (-2002.975) (-1992.808) (-1986.344) * (-1992.648) (-1985.610) (-1998.114) [-1980.476] -- 0:05:05
67200 -- [-1986.096] (-1998.969) (-1991.316) (-1985.827) * (-1989.211) (-1981.200) (-2002.721) [-1983.646] -- 0:05:05
67300 -- (-1986.558) (-1999.521) (-1995.074) [-1982.634] * [-1988.247] (-1984.483) (-1998.155) (-1982.354) -- 0:05:04
67400 -- (-1983.982) [-1990.021] (-1998.545) (-1985.848) * (-1991.716) (-1989.255) (-2000.949) [-1980.010] -- 0:05:04
67500 -- [-1979.260] (-1995.687) (-1995.142) (-1981.567) * (-1988.855) (-1992.853) (-1994.645) [-1980.587] -- 0:05:03
67600 -- (-1982.091) (-1988.569) (-1989.029) [-1980.995] * (-1991.814) [-1987.680] (-2004.709) (-1980.154) -- 0:05:03
67700 -- (-1983.923) (-1988.692) (-1988.365) [-1983.454] * (-1990.448) (-1987.389) (-1994.626) [-1980.321] -- 0:05:02
67800 -- (-1989.443) (-1988.870) (-1990.363) [-1983.855] * (-1994.223) (-1987.884) (-1990.853) [-1984.206] -- 0:05:02
67900 -- (-1985.904) (-1993.547) (-1991.999) [-1983.797] * (-1989.294) (-1985.628) (-1988.576) [-1983.378] -- 0:05:02
68000 -- [-1984.801] (-1996.607) (-1998.631) (-1985.158) * (-1985.239) (-1983.906) (-1994.955) [-1981.255] -- 0:05:01
Average standard deviation of split frequencies: 0.012059
68100 -- [-1982.755] (-1997.983) (-2001.687) (-1988.375) * (-1990.443) [-1988.320] (-1995.191) (-1981.933) -- 0:05:01
68200 -- [-1984.219] (-1999.416) (-1994.388) (-1991.103) * (-1985.990) (-1986.327) (-2010.443) [-1982.440] -- 0:05:00
68300 -- (-1986.229) [-1996.659] (-1994.672) (-1989.162) * (-1988.438) [-1983.700] (-2000.315) (-1987.404) -- 0:05:00
68400 -- [-1984.501] (-1999.186) (-1998.422) (-1992.913) * (-1985.789) [-1978.898] (-2001.384) (-1985.867) -- 0:04:59
68500 -- [-1985.761] (-1995.777) (-1989.724) (-1989.802) * (-1992.434) (-1985.757) (-1994.483) [-1988.323] -- 0:04:59
68600 -- (-1989.616) (-2003.309) (-2003.922) [-1984.736] * (-1998.064) (-1981.202) (-1994.851) [-1991.201] -- 0:04:58
68700 -- (-1992.344) (-2002.234) (-2006.240) [-1981.911] * (-1989.651) (-1988.431) [-1989.424] (-1991.032) -- 0:04:58
68800 -- (-1991.574) (-2009.839) (-2004.101) [-1985.384] * (-1990.881) [-1987.175] (-1993.464) (-1995.272) -- 0:04:57
68900 -- [-1992.252] (-2006.962) (-1998.524) (-1983.570) * (-1988.659) (-1991.778) (-1993.418) [-1985.042] -- 0:04:57
69000 -- (-1988.872) (-2007.909) (-2008.697) [-1981.015] * (-1996.768) (-1985.538) [-1983.908] (-1983.189) -- 0:04:56
Average standard deviation of split frequencies: 0.012457
69100 -- [-1986.361] (-1998.723) (-2006.636) (-1982.101) * (-1992.845) (-1986.972) (-1994.059) [-1985.876] -- 0:04:56
69200 -- (-1985.050) (-1994.319) (-2008.888) [-1982.855] * (-1990.886) (-1995.008) [-1994.198] (-1984.792) -- 0:04:55
69300 -- [-1984.797] (-1995.430) (-1997.029) (-1997.576) * (-1992.591) [-1979.955] (-1991.279) (-1989.618) -- 0:04:55
69400 -- [-1984.438] (-1993.596) (-2002.309) (-1992.489) * (-1987.920) [-1978.305] (-1990.178) (-1990.697) -- 0:04:55
69500 -- [-1980.488] (-1991.343) (-2000.639) (-1989.972) * (-1995.606) [-1982.986] (-2001.085) (-1985.433) -- 0:04:54
69600 -- (-1984.199) (-2005.828) (-1997.217) [-1984.161] * (-1998.533) (-1996.707) (-1997.306) [-1980.667] -- 0:04:54
69700 -- (-1988.647) (-2001.954) (-1996.571) [-1984.690] * (-1993.364) (-1992.124) (-1993.125) [-1983.647] -- 0:04:53
69800 -- [-1982.564] (-1996.563) (-1994.015) (-1984.422) * (-2002.741) (-1994.395) (-1992.546) [-1978.061] -- 0:04:53
69900 -- [-1983.717] (-2000.723) (-1989.720) (-1985.452) * (-2006.903) (-1989.243) (-1993.538) [-1980.985] -- 0:04:52
70000 -- [-1981.463] (-1995.078) (-1987.492) (-1985.829) * (-1995.602) [-1989.872] (-1988.401) (-1980.309) -- 0:04:52
Average standard deviation of split frequencies: 0.011139
70100 -- [-1983.209] (-2003.751) (-1987.219) (-1991.789) * (-1997.075) (-1988.721) (-1983.578) [-1978.566] -- 0:05:05
70200 -- [-1982.519] (-2006.327) (-1987.871) (-1997.518) * (-1993.710) [-1993.179] (-1990.134) (-1980.676) -- 0:05:04
70300 -- (-1984.182) (-1998.970) [-1991.856] (-1991.349) * (-1988.952) (-1990.285) (-1990.288) [-1982.550] -- 0:05:04
70400 -- [-1983.425] (-1993.047) (-2000.225) (-2001.085) * [-1983.951] (-1980.943) (-1994.241) (-1980.345) -- 0:05:03
70500 -- [-1980.705] (-1989.654) (-1994.527) (-2004.404) * (-1985.113) [-1979.888] (-1994.581) (-1979.080) -- 0:05:03
70600 -- (-1985.238) [-1990.447] (-1992.163) (-1995.667) * (-1981.213) [-1980.431] (-1989.423) (-1982.619) -- 0:05:02
70700 -- (-1984.271) (-1988.764) (-1999.764) [-1996.492] * (-1986.725) [-1982.615] (-1992.954) (-1983.092) -- 0:05:02
70800 -- (-1983.143) [-1990.055] (-2006.112) (-1998.962) * [-1986.208] (-1977.711) (-1996.273) (-1986.555) -- 0:05:01
70900 -- [-1984.715] (-1988.132) (-1998.458) (-1991.618) * (-1987.200) [-1976.975] (-1993.037) (-1992.488) -- 0:05:01
71000 -- [-1980.054] (-1991.865) (-2003.043) (-1988.459) * (-1981.813) [-1980.092] (-1990.340) (-1993.427) -- 0:05:00
Average standard deviation of split frequencies: 0.012107
71100 -- [-1980.693] (-1990.390) (-2002.687) (-1992.493) * [-1984.845] (-1982.465) (-1996.869) (-1991.997) -- 0:05:00
71200 -- [-1979.478] (-1992.530) (-1994.863) (-1984.941) * (-1986.111) [-1981.376] (-1993.750) (-1990.663) -- 0:05:00
71300 -- [-1982.925] (-1996.154) (-1993.627) (-1980.884) * (-1985.819) [-1980.627] (-1992.311) (-1994.254) -- 0:04:59
71400 -- [-1985.048] (-1993.888) (-1991.322) (-1977.797) * (-1986.434) [-1978.171] (-1997.051) (-1994.349) -- 0:04:59
71500 -- [-1984.675] (-1995.205) (-1990.603) (-1982.359) * (-1985.307) (-1981.593) [-1989.630] (-1992.802) -- 0:04:58
71600 -- [-1984.948] (-1990.107) (-1989.416) (-1984.811) * (-1989.782) [-1976.984] (-1987.372) (-2000.748) -- 0:04:58
71700 -- (-1988.075) (-1994.292) (-1993.114) [-1986.427] * (-1999.785) (-1984.402) [-1981.681] (-1991.790) -- 0:04:57
71800 -- (-1988.476) (-1990.590) (-1993.335) [-1982.833] * (-1990.558) (-1979.492) [-1988.631] (-2000.152) -- 0:04:57
71900 -- [-1987.724] (-1990.752) (-1996.289) (-1983.915) * (-1991.520) [-1978.582] (-1986.780) (-1993.375) -- 0:04:56
72000 -- (-1987.403) (-1992.808) (-1986.809) [-1985.949] * (-1994.657) [-1985.909] (-1985.487) (-2004.847) -- 0:04:56
Average standard deviation of split frequencies: 0.010643
72100 -- (-1983.236) (-1990.452) (-1989.645) [-1984.095] * (-1997.758) [-1985.348] (-1992.941) (-1991.662) -- 0:04:56
72200 -- (-1990.035) (-1988.113) [-1989.195] (-1988.513) * (-2005.836) (-1982.037) (-1984.170) [-1988.559] -- 0:04:55
72300 -- [-1983.605] (-1987.486) (-1990.804) (-1985.593) * (-2001.504) (-1978.924) [-1986.250] (-1991.864) -- 0:04:55
72400 -- (-1991.557) (-1994.161) [-1984.869] (-1988.828) * (-2006.112) [-1979.360] (-1995.176) (-1992.966) -- 0:04:54
72500 -- (-1985.794) (-2001.505) [-1990.379] (-1999.434) * (-1986.367) [-1976.819] (-1994.710) (-1993.096) -- 0:04:54
72600 -- [-1989.083] (-1991.598) (-1994.726) (-1990.594) * (-1990.934) [-1979.078] (-1989.932) (-1988.877) -- 0:04:53
72700 -- [-1989.245] (-1989.419) (-1993.940) (-1986.343) * (-1986.388) [-1981.711] (-1996.415) (-1991.851) -- 0:04:53
72800 -- (-1990.154) (-1992.081) (-1996.656) [-1986.737] * (-1995.348) [-1979.285] (-1995.395) (-1987.146) -- 0:04:52
72900 -- (-1982.493) (-1995.747) (-1996.243) [-1993.485] * (-1994.279) (-1988.971) (-1997.778) [-1983.026] -- 0:04:52
73000 -- (-1991.492) (-1996.068) [-1994.186] (-1990.498) * (-1993.875) (-1997.230) (-1999.685) [-1987.195] -- 0:04:52
Average standard deviation of split frequencies: 0.010488
73100 -- (-1985.033) (-1985.141) (-2003.677) [-1982.078] * [-1989.076] (-1996.435) (-1996.392) (-1992.399) -- 0:04:51
73200 -- [-1984.435] (-1990.423) (-1994.627) (-1989.300) * (-1992.374) [-1992.825] (-1999.296) (-1994.710) -- 0:05:03
73300 -- [-1984.771] (-1988.785) (-1994.185) (-1990.296) * [-1988.372] (-1992.290) (-2008.691) (-1990.644) -- 0:05:03
73400 -- [-1977.724] (-1993.903) (-1992.344) (-1984.761) * [-1984.126] (-1997.514) (-2005.999) (-1989.425) -- 0:05:02
73500 -- [-1976.939] (-1989.243) (-2001.201) (-1986.127) * [-1983.610] (-1989.888) (-2002.150) (-1987.913) -- 0:05:02
73600 -- (-1979.890) [-1987.932] (-1994.242) (-1986.432) * [-1985.228] (-1994.828) (-1991.739) (-1985.057) -- 0:05:02
73700 -- (-1979.128) [-1984.173] (-2007.247) (-1987.393) * (-1988.549) (-1988.380) [-1990.740] (-1995.738) -- 0:05:01
73800 -- (-1979.973) [-1989.143] (-1988.763) (-1988.624) * [-1985.633] (-1993.428) (-1986.122) (-1994.009) -- 0:05:01
73900 -- (-1979.943) [-1986.659] (-1984.512) (-1988.556) * (-1984.331) (-1998.737) (-1987.093) [-1988.514] -- 0:05:00
74000 -- [-1980.423] (-1992.764) (-1984.693) (-1991.178) * [-1984.490] (-1994.502) (-1991.367) (-1991.428) -- 0:05:00
Average standard deviation of split frequencies: 0.009811
74100 -- (-1982.955) (-1993.277) [-1981.890] (-1991.499) * (-1985.268) (-1989.029) (-1994.835) [-1988.927] -- 0:04:59
74200 -- (-1994.442) (-1996.958) [-1985.999] (-1989.651) * [-1979.203] (-1989.046) (-1992.348) (-1993.580) -- 0:04:59
74300 -- (-1992.065) (-1998.827) [-1980.974] (-1989.570) * (-1980.876) [-1983.494] (-1987.633) (-1999.407) -- 0:04:59
74400 -- [-1990.915] (-1993.706) (-1984.488) (-1990.231) * (-1980.514) [-1986.667] (-1988.471) (-2003.856) -- 0:04:58
74500 -- [-1986.581] (-1990.191) (-1986.585) (-1987.941) * [-1979.798] (-1987.894) (-1989.953) (-1999.929) -- 0:04:58
74600 -- (-1985.523) [-1986.778] (-1988.864) (-2000.895) * [-1979.352] (-1988.483) (-1990.541) (-2006.923) -- 0:04:57
74700 -- (-1991.923) [-1986.215] (-1988.783) (-2000.485) * [-1984.313] (-1982.985) (-1997.741) (-2006.706) -- 0:04:57
74800 -- (-1998.926) (-1987.120) [-1997.001] (-1991.049) * [-1978.172] (-1986.395) (-1988.909) (-2007.135) -- 0:04:56
74900 -- (-1992.677) [-1984.124] (-1994.982) (-1988.673) * [-1977.237] (-1985.291) (-1991.733) (-1998.656) -- 0:04:56
75000 -- (-1993.489) (-1991.768) (-1993.286) [-1983.793] * [-1979.033] (-1984.201) (-1991.873) (-2003.086) -- 0:04:56
Average standard deviation of split frequencies: 0.008418
75100 -- (-2000.145) (-1986.157) (-1992.609) [-1985.754] * (-1979.769) [-1979.826] (-2001.868) (-2004.422) -- 0:04:55
75200 -- (-2004.971) [-1990.073] (-1992.692) (-1986.568) * [-1984.733] (-1983.465) (-1991.230) (-1998.762) -- 0:04:55
75300 -- (-1998.967) (-1993.719) (-1988.983) [-1984.642] * [-1981.358] (-1988.636) (-2000.158) (-1988.712) -- 0:04:54
75400 -- (-1985.351) (-1991.378) [-1986.330] (-1988.361) * [-1982.928] (-2001.673) (-1990.626) (-1986.864) -- 0:04:54
75500 -- [-1987.500] (-1993.545) (-1989.368) (-1986.200) * (-2005.380) (-1994.962) (-1988.945) [-1989.813] -- 0:04:53
75600 -- (-1987.455) (-1992.615) (-1986.973) [-1982.040] * (-1994.037) (-1995.998) (-1990.171) [-1989.345] -- 0:04:53
75700 -- (-1988.937) (-1985.960) (-1987.178) [-1988.434] * (-1996.336) (-1999.085) (-1993.939) [-1987.939] -- 0:04:53
75800 -- (-1994.109) (-1987.568) (-1983.887) [-1987.722] * [-1995.483] (-1993.970) (-1995.102) (-1988.088) -- 0:04:52
75900 -- (-1997.767) (-1992.416) (-1987.431) [-1986.279] * [-1993.112] (-1995.170) (-1996.104) (-1990.219) -- 0:04:52
76000 -- (-1999.895) (-1994.303) (-1986.997) [-1988.402] * (-1992.225) [-1995.384] (-1994.995) (-1994.254) -- 0:04:51
Average standard deviation of split frequencies: 0.009730
76100 -- (-1995.732) (-1998.441) [-1983.854] (-1999.777) * (-1998.440) (-1997.607) [-1990.572] (-1989.925) -- 0:04:51
76200 -- (-1992.928) (-1989.585) (-1985.028) [-1989.410] * (-2003.239) (-1994.765) (-1995.911) [-1990.921] -- 0:04:50
76300 -- (-2003.485) (-1989.892) [-1989.070] (-1988.847) * (-1997.487) [-1985.932] (-1990.857) (-2001.913) -- 0:04:50
76400 -- (-1997.443) [-1989.862] (-1986.353) (-1991.123) * (-1993.096) [-1980.494] (-1988.939) (-1993.138) -- 0:05:02
76500 -- (-1997.662) [-1989.946] (-1985.176) (-1993.718) * (-1994.674) [-1978.444] (-1988.275) (-1992.516) -- 0:05:01
76600 -- (-2008.296) [-1985.657] (-1985.179) (-1989.571) * (-1995.085) (-1982.505) [-1981.090] (-1989.529) -- 0:05:01
76700 -- (-1994.343) [-1990.221] (-1986.020) (-1996.649) * (-1987.646) [-1983.049] (-1981.887) (-1992.781) -- 0:05:00
76800 -- (-1984.770) [-1986.216] (-1994.764) (-1996.606) * (-1991.219) (-1980.789) [-1980.646] (-1986.665) -- 0:05:00
76900 -- (-1984.213) [-1988.055] (-1987.892) (-1989.345) * (-1986.594) [-1983.044] (-1982.730) (-1993.190) -- 0:05:00
77000 -- (-1987.517) (-1986.122) (-1990.445) [-1982.959] * (-1993.675) (-1984.954) [-1979.194] (-2007.114) -- 0:04:59
Average standard deviation of split frequencies: 0.008723
77100 -- (-1994.744) (-1986.889) (-1985.293) [-1980.102] * (-1996.710) (-1987.645) [-1981.122] (-1999.897) -- 0:04:59
77200 -- (-1989.813) [-1986.706] (-1994.523) (-1981.263) * (-1997.621) [-1988.732] (-1986.728) (-2000.681) -- 0:04:58
77300 -- (-1991.981) (-1990.194) (-2009.510) [-1984.647] * [-1989.044] (-1984.464) (-1985.248) (-1996.272) -- 0:04:58
77400 -- (-1995.769) [-1984.808] (-2007.718) (-1986.171) * (-1988.785) [-1981.464] (-1992.424) (-1994.159) -- 0:04:57
77500 -- (-1990.185) (-1985.440) (-1999.794) [-1988.288] * (-1994.364) [-1983.976] (-1987.385) (-1992.672) -- 0:04:57
77600 -- (-1985.875) (-1987.511) (-2008.559) [-1983.910] * [-1987.007] (-1986.392) (-1990.436) (-1996.921) -- 0:04:57
77700 -- (-1994.552) (-1987.287) (-2006.480) [-1983.015] * (-1985.879) (-1986.464) (-1990.121) [-1989.567] -- 0:04:56
77800 -- (-1986.823) (-1990.483) (-2007.124) [-1984.677] * (-1982.538) (-1999.482) (-1990.884) [-1981.693] -- 0:04:56
77900 -- (-1996.491) [-1986.904] (-2004.169) (-1982.965) * (-1982.816) (-1992.065) (-1989.144) [-1981.296] -- 0:04:55
78000 -- (-1992.644) (-1990.402) (-1991.877) [-1985.095] * [-1982.591] (-2002.304) (-1984.836) (-1980.705) -- 0:04:55
Average standard deviation of split frequencies: 0.009136
78100 -- (-2001.965) (-1988.661) (-1989.345) [-1983.045] * [-1981.053] (-2005.402) (-1993.975) (-1982.254) -- 0:04:55
78200 -- (-1996.192) (-1998.520) (-1987.053) [-1980.499] * (-1983.836) (-2000.681) (-1987.752) [-1985.327] -- 0:04:54
78300 -- [-1988.749] (-1995.705) (-1988.691) (-1985.204) * [-1981.438] (-1995.053) (-1994.390) (-1985.185) -- 0:04:54
78400 -- (-1986.064) (-1990.260) [-1991.712] (-1990.314) * [-1983.982] (-1991.753) (-1988.554) (-1988.993) -- 0:04:53
78500 -- (-1992.078) [-1995.699] (-1990.193) (-1996.099) * [-1984.972] (-1993.430) (-1991.461) (-1991.940) -- 0:04:53
78600 -- (-1996.536) [-1994.266] (-1994.148) (-1996.350) * [-1982.943] (-1992.248) (-1989.662) (-1997.572) -- 0:04:53
78700 -- (-2002.229) (-1996.405) [-1994.973] (-1999.637) * [-1986.357] (-1991.455) (-1991.578) (-1995.594) -- 0:04:52
78800 -- [-1989.299] (-1995.482) (-1992.622) (-1999.141) * [-1989.259] (-1991.917) (-1987.510) (-1997.814) -- 0:04:52
78900 -- (-1988.767) (-1994.696) (-1993.001) [-1987.652] * (-1989.256) [-1980.619] (-1989.029) (-1988.229) -- 0:04:51
79000 -- (-1987.270) (-2001.115) (-1996.508) [-1983.095] * [-1983.405] (-1981.761) (-1987.251) (-1983.794) -- 0:04:51
Average standard deviation of split frequencies: 0.009183
79100 -- (-1990.232) (-2005.244) [-1991.426] (-1981.280) * [-1979.356] (-1988.293) (-1985.744) (-1997.921) -- 0:04:51
79200 -- (-1990.267) (-1994.872) (-1985.849) [-1980.886] * [-1980.338] (-1993.196) (-1982.702) (-1980.975) -- 0:04:50
79300 -- (-1983.305) (-1988.940) [-1990.163] (-1981.894) * [-1980.025] (-1993.618) (-1982.516) (-1986.194) -- 0:04:50
79400 -- (-1987.729) (-1996.768) (-1986.980) [-1982.054] * (-1988.224) (-1989.825) (-1982.980) [-1981.536] -- 0:04:49
79500 -- [-1981.134] (-1996.518) (-1988.569) (-1988.337) * (-2006.667) (-1995.133) [-1988.470] (-1989.168) -- 0:04:49
79600 -- [-1979.358] (-1997.221) (-1986.552) (-1989.679) * (-1994.976) (-2000.367) [-1990.486] (-1987.601) -- 0:05:00
79700 -- [-1978.704] (-1991.722) (-1985.163) (-1991.689) * (-1998.339) (-1989.836) (-1991.911) [-1986.453] -- 0:05:00
79800 -- [-1975.803] (-1991.834) (-1990.531) (-1995.279) * (-1988.303) [-1984.049] (-1989.773) (-1987.097) -- 0:04:59
79900 -- [-1986.061] (-1997.463) (-1992.689) (-2001.610) * (-1985.218) [-1984.880] (-2004.040) (-1992.701) -- 0:04:59
80000 -- (-1984.248) [-1988.868] (-1995.252) (-1986.836) * (-1982.315) (-1989.553) [-1988.319] (-1988.527) -- 0:04:59
Average standard deviation of split frequencies: 0.009412
80100 -- [-1984.162] (-1994.122) (-1994.406) (-1990.853) * (-1986.101) (-1990.896) (-1998.628) [-1990.097] -- 0:04:58
80200 -- [-1986.110] (-1990.109) (-1988.515) (-1996.080) * [-1981.676] (-1987.193) (-1993.570) (-1985.789) -- 0:04:58
80300 -- (-1987.294) (-1997.408) [-1988.790] (-1992.750) * (-1988.421) (-1994.676) (-1994.482) [-1985.330] -- 0:04:57
80400 -- (-1987.068) [-1990.583] (-1985.206) (-1997.743) * [-1979.734] (-1995.878) (-2003.212) (-1991.244) -- 0:04:57
80500 -- (-1991.272) (-1989.408) [-1985.240] (-1989.996) * [-1980.406] (-1997.531) (-1995.851) (-1993.145) -- 0:04:56
80600 -- (-1995.559) (-1994.551) (-1983.992) [-1981.713] * [-1985.369] (-2000.886) (-1990.012) (-1991.977) -- 0:04:56
80700 -- [-1988.643] (-1998.722) (-1985.729) (-1983.270) * (-1981.252) (-1996.714) (-1992.179) [-1989.950] -- 0:04:56
80800 -- (-1987.198) (-1993.985) [-1982.880] (-1986.878) * [-1989.054] (-1991.668) (-1987.974) (-1992.038) -- 0:04:55
80900 -- (-1997.902) (-1996.964) [-1983.753] (-1987.250) * [-1986.750] (-1992.182) (-1988.158) (-1990.400) -- 0:04:55
81000 -- (-1996.442) (-1984.887) [-1982.492] (-1992.193) * (-1987.586) [-1985.261] (-1992.274) (-1987.913) -- 0:04:54
Average standard deviation of split frequencies: 0.009621
81100 -- (-1992.223) (-1988.367) [-1988.425] (-1993.648) * (-1990.650) [-1985.794] (-1997.631) (-1988.635) -- 0:04:54
81200 -- (-1989.079) (-1991.940) [-1982.752] (-2002.586) * (-1992.696) (-1987.642) [-1994.670] (-1990.957) -- 0:04:54
81300 -- (-1988.862) (-1996.465) [-1985.646] (-2012.255) * (-1995.707) [-1991.368] (-1996.956) (-1996.344) -- 0:04:53
81400 -- (-1990.921) [-1989.651] (-1983.325) (-1996.758) * (-1991.618) [-1981.158] (-1990.456) (-1999.049) -- 0:04:53
81500 -- [-1985.924] (-1988.370) (-1994.829) (-1993.872) * (-1992.663) [-1979.689] (-1994.894) (-1992.202) -- 0:04:53
81600 -- [-1986.562] (-1989.937) (-1987.736) (-1995.625) * (-1984.793) [-1985.915] (-1994.463) (-1984.615) -- 0:04:52
81700 -- (-1989.663) (-1992.464) [-1985.829] (-1994.911) * [-1984.315] (-1996.194) (-1991.109) (-1983.062) -- 0:04:52
81800 -- (-1987.619) (-2000.796) [-1987.117] (-1988.745) * [-1987.410] (-1994.835) (-1993.005) (-1985.416) -- 0:04:51
81900 -- (-1986.929) (-2001.088) [-1981.373] (-1992.150) * [-1984.562] (-1991.797) (-1993.773) (-1986.180) -- 0:04:51
82000 -- (-1988.353) (-1991.491) [-1986.552] (-1997.528) * (-1989.533) (-1996.721) [-1982.940] (-1984.212) -- 0:04:51
Average standard deviation of split frequencies: 0.009839
82100 -- [-1990.709] (-1989.594) (-1993.570) (-1992.957) * (-1989.706) (-1996.707) [-1982.719] (-1986.375) -- 0:04:50
82200 -- [-1985.934] (-1991.128) (-1990.842) (-1992.098) * (-1982.939) (-2003.124) (-1984.552) [-1983.597] -- 0:04:50
82300 -- [-1988.629] (-1991.060) (-1993.493) (-1998.318) * (-1990.160) (-1996.071) (-1988.757) [-1983.172] -- 0:04:49
82400 -- (-1996.820) [-1986.165] (-1985.098) (-1997.514) * (-1984.834) (-1990.795) [-1981.429] (-1985.637) -- 0:04:49
82500 -- (-1988.182) (-1987.377) [-1983.790] (-2008.783) * [-1985.466] (-1999.796) (-1984.915) (-1992.420) -- 0:04:49
82600 -- [-1981.858] (-1994.078) (-1987.670) (-2007.188) * (-1985.996) (-1994.416) [-1987.632] (-1990.426) -- 0:04:48
82700 -- (-1984.816) (-1986.877) [-1983.755] (-2001.628) * (-1992.235) (-1989.677) [-1984.244] (-1992.372) -- 0:04:59
82800 -- (-1984.837) [-1989.884] (-1983.973) (-2003.518) * (-1992.214) (-1989.308) (-1982.090) [-1986.916] -- 0:04:59
82900 -- [-1983.171] (-1992.486) (-1981.374) (-1997.326) * (-1995.410) (-1996.507) [-1977.892] (-1990.126) -- 0:04:58
83000 -- (-1980.175) (-1990.042) [-1981.373] (-1998.604) * (-1999.688) [-1985.082] (-1981.722) (-1992.141) -- 0:04:58
Average standard deviation of split frequencies: 0.009713
83100 -- (-1981.975) (-1986.666) [-1982.082] (-1996.423) * (-2001.248) [-1980.097] (-1986.534) (-1988.190) -- 0:04:57
83200 -- (-1978.724) (-1985.992) [-1979.520] (-1998.186) * (-1997.499) (-1983.338) (-1987.226) [-1988.259] -- 0:04:57
83300 -- [-1986.526] (-1989.992) (-1983.078) (-1986.853) * (-1994.645) (-1986.216) [-1984.016] (-1989.881) -- 0:04:57
83400 -- (-1989.337) (-1991.189) [-1981.591] (-1989.482) * (-2009.783) [-1987.270] (-1986.453) (-1989.792) -- 0:04:56
83500 -- [-1986.455] (-1990.174) (-1979.326) (-1990.561) * (-2001.326) (-1988.454) (-1988.671) [-1990.061] -- 0:04:56
83600 -- (-1985.593) (-1991.435) [-1978.677] (-1993.435) * (-1995.776) (-1993.443) (-1987.307) [-1990.777] -- 0:04:55
83700 -- [-1985.959] (-1996.293) (-1986.851) (-1991.440) * (-1982.587) (-1985.139) [-1987.534] (-1990.082) -- 0:04:55
83800 -- (-1979.311) (-2000.644) [-1989.215] (-1987.935) * (-1980.204) (-1991.697) [-1981.947] (-1983.073) -- 0:04:55
83900 -- [-1978.545] (-1996.980) (-1992.424) (-1987.642) * [-1979.733] (-1988.612) (-1982.135) (-1989.009) -- 0:04:54
84000 -- [-1977.978] (-2001.625) (-1991.841) (-1986.367) * [-1981.465] (-1993.220) (-1987.000) (-1989.453) -- 0:04:54
Average standard deviation of split frequencies: 0.009605
84100 -- (-1981.019) (-1998.567) (-1992.098) [-1984.349] * [-1980.947] (-1985.721) (-1992.405) (-1984.483) -- 0:04:54
84200 -- (-1984.075) (-1996.214) (-1986.928) [-1978.132] * (-1981.225) (-1983.878) (-1990.303) [-1982.607] -- 0:04:53
84300 -- (-1979.481) (-1995.498) (-1982.382) [-1980.714] * (-1990.612) (-1989.189) (-1990.824) [-1983.410] -- 0:04:53
84400 -- (-1987.832) (-1994.876) (-1995.674) [-1981.431] * (-1984.433) (-1993.641) (-1990.820) [-1986.339] -- 0:04:52
84500 -- (-1984.742) (-1991.078) (-1997.934) [-1983.263] * (-1992.293) [-1989.286] (-1985.461) (-1986.654) -- 0:04:52
84600 -- (-1981.663) (-1991.799) (-1989.712) [-1980.317] * [-1985.161] (-1990.024) (-1987.806) (-1984.469) -- 0:04:52
84700 -- [-1982.361] (-1994.079) (-1988.690) (-1983.650) * (-1994.515) (-1991.238) (-1993.289) [-1984.186] -- 0:04:51
84800 -- [-1986.045] (-1994.109) (-1996.691) (-1978.857) * (-1985.515) (-1991.228) (-1988.840) [-1984.781] -- 0:04:51
84900 -- [-1980.888] (-2006.226) (-1993.076) (-1988.907) * [-1986.469] (-1991.819) (-1989.506) (-1993.202) -- 0:04:51
85000 -- [-1982.768] (-2001.033) (-1990.103) (-1991.768) * (-1987.668) [-1995.905] (-1989.314) (-1988.271) -- 0:04:50
Average standard deviation of split frequencies: 0.009485
85100 -- (-1982.966) (-1998.130) (-1987.691) [-1986.554] * (-1989.678) (-2000.410) [-1989.693] (-1986.241) -- 0:04:50
85200 -- (-1986.539) (-1992.156) (-1988.903) [-1983.697] * (-1990.064) (-1988.581) [-1987.235] (-1985.567) -- 0:04:49
85300 -- (-1982.678) (-1992.166) (-1989.356) [-1982.180] * (-1991.975) (-1987.807) (-1991.633) [-1982.913] -- 0:04:49
85400 -- (-1989.862) (-1990.521) (-1990.612) [-1982.445] * (-1996.341) [-1980.418] (-1989.374) (-1984.445) -- 0:04:49
85500 -- (-1990.989) (-1992.772) (-1994.059) [-1982.122] * (-1991.152) (-1982.286) (-1984.985) [-1986.620] -- 0:04:48
85600 -- [-1991.367] (-2001.169) (-1993.044) (-1988.489) * (-1990.541) [-1983.382] (-1987.555) (-1988.202) -- 0:04:48
85700 -- [-1982.315] (-2011.818) (-2001.574) (-1986.353) * (-1986.786) [-1983.763] (-1987.554) (-1983.938) -- 0:04:48
85800 -- [-1986.414] (-1994.180) (-1992.157) (-1989.241) * (-1995.528) (-1984.114) [-1994.369] (-1986.919) -- 0:04:47
85900 -- (-1992.634) (-1993.008) (-1994.572) [-1985.001] * (-2001.999) (-1985.278) [-1986.946] (-1990.561) -- 0:04:57
86000 -- (-1987.729) (-1989.678) (-1990.706) [-1984.079] * (-1999.364) [-1982.328] (-1981.942) (-1987.617) -- 0:04:57
Average standard deviation of split frequencies: 0.009539
86100 -- [-1981.782] (-1995.304) (-1991.534) (-1987.197) * (-2005.854) (-1982.009) [-1986.170] (-1991.247) -- 0:04:57
86200 -- [-1981.273] (-1994.224) (-1990.777) (-1985.482) * (-1993.216) (-1984.101) (-1989.299) [-1985.669] -- 0:04:56
86300 -- [-1984.983] (-1992.304) (-1997.748) (-1985.987) * (-1990.097) [-1983.120] (-1988.733) (-1989.629) -- 0:04:56
86400 -- [-1985.580] (-1994.761) (-1990.546) (-1993.477) * (-1990.817) [-1981.125] (-1987.912) (-1996.803) -- 0:04:56
86500 -- (-1981.699) (-2002.615) (-1990.035) [-1983.092] * (-1988.402) [-1982.029] (-1985.595) (-1990.172) -- 0:04:55
86600 -- [-1986.529] (-1998.349) (-1994.903) (-1982.869) * [-1988.073] (-1986.911) (-1988.289) (-1987.580) -- 0:04:55
86700 -- [-1983.380] (-1999.357) (-2002.574) (-1989.021) * (-1985.614) [-1985.705] (-1993.359) (-1994.303) -- 0:04:54
86800 -- (-1986.793) (-1991.070) (-2009.595) [-1989.826] * (-1987.614) (-1993.049) (-1996.566) [-1990.730] -- 0:04:54
86900 -- (-1983.829) (-1997.151) (-2000.671) [-1985.538] * (-1990.699) [-1992.272] (-1998.195) (-1989.139) -- 0:04:54
87000 -- [-1981.988] (-1993.753) (-1990.205) (-1988.912) * (-1994.145) (-1986.615) (-1998.882) [-1989.272] -- 0:04:53
Average standard deviation of split frequencies: 0.009576
87100 -- [-1982.570] (-1992.449) (-1993.753) (-1989.668) * (-1997.636) (-1982.235) (-1993.878) [-1988.002] -- 0:04:53
87200 -- [-1980.432] (-1990.029) (-1990.008) (-1987.668) * (-2002.792) [-1984.942] (-1992.290) (-1989.573) -- 0:04:53
87300 -- (-1979.609) [-1989.729] (-1988.688) (-1990.972) * (-1998.879) [-1986.576] (-1990.102) (-1989.520) -- 0:04:52
87400 -- (-1979.637) [-1990.086] (-1990.680) (-1986.916) * (-1998.576) (-1985.535) (-1989.763) [-1984.655] -- 0:04:52
87500 -- [-1978.504] (-1986.078) (-1992.049) (-1983.720) * (-1990.387) (-1984.931) [-1989.812] (-1997.673) -- 0:04:52
87600 -- (-1980.194) (-1988.605) (-1997.754) [-1984.143] * (-1995.498) (-1985.641) [-1988.408] (-1996.494) -- 0:04:51
87700 -- (-1982.246) (-1990.259) (-2002.353) [-1979.120] * [-1992.067] (-1993.680) (-2004.130) (-1997.304) -- 0:04:51
87800 -- [-1980.700] (-1987.700) (-2003.052) (-1979.531) * (-1996.982) [-1986.290] (-1999.081) (-1987.728) -- 0:04:50
87900 -- (-1985.326) (-1989.944) (-2000.549) [-1980.345] * (-1999.985) [-1981.606] (-1997.411) (-1987.053) -- 0:04:50
88000 -- (-1984.282) (-1989.606) (-1995.328) [-1982.488] * (-2009.848) (-1980.620) (-1999.325) [-1982.982] -- 0:04:50
Average standard deviation of split frequencies: 0.009169
88100 -- [-1982.271] (-1989.467) (-1990.441) (-1985.711) * (-1989.832) [-1981.223] (-1998.259) (-1983.478) -- 0:04:49
88200 -- [-1983.049] (-1989.885) (-1992.412) (-1987.244) * (-1986.100) [-1984.456] (-1995.074) (-1985.825) -- 0:04:49
88300 -- [-1988.868] (-1999.646) (-1992.371) (-1994.200) * (-1991.173) (-1989.577) (-1990.364) [-1984.197] -- 0:04:49
88400 -- (-1988.808) [-1987.169] (-1990.209) (-1994.309) * [-1995.499] (-1988.898) (-1994.964) (-1990.077) -- 0:04:48
88500 -- [-1985.194] (-1997.755) (-1986.632) (-1986.560) * (-1993.963) (-1989.910) (-1988.259) [-1982.737] -- 0:04:48
88600 -- (-1995.845) (-2002.927) [-1987.216] (-1987.138) * (-1987.785) [-1986.611] (-1990.137) (-1983.610) -- 0:04:48
88700 -- (-1988.314) (-2005.969) (-1990.416) [-1988.445] * (-1988.965) [-1981.771] (-1993.938) (-1987.340) -- 0:04:47
88800 -- (-1986.257) (-2016.418) (-1990.699) [-1987.595] * (-1992.576) (-1983.357) [-1986.317] (-1987.485) -- 0:04:47
88900 -- (-1991.882) (-2015.042) [-1988.381] (-1983.791) * (-1990.004) (-1984.703) (-1987.671) [-1984.122] -- 0:04:46
89000 -- (-1994.685) (-2008.383) (-1991.108) [-1981.108] * (-2002.302) (-1984.348) (-1986.647) [-1983.756] -- 0:04:56
Average standard deviation of split frequencies: 0.009060
89100 -- (-1996.628) (-1998.684) (-1993.416) [-1981.305] * (-1997.733) [-1977.698] (-1987.835) (-1981.569) -- 0:04:56
89200 -- (-1994.442) (-1998.035) (-1994.010) [-1981.131] * (-1991.418) (-1986.134) (-1992.587) [-1987.491] -- 0:04:56
89300 -- (-1999.187) (-1992.230) (-1995.307) [-1979.259] * (-1993.544) [-1985.799] (-1992.653) (-1984.442) -- 0:04:55
89400 -- (-1988.987) (-1994.143) (-1991.408) [-1980.841] * (-1992.981) (-1987.699) [-1990.719] (-1999.353) -- 0:04:55
89500 -- (-1983.337) (-1987.192) (-2002.798) [-1980.635] * (-1996.843) [-1987.266] (-1990.777) (-1991.922) -- 0:04:55
89600 -- (-1988.185) [-1985.357] (-2002.488) (-1979.159) * (-1999.519) (-1992.867) [-1987.352] (-1992.863) -- 0:04:54
89700 -- (-1993.568) (-1984.267) (-2008.103) [-1977.995] * (-1994.929) (-1996.555) [-1989.670] (-1993.556) -- 0:04:54
89800 -- (-1997.246) [-1984.242] (-2002.777) (-1977.647) * [-1989.931] (-1993.973) (-1993.129) (-1994.304) -- 0:04:53
89900 -- (-1991.591) [-1992.187] (-1998.000) (-1984.376) * (-1993.152) (-1990.853) (-1990.952) [-1991.632] -- 0:04:53
90000 -- [-1989.743] (-1988.159) (-1991.513) (-1985.910) * (-1994.061) (-1993.526) [-1985.769] (-1995.842) -- 0:04:53
Average standard deviation of split frequencies: 0.009414
90100 -- (-1991.271) [-1986.608] (-1996.956) (-1986.480) * (-2003.132) [-1991.053] (-1988.158) (-1989.884) -- 0:04:52
90200 -- (-1986.083) [-1985.503] (-1991.460) (-1998.110) * (-1998.082) [-1990.597] (-1990.342) (-1986.616) -- 0:04:52
90300 -- (-1987.304) (-1989.735) [-1985.795] (-1992.591) * (-1999.539) (-1987.432) (-1996.239) [-1986.085] -- 0:04:52
90400 -- (-1990.042) (-2002.149) (-1989.532) [-1984.258] * (-2004.969) (-1987.514) [-1990.025] (-1987.891) -- 0:04:51
90500 -- (-1988.690) (-1995.198) (-1995.481) [-1983.664] * (-2002.815) [-1984.850] (-1985.905) (-1995.296) -- 0:04:51
90600 -- [-1985.361] (-1990.562) (-1989.281) (-1988.101) * (-1998.754) [-1980.699] (-1985.473) (-1988.441) -- 0:04:51
90700 -- (-1984.142) (-1990.975) (-1990.883) [-1984.715] * (-2008.359) [-1984.430] (-1993.517) (-1994.813) -- 0:04:50
90800 -- (-1991.162) (-1998.618) (-1987.396) [-1982.610] * (-2004.397) [-1990.998] (-1994.383) (-1999.438) -- 0:04:50
90900 -- [-1988.601] (-1999.916) (-1996.281) (-1988.807) * (-2001.627) [-1989.006] (-1987.784) (-1993.513) -- 0:04:50
91000 -- [-1981.494] (-1996.828) (-1996.911) (-1990.528) * (-2004.720) (-1988.705) [-1987.623] (-1996.592) -- 0:04:49
Average standard deviation of split frequencies: 0.009156
91100 -- (-1985.130) (-1999.126) (-1996.175) [-1985.856] * (-2005.187) [-1985.634] (-1996.344) (-1997.875) -- 0:04:49
91200 -- (-1983.039) (-1996.653) (-1997.007) [-1987.384] * (-2016.938) [-1984.077] (-1993.042) (-2001.153) -- 0:04:48
91300 -- [-1982.965] (-2002.098) (-1991.013) (-1985.649) * (-2000.170) [-1986.928] (-1999.023) (-1987.185) -- 0:04:48
91400 -- (-1985.313) (-2001.725) (-1996.659) [-1983.346] * (-2001.277) (-1986.987) [-1992.408] (-1987.266) -- 0:04:48
91500 -- [-1977.068] (-2010.834) (-1989.953) (-1984.548) * (-2001.659) [-1984.266] (-1995.635) (-1990.813) -- 0:04:47
91600 -- [-1982.215] (-2002.964) (-1991.622) (-1995.045) * (-1994.055) (-1989.218) (-1998.690) [-1985.420] -- 0:04:47
91700 -- (-1983.463) (-2001.598) (-1989.659) [-1984.162] * (-1994.581) [-1988.826] (-1996.104) (-1991.086) -- 0:04:47
91800 -- [-1981.420] (-1993.872) (-2006.437) (-1984.519) * (-1994.211) [-1988.076] (-1997.034) (-1990.076) -- 0:04:46
91900 -- [-1979.405] (-1998.259) (-1999.472) (-1985.780) * (-1996.716) [-1984.407] (-1991.747) (-1988.899) -- 0:04:46
92000 -- (-1985.036) (-2003.552) (-1995.413) [-1982.028] * (-2000.576) (-1983.600) (-1992.491) [-1991.363] -- 0:04:46
Average standard deviation of split frequencies: 0.009064
92100 -- (-1988.788) (-2000.669) (-2000.135) [-1981.219] * (-1998.544) [-1990.211] (-1995.969) (-1994.455) -- 0:04:55
92200 -- (-1992.448) (-2007.140) (-1999.888) [-1980.747] * (-2008.928) (-1991.956) (-1996.847) [-1992.741] -- 0:04:55
92300 -- (-1996.437) (-1995.371) (-2004.306) [-1987.399] * (-1992.755) [-1991.658] (-1994.123) (-1991.203) -- 0:04:55
92400 -- (-1997.034) (-1999.821) (-1998.787) [-1981.364] * (-1995.749) [-1991.841] (-2006.262) (-1989.598) -- 0:04:54
92500 -- (-2000.201) (-1995.776) (-1992.060) [-1982.010] * (-1999.522) [-1987.982] (-2002.373) (-1991.974) -- 0:04:54
92600 -- [-1991.182] (-1992.331) (-1994.746) (-1983.163) * (-1993.541) (-1984.512) (-2000.510) [-1994.930] -- 0:04:53
92700 -- (-1992.135) (-1991.409) (-1991.724) [-1980.415] * (-1991.938) [-1983.649] (-2000.302) (-1994.583) -- 0:04:53
92800 -- (-1986.004) (-1991.532) (-1996.640) [-1978.549] * (-1991.592) [-1984.626] (-1992.338) (-1994.293) -- 0:04:53
92900 -- [-1980.446] (-1993.799) (-1991.568) (-1982.831) * [-1994.874] (-1990.003) (-1993.142) (-1992.686) -- 0:04:52
93000 -- [-1985.464] (-1996.155) (-1985.367) (-1982.586) * (-1992.712) (-1992.888) (-1992.729) [-1991.210] -- 0:04:52
Average standard deviation of split frequencies: 0.008815
93100 -- [-1983.293] (-1997.419) (-1988.423) (-1985.827) * [-1989.452] (-1987.947) (-2000.391) (-1992.022) -- 0:04:52
93200 -- [-1978.317] (-1997.256) (-1990.905) (-1983.601) * [-1990.477] (-1989.521) (-1996.310) (-2000.123) -- 0:04:51
93300 -- [-1976.261] (-1995.694) (-1995.861) (-1986.655) * (-1997.667) (-1999.939) (-2003.547) [-1994.521] -- 0:04:51
93400 -- [-1980.050] (-1993.652) (-2001.687) (-1990.902) * (-1995.559) [-1992.693] (-2010.265) (-1997.609) -- 0:04:51
93500 -- [-1980.444] (-1992.619) (-2004.089) (-1986.353) * (-2002.373) [-1990.885] (-2007.233) (-1990.839) -- 0:04:50
93600 -- (-1983.174) (-1991.670) [-1992.908] (-1990.267) * (-2000.635) (-1997.196) (-1990.597) [-1991.119] -- 0:04:50
93700 -- (-1984.059) (-1993.215) [-1986.361] (-1983.862) * (-1999.296) (-1989.703) (-1995.319) [-1990.751] -- 0:04:50
93800 -- [-1981.731] (-2001.168) (-1987.557) (-1983.302) * (-2000.477) [-1988.037] (-1995.829) (-1992.440) -- 0:04:49
93900 -- (-1983.642) (-2002.618) (-1984.698) [-1980.570] * (-1997.124) (-1982.728) [-1992.952] (-1988.795) -- 0:04:49
94000 -- (-1984.602) (-2006.745) (-1986.077) [-1990.148] * (-1998.581) [-1985.894] (-1991.248) (-1995.707) -- 0:04:49
Average standard deviation of split frequencies: 0.009873
94100 -- [-1982.094] (-2005.173) (-1990.736) (-1985.303) * (-1994.141) (-1990.776) [-1992.230] (-1995.404) -- 0:04:48
94200 -- (-1989.658) (-2001.912) (-1995.424) [-1983.464] * (-2004.089) (-1994.533) (-1992.745) [-1984.198] -- 0:04:48
94300 -- [-1982.826] (-2007.504) (-1995.131) (-1980.928) * (-2006.575) (-1999.860) [-1989.019] (-1983.476) -- 0:04:48
94400 -- (-1987.620) (-1991.553) (-1994.446) [-1978.353] * (-2009.656) (-1995.438) (-1989.469) [-1985.394] -- 0:04:47
94500 -- [-1981.866] (-1990.038) (-1987.474) (-1982.179) * (-2001.407) (-1992.234) [-1986.050] (-1987.852) -- 0:04:47
94600 -- [-1979.008] (-1999.261) (-1986.506) (-1985.609) * (-2013.247) (-1995.665) (-1988.010) [-1989.174] -- 0:04:47
94700 -- [-1979.597] (-1994.082) (-1988.894) (-1986.431) * (-2005.176) (-1995.632) [-1991.497] (-1984.372) -- 0:04:46
94800 -- (-1981.741) (-1995.120) (-1991.574) [-1985.024] * (-2000.687) (-1995.837) (-1997.499) [-1982.251] -- 0:04:46
94900 -- [-1981.839] (-1991.181) (-1999.958) (-1987.694) * (-1997.019) (-2010.411) [-1989.683] (-1983.921) -- 0:04:46
95000 -- [-1977.558] (-1990.450) (-1990.903) (-1985.632) * (-1998.753) (-2006.540) (-1993.919) [-1985.259] -- 0:04:45
Average standard deviation of split frequencies: 0.010045
95100 -- [-1978.843] (-1990.770) (-1993.596) (-1988.578) * [-1993.501] (-2001.358) (-1994.107) (-1984.482) -- 0:04:45
95200 -- [-1976.951] (-1985.448) (-1991.264) (-2001.649) * [-1991.392] (-2003.823) (-1994.327) (-1990.329) -- 0:04:45
95300 -- [-1980.286] (-1988.335) (-1994.627) (-2002.312) * (-1989.668) [-1993.757] (-2000.035) (-1988.349) -- 0:04:54
95400 -- [-1981.478] (-1991.961) (-1990.747) (-2004.461) * [-1992.100] (-1988.834) (-2001.283) (-1986.127) -- 0:04:53
95500 -- (-1985.706) (-1986.327) (-1996.430) [-1988.639] * (-1990.698) [-1981.860] (-2011.426) (-1998.498) -- 0:04:53
95600 -- [-1985.691] (-1992.539) (-1994.773) (-1986.784) * (-1988.307) [-1980.542] (-1992.856) (-1992.590) -- 0:04:53
95700 -- (-1999.972) (-1994.127) (-1994.439) [-1987.229] * (-1987.545) [-1979.103] (-1988.282) (-1998.701) -- 0:04:52
95800 -- (-1995.372) (-1997.253) (-1995.893) [-1985.688] * (-1994.986) [-1981.489] (-1990.873) (-1994.400) -- 0:04:52
95900 -- (-1994.618) (-1992.196) (-1993.128) [-1986.392] * (-1993.573) [-1980.364] (-1994.151) (-1996.924) -- 0:04:52
96000 -- (-1991.528) (-1993.176) (-1992.888) [-1984.021] * [-1992.304] (-1984.939) (-1994.132) (-1993.223) -- 0:04:51
Average standard deviation of split frequencies: 0.010648
96100 -- (-1993.504) (-2003.974) (-2000.926) [-1987.925] * (-1992.361) (-1982.549) (-1989.588) [-1988.135] -- 0:04:51
96200 -- (-1996.594) (-1994.403) (-1993.018) [-1988.571] * (-1990.006) [-1990.681] (-1997.670) (-1989.929) -- 0:04:51
96300 -- (-2006.019) (-1997.329) [-1986.766] (-1999.032) * (-1989.707) (-2001.485) [-1990.159] (-1992.651) -- 0:04:50
96400 -- [-1998.113] (-1994.511) (-1987.403) (-1999.701) * [-1989.065] (-2005.321) (-1985.249) (-2003.326) -- 0:04:50
96500 -- (-1995.048) (-2000.732) [-1988.056] (-1996.523) * [-1988.738] (-1994.042) (-1986.052) (-1997.150) -- 0:04:50
96600 -- (-1992.335) (-1992.036) [-1989.926] (-1992.818) * (-1993.038) (-1994.203) (-1987.091) [-1994.095] -- 0:04:49
96700 -- (-1989.295) (-1989.952) (-1996.079) [-1988.980] * (-1998.299) (-2001.526) (-1990.061) [-1993.276] -- 0:04:49
96800 -- (-1990.958) [-1989.514] (-1985.807) (-1993.843) * [-1990.609] (-2003.353) (-1987.149) (-1992.785) -- 0:04:49
96900 -- (-1999.134) (-1992.896) [-1985.048] (-2000.752) * [-1989.456] (-1995.730) (-1988.019) (-1988.292) -- 0:04:48
97000 -- (-2007.078) (-1993.187) [-1983.874] (-1993.709) * (-1993.265) (-2001.724) (-1985.341) [-1986.948] -- 0:04:48
Average standard deviation of split frequencies: 0.010947
97100 -- (-2008.816) [-1991.896] (-1983.229) (-1984.401) * (-1996.115) (-1994.979) [-1986.121] (-1988.273) -- 0:04:48
97200 -- (-2008.210) (-1995.427) (-1982.241) [-1978.921] * (-1997.566) (-1995.515) [-1986.521] (-1989.079) -- 0:04:47
97300 -- (-1999.703) (-1992.340) (-1984.204) [-1980.110] * (-1994.017) (-1993.159) (-1991.052) [-1990.231] -- 0:04:47
97400 -- (-1997.571) (-2001.912) (-1987.804) [-1978.176] * (-1992.704) (-1993.301) [-1984.599] (-2000.007) -- 0:04:47
97500 -- (-1991.099) (-1998.804) (-1987.477) [-1978.631] * (-2000.194) (-1997.214) [-1987.361] (-1998.677) -- 0:04:46
97600 -- (-1991.645) (-1998.706) (-1985.615) [-1986.495] * (-2000.994) (-2001.269) [-1990.641] (-2007.633) -- 0:04:46
97700 -- (-1993.721) (-1996.305) (-1986.743) [-1984.718] * [-1991.586] (-1999.356) (-1986.351) (-2006.874) -- 0:04:46
97800 -- (-2003.567) (-1999.993) (-1988.425) [-1984.711] * (-1996.490) (-2004.940) [-1990.064] (-1999.357) -- 0:04:45
97900 -- (-2014.763) (-1997.485) (-1984.465) [-1983.263] * (-1993.510) (-2008.969) [-1986.465] (-2000.246) -- 0:04:45
98000 -- (-2006.859) (-1998.459) (-1986.957) [-1986.202] * (-2002.028) (-2000.301) [-1984.882] (-2000.571) -- 0:04:45
Average standard deviation of split frequencies: 0.011254
98100 -- (-2003.954) [-1994.419] (-1991.750) (-1988.663) * (-1991.948) [-1987.435] (-1985.519) (-2007.287) -- 0:04:45
98200 -- (-2001.389) (-1990.656) (-1992.863) [-1989.214] * (-1989.540) (-1995.925) [-1984.079] (-1996.529) -- 0:04:44
98300 -- (-1998.807) [-1992.826] (-1992.736) (-1989.317) * [-1984.559] (-1995.858) (-1990.621) (-1991.460) -- 0:04:44
98400 -- (-1991.653) (-1996.661) (-1998.166) [-1985.493] * [-1984.531] (-1997.545) (-1989.833) (-1985.297) -- 0:04:44
98500 -- (-1986.581) [-1990.718] (-1998.999) (-1988.711) * [-1981.689] (-1997.214) (-2001.286) (-1989.273) -- 0:04:52
98600 -- (-1992.163) (-1992.837) (-1995.712) [-1989.610] * [-1984.691] (-2007.014) (-1996.388) (-1987.030) -- 0:04:52
98700 -- [-1988.021] (-1989.759) (-1990.813) (-1993.130) * (-1988.237) (-2001.725) (-1990.011) [-1986.612] -- 0:04:52
98800 -- [-1987.357] (-1989.018) (-1988.469) (-1991.644) * (-1986.677) (-1996.633) (-1991.293) [-1992.139] -- 0:04:51
98900 -- (-1984.651) (-1988.620) [-1988.616] (-2000.374) * [-1990.120] (-1993.032) (-1996.274) (-1992.367) -- 0:04:51
99000 -- [-1986.341] (-1995.947) (-1986.120) (-2003.327) * (-1994.919) (-1992.427) [-1988.993] (-1988.857) -- 0:04:51
Average standard deviation of split frequencies: 0.011812
99100 -- (-1986.096) (-1996.221) [-1984.895] (-1996.196) * (-1990.851) (-1991.957) [-1988.877] (-1989.136) -- 0:04:50
99200 -- [-1987.782] (-2000.362) (-1978.780) (-1987.347) * (-1996.418) (-1999.038) (-1994.563) [-1989.606] -- 0:04:50
99300 -- (-1986.444) (-1996.295) [-1982.212] (-1989.140) * (-1997.047) (-1991.456) [-1988.632] (-1990.804) -- 0:04:50
99400 -- (-1987.603) (-1986.533) [-1978.101] (-1989.737) * (-1996.750) (-2001.234) [-1985.230] (-1991.321) -- 0:04:49
99500 -- (-1989.881) (-1981.974) (-1980.589) [-1983.167] * (-1996.516) (-1996.766) (-1989.989) [-1990.996] -- 0:04:49
99600 -- (-1987.161) [-1984.688] (-1993.555) (-1988.215) * (-1990.197) (-1991.084) (-1995.301) [-1987.782] -- 0:04:49
99700 -- (-1987.328) (-1989.583) [-1989.805] (-1990.264) * (-1986.487) (-1988.061) (-1997.456) [-1985.766] -- 0:04:48
99800 -- (-1987.283) (-1991.480) [-1980.348] (-1995.492) * (-1982.871) (-1993.914) [-1992.068] (-1992.077) -- 0:04:48
99900 -- (-1989.738) (-1989.419) [-1980.779] (-1993.083) * (-1985.252) (-1997.160) (-1994.442) [-1984.677] -- 0:04:48
100000 -- (-1995.770) (-1990.222) [-1982.097] (-2002.221) * [-1986.485] (-1995.772) (-1994.313) (-1985.268) -- 0:04:48
Average standard deviation of split frequencies: 0.011433
100100 -- (-1986.291) (-1993.995) [-1981.552] (-2002.691) * [-1983.160] (-1990.605) (-2001.616) (-1985.702) -- 0:04:47
100200 -- (-1990.581) (-1984.560) [-1982.858] (-1997.303) * (-1987.603) (-1992.204) (-2005.038) [-1989.294] -- 0:04:47
100300 -- [-1987.049] (-1989.673) (-1983.523) (-1999.125) * (-1991.737) [-1991.238] (-1999.610) (-1993.329) -- 0:04:47
100400 -- (-1988.288) [-1988.540] (-1978.556) (-2006.793) * [-1993.693] (-1993.212) (-1991.520) (-1993.267) -- 0:04:46
100500 -- [-1984.403] (-1994.481) (-1981.070) (-2005.517) * (-1989.990) (-1999.962) [-1996.626] (-1994.438) -- 0:04:46
100600 -- [-1981.127] (-1998.955) (-1975.632) (-1992.320) * [-1984.027] (-2000.271) (-1993.661) (-1991.074) -- 0:04:46
100700 -- (-1984.702) (-1984.034) [-1975.550] (-1998.845) * (-1986.551) (-1996.053) [-1988.342] (-1994.424) -- 0:04:45
100800 -- [-1983.083] (-1994.606) (-1988.982) (-1999.571) * [-1993.656] (-1998.796) (-1999.999) (-1984.968) -- 0:04:45
100900 -- (-1979.263) (-2003.752) [-1986.645] (-2016.677) * (-1992.433) (-1990.035) (-2003.764) [-1986.338] -- 0:04:45
101000 -- [-1976.913] (-1995.238) (-1982.759) (-2008.286) * [-1989.574] (-1994.867) (-1996.162) (-1986.069) -- 0:04:44
Average standard deviation of split frequencies: 0.011446
101100 -- [-1982.956] (-2003.797) (-1988.460) (-2005.481) * [-1988.276] (-1989.544) (-1990.074) (-1991.817) -- 0:04:44
101200 -- [-1992.531] (-1996.967) (-1987.986) (-2005.113) * (-1990.216) (-1993.741) (-1986.910) [-1989.209] -- 0:04:44
101300 -- [-1987.868] (-1995.599) (-1989.235) (-1998.359) * (-1991.963) [-1987.704] (-1988.076) (-1988.156) -- 0:04:43
101400 -- (-1989.030) (-1997.747) (-1984.640) [-1991.694] * (-1998.641) [-1984.581] (-1986.687) (-1993.778) -- 0:04:43
101500 -- (-1985.219) (-1994.971) [-1988.829] (-1997.475) * (-2000.741) (-1991.404) [-1987.919] (-1999.615) -- 0:04:43
101600 -- (-1988.049) (-1996.126) (-1998.063) [-1986.929] * (-1991.605) (-1989.950) [-1987.747] (-1995.549) -- 0:04:51
101700 -- [-1984.962] (-2000.215) (-1995.988) (-1993.144) * (-2000.825) (-1989.652) (-1988.078) [-1990.329] -- 0:04:51
101800 -- (-1982.249) (-1996.097) (-1987.573) [-1987.538] * (-1998.975) [-1986.794] (-1993.611) (-1991.120) -- 0:04:51
101900 -- (-1988.657) (-2001.450) [-1984.878] (-1986.595) * [-1986.634] (-1991.143) (-1993.461) (-1987.215) -- 0:04:50
102000 -- (-1992.199) (-2001.947) (-1985.171) [-1986.651] * (-2001.427) (-1993.757) [-1991.138] (-1994.974) -- 0:04:50
Average standard deviation of split frequencies: 0.010682
102100 -- (-1984.109) (-2003.981) (-1981.561) [-1995.441] * (-1994.860) (-1986.617) [-1994.086] (-1989.598) -- 0:04:50
102200 -- (-1985.332) (-2002.301) (-1982.162) [-1986.403] * (-1991.972) (-1995.215) [-1991.141] (-1986.460) -- 0:04:49
102300 -- (-1984.787) (-1997.344) [-1988.722] (-1994.615) * (-1995.175) (-1989.710) [-1985.805] (-1997.337) -- 0:04:49
102400 -- (-1983.609) (-2001.111) (-1992.312) [-1992.713] * (-2000.363) (-1988.719) [-1985.455] (-1998.473) -- 0:04:49
102500 -- [-1980.983] (-1993.345) (-1996.475) (-1995.385) * (-1995.870) (-1992.765) [-1984.485] (-2001.687) -- 0:04:48
102600 -- [-1979.873] (-1988.758) (-1984.419) (-2002.164) * (-1999.110) (-1994.264) [-1989.698] (-1996.079) -- 0:04:48
102700 -- (-1982.401) (-1986.432) [-1991.721] (-1988.541) * [-1993.298] (-2001.829) (-1991.533) (-1998.440) -- 0:04:48
102800 -- [-1981.170] (-1984.182) (-1993.462) (-1988.267) * (-2001.654) [-1991.692] (-2003.540) (-2000.871) -- 0:04:48
102900 -- [-1982.247] (-1985.932) (-1982.060) (-1994.321) * (-1993.793) [-1993.434] (-1993.754) (-1999.170) -- 0:04:47
103000 -- (-1982.487) [-1989.716] (-1986.501) (-1996.633) * [-1998.041] (-1993.803) (-1996.829) (-1999.342) -- 0:04:47
Average standard deviation of split frequencies: 0.010832
103100 -- (-1984.971) (-1990.948) [-1988.820] (-1996.214) * (-2002.879) [-1994.960] (-1994.987) (-1999.399) -- 0:04:47
103200 -- [-1985.286] (-1989.633) (-1991.483) (-1996.870) * [-1993.909] (-1999.971) (-1996.672) (-2002.998) -- 0:04:46
103300 -- (-1989.215) [-1989.154] (-1993.345) (-1990.196) * (-1994.284) (-2002.599) (-1996.324) [-1992.282] -- 0:04:46
103400 -- (-1985.752) [-1992.860] (-1994.196) (-1998.012) * (-1990.503) (-1998.084) (-2006.630) [-1987.305] -- 0:04:46
103500 -- [-1984.291] (-1993.940) (-2000.804) (-2001.760) * (-1990.036) [-1992.280] (-2001.686) (-1984.142) -- 0:04:45
103600 -- [-1988.311] (-1996.293) (-1993.095) (-2001.755) * (-1994.033) (-1995.204) (-1993.421) [-1984.926] -- 0:04:45
103700 -- [-1984.778] (-1997.587) (-2000.000) (-1994.366) * [-1994.965] (-1995.576) (-1989.478) (-1988.722) -- 0:04:45
103800 -- (-1989.952) (-1996.048) (-1992.622) [-1992.256] * (-1990.463) (-1992.461) [-1991.431] (-1987.994) -- 0:04:44
103900 -- [-1987.919] (-1994.994) (-1993.729) (-2003.049) * [-1987.396] (-1989.709) (-1993.486) (-1994.156) -- 0:04:44
104000 -- (-1989.715) [-1989.943] (-1994.665) (-1998.136) * (-1995.647) [-1993.583] (-1990.746) (-1997.098) -- 0:04:44
Average standard deviation of split frequencies: 0.010735
104100 -- [-1988.095] (-1986.049) (-1997.117) (-1994.483) * (-1995.120) (-1996.238) (-1988.786) [-1996.997] -- 0:04:44
104200 -- (-1993.180) [-1985.533] (-1990.106) (-2001.503) * (-1991.296) [-1992.955] (-1993.497) (-1999.270) -- 0:04:43
104300 -- (-1985.537) (-1993.833) [-1986.587] (-1996.139) * (-2001.728) [-1988.251] (-1992.074) (-1992.758) -- 0:04:43
104400 -- [-1987.949] (-2005.944) (-1989.787) (-1998.429) * (-1997.177) [-1986.482] (-1995.057) (-1989.734) -- 0:04:43
104500 -- (-1988.404) (-2003.563) [-1988.112] (-1997.094) * (-1991.382) (-1987.971) [-1994.968] (-1987.050) -- 0:04:42
104600 -- (-1983.872) (-2002.679) [-1992.649] (-1997.803) * (-1996.139) (-1995.859) (-2010.613) [-1989.427] -- 0:04:42
104700 -- [-1986.619] (-2013.905) (-1991.343) (-1989.370) * (-1995.729) [-1991.876] (-2019.597) (-1994.803) -- 0:04:50
104800 -- [-1984.178] (-2005.945) (-1988.681) (-2004.856) * (-1992.702) [-1992.466] (-2018.422) (-1994.184) -- 0:04:50
104900 -- [-1981.214] (-1994.793) (-1988.830) (-1997.627) * (-1998.072) [-1985.891] (-2019.048) (-1984.004) -- 0:04:50
105000 -- (-1989.550) [-1986.375] (-1986.736) (-1999.948) * (-1998.480) [-1989.081] (-2010.269) (-1986.984) -- 0:04:49
Average standard deviation of split frequencies: 0.011267
105100 -- (-1994.465) [-1983.544] (-1986.533) (-2006.284) * (-2003.323) [-2001.147] (-2004.100) (-1988.526) -- 0:04:49
105200 -- (-1987.795) [-1984.775] (-1987.219) (-2004.493) * (-2004.926) (-1998.901) (-1998.973) [-1986.588] -- 0:04:49
105300 -- [-1981.629] (-1986.761) (-1989.891) (-2001.007) * (-2000.683) (-1993.177) (-1994.542) [-1987.482] -- 0:04:48
105400 -- [-1985.484] (-1985.861) (-1990.857) (-1995.347) * (-2003.865) (-1990.884) (-1998.069) [-1985.884] -- 0:04:48
105500 -- [-1985.045] (-1989.053) (-1985.156) (-1996.977) * (-1993.731) (-1996.776) (-1998.326) [-1986.868] -- 0:04:48
105600 -- (-1987.486) [-1991.810] (-1990.256) (-1997.558) * [-1985.696] (-1996.943) (-2000.087) (-1991.159) -- 0:04:47
105700 -- (-2003.520) (-1996.614) [-1986.323] (-1995.835) * [-1985.444] (-1992.647) (-1998.027) (-1988.064) -- 0:04:47
105800 -- (-1996.992) (-1997.305) [-1984.861] (-2003.477) * (-1989.104) [-1988.756] (-2002.246) (-1988.820) -- 0:04:47
105900 -- (-1992.756) [-1995.796] (-1991.835) (-1999.604) * [-1992.196] (-1985.768) (-1995.010) (-1988.453) -- 0:04:47
106000 -- [-1985.770] (-1988.339) (-1981.635) (-1991.364) * (-1991.644) [-1988.616] (-1996.046) (-1995.797) -- 0:04:46
Average standard deviation of split frequencies: 0.011421
106100 -- (-1987.228) (-1988.736) [-1981.195] (-1984.887) * (-1996.761) (-1994.637) (-1992.751) [-1987.963] -- 0:04:46
106200 -- (-1987.320) [-1989.460] (-1993.239) (-1986.922) * [-1995.010] (-1989.314) (-1994.821) (-1990.449) -- 0:04:46
106300 -- [-1983.637] (-1991.326) (-1996.469) (-1989.827) * (-1991.219) [-1986.031] (-1994.246) (-1991.309) -- 0:04:45
106400 -- [-1978.897] (-1997.764) (-1994.634) (-1991.731) * (-1989.906) (-1991.229) (-1995.711) [-1995.372] -- 0:04:45
106500 -- [-1985.036] (-2000.133) (-1996.329) (-1999.594) * (-1994.040) (-1996.389) (-1991.567) [-1992.923] -- 0:04:45
106600 -- (-1986.828) [-1991.779] (-1988.479) (-2004.459) * (-1990.030) [-1995.711] (-1996.271) (-1989.609) -- 0:04:44
106700 -- (-1987.535) (-1991.920) (-1993.275) [-1991.575] * [-1989.366] (-1993.319) (-1997.801) (-1993.523) -- 0:04:44
106800 -- (-1995.350) [-1986.789] (-1987.793) (-1989.277) * [-1986.453] (-1992.320) (-1996.147) (-1988.070) -- 0:04:44
106900 -- (-2001.084) [-1987.682] (-1988.866) (-1994.714) * [-1985.145] (-1994.501) (-1987.755) (-1989.190) -- 0:04:44
107000 -- (-1992.381) [-1981.714] (-1986.927) (-1996.884) * (-1985.499) (-1992.981) (-1994.010) [-1986.376] -- 0:04:43
Average standard deviation of split frequencies: 0.011559
107100 -- (-1996.142) (-1984.668) [-1983.839] (-2008.236) * (-1983.707) (-1992.496) (-1991.519) [-1988.626] -- 0:04:43
107200 -- (-1982.519) (-1981.593) [-1986.164] (-2003.991) * (-1993.145) [-1989.452] (-1991.675) (-1989.907) -- 0:04:43
107300 -- (-1987.338) [-1993.379] (-1997.772) (-2010.371) * (-1995.023) (-1996.242) (-1997.356) [-1986.739] -- 0:04:42
107400 -- [-1990.043] (-1991.094) (-1998.440) (-2004.437) * (-1989.938) (-1989.841) [-1987.859] (-1991.854) -- 0:04:42
107500 -- (-1983.783) [-1989.931] (-1993.429) (-1995.172) * (-1989.546) (-1991.011) [-1985.704] (-1994.224) -- 0:04:42
107600 -- [-1983.789] (-1996.030) (-1996.775) (-1993.216) * (-1991.003) (-1986.488) [-1990.200] (-1992.359) -- 0:04:41
107700 -- [-1982.644] (-1993.928) (-1989.865) (-1993.386) * [-1987.092] (-1986.372) (-1988.132) (-1996.612) -- 0:04:41
107800 -- [-1980.765] (-2002.802) (-1985.028) (-1987.689) * (-1990.752) [-1988.942] (-1988.311) (-1995.043) -- 0:04:41
107900 -- (-1985.018) (-1999.777) [-1983.809] (-1988.724) * (-1990.828) (-1989.637) (-1995.621) [-1988.390] -- 0:04:49
108000 -- [-1981.906] (-1996.789) (-1988.677) (-1994.045) * [-1991.168] (-1987.204) (-1993.874) (-1990.611) -- 0:04:49
Average standard deviation of split frequencies: 0.010836
108100 -- [-1980.278] (-1994.651) (-1987.874) (-1996.844) * [-1985.233] (-1988.425) (-1994.078) (-1991.137) -- 0:04:48
108200 -- [-1985.601] (-1997.393) (-1989.621) (-1993.786) * [-1986.366] (-2001.288) (-1997.180) (-1992.213) -- 0:04:48
108300 -- [-1981.158] (-1997.363) (-1991.846) (-1990.701) * (-1992.495) (-2009.407) [-1995.765] (-1992.804) -- 0:04:48
108400 -- [-1982.557] (-1994.559) (-1991.897) (-1993.049) * [-1985.913] (-2001.688) (-1995.367) (-1996.108) -- 0:04:47
108500 -- (-1985.114) [-1990.018] (-1991.142) (-1991.333) * [-1984.788] (-1994.745) (-1994.402) (-1997.095) -- 0:04:47
108600 -- [-1984.715] (-1988.179) (-1992.154) (-1989.292) * [-1987.440] (-1993.910) (-2000.986) (-1991.769) -- 0:04:47
108700 -- (-1988.883) (-1993.265) [-1985.713] (-1999.486) * (-1993.614) (-1993.909) (-1991.403) [-1983.663] -- 0:04:46
108800 -- [-1989.747] (-2001.339) (-1991.329) (-1995.125) * (-2000.938) (-1991.354) (-1992.840) [-1984.277] -- 0:04:46
108900 -- (-1987.937) (-2015.353) (-1993.941) [-1989.299] * (-2003.934) [-1991.816] (-1996.947) (-1989.487) -- 0:04:46
109000 -- (-1985.373) (-2012.716) [-1986.152] (-1993.510) * (-1994.583) (-1997.887) (-1999.917) [-1989.892] -- 0:04:46
Average standard deviation of split frequencies: 0.010854
109100 -- [-1983.077] (-2007.862) (-1987.269) (-1991.625) * (-1992.012) (-1999.423) [-2003.340] (-1990.463) -- 0:04:45
109200 -- [-1981.891] (-2004.775) (-1993.000) (-1992.505) * (-2001.478) (-1999.590) (-2003.847) [-1991.156] -- 0:04:45
109300 -- (-1983.898) (-1999.526) (-2000.733) [-1991.101] * (-1997.631) [-1992.181] (-1996.338) (-1995.211) -- 0:04:45
109400 -- [-1982.255] (-2002.058) (-1990.903) (-1985.971) * (-1997.551) (-2011.371) (-1998.072) [-1991.511] -- 0:04:44
109500 -- (-1983.015) (-1999.282) (-1994.335) [-1986.238] * [-1986.181] (-1998.892) (-1996.834) (-1989.951) -- 0:04:44
109600 -- [-1985.928] (-2000.293) (-2002.621) (-1994.625) * (-1988.194) (-1990.400) (-1997.716) [-1985.455] -- 0:04:44
109700 -- [-1987.505] (-1993.043) (-1995.007) (-1993.145) * (-1986.426) [-1986.954] (-2000.899) (-1990.698) -- 0:04:44
109800 -- (-1987.273) [-1986.085] (-1997.330) (-1994.260) * [-1984.885] (-1989.589) (-2010.555) (-1999.794) -- 0:04:43
109900 -- (-1989.212) (-1988.668) [-1991.107] (-2000.888) * [-1983.911] (-1995.836) (-1996.940) (-1996.748) -- 0:04:43
110000 -- (-1987.754) (-1987.812) [-1988.347] (-2002.722) * [-1984.784] (-2000.722) (-1995.746) (-1995.896) -- 0:04:43
Average standard deviation of split frequencies: 0.010517
110100 -- (-1992.909) (-1992.023) (-1991.911) [-1991.325] * [-1993.242] (-1996.655) (-1999.744) (-2002.858) -- 0:04:42
110200 -- (-1994.259) [-1995.410] (-2001.438) (-1993.896) * (-1994.085) [-1998.624] (-1989.660) (-1993.726) -- 0:04:42
110300 -- (-1992.058) (-2007.641) [-1990.305] (-1992.386) * (-1996.974) (-1997.532) [-1992.489] (-1994.551) -- 0:04:42
110400 -- (-1987.980) (-1999.332) (-1984.066) [-1986.099] * (-1995.707) (-2012.132) [-1992.423] (-1991.010) -- 0:04:42
110500 -- (-1981.675) (-1996.526) (-1987.998) [-1987.841] * [-1989.735] (-2005.068) (-1992.389) (-1991.142) -- 0:04:41
110600 -- (-1979.820) (-2010.572) [-1985.868] (-1995.332) * (-1989.289) (-1994.317) (-1992.045) [-1986.886] -- 0:04:41
110700 -- [-1978.062] (-1999.715) (-1987.913) (-1993.526) * (-1997.045) (-2004.208) [-1998.132] (-1986.353) -- 0:04:41
110800 -- [-1979.934] (-1998.807) (-1987.288) (-1991.343) * [-1991.693] (-1989.801) (-1997.849) (-1997.221) -- 0:04:40
110900 -- [-1983.195] (-1996.936) (-1983.516) (-1995.493) * [-1990.174] (-1985.165) (-2004.433) (-2005.341) -- 0:04:40
111000 -- (-1987.769) (-1993.330) [-1984.438] (-1996.938) * [-1988.208] (-1989.941) (-2006.475) (-1995.767) -- 0:04:48
Average standard deviation of split frequencies: 0.010538
111100 -- (-1986.934) (-1998.741) [-1982.231] (-1999.783) * [-1992.818] (-1990.641) (-1998.422) (-1990.907) -- 0:04:48
111200 -- (-1991.832) (-1992.432) [-1981.332] (-2003.047) * (-1996.925) (-1991.558) (-2001.547) [-1997.647] -- 0:04:47
111300 -- (-1987.335) [-1994.110] (-1980.575) (-1993.600) * [-1992.333] (-1990.869) (-1998.705) (-2001.548) -- 0:04:47
111400 -- (-1995.989) (-1996.746) [-1983.948] (-1990.879) * (-1995.279) (-1996.151) [-1997.542] (-1997.342) -- 0:04:47
111500 -- (-1994.584) (-1993.564) [-1985.434] (-1989.369) * (-2002.619) (-1993.593) (-1999.658) [-1990.183] -- 0:04:46
111600 -- (-1998.714) (-1990.186) [-1990.478] (-1995.051) * (-1994.109) (-1990.791) (-1996.388) [-1990.058] -- 0:04:46
111700 -- (-1996.589) [-1989.557] (-1982.645) (-1998.445) * [-1992.927] (-1986.080) (-1998.905) (-1988.943) -- 0:04:46
111800 -- (-1998.665) [-1985.324] (-1983.285) (-1995.722) * (-1995.521) [-1987.901] (-2000.866) (-1995.957) -- 0:04:46
111900 -- (-2003.167) [-1983.042] (-1981.811) (-1992.451) * (-1993.479) [-1991.182] (-2003.129) (-1996.995) -- 0:04:45
112000 -- (-1992.498) (-1982.696) [-1979.625] (-1999.871) * (-1995.766) [-1991.966] (-2000.903) (-1997.376) -- 0:04:45
Average standard deviation of split frequencies: 0.009969
112100 -- (-1986.417) (-1983.326) (-1978.687) [-1991.405] * (-1989.229) [-1990.127] (-1996.654) (-1995.713) -- 0:04:45
112200 -- (-1985.714) (-1989.261) [-1984.434] (-1990.864) * (-1991.546) (-2004.091) [-1990.968] (-1987.444) -- 0:04:44
112300 -- (-1983.503) (-1986.333) [-1982.440] (-1992.636) * (-1985.245) (-2006.948) [-1991.555] (-1994.330) -- 0:04:44
112400 -- (-1983.916) (-1985.414) [-1984.028] (-1995.140) * (-1995.199) (-1998.993) [-1991.263] (-1992.287) -- 0:04:44
112500 -- [-1984.187] (-1986.809) (-1991.622) (-1993.329) * (-1989.912) (-1998.057) [-1990.619] (-1996.237) -- 0:04:44
112600 -- (-1990.539) [-1984.779] (-2009.661) (-1994.976) * [-1984.734] (-2001.770) (-1996.954) (-2000.364) -- 0:04:43
112700 -- (-1986.884) [-1988.533] (-1996.212) (-1997.480) * [-1987.912] (-1999.047) (-1997.042) (-2005.114) -- 0:04:43
112800 -- (-1986.185) [-1984.609] (-1997.484) (-1995.147) * (-1992.142) [-2003.157] (-1995.602) (-1999.552) -- 0:04:43
112900 -- [-1989.726] (-1985.763) (-1998.498) (-1996.581) * (-1999.569) (-2013.022) [-1983.714] (-1993.182) -- 0:04:42
113000 -- (-1988.858) [-1981.060] (-2008.195) (-1995.684) * (-2011.316) (-1998.539) (-1990.238) [-1994.108] -- 0:04:42
Average standard deviation of split frequencies: 0.009519
113100 -- [-1987.181] (-1982.199) (-1991.748) (-1994.083) * (-2003.496) (-1998.263) (-1989.399) [-1990.736] -- 0:04:42
113200 -- [-1983.196] (-1981.061) (-1986.183) (-1999.321) * (-2005.742) (-1996.692) [-1987.723] (-1990.789) -- 0:04:42
113300 -- (-1990.261) [-1981.064] (-1989.622) (-1992.876) * (-2000.883) (-2002.299) (-1994.302) [-1990.476] -- 0:04:41
113400 -- (-1987.646) (-1986.993) (-1983.879) [-1992.104] * (-1993.100) (-2000.930) (-2004.985) [-1989.414] -- 0:04:41
113500 -- (-1986.679) (-1983.123) [-1978.815] (-1995.766) * [-1996.796] (-2005.737) (-1996.481) (-1987.845) -- 0:04:41
113600 -- (-1997.802) (-1984.504) [-1982.650] (-1994.565) * [-1995.524] (-2009.313) (-1998.240) (-1990.952) -- 0:04:40
113700 -- (-1991.379) [-1985.285] (-1985.993) (-1988.562) * [-1990.179] (-2005.518) (-1994.037) (-1988.747) -- 0:04:40
113800 -- (-1991.219) (-1995.498) (-1993.447) [-1988.699] * (-2007.199) (-2003.869) [-1991.037] (-1990.041) -- 0:04:40
113900 -- (-1989.384) [-1990.782] (-1989.479) (-1984.299) * (-1995.089) (-1999.579) [-1989.470] (-1990.251) -- 0:04:40
114000 -- (-1990.092) (-1997.157) (-1989.492) [-1991.093] * (-2008.043) (-1995.787) (-1989.399) [-1993.991] -- 0:04:39
Average standard deviation of split frequencies: 0.009559
114100 -- [-1994.739] (-1998.223) (-1980.795) (-1992.232) * [-1991.772] (-1991.660) (-1989.957) (-2001.185) -- 0:04:39
114200 -- (-1993.551) (-2000.341) (-1982.194) [-1990.839] * (-1987.996) [-1988.356] (-1988.343) (-2004.725) -- 0:04:46
114300 -- (-2004.042) (-1996.635) [-1981.773] (-1994.432) * [-1986.501] (-1994.990) (-1989.832) (-1998.988) -- 0:04:46
114400 -- (-1998.216) (-1997.176) [-1977.044] (-1996.368) * [-1988.482] (-1987.775) (-1997.411) (-1992.283) -- 0:04:46
114500 -- (-1995.598) (-1996.100) [-1977.002] (-1994.460) * (-1995.078) (-1989.124) (-1996.609) [-1992.891] -- 0:04:46
114600 -- [-1985.675] (-1989.914) (-1983.533) (-1990.844) * (-1995.568) [-1986.590] (-1997.394) (-1987.205) -- 0:04:45
114700 -- [-1986.060] (-1988.370) (-1983.711) (-1994.169) * (-2000.950) (-1988.864) (-1999.886) [-1984.728] -- 0:04:45
114800 -- (-1985.931) (-1988.170) (-1988.124) [-1989.135] * (-2001.315) (-1990.527) (-2001.000) [-1986.295] -- 0:04:45
114900 -- [-1984.900] (-1985.085) (-1982.763) (-1995.321) * [-1994.135] (-1997.000) (-2004.088) (-1986.489) -- 0:04:45
115000 -- (-1989.466) [-1988.232] (-1987.610) (-1990.969) * (-1993.127) (-2003.929) (-2002.694) [-1987.324] -- 0:04:44
Average standard deviation of split frequencies: 0.009353
115100 -- (-1987.112) (-1994.477) [-1985.871] (-1989.611) * (-1993.053) (-2010.316) (-2003.948) [-1988.320] -- 0:04:44
115200 -- (-2000.836) (-1999.170) [-1991.415] (-1987.076) * [-1991.181] (-2002.421) (-2008.795) (-1990.375) -- 0:04:44
115300 -- (-1999.225) (-1994.883) (-1987.502) [-1986.624] * (-2000.010) (-1998.472) (-1995.136) [-1986.894] -- 0:04:43
115400 -- (-1993.383) (-2007.237) [-1993.951] (-1983.314) * (-2000.745) (-2003.476) [-1987.531] (-1987.933) -- 0:04:43
115500 -- (-1991.733) (-1993.496) (-1996.427) [-1985.603] * (-1991.785) (-2004.052) (-1990.635) [-1990.513] -- 0:04:43
115600 -- [-1980.044] (-1994.172) (-1992.415) (-1991.227) * (-1995.165) (-2007.159) (-1993.947) [-1990.111] -- 0:04:43
115700 -- [-1983.493] (-1995.327) (-1995.617) (-1992.564) * (-1998.275) (-1996.289) (-1998.165) [-1989.285] -- 0:04:42
115800 -- [-1987.556] (-1994.330) (-1989.338) (-1996.790) * (-2003.541) [-1996.265] (-2000.382) (-1989.617) -- 0:04:42
115900 -- [-1985.963] (-1994.857) (-2007.064) (-1997.125) * (-2001.547) (-1997.856) (-1995.921) [-1987.660] -- 0:04:42
116000 -- (-1988.979) (-1996.009) (-1997.397) [-1987.885] * (-2000.848) (-2004.086) (-1992.014) [-1985.130] -- 0:04:41
Average standard deviation of split frequencies: 0.009046
116100 -- [-1986.005] (-1995.713) (-1994.270) (-1991.952) * (-2000.124) (-1993.579) [-1991.286] (-1987.385) -- 0:04:41
116200 -- (-1992.582) [-1994.544] (-1991.479) (-2002.537) * [-2001.010] (-1994.532) (-1989.858) (-1986.675) -- 0:04:41
116300 -- (-1989.027) (-1999.798) [-1988.238] (-1996.666) * (-1996.302) (-1991.594) (-1987.413) [-1981.760] -- 0:04:41
116400 -- (-1988.784) (-2005.555) [-1985.690] (-2003.944) * (-1995.729) (-1997.322) (-1988.999) [-1985.529] -- 0:04:40
116500 -- [-1983.499] (-1998.864) (-1993.203) (-2002.092) * (-1989.085) [-1999.040] (-1995.982) (-1983.986) -- 0:04:40
116600 -- [-1983.930] (-1995.707) (-1984.726) (-2005.514) * [-1988.134] (-1992.034) (-1996.812) (-1984.968) -- 0:04:40
116700 -- (-1982.933) (-1997.583) [-1982.779] (-1987.544) * (-2003.353) (-1985.117) (-1989.394) [-1982.042] -- 0:04:40
116800 -- (-1984.836) (-2006.448) [-1988.359] (-1992.368) * (-1997.800) (-1989.180) [-1990.682] (-1987.228) -- 0:04:39
116900 -- [-1986.261] (-1991.761) (-1987.611) (-1998.605) * (-1991.806) (-1987.610) (-1985.623) [-1984.477] -- 0:04:39
117000 -- [-1983.882] (-1995.433) (-1983.096) (-1995.312) * (-1992.880) (-1990.070) (-1989.834) [-1980.553] -- 0:04:39
Average standard deviation of split frequencies: 0.008849
117100 -- [-1985.290] (-1995.864) (-1993.878) (-1989.202) * (-1990.518) (-1996.062) (-1992.413) [-1991.764] -- 0:04:38
117200 -- (-1995.355) (-1993.391) (-1986.874) [-1985.677] * (-2001.091) (-1999.839) (-1987.681) [-1984.379] -- 0:04:38
117300 -- [-1982.616] (-1989.474) (-1992.581) (-1987.561) * (-1991.020) (-2018.651) (-1994.624) [-1986.590] -- 0:04:45
117400 -- [-1985.142] (-1991.180) (-1985.182) (-1987.864) * (-1986.835) (-2004.648) (-2000.602) [-1989.077] -- 0:04:45
117500 -- (-1983.883) (-1986.842) [-1982.436] (-1990.838) * [-1986.456] (-1996.809) (-2002.438) (-1986.906) -- 0:04:45
117600 -- (-1986.943) (-1984.906) [-1977.705] (-1994.291) * (-1987.506) (-1990.987) (-2019.005) [-1981.613] -- 0:04:45
117700 -- (-1985.256) (-1986.861) [-1980.861] (-2006.505) * [-1990.476] (-1988.686) (-2001.881) (-1982.333) -- 0:04:44
117800 -- (-1990.393) (-1986.834) [-1980.846] (-1997.455) * (-1991.204) (-1992.996) (-1994.798) [-1983.457] -- 0:04:44
117900 -- (-1994.169) (-1979.181) [-1979.572] (-1990.798) * (-1989.731) (-1988.896) (-2014.141) [-1982.217] -- 0:04:44
118000 -- (-1991.861) [-1988.084] (-1983.933) (-1996.023) * (-1986.489) (-1990.306) (-2005.524) [-1981.231] -- 0:04:44
Average standard deviation of split frequencies: 0.009121
118100 -- (-1996.628) (-1990.532) [-1987.871] (-1997.901) * (-1988.020) (-1996.370) (-2010.211) [-1980.485] -- 0:04:43
118200 -- [-1986.723] (-1993.740) (-1992.805) (-2007.315) * [-1991.088] (-1997.832) (-2018.544) (-1992.952) -- 0:04:43
118300 -- (-1988.542) [-1988.640] (-1992.738) (-2007.238) * [-1987.161] (-1987.156) (-2009.213) (-1995.320) -- 0:04:43
118400 -- (-1997.066) (-1992.732) [-1991.605] (-2009.011) * [-1983.052] (-1996.398) (-2004.030) (-1993.593) -- 0:04:42
118500 -- (-1991.012) [-1985.742] (-1991.122) (-2008.502) * [-1985.754] (-1996.021) (-2009.807) (-1989.021) -- 0:04:42
118600 -- (-1998.841) [-1982.705] (-1997.339) (-1999.159) * [-1983.445] (-1997.228) (-1993.583) (-1985.591) -- 0:04:42
118700 -- (-1996.533) [-1980.365] (-1994.008) (-1995.100) * (-1989.035) (-1996.669) (-1994.035) [-1981.643] -- 0:04:42
118800 -- (-1989.414) (-1983.470) [-1987.328] (-1999.322) * (-1991.550) (-1999.038) (-1985.450) [-1982.459] -- 0:04:41
118900 -- (-1986.669) [-1979.002] (-1992.431) (-1998.303) * (-1986.226) (-1997.763) [-1982.847] (-1985.401) -- 0:04:41
119000 -- (-1991.838) [-1980.515] (-1989.899) (-1992.556) * (-1989.891) (-2011.445) (-1982.451) [-1985.397] -- 0:04:41
Average standard deviation of split frequencies: 0.009378
119100 -- (-1989.434) [-1981.955] (-1993.392) (-2010.023) * (-1992.004) (-2003.709) (-1985.049) [-1980.407] -- 0:04:41
119200 -- (-1992.071) (-1981.643) (-1986.033) [-1997.264] * (-1998.475) [-1987.694] (-1998.479) (-1984.934) -- 0:04:40
119300 -- (-1984.024) [-1990.208] (-1991.217) (-2004.916) * (-1999.716) (-1988.852) (-1999.103) [-1982.125] -- 0:04:40
119400 -- [-1986.672] (-1987.289) (-1990.986) (-1995.140) * (-2001.378) [-1989.696] (-1993.185) (-1982.886) -- 0:04:40
119500 -- [-1991.151] (-1995.858) (-1993.378) (-1998.598) * (-1995.496) (-1993.111) [-1990.988] (-1982.285) -- 0:04:39
119600 -- (-1986.239) (-1986.431) [-1987.051] (-2000.525) * (-2004.836) (-1988.056) (-1988.173) [-1985.036] -- 0:04:39
119700 -- [-1982.968] (-1987.338) (-1986.076) (-2004.990) * (-2001.566) (-1986.826) (-1994.367) [-1986.052] -- 0:04:39
119800 -- [-1982.452] (-1989.640) (-1985.162) (-1999.508) * (-2005.121) [-1982.701] (-1990.886) (-1989.662) -- 0:04:39
119900 -- [-1981.829] (-1991.485) (-1986.134) (-1999.425) * (-1990.160) [-1984.844] (-1992.620) (-1990.635) -- 0:04:38
120000 -- (-1994.645) (-1996.894) [-1987.751] (-1989.765) * [-1989.327] (-1986.619) (-1991.752) (-2000.659) -- 0:04:38
Average standard deviation of split frequencies: 0.009081
120100 -- (-1998.688) (-1997.224) (-1993.664) [-1988.770] * (-1987.074) [-1981.415] (-1988.061) (-1996.219) -- 0:04:38
120200 -- (-1987.618) [-1992.936] (-1988.805) (-1997.495) * (-1990.295) (-1986.375) [-1987.257] (-1998.100) -- 0:04:38
120300 -- (-1990.831) [-1988.696] (-1982.723) (-1992.302) * (-1985.182) (-1986.630) [-1991.468] (-1994.238) -- 0:04:37
120400 -- (-1994.987) (-1998.680) (-1986.276) [-1995.022] * [-1988.743] (-1990.176) (-1997.749) (-2002.095) -- 0:04:37
120500 -- (-1995.507) (-1994.571) [-1982.478] (-2002.372) * [-1988.625] (-1997.536) (-1994.362) (-2009.216) -- 0:04:44
120600 -- (-2003.999) (-1995.677) [-1976.156] (-2000.911) * [-1986.374] (-1994.908) (-1996.453) (-2000.638) -- 0:04:44
120700 -- (-1995.710) (-1987.535) [-1982.923] (-1995.555) * [-1992.822] (-1999.078) (-1996.127) (-2003.293) -- 0:04:44
120800 -- (-2004.567) [-1993.672] (-1982.883) (-2005.276) * (-1995.143) [-1991.972] (-2003.299) (-2002.210) -- 0:04:43
120900 -- (-1992.702) (-1991.364) [-1980.782] (-2005.334) * [-1995.980] (-1996.656) (-2009.918) (-1991.433) -- 0:04:43
121000 -- [-1982.296] (-2000.010) (-1983.503) (-1992.558) * (-1994.975) (-1987.211) (-1996.343) [-1985.552] -- 0:04:43
Average standard deviation of split frequencies: 0.008446
121100 -- [-1985.327] (-2001.064) (-1982.107) (-1986.764) * [-1995.400] (-1994.706) (-1997.225) (-1988.825) -- 0:04:43
121200 -- (-1989.511) (-1997.185) [-1983.846] (-1992.214) * (-1990.393) (-1996.872) (-1993.521) [-1988.824] -- 0:04:42
121300 -- (-1994.267) [-1989.316] (-1986.739) (-1990.209) * (-1989.583) (-2002.987) (-1994.464) [-1988.826] -- 0:04:42
121400 -- (-1995.333) [-1984.732] (-1994.990) (-1997.704) * [-1987.481] (-2008.184) (-1992.806) (-1998.833) -- 0:04:42
121500 -- (-1989.147) [-1982.665] (-1993.509) (-1996.180) * (-1993.173) (-2003.416) (-1994.018) [-1993.925] -- 0:04:41
121600 -- (-1979.299) [-1982.034] (-1998.158) (-2003.236) * (-1992.549) [-1992.185] (-1994.143) (-1997.144) -- 0:04:41
121700 -- [-1984.453] (-1986.386) (-1998.760) (-2000.839) * (-1993.043) [-1991.328] (-1991.309) (-1994.867) -- 0:04:41
121800 -- [-1979.636] (-1986.107) (-2001.287) (-2004.501) * (-1993.865) (-1997.238) (-1991.848) [-1997.167] -- 0:04:41
121900 -- [-1981.566] (-1987.869) (-2007.775) (-1999.169) * [-1992.076] (-1998.795) (-1992.075) (-2006.497) -- 0:04:40
122000 -- [-1984.813] (-1984.168) (-2002.286) (-1988.134) * [-1992.202] (-2000.515) (-2000.281) (-1994.825) -- 0:04:40
Average standard deviation of split frequencies: 0.007940
122100 -- [-1986.567] (-1987.037) (-1994.008) (-1990.801) * (-1991.800) (-2001.769) (-1998.691) [-1991.157] -- 0:04:40
122200 -- [-1985.947] (-1982.824) (-1990.863) (-1991.946) * [-1987.781] (-1994.280) (-1997.197) (-1986.999) -- 0:04:40
122300 -- (-1991.500) (-1981.363) (-1985.815) [-1991.188] * [-1985.043] (-1985.986) (-1991.534) (-1991.336) -- 0:04:39
122400 -- (-1987.411) [-1980.499] (-1990.232) (-1998.528) * (-1987.600) [-1988.235] (-1989.095) (-1995.590) -- 0:04:39
122500 -- (-1987.039) (-1982.820) (-1987.903) [-1993.757] * (-1993.006) (-1987.353) [-1989.838] (-1998.608) -- 0:04:39
122600 -- (-1991.755) (-1987.962) [-1987.332] (-2001.707) * (-1997.195) (-1991.585) [-1989.884] (-1989.281) -- 0:04:39
122700 -- (-1986.550) (-1995.380) [-1984.899] (-1993.474) * (-1992.484) (-1996.817) (-1994.243) [-1994.191] -- 0:04:38
122800 -- [-1988.320] (-1991.236) (-1986.935) (-2013.205) * (-1990.751) (-1998.679) (-1992.667) [-1994.674] -- 0:04:38
122900 -- [-1984.457] (-1996.121) (-1987.760) (-2002.437) * (-1990.113) (-1991.202) [-1985.643] (-1993.909) -- 0:04:38
123000 -- (-1982.887) (-1998.982) [-1988.207] (-2000.051) * (-1991.222) (-1987.370) [-1988.094] (-1992.581) -- 0:04:38
Average standard deviation of split frequencies: 0.008309
123100 -- [-1983.630] (-2000.768) (-1985.439) (-2001.999) * (-1997.536) (-1997.436) [-1990.457] (-1994.616) -- 0:04:37
123200 -- [-1980.044] (-2005.241) (-1981.310) (-1999.563) * (-2003.341) (-1995.226) [-1986.890] (-1999.394) -- 0:04:37
123300 -- (-1992.453) (-1996.794) [-1979.691] (-2002.360) * (-2001.251) [-1989.748] (-1987.642) (-1990.979) -- 0:04:37
123400 -- [-1993.094] (-2004.905) (-1990.168) (-2002.081) * [-1998.801] (-1990.359) (-1985.853) (-1997.332) -- 0:04:37
123500 -- [-1984.631] (-1998.630) (-1999.036) (-1993.492) * (-1997.546) [-1986.755] (-1985.660) (-1997.393) -- 0:04:36
123600 -- [-1989.064] (-2001.743) (-1999.396) (-1994.271) * (-1993.035) [-1985.086] (-1988.557) (-1999.711) -- 0:04:43
123700 -- (-1987.574) (-1995.965) (-2001.180) [-1992.084] * (-1990.091) [-1986.506] (-1994.610) (-2002.566) -- 0:04:43
123800 -- [-1984.860] (-2000.079) (-1988.638) (-1996.445) * (-1986.980) (-1989.374) (-1991.965) [-1993.205] -- 0:04:43
123900 -- [-1981.867] (-2001.513) (-1984.025) (-1992.836) * (-1988.706) (-1989.261) [-1985.158] (-1991.998) -- 0:04:42
124000 -- [-1986.105] (-1997.819) (-1988.714) (-2000.018) * (-1991.016) [-1988.530] (-1990.328) (-1992.589) -- 0:04:42
Average standard deviation of split frequencies: 0.008138
124100 -- (-1993.089) (-1996.912) [-1987.142] (-2001.459) * [-1996.477] (-2001.787) (-1991.718) (-1990.148) -- 0:04:42
124200 -- (-1991.793) (-1999.854) [-1985.561] (-1992.397) * (-1994.420) [-1997.185] (-1988.960) (-2002.861) -- 0:04:42
124300 -- (-1985.246) (-2001.234) [-1980.461] (-1992.243) * [-1991.946] (-1997.025) (-1990.192) (-2006.297) -- 0:04:41
124400 -- (-1982.983) (-1998.715) [-1980.920] (-1995.121) * (-1992.331) (-2000.209) [-1989.088] (-1998.497) -- 0:04:41
124500 -- (-1984.867) (-2005.174) (-1982.671) [-1989.522] * [-1989.927] (-1996.724) (-1993.636) (-1994.957) -- 0:04:41
124600 -- [-1989.908] (-2008.768) (-1991.234) (-1988.709) * [-1990.468] (-2002.374) (-1991.702) (-1997.673) -- 0:04:41
124700 -- [-1982.115] (-2000.274) (-1983.680) (-1988.991) * (-1992.652) [-1992.526] (-1991.302) (-1998.433) -- 0:04:40
124800 -- (-1988.575) (-1995.411) (-1989.709) [-1988.946] * (-1992.438) (-1994.207) [-1989.787] (-2007.741) -- 0:04:40
124900 -- (-1988.686) (-1987.694) (-1984.317) [-1988.761] * (-1988.304) (-1991.260) [-1990.509] (-2009.673) -- 0:04:40
125000 -- (-1984.833) (-1997.159) [-1989.793] (-1989.719) * [-1986.575] (-1992.672) (-1986.216) (-2005.276) -- 0:04:40
Average standard deviation of split frequencies: 0.007746
125100 -- (-1981.180) (-1996.025) [-1991.181] (-1994.702) * [-1991.533] (-1993.549) (-1994.759) (-2003.153) -- 0:04:39
125200 -- (-1987.055) [-1990.611] (-1984.995) (-1994.930) * [-1995.165] (-1994.115) (-1995.141) (-1998.996) -- 0:04:39
125300 -- (-1984.727) [-1983.735] (-1983.540) (-1989.703) * [-1990.434] (-2001.246) (-1989.886) (-2001.401) -- 0:04:39
125400 -- (-1988.713) [-1979.770] (-1989.512) (-1994.465) * (-1999.137) (-1993.216) [-1991.386] (-1991.604) -- 0:04:38
125500 -- (-1998.497) [-1981.987] (-1985.205) (-1989.117) * [-1985.450] (-1995.900) (-1993.628) (-1987.498) -- 0:04:38
125600 -- (-1999.001) [-1983.686] (-1986.765) (-1987.256) * (-1996.492) (-1998.296) [-1991.067] (-1993.836) -- 0:04:38
125700 -- (-1993.702) [-1984.025] (-1985.103) (-1992.316) * (-1988.198) (-1995.795) [-1989.502] (-1997.661) -- 0:04:38
125800 -- (-1994.655) (-1982.984) [-1978.209] (-2006.876) * (-1986.754) (-2001.677) [-1991.205] (-2000.472) -- 0:04:37
125900 -- (-1995.906) (-1983.628) [-1979.812] (-1999.352) * [-1986.534] (-1998.787) (-1998.115) (-1998.339) -- 0:04:37
126000 -- (-2002.078) (-1989.496) [-1980.055] (-1987.578) * (-1991.789) [-1994.660] (-1997.953) (-1995.460) -- 0:04:37
Average standard deviation of split frequencies: 0.007475
126100 -- (-2012.444) (-1983.649) [-1982.282] (-1989.002) * (-1999.136) [-1990.995] (-1997.951) (-2003.716) -- 0:04:37
126200 -- (-2019.366) (-1989.089) [-1986.693] (-1988.836) * [-1991.162] (-1987.419) (-1993.617) (-1999.256) -- 0:04:36
126300 -- (-2014.966) (-1990.778) [-1987.919] (-2003.267) * (-1997.288) (-1984.898) [-1991.225] (-1995.066) -- 0:04:36
126400 -- (-2014.990) (-1996.429) [-1982.090] (-2004.115) * (-1993.243) [-1987.822] (-1988.836) (-1998.170) -- 0:04:36
126500 -- (-2004.685) (-1981.564) [-1983.559] (-2015.129) * (-1986.568) [-1987.813] (-1988.668) (-1998.037) -- 0:04:36
126600 -- (-2005.013) (-1986.295) (-1987.262) [-1994.019] * [-1989.478] (-1989.591) (-2002.216) (-2003.002) -- 0:04:35
126700 -- (-2001.706) (-1984.179) [-1983.138] (-1992.743) * [-1990.103] (-1994.808) (-1998.573) (-1993.362) -- 0:04:42
126800 -- (-1997.311) (-1985.116) [-1980.375] (-1995.213) * (-1992.422) (-2001.376) (-1989.438) [-1987.826] -- 0:04:42
126900 -- (-1989.057) (-1980.297) [-1980.360] (-1989.696) * (-1989.207) (-1994.519) (-1988.246) [-1990.976] -- 0:04:42
127000 -- (-1988.173) (-1982.713) [-1984.023] (-1996.795) * [-1989.641] (-1991.189) (-1992.209) (-2000.139) -- 0:04:41
Average standard deviation of split frequencies: 0.007518
127100 -- (-1992.094) [-1984.480] (-1990.378) (-2001.125) * (-1993.936) (-1987.570) [-1991.637] (-2001.549) -- 0:04:41
127200 -- (-1995.259) (-1985.581) [-1982.653] (-1993.793) * (-1993.886) [-1995.757] (-1986.323) (-2000.108) -- 0:04:41
127300 -- (-1981.239) (-1989.393) (-1989.981) [-1990.410] * (-1988.196) [-1989.769] (-1990.495) (-2001.593) -- 0:04:41
127400 -- [-1987.050] (-1991.602) (-1995.737) (-1992.036) * (-1989.982) (-2002.920) [-1986.789] (-1991.704) -- 0:04:40
127500 -- (-1989.525) [-1991.122] (-1991.406) (-1992.920) * (-1988.508) (-2001.256) [-1983.737] (-1995.842) -- 0:04:40
127600 -- (-1991.616) (-1998.025) (-1989.807) [-1987.039] * [-1991.732] (-2002.909) (-1987.759) (-1994.365) -- 0:04:40
127700 -- (-1997.369) (-1995.785) [-1987.190] (-1988.375) * (-1987.773) (-2002.414) [-1984.385] (-1990.505) -- 0:04:40
127800 -- (-2013.780) (-1994.151) [-1986.019] (-1988.770) * (-1988.834) (-1999.129) [-1985.703] (-1992.744) -- 0:04:39
127900 -- (-2015.688) (-1989.840) (-1993.700) [-1988.509] * [-1991.946] (-1997.310) (-1993.081) (-1994.253) -- 0:04:39
128000 -- (-2022.910) (-1988.182) [-1992.056] (-1993.807) * (-1991.480) [-1995.524] (-1992.332) (-1996.792) -- 0:04:39
Average standard deviation of split frequencies: 0.007253
128100 -- (-2015.818) (-1990.753) (-1995.628) [-1990.653] * (-1988.176) (-1993.879) [-1991.566] (-2002.021) -- 0:04:39
128200 -- (-1996.351) [-1983.577] (-1996.931) (-1997.870) * [-1986.717] (-1987.468) (-2000.082) (-2005.788) -- 0:04:38
128300 -- (-1992.235) (-1985.685) [-1995.252] (-2001.220) * (-1985.700) [-1985.209] (-1985.046) (-1989.435) -- 0:04:38
128400 -- (-1989.353) [-1984.343] (-1989.842) (-2004.811) * (-1996.715) (-1991.606) (-1987.276) [-1992.229] -- 0:04:38
128500 -- (-1997.795) [-1982.657] (-1991.328) (-1996.304) * (-1996.008) [-1991.350] (-1990.176) (-1997.341) -- 0:04:38
128600 -- (-1996.219) [-1984.388] (-1987.221) (-1991.071) * (-1998.403) (-1989.365) [-1991.276] (-1993.260) -- 0:04:37
128700 -- [-1989.336] (-1985.880) (-1988.425) (-1990.295) * (-1990.735) (-1992.334) [-1985.226] (-1996.087) -- 0:04:37
128800 -- (-1987.580) [-1990.975] (-1996.181) (-1993.850) * (-1991.662) (-1989.744) [-1983.913] (-1995.744) -- 0:04:37
128900 -- (-1983.634) [-1987.956] (-1995.897) (-1994.302) * (-1989.182) (-1995.101) (-1985.944) [-1991.626] -- 0:04:37
129000 -- [-1985.406] (-1983.881) (-2011.839) (-1991.572) * (-1987.118) (-2005.694) [-1984.577] (-1986.285) -- 0:04:36
Average standard deviation of split frequencies: 0.007193
129100 -- (-1985.259) (-1984.746) (-1997.266) [-1987.710] * (-1988.218) (-1992.930) [-1987.743] (-1988.394) -- 0:04:36
129200 -- (-1990.072) [-1989.621] (-2006.031) (-1989.558) * (-2003.884) (-1998.715) (-1986.609) [-1985.521] -- 0:04:36
129300 -- [-1988.821] (-1983.304) (-2011.385) (-1988.832) * (-1998.637) (-1987.956) [-1991.346] (-1985.961) -- 0:04:36
129400 -- (-1993.431) [-1986.500] (-2017.096) (-1989.224) * (-1995.590) (-1994.464) (-1998.511) [-1990.272] -- 0:04:35
129500 -- (-1990.476) [-1980.846] (-2009.109) (-1987.808) * (-1995.174) (-1990.852) (-2000.615) [-1991.724] -- 0:04:35
129600 -- (-1991.375) [-1980.789] (-2005.910) (-1991.703) * (-2000.362) [-1990.905] (-1994.705) (-1985.284) -- 0:04:35
129700 -- [-1987.914] (-1990.000) (-2002.601) (-1985.941) * (-1995.975) [-1985.537] (-1997.663) (-1988.049) -- 0:04:35
129800 -- (-1985.525) [-1982.115] (-1998.147) (-1985.769) * (-1990.458) (-1988.365) (-1996.992) [-1985.994] -- 0:04:41
129900 -- (-1984.446) [-1986.446] (-1999.966) (-1989.256) * (-1989.537) [-1989.380] (-1997.440) (-1988.499) -- 0:04:41
130000 -- (-1988.904) (-1990.399) (-1998.013) [-1983.062] * (-1987.464) (-1992.605) (-2002.588) [-1991.578] -- 0:04:41
Average standard deviation of split frequencies: 0.007348
130100 -- (-1993.493) (-1994.879) (-1997.746) [-1989.443] * [-1989.692] (-1994.907) (-1997.754) (-1998.320) -- 0:04:40
130200 -- (-1999.103) [-1988.230] (-2008.058) (-1983.668) * (-1986.899) (-1994.763) [-1989.163] (-1998.614) -- 0:04:40
130300 -- (-1998.020) [-1982.209] (-2001.071) (-1984.087) * (-1990.617) [-1992.445] (-1987.831) (-1990.989) -- 0:04:40
130400 -- (-2000.817) [-1983.406] (-2001.999) (-1995.588) * (-1994.527) (-1991.389) [-1990.360] (-1995.627) -- 0:04:40
130500 -- (-2001.482) [-1980.613] (-2005.125) (-1994.407) * (-1991.730) (-1995.636) [-1989.534] (-2005.779) -- 0:04:39
130600 -- (-1998.809) [-1983.381] (-1995.902) (-1993.233) * (-1987.531) [-1986.891] (-1990.724) (-1999.681) -- 0:04:39
130700 -- (-2007.804) [-1979.749] (-1993.339) (-1990.999) * (-1990.990) [-1987.621] (-2002.972) (-2004.328) -- 0:04:39
130800 -- (-1998.854) [-1985.851] (-1986.066) (-1994.021) * [-1991.326] (-1992.591) (-1998.604) (-1998.145) -- 0:04:39
130900 -- (-2009.287) (-1987.249) [-1985.336] (-2008.875) * [-1993.356] (-1991.884) (-2000.087) (-1995.634) -- 0:04:38
131000 -- (-1995.435) [-1984.386] (-1989.776) (-2002.518) * (-1991.739) (-1990.482) (-1997.714) [-1992.036] -- 0:04:38
Average standard deviation of split frequencies: 0.006673
131100 -- (-1996.811) (-1985.320) [-1987.903] (-1992.942) * (-1990.187) (-1992.211) (-1996.847) [-1993.214] -- 0:04:38
131200 -- (-1996.517) [-1982.214] (-1987.935) (-1997.196) * [-1990.002] (-1996.317) (-1992.181) (-2001.715) -- 0:04:38
131300 -- (-1991.269) [-1985.478] (-1986.812) (-1989.337) * (-1985.747) [-1990.571] (-1994.379) (-1997.066) -- 0:04:37
131400 -- (-1985.495) [-1981.397] (-1988.550) (-1989.807) * [-1984.505] (-2000.239) (-1990.800) (-1996.876) -- 0:04:37
131500 -- (-1989.557) [-1983.701] (-1996.672) (-1998.899) * (-1987.543) [-2002.644] (-1989.546) (-1998.698) -- 0:04:37
131600 -- (-1993.509) [-1982.097] (-1993.490) (-1992.423) * [-1984.733] (-1996.764) (-1987.343) (-1992.742) -- 0:04:37
131700 -- (-1989.686) [-1986.198] (-1994.704) (-1987.615) * (-1987.877) (-1994.939) [-1985.968] (-1993.158) -- 0:04:36
131800 -- (-1988.023) [-1983.023] (-2001.258) (-1989.348) * [-1989.325] (-1999.782) (-1997.052) (-1989.933) -- 0:04:36
131900 -- (-1993.945) (-1988.324) (-1997.168) [-1982.193] * (-1984.919) (-1993.462) (-2001.947) [-1988.379] -- 0:04:36
132000 -- (-1990.313) (-1986.269) (-2001.374) [-1983.716] * (-1986.102) [-1991.752] (-2001.600) (-1984.088) -- 0:04:36
Average standard deviation of split frequencies: 0.006626
132100 -- (-1990.977) [-1987.190] (-2004.097) (-1992.037) * (-1984.496) (-1995.150) (-1996.403) [-1980.939] -- 0:04:35
132200 -- [-1991.858] (-1990.710) (-1996.292) (-1986.526) * (-1985.421) (-1993.133) (-2006.155) [-1984.105] -- 0:04:35
132300 -- (-1992.789) (-1992.180) [-1994.936] (-1989.970) * [-1983.935] (-1991.887) (-1998.886) (-1988.335) -- 0:04:35
132400 -- [-1989.503] (-1993.237) (-1998.988) (-1997.604) * [-1985.000] (-1993.924) (-1994.819) (-1989.140) -- 0:04:35
132500 -- [-1989.868] (-1996.293) (-1989.937) (-1997.454) * [-1986.926] (-1993.347) (-1990.993) (-1991.868) -- 0:04:34
132600 -- (-1991.393) (-1998.458) (-1992.539) [-1987.022] * [-1990.359] (-1991.257) (-1984.882) (-1993.508) -- 0:04:34
132700 -- (-1990.347) (-1998.080) (-1993.714) [-1986.244] * (-1997.485) (-1997.718) [-1983.940] (-1985.955) -- 0:04:34
132800 -- (-1990.619) (-2004.326) (-2004.474) [-1985.234] * (-2000.940) (-1996.808) (-1985.513) [-1986.566] -- 0:04:34
132900 -- (-1989.965) (-2008.830) (-2002.020) [-1989.247] * (-1999.319) (-1994.791) [-1986.850] (-1990.224) -- 0:04:34
133000 -- (-1994.323) (-1996.086) (-1996.907) [-1988.231] * (-1997.691) (-1992.590) [-1988.127] (-1994.745) -- 0:04:40
Average standard deviation of split frequencies: 0.006067
133100 -- (-1994.018) (-1991.272) (-1997.882) [-1983.856] * (-1995.662) (-1997.240) [-1991.516] (-2001.739) -- 0:04:40
133200 -- (-1993.645) (-1995.262) (-1993.828) [-1984.445] * (-2000.531) (-1997.651) (-1987.234) [-1991.948] -- 0:04:39
133300 -- (-1996.063) (-1990.851) (-1986.790) [-1984.851] * (-1998.518) (-1990.818) [-1991.489] (-1992.556) -- 0:04:39
133400 -- (-1990.144) (-1994.879) [-1985.446] (-1991.847) * (-2007.624) [-1994.203] (-2000.406) (-1989.759) -- 0:04:39
133500 -- (-1985.651) (-1995.532) (-1988.843) [-1987.174] * (-1996.445) (-1988.305) [-1997.022] (-1991.290) -- 0:04:39
133600 -- [-1986.668] (-1990.762) (-1997.789) (-1988.870) * [-1992.227] (-1989.336) (-1997.103) (-1988.228) -- 0:04:38
133700 -- (-1995.028) [-1981.941] (-2008.571) (-1982.924) * (-1998.387) [-1985.201] (-1998.266) (-1984.439) -- 0:04:38
133800 -- (-1993.787) (-1987.865) (-2004.073) [-1985.132] * (-2000.650) [-1985.959] (-1992.646) (-1986.731) -- 0:04:38
133900 -- (-1986.204) [-1986.040] (-1993.322) (-1985.088) * (-1990.884) [-1986.877] (-1988.909) (-1996.739) -- 0:04:38
134000 -- (-1988.382) [-1980.132] (-1995.561) (-1990.813) * (-1989.436) (-1992.124) [-1989.480] (-1988.024) -- 0:04:37
Average standard deviation of split frequencies: 0.006527
134100 -- (-1996.230) [-1978.443] (-1998.439) (-1981.381) * (-1991.754) (-1986.907) [-1991.462] (-1994.546) -- 0:04:37
134200 -- (-1988.330) [-1982.781] (-1999.726) (-1988.317) * (-1989.896) (-1989.494) (-1986.636) [-1990.721] -- 0:04:37
134300 -- (-1993.736) [-1982.647] (-2000.845) (-1992.276) * (-1993.872) [-1987.291] (-1990.058) (-1994.335) -- 0:04:37
134400 -- (-1997.119) (-1982.998) (-2003.865) [-1985.703] * (-1990.998) [-1986.294] (-1987.753) (-1989.996) -- 0:04:36
134500 -- (-1997.753) [-1987.792] (-2002.812) (-1982.712) * (-1992.909) [-1987.665] (-1988.731) (-1996.353) -- 0:04:36
134600 -- (-1994.791) (-1982.229) (-2000.372) [-1982.270] * [-1990.740] (-1988.152) (-1998.703) (-1993.438) -- 0:04:36
134700 -- (-1996.285) (-1993.144) (-1996.958) [-1983.263] * (-1992.093) (-1993.401) [-1988.600] (-1989.873) -- 0:04:36
134800 -- (-1998.968) (-1992.400) (-1991.174) [-1986.221] * (-1990.651) [-1986.302] (-1995.157) (-1998.400) -- 0:04:35
134900 -- (-2003.735) (-1988.754) [-1991.786] (-1986.466) * (-1991.057) (-1992.670) (-1988.912) [-1987.916] -- 0:04:35
135000 -- (-1993.563) (-1988.887) [-1986.908] (-1988.302) * (-1992.679) (-1996.034) [-1989.995] (-1990.159) -- 0:04:35
Average standard deviation of split frequencies: 0.006475
135100 -- (-1991.206) (-1988.721) (-1989.086) [-1984.693] * (-1986.411) (-1999.718) [-1989.699] (-1994.425) -- 0:04:35
135200 -- [-1986.546] (-1991.594) (-1992.724) (-1986.163) * (-1990.485) (-1997.247) [-1991.576] (-1997.706) -- 0:04:35
135300 -- [-1985.600] (-1990.584) (-1987.262) (-1985.994) * [-1991.202] (-1999.648) (-1990.249) (-2000.658) -- 0:04:34
135400 -- (-1989.346) (-1990.349) (-1990.367) [-1984.491] * [-1995.125] (-1998.767) (-1993.349) (-1997.667) -- 0:04:34
135500 -- (-1987.165) (-1993.485) (-1997.796) [-1978.273] * (-1992.365) (-1990.353) [-1991.909] (-2000.968) -- 0:04:34
135600 -- (-1990.151) (-1994.305) (-1993.958) [-1979.979] * [-1983.702] (-1996.137) (-1985.411) (-1997.088) -- 0:04:34
135700 -- (-2006.154) (-2002.919) (-1993.690) [-1979.125] * (-1988.542) (-2000.442) [-1984.918] (-1993.505) -- 0:04:33
135800 -- (-1994.035) (-2009.521) (-1996.141) [-1979.917] * (-1995.792) (-1992.136) [-1985.163] (-1999.983) -- 0:04:33
135900 -- (-1995.262) (-1997.626) (-1991.608) [-1981.386] * (-1989.755) (-1995.694) [-1987.018] (-1999.209) -- 0:04:33
136000 -- [-1993.264] (-2001.168) (-1993.041) (-1985.808) * (-1995.521) (-1991.610) [-1991.662] (-1990.623) -- 0:04:33
Average standard deviation of split frequencies: 0.007025
136100 -- (-1995.198) (-1997.152) (-1991.155) [-1983.822] * (-1998.778) (-1991.997) (-1992.211) [-1994.159] -- 0:04:39
136200 -- (-1987.963) (-2004.550) [-1991.414] (-1990.409) * (-2001.290) (-1996.066) (-1992.322) [-1990.005] -- 0:04:39
136300 -- [-1988.699] (-1990.474) (-1986.250) (-1990.375) * [-1998.118] (-1993.645) (-1995.007) (-1993.785) -- 0:04:38
136400 -- (-1991.599) (-1985.349) (-1986.297) [-1986.784] * (-1999.181) [-1989.031] (-1996.238) (-1992.883) -- 0:04:38
136500 -- [-1988.905] (-1988.653) (-1985.172) (-1991.062) * (-1987.706) (-1990.999) (-1997.756) [-1997.599] -- 0:04:38
136600 -- (-1988.004) (-1991.406) (-1981.579) [-1991.404] * [-1988.532] (-2008.624) (-1993.559) (-2002.768) -- 0:04:38
136700 -- (-1993.821) (-1996.262) [-1990.272] (-1987.584) * [-1986.738] (-2006.595) (-1992.309) (-1994.954) -- 0:04:37
136800 -- (-1989.324) (-1992.477) (-1986.812) [-1984.474] * [-1984.918] (-1998.647) (-1993.235) (-1991.009) -- 0:04:37
136900 -- (-1986.484) (-1987.423) [-1988.696] (-1989.887) * (-1995.364) (-1996.594) (-1990.328) [-1986.508] -- 0:04:37
137000 -- (-1989.692) [-1983.475] (-1991.991) (-1991.452) * (-1991.045) (-1998.185) (-1991.185) [-1988.951] -- 0:04:37
Average standard deviation of split frequencies: 0.006577
137100 -- [-1981.964] (-1986.272) (-1987.789) (-1995.242) * (-1992.296) (-1996.780) [-1990.282] (-1988.470) -- 0:04:36
137200 -- (-1985.877) (-1987.082) (-1986.086) [-1991.544] * (-1997.770) (-1997.136) [-1990.992] (-1988.154) -- 0:04:36
137300 -- (-1985.498) [-1980.571] (-1987.198) (-1996.615) * (-1998.202) (-1999.108) (-1997.140) [-1990.157] -- 0:04:36
137400 -- (-1986.252) [-1983.780] (-1987.012) (-1998.910) * [-1992.590] (-1997.283) (-1996.357) (-1988.888) -- 0:04:36
137500 -- (-1987.006) [-1981.724] (-1984.198) (-1995.461) * (-1991.225) (-1993.912) [-1988.902] (-1995.095) -- 0:04:36
137600 -- (-1990.364) (-1984.198) [-1981.167] (-2000.611) * [-1992.178] (-1994.497) (-1988.247) (-1995.936) -- 0:04:35
137700 -- (-1988.905) [-1988.856] (-1977.705) (-1991.748) * (-1992.122) (-1995.153) (-1989.268) [-1993.700] -- 0:04:35
137800 -- (-1988.580) (-1983.964) [-1979.698] (-1994.961) * [-1986.956] (-1986.654) (-1992.271) (-1998.241) -- 0:04:35
137900 -- (-1993.128) (-1986.832) [-1980.620] (-1996.609) * (-1989.781) (-1990.223) [-1988.701] (-1989.982) -- 0:04:35
138000 -- (-1995.692) (-1992.374) [-1984.072] (-1991.553) * (-1990.190) (-1995.437) [-1983.903] (-1985.394) -- 0:04:34
Average standard deviation of split frequencies: 0.005850
138100 -- (-1988.687) (-1992.467) [-1983.099] (-1991.118) * (-1993.058) (-1998.258) (-1992.022) [-1993.685] -- 0:04:34
138200 -- (-1989.677) (-1987.659) (-1992.006) [-1988.519] * (-1997.130) (-1990.456) [-1985.357] (-1988.837) -- 0:04:34
138300 -- [-1984.550] (-1993.789) (-1988.351) (-1993.119) * (-1998.417) (-1996.033) [-1985.944] (-1989.324) -- 0:04:34
138400 -- [-1983.110] (-1991.049) (-1992.322) (-1985.461) * (-1996.228) (-1997.338) [-1986.947] (-1991.798) -- 0:04:33
138500 -- (-1984.873) (-2000.192) [-1989.058] (-1981.626) * (-1995.549) [-1993.061] (-1990.756) (-1991.269) -- 0:04:33
138600 -- (-1990.944) [-1992.738] (-1999.972) (-1986.284) * (-1997.225) (-1990.883) (-1992.847) [-1989.645] -- 0:04:33
138700 -- (-1998.250) (-1995.200) (-1994.898) [-1985.421] * (-2000.861) (-1991.134) (-1993.898) [-1986.286] -- 0:04:33
138800 -- (-1994.963) (-1991.514) (-2004.604) [-1983.062] * (-2003.624) [-1991.146] (-1994.389) (-1989.640) -- 0:04:33
138900 -- (-1993.004) (-1986.255) (-1998.571) [-1983.060] * (-2000.442) (-1995.117) (-1992.518) [-1992.354] -- 0:04:32
139000 -- (-1991.105) (-1989.869) [-1988.653] (-1985.553) * (-1987.614) (-1997.451) (-1998.260) [-1987.550] -- 0:04:32
Average standard deviation of split frequencies: 0.005805
139100 -- (-1993.688) [-1979.081] (-1986.179) (-1994.779) * (-1986.331) (-1994.047) (-1998.757) [-1993.800] -- 0:04:32
139200 -- (-1992.989) [-1985.926] (-1987.077) (-1991.892) * (-1989.586) (-1995.774) [-1993.646] (-1991.267) -- 0:04:32
139300 -- (-2000.342) (-1993.262) [-1986.541] (-2002.267) * [-1996.152] (-1993.390) (-1992.888) (-1996.428) -- 0:04:38
139400 -- (-1992.022) (-1992.109) [-1987.592] (-1988.611) * [-1989.223] (-1995.380) (-1994.029) (-1997.192) -- 0:04:37
139500 -- (-1993.125) (-1995.921) (-1987.833) [-1983.446] * (-1988.637) (-1996.204) (-1992.304) [-1990.983] -- 0:04:37
139600 -- (-1994.732) (-2001.916) (-1992.141) [-1981.649] * (-2002.094) [-1985.865] (-1985.606) (-1999.671) -- 0:04:37
139700 -- (-2004.792) (-1998.598) (-1989.334) [-1988.317] * (-2001.567) (-1990.113) [-1984.855] (-1990.496) -- 0:04:37
139800 -- (-2011.598) (-2002.982) (-1991.849) [-1986.067] * (-1993.010) (-1993.819) [-1986.785] (-1997.049) -- 0:04:36
139900 -- (-2003.911) (-1999.226) (-1988.491) [-1988.656] * (-1999.281) [-1991.578] (-1987.431) (-2000.668) -- 0:04:36
140000 -- (-2005.266) (-1999.370) (-1993.065) [-1985.802] * (-1992.185) (-1990.164) [-1989.131] (-2000.056) -- 0:04:36
Average standard deviation of split frequencies: 0.006055
140100 -- (-1988.827) (-1995.221) (-1985.024) [-1977.803] * (-1992.367) (-1997.851) (-1989.093) [-1992.452] -- 0:04:36
140200 -- (-1986.406) (-1995.739) (-1978.522) [-1985.617] * [-1985.428] (-2002.422) (-1990.593) (-1989.510) -- 0:04:35
140300 -- (-1989.080) (-1997.661) [-1982.275] (-1986.687) * [-1988.573] (-2007.683) (-1992.184) (-1992.462) -- 0:04:35
140400 -- (-1990.342) (-1987.556) (-1988.918) [-1986.855] * [-1986.254] (-2002.262) (-1995.764) (-1993.463) -- 0:04:35
140500 -- (-1996.664) (-1984.324) [-1987.314] (-1987.530) * (-1983.053) (-2001.234) (-1996.710) [-1985.915] -- 0:04:35
140600 -- (-1990.968) [-1984.476] (-1990.069) (-1988.750) * (-1987.333) (-1993.179) (-2004.854) [-1986.612] -- 0:04:35
140700 -- (-1991.751) (-1982.760) [-1983.078] (-1989.304) * (-1987.942) (-1997.168) (-2001.736) [-1986.448] -- 0:04:34
140800 -- (-1991.206) [-1982.285] (-1987.701) (-1987.580) * (-1988.827) (-1999.783) (-1999.469) [-1984.976] -- 0:04:34
140900 -- (-1993.171) (-1983.111) [-1986.219] (-1987.680) * (-1987.137) (-1996.633) (-2005.749) [-1990.879] -- 0:04:34
141000 -- (-2002.663) [-1982.749] (-1983.632) (-1987.674) * [-1987.401] (-1985.874) (-2002.306) (-1988.922) -- 0:04:34
Average standard deviation of split frequencies: 0.006200
141100 -- (-1998.483) [-1983.678] (-1993.838) (-1986.142) * [-1988.651] (-1989.402) (-2008.493) (-1993.174) -- 0:04:33
141200 -- (-1998.862) [-1978.664] (-1987.230) (-1990.861) * (-1992.964) [-1986.102] (-2011.274) (-1995.071) -- 0:04:33
141300 -- (-1994.946) [-1978.426] (-1986.450) (-1990.614) * (-1986.474) [-1984.247] (-2010.945) (-1993.019) -- 0:04:33
141400 -- (-1989.258) [-1981.704] (-1986.076) (-2002.946) * (-1998.948) (-1985.144) (-2008.596) [-1989.936] -- 0:04:33
141500 -- (-1984.794) (-1980.327) [-1988.684] (-1992.483) * (-1993.871) [-1986.104] (-2011.218) (-1989.860) -- 0:04:33
141600 -- (-1985.388) [-1981.850] (-2000.597) (-1990.575) * (-2003.540) [-1988.551] (-1999.981) (-1996.537) -- 0:04:32
141700 -- (-1984.517) [-1979.737] (-1991.896) (-1996.201) * (-1995.248) [-1986.485] (-1994.926) (-1997.743) -- 0:04:32
141800 -- (-1988.653) [-1982.572] (-1997.062) (-1996.915) * (-1998.207) (-1986.085) [-1988.568] (-1993.120) -- 0:04:32
141900 -- (-1989.548) [-1981.922] (-1997.375) (-1997.517) * (-2004.524) [-1984.394] (-1988.885) (-1988.683) -- 0:04:32
142000 -- (-1988.426) [-1983.116] (-2000.195) (-1992.154) * (-2000.729) (-1987.190) (-1986.971) [-1985.428] -- 0:04:31
Average standard deviation of split frequencies: 0.007391
142100 -- [-1989.552] (-1988.916) (-1996.920) (-1987.512) * (-1999.844) [-1988.336] (-1993.686) (-1986.755) -- 0:04:31
142200 -- (-1991.126) [-1984.662] (-1995.853) (-1985.873) * (-2003.712) [-1983.327] (-1991.381) (-1990.236) -- 0:04:31
142300 -- (-1990.462) (-1987.041) (-1994.695) [-1988.555] * (-1996.800) (-1988.639) (-2000.739) [-1992.408] -- 0:04:31
142400 -- (-1993.121) (-1987.294) (-1996.644) [-1984.031] * (-1997.228) (-1991.764) (-1999.524) [-1991.370] -- 0:04:37
142500 -- (-1988.699) [-1978.543] (-1990.045) (-1981.076) * (-2000.188) (-1988.742) (-1992.695) [-1987.563] -- 0:04:36
142600 -- (-1985.829) (-1980.980) (-1994.039) [-1984.094] * (-2001.398) [-1989.253] (-2003.425) (-1987.411) -- 0:04:36
142700 -- (-1986.192) (-1981.059) (-1984.200) [-1985.409] * (-1992.058) (-1985.194) (-1999.561) [-1988.070] -- 0:04:36
142800 -- (-1984.878) [-1978.901] (-1992.340) (-1991.874) * (-1994.639) [-1989.415] (-2001.237) (-1994.760) -- 0:04:36
142900 -- (-1992.287) [-1980.395] (-1989.465) (-1986.400) * (-1997.299) [-1986.242] (-1999.949) (-1990.211) -- 0:04:35
143000 -- (-1993.849) [-1982.019] (-1989.171) (-1985.377) * (-2000.231) (-1988.295) (-2003.782) [-1988.228] -- 0:04:35
Average standard deviation of split frequencies: 0.007618
143100 -- (-1996.553) (-1986.124) (-1988.855) [-1979.616] * (-2002.540) (-1985.789) (-2000.737) [-1991.540] -- 0:04:35
143200 -- (-1992.249) [-1981.512] (-1988.959) (-1984.626) * (-2002.746) (-1987.894) (-2014.459) [-1986.118] -- 0:04:35
143300 -- (-1991.670) (-1982.085) (-1988.564) [-1983.668] * (-2010.191) [-1993.180] (-2007.144) (-1988.778) -- 0:04:35
143400 -- (-1987.293) [-1991.037] (-1988.628) (-1985.824) * (-2000.688) [-1990.469] (-2001.085) (-1992.472) -- 0:04:34
143500 -- (-1985.926) (-1989.376) [-1982.941] (-1988.881) * (-2002.470) (-1988.505) (-2008.709) [-1992.408] -- 0:04:34
143600 -- [-1986.613] (-1986.163) (-1987.500) (-1986.056) * (-1998.203) [-1990.731] (-1996.770) (-1988.084) -- 0:04:34
143700 -- (-1993.072) (-1986.578) [-1983.094] (-1991.066) * (-1997.660) [-1994.939] (-1999.694) (-1992.745) -- 0:04:34
143800 -- (-1997.155) (-1992.399) [-1982.809] (-1996.226) * (-1994.484) [-1986.077] (-2000.777) (-1994.761) -- 0:04:33
143900 -- (-1987.763) (-1990.955) [-1985.470] (-1992.930) * (-1990.088) (-1985.161) (-1991.115) [-1988.493] -- 0:04:33
144000 -- (-2001.813) [-1987.897] (-1987.448) (-1992.353) * (-1988.413) [-1984.498] (-1995.655) (-1988.065) -- 0:04:33
Average standard deviation of split frequencies: 0.007756
144100 -- (-1998.224) [-1992.536] (-1994.721) (-2001.562) * [-1990.141] (-1988.933) (-1986.626) (-1986.755) -- 0:04:33
144200 -- (-1997.339) (-2003.715) [-1998.734] (-2001.170) * (-1988.638) (-1990.554) (-1995.844) [-1987.866] -- 0:04:33
144300 -- (-1997.018) (-2000.994) [-1991.342] (-2008.375) * (-1988.867) (-1995.229) (-2004.664) [-1985.147] -- 0:04:32
144400 -- (-1990.141) (-2006.584) [-1986.740] (-2000.075) * (-1994.106) [-1988.632] (-2002.053) (-1986.532) -- 0:04:32
144500 -- [-1982.913] (-2002.895) (-1988.196) (-1994.067) * (-1989.059) [-1993.315] (-2002.796) (-1987.771) -- 0:04:32
144600 -- [-1986.963] (-1998.656) (-1986.535) (-1989.162) * (-1989.716) [-1982.163] (-2002.202) (-1987.534) -- 0:04:32
144700 -- [-1984.207] (-1992.783) (-1989.468) (-1991.373) * (-1994.448) [-1978.699] (-2008.164) (-1995.862) -- 0:04:31
144800 -- [-1995.407] (-1991.758) (-1985.753) (-1990.216) * (-1987.787) (-1990.163) (-2014.957) [-1992.774] -- 0:04:31
144900 -- (-1985.919) (-1988.385) [-1983.561] (-1984.281) * [-1991.759] (-1988.387) (-2012.803) (-1994.188) -- 0:04:31
145000 -- (-1988.891) [-1987.960] (-1992.686) (-1986.601) * (-1993.811) (-1984.661) (-2013.856) [-1994.858] -- 0:04:31
Average standard deviation of split frequencies: 0.007050
145100 -- (-1989.522) (-1990.117) (-1988.426) [-1986.609] * (-2002.939) [-1985.823] (-2007.103) (-2008.062) -- 0:04:31
145200 -- [-1995.036] (-1985.372) (-1989.769) (-1983.293) * (-2002.492) [-1983.557] (-1997.401) (-2003.308) -- 0:04:30
145300 -- (-1991.935) (-1989.230) (-1989.816) [-1981.293] * (-1995.134) [-1986.370] (-1994.748) (-1989.597) -- 0:04:30
145400 -- (-1993.282) (-1994.105) (-1985.909) [-1984.356] * (-1995.828) (-1988.238) [-1987.962] (-1989.663) -- 0:04:30
145500 -- (-1983.242) (-1990.945) (-1989.485) [-1981.729] * (-1997.072) (-1989.725) (-1993.066) [-1986.144] -- 0:04:36
145600 -- (-1985.062) [-1988.571] (-1988.087) (-1981.814) * (-1995.530) (-1993.524) (-1994.874) [-1993.319] -- 0:04:35
145700 -- (-1980.830) (-1991.048) (-1990.815) [-1980.379] * [-1989.598] (-1990.670) (-1991.234) (-1993.220) -- 0:04:35
145800 -- (-1981.877) (-1996.585) (-1996.786) [-1978.120] * (-1998.005) (-1985.334) [-1987.891] (-1985.845) -- 0:04:35
145900 -- (-1985.733) (-1998.780) (-1991.936) [-1978.951] * (-1994.452) (-1986.250) [-1987.737] (-1986.506) -- 0:04:35
146000 -- [-1985.276] (-1995.481) (-1995.192) (-1980.110) * [-1999.067] (-1993.197) (-1989.173) (-1988.688) -- 0:04:34
Average standard deviation of split frequencies: 0.006913
146100 -- [-1986.564] (-1990.820) (-1994.106) (-1976.727) * (-2001.184) (-1988.201) (-1987.972) [-1983.265] -- 0:04:34
146200 -- (-1994.074) (-2000.566) (-1992.779) [-1979.728] * (-2005.770) (-1997.365) (-1996.273) [-1983.631] -- 0:04:34
146300 -- (-1986.458) (-1995.946) (-1996.647) [-1977.678] * (-1999.132) (-1992.073) (-1992.613) [-1983.466] -- 0:04:34
146400 -- (-1987.993) [-1992.794] (-1999.056) (-1983.144) * (-2002.696) (-1996.267) (-2000.656) [-1986.897] -- 0:04:34
146500 -- [-1985.205] (-1994.270) (-2001.067) (-1985.914) * [-1991.729] (-2000.212) (-1993.722) (-1985.590) -- 0:04:33
146600 -- [-1989.855] (-1989.347) (-1995.947) (-1991.180) * (-1997.305) (-1990.592) (-1997.173) [-1989.051] -- 0:04:33
146700 -- (-1987.329) [-1985.783] (-1994.512) (-1992.989) * (-1990.265) [-1988.217] (-1987.100) (-1992.480) -- 0:04:33
146800 -- (-1986.288) [-1988.239] (-1995.827) (-1988.879) * (-1996.597) (-1989.089) (-1988.386) [-1989.037] -- 0:04:33
146900 -- (-1987.636) [-1987.787] (-2003.675) (-1989.451) * (-1994.092) (-1993.617) (-1989.716) [-1990.177] -- 0:04:32
147000 -- [-1988.659] (-1989.131) (-2003.026) (-1994.403) * (-1984.374) [-1983.712] (-1991.160) (-1992.535) -- 0:04:32
Average standard deviation of split frequencies: 0.005764
147100 -- [-1988.599] (-1992.543) (-2005.117) (-1998.379) * (-1990.628) [-1986.966] (-1996.272) (-1999.971) -- 0:04:32
147200 -- [-1987.544] (-1990.378) (-2006.484) (-1992.630) * (-1991.290) [-1987.171] (-1993.741) (-1995.357) -- 0:04:32
147300 -- (-1987.924) (-1993.135) (-1996.663) [-1984.666] * (-1987.345) [-1982.639] (-1998.102) (-1989.114) -- 0:04:32
147400 -- (-1988.845) (-1986.319) (-1996.855) [-1987.498] * (-1996.012) [-1984.043] (-1996.950) (-1991.152) -- 0:04:31
147500 -- (-1986.778) [-1983.838] (-1993.477) (-1981.399) * (-1992.992) [-1985.637] (-1999.691) (-1992.477) -- 0:04:31
147600 -- (-1987.869) (-1989.211) (-2000.754) [-1979.767] * (-1988.511) [-1983.311] (-1994.905) (-1992.224) -- 0:04:31
147700 -- (-1991.287) (-1995.151) (-1991.953) [-1993.355] * (-1988.649) [-1985.930] (-1993.094) (-1987.850) -- 0:04:31
147800 -- (-1988.397) (-1989.585) (-1990.732) [-1986.547] * (-1987.351) (-1987.887) (-1990.489) [-1988.022] -- 0:04:30
147900 -- (-1989.024) [-1990.545] (-1990.059) (-1993.330) * [-1983.753] (-1992.140) (-1991.686) (-1999.090) -- 0:04:30
148000 -- (-1986.836) [-1989.625] (-1989.059) (-2002.639) * [-1987.154] (-1989.325) (-1992.209) (-2000.777) -- 0:04:30
Average standard deviation of split frequencies: 0.005274
148100 -- [-1990.925] (-1989.159) (-1995.551) (-1991.137) * [-1989.278] (-1989.849) (-1996.858) (-2001.767) -- 0:04:30
148200 -- (-1991.075) (-1989.098) (-1996.633) [-1989.360] * (-1987.453) [-1985.515] (-1989.857) (-1999.342) -- 0:04:30
148300 -- (-1990.002) [-1986.774] (-1996.376) (-1990.403) * (-1992.418) (-1981.316) [-1986.753] (-1999.028) -- 0:04:29
148400 -- [-1979.299] (-1987.800) (-1994.367) (-1992.854) * (-1998.933) [-1986.841] (-1989.436) (-2001.429) -- 0:04:29
148500 -- [-1983.312] (-1985.679) (-1989.175) (-1991.174) * [-1991.874] (-1986.700) (-1992.116) (-1997.424) -- 0:04:29
148600 -- [-1989.214] (-1992.297) (-1989.012) (-1983.651) * (-2009.603) [-1980.039] (-1987.488) (-1994.381) -- 0:04:29
148700 -- (-1986.577) (-1993.627) (-1988.268) [-1986.160] * (-2001.258) (-1984.545) [-1983.797] (-1987.583) -- 0:04:34
148800 -- [-1984.222] (-1996.058) (-1995.833) (-1987.417) * (-1996.781) [-1987.360] (-1989.310) (-1984.452) -- 0:04:34
148900 -- [-1979.159] (-1990.673) (-1991.966) (-1989.150) * (-2000.626) [-1984.245] (-1988.625) (-1986.224) -- 0:04:34
149000 -- [-1979.977] (-1988.268) (-2003.365) (-1990.912) * (-1997.484) (-1982.817) [-1988.990] (-1989.759) -- 0:04:34
Average standard deviation of split frequencies: 0.004694
149100 -- [-1979.447] (-1988.148) (-2004.569) (-1983.796) * (-1990.909) (-1980.774) (-1991.426) [-1989.836] -- 0:04:33
149200 -- [-1983.472] (-1990.113) (-2000.978) (-1989.323) * (-1991.178) [-1980.265] (-1990.086) (-1993.189) -- 0:04:33
149300 -- (-1987.411) (-1988.719) (-1996.335) [-1987.171] * (-1994.541) (-1981.645) (-1993.726) [-1988.107] -- 0:04:33
149400 -- [-1986.742] (-1987.679) (-2007.808) (-1991.886) * (-2001.740) [-1980.215] (-1994.056) (-1989.787) -- 0:04:33
149500 -- (-1990.551) [-1992.622] (-2012.211) (-1993.416) * (-2001.555) [-1987.418] (-1992.540) (-1989.005) -- 0:04:33
149600 -- (-1993.604) [-1985.734] (-2000.933) (-1988.573) * (-1995.510) [-1982.957] (-1988.595) (-1987.786) -- 0:04:32
149700 -- (-1994.519) [-1988.805] (-1993.642) (-1989.711) * (-1993.444) [-1989.834] (-1986.460) (-1992.865) -- 0:04:32
149800 -- (-1989.304) [-1989.490] (-1990.564) (-1985.643) * (-1994.156) [-1991.455] (-1984.313) (-1994.405) -- 0:04:32
149900 -- (-1985.408) (-1984.421) [-1984.959] (-1982.912) * (-1991.122) (-1991.591) [-1986.763] (-1989.953) -- 0:04:32
150000 -- [-1979.671] (-1985.180) (-1987.733) (-1992.980) * (-1996.248) [-1998.492] (-1996.447) (-1993.715) -- 0:04:32
Average standard deviation of split frequencies: 0.004934
150100 -- (-1987.209) [-1987.715] (-1987.133) (-1984.683) * (-1995.573) (-1996.073) [-1988.117] (-1990.303) -- 0:04:31
150200 -- (-1993.137) [-1983.128] (-1989.930) (-1999.068) * (-1999.262) [-1986.711] (-1991.327) (-1992.202) -- 0:04:31
150300 -- (-1987.976) [-1982.131] (-1996.146) (-1991.076) * (-1992.639) [-1982.025] (-1990.373) (-1996.643) -- 0:04:31
150400 -- [-1990.008] (-1984.588) (-1989.043) (-1995.731) * (-1999.408) (-1981.874) (-1998.355) [-1992.418] -- 0:04:31
150500 -- [-1987.423] (-1996.704) (-1990.692) (-1996.158) * (-1999.524) [-1984.710] (-2002.151) (-2002.762) -- 0:04:30
150600 -- [-1986.650] (-1994.027) (-1993.128) (-1992.255) * (-1990.876) [-1982.359] (-1998.004) (-1991.985) -- 0:04:30
150700 -- (-1984.947) [-1988.627] (-1993.684) (-1991.722) * (-1996.615) (-1986.371) (-1998.942) [-1987.865] -- 0:04:30
150800 -- [-1984.325] (-1989.175) (-1994.222) (-1992.049) * (-1994.433) [-1979.337] (-1995.117) (-1988.331) -- 0:04:30
150900 -- (-1986.442) [-1981.900] (-1993.100) (-1995.067) * (-2004.173) (-1975.408) (-1993.940) [-1989.717] -- 0:04:30
151000 -- [-1980.813] (-1984.496) (-1999.838) (-1994.335) * (-2007.995) [-1976.332] (-1992.164) (-1991.994) -- 0:04:29
Average standard deviation of split frequencies: 0.004543
151100 -- [-1980.930] (-2000.686) (-1998.877) (-1988.744) * (-2002.100) [-1979.512] (-1995.476) (-1993.646) -- 0:04:29
151200 -- (-1984.186) [-1988.712] (-1990.238) (-1987.570) * (-2003.230) [-1989.385] (-1995.417) (-1992.455) -- 0:04:29
151300 -- (-1985.630) (-1997.444) (-1991.302) [-1985.916] * (-1995.821) (-1990.175) (-1990.552) [-1989.880] -- 0:04:29
151400 -- (-1986.350) (-1990.485) [-1987.088] (-2000.899) * (-1991.860) (-1988.116) (-1998.498) [-1989.269] -- 0:04:29
151500 -- [-1986.416] (-2000.737) (-1985.979) (-2003.044) * (-1994.824) [-1982.659] (-1992.620) (-1988.973) -- 0:04:28
151600 -- [-1985.180] (-1992.999) (-1991.591) (-1998.038) * (-1990.744) [-1978.451] (-1999.349) (-1992.078) -- 0:04:28
151700 -- [-1978.659] (-1993.103) (-1995.665) (-1987.972) * (-1990.614) [-1984.978] (-2000.109) (-1992.684) -- 0:04:28
151800 -- [-1975.533] (-1992.893) (-1993.179) (-1981.622) * (-1988.873) [-1985.603] (-2005.970) (-1996.389) -- 0:04:33
151900 -- [-1977.861] (-1995.855) (-1994.280) (-1980.938) * [-1982.691] (-1981.346) (-1996.434) (-1993.996) -- 0:04:33
152000 -- [-1985.053] (-1994.660) (-2004.556) (-1987.884) * (-1988.653) [-1984.121] (-1994.045) (-1994.086) -- 0:04:33
Average standard deviation of split frequencies: 0.005046
152100 -- (-1982.568) (-1993.434) (-1998.121) [-1983.036] * [-1987.125] (-1982.851) (-1998.990) (-2000.459) -- 0:04:33
152200 -- [-1985.314] (-1987.529) (-1995.623) (-1981.495) * [-1993.786] (-1984.022) (-2003.464) (-2002.583) -- 0:04:32
152300 -- (-1984.540) (-1984.122) (-1995.211) [-1983.493] * (-1996.142) [-1981.842] (-1995.969) (-2002.121) -- 0:04:32
152400 -- (-1982.997) (-1986.987) (-2000.410) [-1983.379] * (-1990.930) [-1979.753] (-1993.273) (-1999.248) -- 0:04:32
152500 -- (-1981.776) (-1987.698) (-2001.033) [-1979.246] * [-1988.218] (-1989.882) (-1991.797) (-1997.919) -- 0:04:32
152600 -- [-1983.361] (-1988.262) (-2009.236) (-1985.023) * (-1994.505) [-1990.726] (-1994.476) (-1992.467) -- 0:04:32
152700 -- (-1985.718) (-1985.697) (-2004.847) [-1984.739] * (-1992.439) (-1994.329) (-1996.016) [-1987.448] -- 0:04:31
152800 -- (-1990.637) [-1986.446] (-1994.705) (-1984.336) * (-1994.938) [-1992.904] (-2000.494) (-1993.268) -- 0:04:31
152900 -- [-1991.618] (-1988.578) (-1995.429) (-1982.052) * (-1999.517) [-1990.999] (-2008.337) (-1993.376) -- 0:04:31
153000 -- [-1984.827] (-1984.412) (-1997.158) (-1983.404) * (-1989.653) [-1982.589] (-2002.606) (-1995.711) -- 0:04:31
Average standard deviation of split frequencies: 0.004660
153100 -- [-1985.675] (-1985.881) (-1997.613) (-1992.557) * (-1991.690) [-1981.280] (-2000.862) (-1991.614) -- 0:04:31
153200 -- (-1989.947) [-1985.395] (-1991.663) (-1992.515) * (-1995.084) [-1982.076] (-1994.123) (-1988.646) -- 0:04:30
153300 -- (-1991.041) [-1985.592] (-1993.189) (-2002.304) * [-1992.871] (-1977.955) (-1997.965) (-1992.837) -- 0:04:30
153400 -- (-1990.975) (-1984.277) (-1992.945) [-1994.263] * (-1995.533) [-1985.486] (-1989.659) (-1990.587) -- 0:04:30
153500 -- (-1999.746) [-1985.138] (-1990.938) (-1999.720) * (-1992.586) [-1993.518] (-1999.782) (-1988.419) -- 0:04:30
153600 -- (-1991.405) (-1988.287) [-1990.464] (-2002.055) * (-1992.900) [-1988.702] (-2012.484) (-1993.548) -- 0:04:30
153700 -- (-1992.254) [-1987.973] (-1991.573) (-2003.780) * (-2005.836) [-1984.602] (-1992.863) (-1989.492) -- 0:04:29
153800 -- (-2000.095) [-1985.575] (-1996.581) (-1994.577) * (-2004.816) (-1982.258) (-1994.246) [-1991.090] -- 0:04:29
153900 -- (-2011.060) [-1984.495] (-2002.035) (-1990.825) * (-2000.863) [-1981.101] (-1995.208) (-1991.496) -- 0:04:29
154000 -- (-1991.875) [-1985.782] (-1996.382) (-1997.627) * (-1996.249) (-1980.507) (-1997.425) [-1990.829] -- 0:04:29
Average standard deviation of split frequencies: 0.005068
154100 -- (-1994.605) (-1983.696) [-1989.917] (-1993.811) * (-1997.395) [-1987.203] (-2011.481) (-1990.316) -- 0:04:28
154200 -- (-1986.766) (-1991.996) (-1987.035) [-1991.170] * (-2002.749) [-1982.859] (-2017.769) (-1995.957) -- 0:04:28
154300 -- (-1997.227) [-1986.522] (-1988.305) (-1990.893) * (-1990.550) [-1983.525] (-2003.064) (-1995.169) -- 0:04:28
154400 -- (-1987.198) [-1983.759] (-1999.104) (-1989.850) * (-1992.170) [-1982.834] (-2008.881) (-1983.477) -- 0:04:28
154500 -- [-1988.388] (-1982.246) (-1998.456) (-1988.010) * (-1995.076) [-1977.888] (-2010.532) (-1986.196) -- 0:04:28
154600 -- (-1981.854) [-1983.310] (-2005.104) (-1990.222) * [-1995.911] (-1979.159) (-2000.297) (-1988.694) -- 0:04:27
154700 -- (-1984.975) [-1982.009] (-2008.266) (-1993.083) * (-1991.038) [-1979.816] (-1995.140) (-1987.324) -- 0:04:27
154800 -- [-1981.983] (-1984.239) (-1993.615) (-2002.007) * (-2000.077) [-1983.007] (-1990.674) (-1987.214) -- 0:04:27
154900 -- (-1981.720) [-1980.112] (-1996.596) (-1993.460) * (-1990.414) [-1983.017] (-1992.358) (-1992.876) -- 0:04:27
155000 -- (-1984.791) [-1981.817] (-2001.340) (-1992.685) * (-1989.674) [-1977.856] (-1999.848) (-1991.924) -- 0:04:32
Average standard deviation of split frequencies: 0.005033
155100 -- (-1986.864) [-1983.756] (-2000.192) (-1994.391) * (-1990.905) (-1984.434) (-1998.081) [-1996.100] -- 0:04:32
155200 -- [-1988.559] (-1987.505) (-2000.436) (-1994.559) * (-1993.137) [-1981.438] (-1994.756) (-1995.047) -- 0:04:32
155300 -- (-1987.524) [-1987.488] (-2001.476) (-1996.519) * (-1989.406) [-1986.397] (-1991.613) (-1991.634) -- 0:04:31
155400 -- [-1980.350] (-1986.152) (-1995.859) (-1991.784) * (-1999.944) (-1989.686) (-1991.124) [-1989.271] -- 0:04:31
155500 -- (-1983.963) [-1982.359] (-1991.507) (-1997.970) * (-1987.047) [-1985.582] (-1989.475) (-1995.566) -- 0:04:31
155600 -- [-1984.003] (-1979.337) (-1992.742) (-1993.733) * (-1991.676) [-1981.767] (-1996.655) (-1991.566) -- 0:04:31
155700 -- (-1993.591) [-1983.571] (-1994.709) (-2001.726) * (-1998.153) [-1980.501] (-2019.787) (-1997.655) -- 0:04:31
155800 -- [-1985.636] (-1984.785) (-1998.416) (-2006.473) * [-1985.314] (-1981.609) (-1996.001) (-1996.182) -- 0:04:30
155900 -- [-1979.879] (-1985.300) (-1994.293) (-2000.272) * [-1984.568] (-1990.068) (-1996.868) (-2002.207) -- 0:04:30
156000 -- (-1979.526) [-1985.707] (-2001.749) (-2003.651) * [-1987.014] (-1989.305) (-1992.929) (-2013.917) -- 0:04:30
Average standard deviation of split frequencies: 0.005176
156100 -- [-1984.087] (-1997.602) (-1993.757) (-1995.042) * (-1987.602) [-1986.185] (-1993.191) (-2017.288) -- 0:04:30
156200 -- (-1983.821) (-1998.415) [-1994.348] (-1992.782) * [-1983.032] (-1987.696) (-1996.187) (-2012.062) -- 0:04:30
156300 -- [-1986.695] (-1993.409) (-1994.002) (-1994.612) * [-1985.372] (-1984.541) (-1998.436) (-2004.337) -- 0:04:29
156400 -- (-1992.654) [-1984.291] (-1990.320) (-1994.296) * (-1990.444) [-1990.621] (-1990.768) (-1996.315) -- 0:04:29
156500 -- (-1995.952) (-1985.008) (-1996.360) [-1988.415] * (-1987.181) (-1994.442) [-1988.716] (-1994.399) -- 0:04:29
156600 -- (-1994.676) [-1989.184] (-1997.751) (-1991.102) * (-1992.544) (-2004.483) (-1995.300) [-1993.821] -- 0:04:29
156700 -- (-1990.895) (-1989.761) [-1993.563] (-1987.569) * [-1989.005] (-1987.737) (-2002.985) (-1995.435) -- 0:04:29
156800 -- (-1997.456) (-1999.592) (-1993.270) [-1983.408] * [-1988.081] (-1987.364) (-1996.243) (-1996.441) -- 0:04:28
156900 -- (-1995.665) (-1992.772) (-1990.837) [-1983.355] * (-1998.448) (-1989.131) (-1998.831) [-1990.224] -- 0:04:28
157000 -- (-1997.047) (-1996.137) (-1989.199) [-1984.599] * (-2000.341) [-1989.915] (-1996.899) (-2012.369) -- 0:04:28
Average standard deviation of split frequencies: 0.004969
157100 -- (-1994.148) (-1999.186) (-1988.033) [-1988.518] * (-2001.772) [-1980.369] (-1992.171) (-1995.009) -- 0:04:28
157200 -- (-1982.953) (-1985.685) (-1986.914) [-1984.240] * (-2002.373) (-1988.435) (-1994.072) [-1995.233] -- 0:04:28
157300 -- (-1983.933) [-1986.398] (-1992.049) (-1985.832) * (-2000.610) [-1990.234] (-1989.912) (-1998.254) -- 0:04:27
157400 -- (-1987.190) [-1980.523] (-1997.958) (-1989.987) * (-2002.167) (-1989.591) [-1992.659] (-1996.247) -- 0:04:27
157500 -- (-1985.284) (-1986.097) (-1997.090) [-1986.064] * (-2000.737) [-1990.091] (-1997.010) (-2000.179) -- 0:04:27
157600 -- (-1989.855) [-1982.261] (-1993.525) (-1984.708) * (-2007.018) [-1993.624] (-1992.828) (-1995.906) -- 0:04:27
157700 -- (-1990.426) (-1990.787) (-1992.959) [-1982.015] * (-2012.732) (-1988.162) [-1988.136] (-2000.742) -- 0:04:27
157800 -- (-1992.959) (-1987.889) (-1998.599) [-1983.864] * (-2005.095) [-1978.863] (-1995.560) (-2004.287) -- 0:04:26
157900 -- [-1986.975] (-1986.634) (-2001.162) (-1994.086) * (-2002.966) [-1979.742] (-1991.968) (-1999.909) -- 0:04:26
158000 -- (-1988.794) [-1983.330] (-1997.726) (-1990.104) * (-2000.779) [-1981.385] (-1986.176) (-1999.291) -- 0:04:26
Average standard deviation of split frequencies: 0.005196
158100 -- (-1990.323) [-1985.806] (-1998.126) (-1990.524) * (-1998.527) [-1988.148] (-1987.953) (-1996.550) -- 0:04:31
158200 -- (-1995.295) [-1984.141] (-1995.079) (-1985.458) * (-1996.447) (-1985.747) [-1980.963] (-2001.364) -- 0:04:31
158300 -- (-2000.514) (-1983.744) (-2000.974) [-1981.876] * (-1992.995) (-1984.247) [-1979.456] (-1993.520) -- 0:04:31
158400 -- (-2001.985) (-1988.492) (-2002.488) [-1980.698] * (-1997.135) (-1987.334) [-1982.669] (-1990.056) -- 0:04:30
158500 -- (-2000.870) [-1984.147] (-2001.914) (-1979.362) * (-2004.900) (-1980.599) [-1984.982] (-1988.743) -- 0:04:30
158600 -- (-1997.870) (-1986.225) (-1996.517) [-1979.359] * (-1997.873) [-1981.006] (-1986.975) (-1981.021) -- 0:04:30
158700 -- (-1993.392) (-1988.545) (-2000.992) [-1980.274] * (-1997.874) (-1992.229) (-1991.211) [-1991.959] -- 0:04:30
158800 -- (-2000.737) (-1991.857) (-1993.620) [-1980.116] * (-1988.501) (-1982.471) [-1996.226] (-1995.515) -- 0:04:30
158900 -- (-1998.948) (-1988.588) (-1989.744) [-1980.964] * (-1992.221) [-1982.900] (-1993.278) (-1994.076) -- 0:04:29
159000 -- (-1993.215) (-1989.815) (-1993.700) [-1988.448] * (-1992.846) [-1985.389] (-1991.356) (-1996.601) -- 0:04:29
Average standard deviation of split frequencies: 0.005668
159100 -- (-1998.042) (-1987.742) (-1995.874) [-1984.326] * (-1988.271) [-1984.162] (-1994.770) (-1998.045) -- 0:04:29
159200 -- (-1996.958) (-1990.527) (-2006.859) [-1979.637] * (-1987.265) (-1988.446) [-1987.762] (-2006.422) -- 0:04:29
159300 -- (-2000.081) (-1990.342) (-2001.504) [-1977.681] * [-1990.968] (-1987.834) (-1999.083) (-1999.363) -- 0:04:29
159400 -- (-2001.775) (-1991.855) (-1996.953) [-1980.239] * (-1997.949) [-1990.268] (-1999.719) (-1997.586) -- 0:04:28
159500 -- (-1999.937) [-1993.151] (-2003.887) (-1990.933) * (-1994.469) (-1989.133) [-1986.498] (-1998.632) -- 0:04:28
159600 -- (-1991.889) [-1990.343] (-2004.223) (-1987.040) * (-2003.874) (-1985.816) [-1985.709] (-2001.420) -- 0:04:28
159700 -- (-1989.019) (-1991.244) (-2001.051) [-1990.035] * (-1991.119) [-1986.877] (-1983.730) (-1995.479) -- 0:04:28
159800 -- (-1990.919) [-1984.540] (-2001.432) (-1987.032) * (-1995.847) [-1978.572] (-1984.682) (-1994.301) -- 0:04:28
159900 -- (-1997.709) [-1985.901] (-2001.441) (-1988.128) * (-1994.315) [-1984.892] (-1983.099) (-1993.760) -- 0:04:27
160000 -- (-1998.651) [-1983.089] (-1992.518) (-1992.635) * (-1988.675) (-1985.086) [-1984.394] (-1999.534) -- 0:04:27
Average standard deviation of split frequencies: 0.005551
160100 -- (-1993.368) (-1988.797) [-2000.403] (-2000.006) * (-1992.141) (-1985.300) [-1981.883] (-1995.855) -- 0:04:27
160200 -- (-1996.429) [-1988.274] (-1991.517) (-1990.095) * (-1995.342) (-1985.960) [-1984.499] (-1991.601) -- 0:04:27
160300 -- (-1991.471) (-1987.195) [-1990.818] (-1993.594) * (-2007.132) (-1981.475) [-1984.970] (-1987.223) -- 0:04:27
160400 -- [-1988.050] (-1986.952) (-2000.536) (-1984.311) * (-2000.040) [-1989.361] (-1985.797) (-1991.525) -- 0:04:26
160500 -- (-1993.318) (-1989.377) (-1999.933) [-1985.240] * (-2009.232) [-1988.323] (-1984.999) (-1995.950) -- 0:04:26
160600 -- (-1990.876) (-1984.675) (-1991.289) [-1983.020] * (-1995.724) (-1988.152) [-1982.505] (-1991.243) -- 0:04:26
160700 -- (-1995.703) [-1984.769] (-1990.077) (-1982.364) * (-2000.007) (-1983.987) [-1986.760] (-1995.374) -- 0:04:26
160800 -- (-1993.121) [-1984.226] (-1989.909) (-1983.093) * (-1995.700) (-1982.486) [-1982.974] (-1993.986) -- 0:04:26
160900 -- (-1993.281) (-1980.172) (-1988.658) [-1979.541] * (-1997.437) [-1982.732] (-1985.657) (-1996.485) -- 0:04:25
161000 -- [-1991.309] (-1987.129) (-1986.621) (-1999.254) * [-1991.640] (-1985.813) (-1992.029) (-1999.727) -- 0:04:25
Average standard deviation of split frequencies: 0.005514
161100 -- (-1995.759) [-1997.535] (-1985.703) (-1998.098) * (-1998.459) [-1986.039] (-1986.158) (-1999.962) -- 0:04:25
161200 -- (-1989.490) (-1996.762) [-1992.085] (-1984.798) * (-1999.054) [-1987.645] (-1991.202) (-2003.029) -- 0:04:25
161300 -- (-1996.068) (-1991.725) (-1993.668) [-1991.727] * (-1995.748) [-1985.460] (-1990.909) (-2000.449) -- 0:04:30
161400 -- (-1992.839) (-1994.528) (-1995.221) [-1980.042] * (-1990.436) [-1981.438] (-1983.355) (-2002.784) -- 0:04:30
161500 -- (-1991.380) (-1986.005) (-1992.727) [-1978.672] * (-1995.453) (-1983.487) [-1982.444] (-2006.062) -- 0:04:29
161600 -- (-2000.409) (-1987.892) (-1998.058) [-1979.494] * (-1995.077) [-1987.069] (-1980.118) (-1997.193) -- 0:04:29
161700 -- (-1994.218) (-1983.407) (-2000.479) [-1980.248] * (-1995.290) (-1980.869) [-1982.477] (-1995.645) -- 0:04:29
161800 -- (-1987.623) [-1984.426] (-1997.334) (-1979.491) * (-1991.815) [-1980.049] (-1984.437) (-1996.549) -- 0:04:29
161900 -- (-1985.659) (-1982.604) (-1992.771) [-1984.402] * (-1995.091) [-1981.597] (-1984.436) (-2000.877) -- 0:04:29
162000 -- [-1986.034] (-1984.749) (-1996.198) (-1985.902) * (-1988.972) (-1984.258) [-1989.141] (-1996.983) -- 0:04:28
Average standard deviation of split frequencies: 0.005732
162100 -- (-1988.551) [-1978.982] (-2007.869) (-1991.106) * (-1996.032) [-1981.721] (-1994.572) (-1998.539) -- 0:04:28
162200 -- (-1992.796) [-1982.090] (-1997.044) (-1991.661) * (-1997.444) [-1985.603] (-1991.960) (-1997.122) -- 0:04:28
162300 -- (-1994.580) [-1980.919] (-2006.276) (-1988.010) * (-1997.157) [-1985.868] (-1985.831) (-1999.456) -- 0:04:28
162400 -- (-1993.276) [-1981.769] (-2013.213) (-1988.907) * (-1986.850) (-1984.092) (-1992.593) [-1993.542] -- 0:04:28
162500 -- (-1990.153) [-1983.788] (-2010.995) (-1998.690) * [-1987.644] (-1986.383) (-1999.166) (-2002.616) -- 0:04:28
162600 -- (-1996.903) (-1985.362) (-2008.830) [-1988.860] * [-1989.344] (-1985.892) (-1995.645) (-2001.811) -- 0:04:27
162700 -- (-2000.464) [-1988.574] (-2006.569) (-1990.905) * (-1993.415) [-1983.192] (-1987.085) (-1995.893) -- 0:04:27
162800 -- (-1998.358) [-1984.110] (-2012.238) (-1992.047) * (-1994.540) [-1983.875] (-1984.808) (-2005.519) -- 0:04:27
162900 -- [-1992.313] (-1981.600) (-2019.264) (-1986.127) * (-1998.258) (-1982.251) [-1983.235] (-2006.133) -- 0:04:27
163000 -- (-1995.971) [-1979.146] (-2011.513) (-1991.879) * (-1993.737) [-1981.484] (-1981.093) (-1998.415) -- 0:04:27
Average standard deviation of split frequencies: 0.005447
163100 -- (-1984.963) [-1978.102] (-2005.340) (-2001.078) * (-1994.488) (-1984.249) [-1983.468] (-1999.572) -- 0:04:26
163200 -- (-1989.966) [-1977.637] (-2004.750) (-1994.415) * (-1992.195) (-1983.001) [-1983.270] (-1991.765) -- 0:04:26
163300 -- (-1992.013) [-1975.534] (-2008.244) (-1985.483) * [-1985.475] (-1985.143) (-1988.280) (-1993.047) -- 0:04:26
163400 -- (-1995.078) [-1977.346] (-2003.795) (-1985.290) * (-1986.203) [-1978.799] (-1987.073) (-1992.847) -- 0:04:26
163500 -- (-1999.609) (-1987.353) (-2009.581) [-1983.916] * (-1987.091) [-1976.262] (-1997.840) (-1992.434) -- 0:04:26
163600 -- (-1997.287) [-1985.342] (-1990.370) (-1981.987) * (-1988.144) (-1984.205) [-1985.169] (-1991.708) -- 0:04:25
163700 -- (-1997.845) [-1985.812] (-1998.439) (-1978.411) * (-1993.092) (-1988.051) [-1984.961] (-1994.737) -- 0:04:25
163800 -- (-1999.108) (-1982.274) (-1995.046) [-1978.699] * (-1990.985) (-1983.009) [-1983.054] (-1994.080) -- 0:04:25
163900 -- (-2006.834) (-1984.475) (-1996.274) [-1981.116] * (-1991.178) [-1985.983] (-1992.547) (-1994.575) -- 0:04:25
164000 -- (-2000.833) [-1983.440] (-1989.093) (-1985.310) * (-1993.063) (-1980.090) [-1989.976] (-1993.687) -- 0:04:25
Average standard deviation of split frequencies: 0.005744
164100 -- (-1994.041) [-1986.397] (-1994.276) (-1980.651) * (-1996.767) [-1980.879] (-1989.259) (-1994.347) -- 0:04:24
164200 -- (-1996.195) (-1979.891) (-1997.103) [-1985.366] * (-1996.412) (-1983.627) [-1985.305] (-1989.877) -- 0:04:24
164300 -- (-1996.150) [-1980.785] (-1993.509) (-1985.478) * (-1987.052) [-1985.953] (-1986.414) (-1993.182) -- 0:04:24
164400 -- (-1997.071) (-1987.918) (-2000.943) [-1987.174] * (-1987.351) [-1983.875] (-1983.233) (-1993.263) -- 0:04:29
164500 -- (-1992.731) (-1988.534) (-1997.122) [-1989.048] * (-1991.511) [-1987.476] (-1982.831) (-1995.091) -- 0:04:29
164600 -- (-1995.819) (-1981.875) (-1992.065) [-1986.404] * (-1998.993) (-1995.297) [-1984.394] (-1985.645) -- 0:04:28
164700 -- (-1990.998) [-1986.527] (-1991.898) (-1994.160) * (-1993.902) (-1998.615) [-1983.030] (-1992.505) -- 0:04:28
164800 -- (-2004.578) (-1992.995) (-1993.040) [-1989.716] * (-1997.121) (-2000.895) [-1982.120] (-1996.914) -- 0:04:28
164900 -- (-1998.137) (-1993.026) (-1990.310) [-1994.999] * (-1993.529) (-1999.415) [-1986.440] (-1993.089) -- 0:04:28
165000 -- (-1991.689) (-1992.735) (-1994.698) [-1987.998] * (-1988.583) (-1995.019) [-1982.000] (-1998.723) -- 0:04:28
Average standard deviation of split frequencies: 0.005626
165100 -- [-1986.522] (-2001.137) (-1989.258) (-1993.094) * [-1984.588] (-1992.792) (-1979.616) (-1998.298) -- 0:04:28
165200 -- [-1989.093] (-2001.637) (-1989.701) (-1998.557) * [-1982.971] (-1991.801) (-1979.265) (-1999.169) -- 0:04:27
165300 -- (-1991.276) (-1995.660) (-1992.331) [-1989.457] * (-1989.037) [-1996.035] (-1986.594) (-2000.388) -- 0:04:27
165400 -- (-1995.836) (-2000.652) (-1996.485) [-1990.875] * [-1986.925] (-1998.075) (-1984.882) (-2002.454) -- 0:04:27
165500 -- (-1992.657) (-2015.973) (-2008.182) [-1988.152] * (-1991.494) (-1999.237) [-1981.368] (-1991.406) -- 0:04:27
165600 -- [-1990.669] (-2005.274) (-2010.558) (-1994.542) * (-1990.886) (-1992.907) [-1982.976] (-1993.417) -- 0:04:27
165700 -- [-1989.371] (-1991.026) (-2008.305) (-1994.310) * (-1993.250) (-1990.729) [-1985.563] (-1996.195) -- 0:04:26
165800 -- [-1991.495] (-1986.838) (-2015.161) (-1987.182) * (-1999.805) (-1987.816) [-1987.941] (-2001.388) -- 0:04:26
165900 -- [-1990.298] (-1988.689) (-2012.718) (-1991.131) * (-1994.335) (-1987.216) [-1987.928] (-1994.090) -- 0:04:26
166000 -- (-1991.756) (-1993.785) (-2005.274) [-1987.820] * (-1986.002) [-1983.605] (-1983.584) (-2000.867) -- 0:04:26
Average standard deviation of split frequencies: 0.005594
166100 -- (-1993.740) [-1989.450] (-2001.259) (-1986.695) * [-1983.912] (-1984.126) (-1981.868) (-1996.856) -- 0:04:26
166200 -- (-1992.177) (-1984.509) (-1994.238) [-1986.776] * [-1980.266] (-1979.747) (-1982.880) (-1997.609) -- 0:04:25
166300 -- (-1993.523) (-1989.641) (-1998.834) [-1985.009] * [-1981.765] (-1987.017) (-1984.712) (-1995.122) -- 0:04:25
166400 -- (-1995.706) [-1986.704] (-1992.539) (-1982.375) * (-1988.304) (-1984.974) [-1987.509] (-2002.419) -- 0:04:25
166500 -- (-1998.898) (-1983.673) (-1988.443) [-1982.142] * (-1985.025) (-2002.287) [-1981.544] (-1995.950) -- 0:04:25
166600 -- (-1999.163) (-1984.509) (-1989.639) [-1978.811] * (-1977.338) (-1991.677) [-1987.682] (-1992.423) -- 0:04:25
166700 -- (-2003.643) (-1981.187) (-1986.637) [-1981.447] * [-1979.995] (-1985.391) (-1980.257) (-1994.203) -- 0:04:24
166800 -- (-1996.689) [-1980.700] (-1988.132) (-1993.027) * [-1979.445] (-1987.119) (-1983.507) (-1996.567) -- 0:04:24
166900 -- (-2000.019) [-1981.413] (-1987.197) (-1985.585) * (-1982.959) [-1983.721] (-1983.209) (-1992.257) -- 0:04:24
167000 -- (-1997.481) [-1985.247] (-1999.751) (-1984.017) * [-1981.791] (-1983.489) (-1986.739) (-1988.003) -- 0:04:24
Average standard deviation of split frequencies: 0.005558
167100 -- (-2002.742) (-1980.537) (-1992.811) [-1984.204] * [-1978.746] (-1979.152) (-1991.881) (-1990.328) -- 0:04:24
167200 -- (-1994.246) (-1978.920) (-1990.014) [-1988.604] * (-1981.311) [-1985.383] (-1990.500) (-1987.504) -- 0:04:23
167300 -- (-1998.631) [-1981.334] (-1999.538) (-1986.507) * [-1976.746] (-1987.280) (-1997.357) (-1987.414) -- 0:04:23
167400 -- (-1997.982) (-1978.815) (-1999.140) [-1986.669] * [-1975.274] (-1984.166) (-1991.807) (-1989.798) -- 0:04:23
167500 -- (-2001.520) [-1980.351] (-1996.656) (-1987.966) * (-1980.416) (-1987.755) (-1991.985) [-1990.787] -- 0:04:23
167600 -- (-1999.524) [-1981.120] (-1992.873) (-1992.830) * [-1979.042] (-1994.862) (-1987.169) (-1992.807) -- 0:04:28
167700 -- (-1998.682) (-1989.371) (-1992.088) [-1992.520] * [-1981.680] (-1988.416) (-1994.483) (-1993.118) -- 0:04:28
167800 -- (-2005.378) (-1984.277) (-1992.329) [-1993.521] * [-1981.495] (-1985.615) (-1998.915) (-1988.426) -- 0:04:27
167900 -- (-2011.094) [-1983.263] (-1996.072) (-1990.056) * (-1985.999) [-1989.864] (-1998.859) (-1995.370) -- 0:04:27
168000 -- (-2002.699) [-1981.430] (-1995.745) (-1993.822) * [-1982.811] (-1999.132) (-1992.260) (-1991.237) -- 0:04:27
Average standard deviation of split frequencies: 0.005287
168100 -- (-2002.550) [-1981.510] (-1994.799) (-1998.997) * [-1985.030] (-1986.432) (-1990.644) (-1995.197) -- 0:04:27
168200 -- (-2006.570) [-1984.777] (-1995.601) (-1993.202) * (-1987.265) [-1982.019] (-1991.365) (-1988.382) -- 0:04:27
168300 -- (-2001.929) [-1980.099] (-2000.431) (-1995.964) * (-1987.869) [-1981.828] (-1994.817) (-1992.545) -- 0:04:26
168400 -- (-2006.547) [-1975.988] (-1996.919) (-1995.341) * (-1985.573) [-1982.762] (-1993.852) (-1996.310) -- 0:04:26
168500 -- (-1994.406) [-1975.795] (-1994.181) (-1991.421) * [-1985.693] (-1979.671) (-1989.157) (-1990.866) -- 0:04:26
168600 -- (-1986.990) [-1978.088] (-1997.449) (-1989.802) * (-1985.679) (-1987.471) [-1986.412] (-1999.128) -- 0:04:26
168700 -- [-1989.268] (-1980.428) (-2000.198) (-1999.655) * [-1982.864] (-1985.898) (-1988.164) (-2003.826) -- 0:04:26
168800 -- (-1994.690) [-1982.898] (-1991.627) (-1991.607) * [-1984.516] (-1981.226) (-1988.609) (-2011.599) -- 0:04:25
168900 -- (-1993.706) (-1982.180) (-2001.405) [-1986.160] * (-1981.674) [-1980.523] (-2008.127) (-1998.473) -- 0:04:25
169000 -- [-1988.449] (-1987.912) (-2004.482) (-1985.769) * (-1987.774) [-1978.003] (-2002.726) (-1999.210) -- 0:04:25
Average standard deviation of split frequencies: 0.004776
169100 -- (-1987.818) (-1991.392) (-1999.474) [-1987.016] * (-1989.200) [-1980.383] (-2000.437) (-2003.367) -- 0:04:25
169200 -- (-1988.545) (-1983.971) (-1997.506) [-1982.773] * [-1984.085] (-1981.423) (-2000.735) (-1997.064) -- 0:04:25
169300 -- (-1993.063) (-1984.630) (-2004.120) [-1983.250] * (-1983.726) [-1986.050] (-1989.299) (-1991.086) -- 0:04:24
169400 -- (-1992.889) (-1991.261) (-2013.122) [-1979.586] * (-1981.589) [-1986.883] (-1989.860) (-2003.304) -- 0:04:24
169500 -- (-1993.682) (-1991.031) (-2002.278) [-1984.912] * (-1981.035) (-1985.382) [-1989.162] (-1998.770) -- 0:04:24
169600 -- (-1996.865) [-1984.946] (-1998.090) (-1984.264) * [-1984.518] (-1985.960) (-2004.547) (-1997.180) -- 0:04:24
169700 -- (-1994.977) [-1986.809] (-1999.197) (-1982.750) * [-1988.745] (-1984.515) (-1992.285) (-1990.172) -- 0:04:24
169800 -- (-2002.548) (-1988.190) (-1996.179) [-1983.077] * [-1988.694] (-1989.151) (-1988.296) (-1994.748) -- 0:04:24
169900 -- (-2000.814) (-1987.867) (-1988.571) [-1986.432] * (-1989.245) (-1991.044) [-1986.847] (-1986.630) -- 0:04:23
170000 -- (-2001.362) [-1991.698] (-1988.253) (-1996.739) * (-1992.492) (-1992.766) [-1986.514] (-1992.873) -- 0:04:23
Average standard deviation of split frequencies: 0.004829
170100 -- (-1992.602) (-2004.938) [-1990.188] (-1998.725) * (-1990.106) [-1991.921] (-1990.780) (-1995.152) -- 0:04:23
170200 -- (-1994.998) (-1990.778) [-1995.106] (-1987.134) * [-1988.461] (-1988.244) (-1992.843) (-2001.698) -- 0:04:23
170300 -- (-1994.449) (-1988.888) [-1987.649] (-1992.443) * [-1985.334] (-1979.504) (-1985.579) (-1997.691) -- 0:04:23
170400 -- (-1994.542) (-1992.319) [-1988.649] (-1993.287) * [-1983.011] (-1981.397) (-1991.794) (-1993.529) -- 0:04:22
170500 -- (-1999.813) (-1990.523) [-1988.310] (-1990.543) * (-1983.828) [-1979.162] (-1989.320) (-1992.578) -- 0:04:22
170600 -- [-1989.141] (-1993.506) (-1994.068) (-1998.830) * [-1980.076] (-1985.667) (-1989.443) (-2004.254) -- 0:04:22
170700 -- (-1994.505) [-1994.302] (-1990.470) (-1989.737) * (-1984.449) [-1980.598] (-1989.971) (-1999.413) -- 0:04:27
170800 -- (-1991.603) (-1994.514) [-1987.559] (-1991.426) * (-1979.214) [-1979.746] (-1991.538) (-1996.756) -- 0:04:27
170900 -- (-1986.513) (-1987.617) (-1991.262) [-1984.009] * [-1984.568] (-1985.594) (-1990.161) (-2006.424) -- 0:04:26
171000 -- [-1985.339] (-1992.995) (-1991.725) (-1988.598) * (-1986.285) (-1997.295) [-1988.180] (-1990.586) -- 0:04:26
Average standard deviation of split frequencies: 0.004878
171100 -- (-1987.945) [-1985.931] (-1990.570) (-1989.538) * [-1978.283] (-1984.722) (-1991.123) (-1988.675) -- 0:04:26
171200 -- (-1994.421) (-1989.004) (-1986.375) [-1983.242] * [-1984.692] (-1991.515) (-1992.231) (-1994.742) -- 0:04:26
171300 -- (-1991.470) (-1995.425) [-1987.294] (-1981.400) * [-1983.903] (-1989.666) (-1985.718) (-1989.520) -- 0:04:26
171400 -- (-1994.739) (-1996.268) (-1986.999) [-1985.308] * (-1984.871) (-1985.549) [-1986.494] (-1986.040) -- 0:04:25
171500 -- (-2007.135) (-1993.511) [-1987.907] (-1991.262) * (-1991.673) (-1986.293) (-1990.444) [-1982.740] -- 0:04:25
171600 -- (-2014.556) (-1988.699) [-1984.480] (-1987.037) * (-1995.875) [-1983.031] (-1990.084) (-1989.718) -- 0:04:25
171700 -- (-2006.383) (-1994.228) [-1985.555] (-1992.016) * (-1987.690) [-1980.961] (-1995.847) (-1987.961) -- 0:04:25
171800 -- (-2005.538) [-1985.555] (-1989.969) (-1992.360) * (-1990.972) [-1982.627] (-1998.620) (-2001.230) -- 0:04:25
171900 -- (-1999.188) [-1987.375] (-1987.963) (-1996.901) * (-1989.367) [-1980.212] (-1993.212) (-1992.943) -- 0:04:24
172000 -- (-2001.056) (-1988.129) (-1991.228) [-1992.720] * (-1990.424) [-1977.715] (-1994.261) (-1990.057) -- 0:04:24
Average standard deviation of split frequencies: 0.004225
172100 -- (-1998.792) (-1989.711) [-1991.471] (-1990.528) * (-1984.260) [-1977.315] (-1995.819) (-1991.680) -- 0:04:24
172200 -- (-1999.267) (-1985.864) [-1985.641] (-1989.222) * [-1982.633] (-1987.198) (-1996.295) (-1990.789) -- 0:04:24
172300 -- (-1991.778) (-1988.399) (-1988.030) [-1994.564] * [-1989.636] (-1992.383) (-1986.449) (-1989.049) -- 0:04:24
172400 -- (-1985.440) [-1985.025] (-1991.131) (-1995.225) * (-1997.485) (-1998.052) [-1984.574] (-1999.057) -- 0:04:24
172500 -- (-1986.994) (-1992.077) [-1991.534] (-1989.734) * (-1987.441) (-1996.713) [-1984.702] (-1989.030) -- 0:04:23
172600 -- (-1986.842) [-1988.671] (-1996.896) (-1987.461) * [-1987.367] (-2003.573) (-1988.056) (-1987.019) -- 0:04:23
172700 -- [-1986.559] (-1986.784) (-2009.305) (-1993.752) * [-1987.731] (-2000.218) (-1987.886) (-1989.275) -- 0:04:23
172800 -- (-1988.617) [-1989.010] (-1990.199) (-1997.127) * [-1988.312] (-1990.711) (-1990.136) (-1992.052) -- 0:04:23
172900 -- (-1996.092) [-1994.530] (-1989.855) (-1990.868) * (-1992.688) (-1992.448) [-1990.104] (-1998.270) -- 0:04:23
173000 -- (-1996.571) (-2003.835) (-1996.089) [-1981.667] * [-1983.672] (-1992.505) (-1998.133) (-1996.881) -- 0:04:22
Average standard deviation of split frequencies: 0.004433
173100 -- (-2001.546) (-1994.744) (-1991.602) [-1983.128] * [-1984.732] (-2003.261) (-1991.208) (-1995.484) -- 0:04:22
173200 -- (-1995.180) (-1995.391) (-1994.934) [-1985.551] * (-1989.517) (-1993.022) [-1986.345] (-1992.645) -- 0:04:22
173300 -- (-2003.070) (-1998.244) (-1998.406) [-1984.300] * (-1987.365) (-1994.267) [-1988.141] (-1997.537) -- 0:04:22
173400 -- (-1999.975) (-1984.059) (-1996.571) [-1982.814] * [-1985.464] (-1992.165) (-1991.798) (-1993.702) -- 0:04:22
173500 -- (-2006.844) [-1988.444] (-1997.005) (-1984.133) * [-1984.130] (-2002.685) (-1994.672) (-1996.369) -- 0:04:22
173600 -- (-2002.225) [-1988.401] (-1992.018) (-1987.802) * [-1981.229] (-1994.920) (-1991.494) (-1994.020) -- 0:04:21
173700 -- (-2001.055) [-1982.574] (-1988.081) (-1981.505) * [-1980.610] (-2000.087) (-1993.538) (-1996.836) -- 0:04:21
173800 -- (-1996.473) [-1982.428] (-1993.665) (-1985.677) * [-1982.899] (-1998.092) (-1993.922) (-1998.428) -- 0:04:26
173900 -- (-1992.418) (-1980.704) (-1999.795) [-1978.644] * [-1983.738] (-2004.237) (-1998.619) (-2003.352) -- 0:04:26
174000 -- (-1992.297) (-1985.235) (-2005.087) [-1975.951] * (-1982.734) [-1991.638] (-1987.358) (-2009.670) -- 0:04:25
Average standard deviation of split frequencies: 0.005028
174100 -- (-1992.574) (-1990.292) (-2000.990) [-1976.048] * [-1984.600] (-1994.130) (-1992.150) (-2001.931) -- 0:04:25
174200 -- (-1993.384) (-1989.409) (-1993.319) [-1977.938] * [-1981.513] (-1995.801) (-1998.229) (-2002.561) -- 0:04:25
174300 -- [-1987.430] (-1990.525) (-1988.596) (-1979.544) * [-1981.216] (-2003.631) (-1993.219) (-2000.839) -- 0:04:25
174400 -- (-1990.570) [-1989.148] (-1989.885) (-1988.606) * [-1979.711] (-2001.538) (-1993.651) (-2000.995) -- 0:04:25
174500 -- [-1987.425] (-1991.490) (-1988.170) (-1987.133) * [-1979.980] (-2002.901) (-1993.677) (-1991.892) -- 0:04:24
174600 -- (-1986.881) (-1989.418) (-1985.991) [-1987.484] * [-1978.593] (-1999.098) (-1990.336) (-1995.165) -- 0:04:24
174700 -- [-1987.258] (-1990.402) (-1992.423) (-1983.149) * [-1983.651] (-1990.620) (-1991.011) (-1997.693) -- 0:04:24
174800 -- (-1989.263) (-1990.912) (-1992.767) [-1985.027] * [-1979.283] (-1987.189) (-1995.402) (-1993.939) -- 0:04:24
174900 -- (-1995.374) (-1990.145) (-1991.768) [-1980.972] * (-1984.684) (-1990.493) [-1985.509] (-1993.471) -- 0:04:24
175000 -- (-1995.877) (-1994.755) (-1987.581) [-1985.014] * (-1990.167) (-1993.216) [-1985.824] (-1996.212) -- 0:04:24
Average standard deviation of split frequencies: 0.005151
175100 -- (-2001.333) (-1994.628) (-1989.473) [-1979.270] * (-1988.702) (-2000.644) [-1984.889] (-1995.593) -- 0:04:23
175200 -- (-2004.467) (-1998.341) (-1994.024) [-1979.864] * [-1988.993] (-1995.415) (-1988.814) (-1999.117) -- 0:04:23
175300 -- (-2012.233) (-1993.412) (-1992.915) [-1983.407] * (-1991.537) (-1999.258) [-1992.545] (-1999.054) -- 0:04:23
175400 -- (-2003.282) [-1989.222] (-1984.792) (-1985.995) * (-1993.075) (-1990.055) (-1997.408) [-1994.407] -- 0:04:23
175500 -- (-1999.253) (-1990.093) [-1984.520] (-1986.222) * (-1986.258) (-1993.009) (-2000.872) [-1990.152] -- 0:04:23
175600 -- (-1994.109) [-1986.878] (-1992.932) (-1984.997) * (-1988.309) (-1987.317) (-1997.375) [-1985.324] -- 0:04:22
175700 -- (-2006.340) [-1984.828] (-1993.258) (-1982.900) * [-1989.872] (-1984.672) (-1991.778) (-1987.099) -- 0:04:22
175800 -- (-1997.027) (-1988.782) (-2002.795) [-1979.759] * [-1982.571] (-1985.393) (-1992.117) (-1986.623) -- 0:04:22
175900 -- (-1996.081) (-1990.605) (-1993.224) [-1979.332] * (-1987.559) [-1982.319] (-1995.441) (-1995.575) -- 0:04:22
176000 -- (-1994.723) (-1992.291) (-1993.180) [-1980.734] * (-1986.015) [-1983.814] (-1995.620) (-1993.716) -- 0:04:22
Average standard deviation of split frequencies: 0.005429
176100 -- (-1994.353) (-1989.817) (-1988.843) [-1982.235] * (-1990.400) [-1985.042] (-1991.899) (-1987.691) -- 0:04:22
176200 -- (-1989.440) (-1995.003) (-1990.396) [-1984.602] * (-1986.767) [-1981.129] (-1989.948) (-1990.578) -- 0:04:21
176300 -- (-1987.811) (-1996.332) (-1987.683) [-1983.190] * [-1982.060] (-1985.579) (-1998.065) (-1988.689) -- 0:04:21
176400 -- (-1989.961) (-1987.321) (-1990.098) [-1987.662] * (-1987.799) [-1984.036] (-1996.697) (-1990.368) -- 0:04:21
176500 -- (-1991.955) [-1987.857] (-1995.267) (-1995.883) * (-1987.571) [-1990.597] (-1996.973) (-1987.019) -- 0:04:21
176600 -- (-1992.180) [-1986.435] (-2000.193) (-1993.362) * (-1983.389) (-1989.584) [-1987.493] (-1988.583) -- 0:04:21
176700 -- (-1989.793) [-1985.282] (-2004.263) (-1988.937) * [-1982.209] (-1992.125) (-1990.893) (-1995.058) -- 0:04:20
176800 -- (-1995.473) (-1987.310) [-1999.679] (-1994.648) * (-1985.885) [-1987.901] (-1987.489) (-1998.071) -- 0:04:20
176900 -- (-1992.819) [-1987.883] (-1994.972) (-1993.298) * (-1988.106) (-1994.751) [-1986.682] (-1991.146) -- 0:04:20
177000 -- [-1988.301] (-1994.602) (-1990.101) (-1991.265) * [-1985.755] (-1993.256) (-1988.706) (-1992.936) -- 0:04:25
Average standard deviation of split frequencies: 0.005549
177100 -- (-1990.263) (-1990.551) (-1988.522) [-1987.034] * [-1982.211] (-1997.957) (-1990.404) (-1992.305) -- 0:04:24
177200 -- (-1993.280) (-1994.887) (-1988.319) [-1984.956] * [-1982.468] (-2000.246) (-1999.079) (-1998.816) -- 0:04:24
177300 -- (-1990.110) (-1998.228) (-1988.056) [-1982.985] * [-1979.639] (-1991.312) (-1999.346) (-1989.780) -- 0:04:24
177400 -- (-1996.683) [-1994.081] (-1996.018) (-1980.109) * [-1981.239] (-1994.599) (-1989.115) (-1993.739) -- 0:04:24
177500 -- (-1990.112) (-1997.846) (-2000.914) [-1979.327] * (-1983.280) (-2001.577) [-1987.510] (-1991.349) -- 0:04:24
177600 -- (-1991.843) (-1995.939) (-2005.319) [-1982.048] * [-1980.859] (-1990.338) (-1987.334) (-1990.251) -- 0:04:23
177700 -- (-1992.820) (-1993.567) (-1995.007) [-1985.389] * [-1983.373] (-1991.254) (-1992.065) (-1988.709) -- 0:04:23
177800 -- (-1991.471) [-1990.015] (-1996.503) (-1984.496) * [-1991.648] (-1990.509) (-1993.808) (-1991.188) -- 0:04:23
177900 -- [-1983.121] (-2000.925) (-1995.046) (-1985.111) * [-1986.564] (-1992.482) (-1990.958) (-1989.500) -- 0:04:23
178000 -- (-1986.451) (-1994.006) (-1986.347) [-1982.819] * (-1990.052) [-1988.676] (-1987.198) (-1988.823) -- 0:04:23
Average standard deviation of split frequencies: 0.005822
178100 -- (-1991.481) (-1993.813) (-1986.632) [-1982.322] * (-1983.824) (-2003.880) [-1985.242] (-1985.871) -- 0:04:23
178200 -- (-1991.785) (-1994.682) [-1984.535] (-1993.365) * (-2001.858) (-1990.398) (-1983.974) [-1983.349] -- 0:04:22
178300 -- (-1995.002) (-2001.450) [-1986.490] (-1993.258) * (-1994.697) (-1989.218) (-1989.068) [-1985.164] -- 0:04:22
178400 -- (-1993.780) (-2003.703) (-1987.243) [-1990.087] * (-1988.639) (-1990.784) (-1991.636) [-1991.197] -- 0:04:22
178500 -- (-1991.813) (-2000.040) [-1985.589] (-1987.365) * [-1987.874] (-1987.957) (-1995.018) (-1987.284) -- 0:04:22
178600 -- (-1991.829) (-1989.943) (-1984.133) [-1989.933] * [-1986.668] (-1977.544) (-2001.660) (-1995.834) -- 0:04:22
178700 -- (-1995.654) [-1986.696] (-1986.173) (-1993.819) * (-1994.591) [-1980.787] (-1995.409) (-1995.389) -- 0:04:21
178800 -- (-1999.683) (-1988.120) [-1990.739] (-1994.137) * (-1997.556) [-1982.212] (-1997.751) (-1985.976) -- 0:04:21
178900 -- (-1994.695) (-1999.121) (-1992.773) [-1990.781] * (-2007.607) (-1987.896) (-1991.565) [-1980.820] -- 0:04:21
179000 -- (-1992.788) (-2002.591) (-1999.868) [-1984.620] * (-2003.824) (-1987.741) (-1994.936) [-1980.142] -- 0:04:21
Average standard deviation of split frequencies: 0.005487
179100 -- (-1998.116) (-1995.719) [-2001.440] (-1985.738) * (-1996.375) (-1986.582) (-1999.290) [-1976.845] -- 0:04:21
179200 -- (-1997.928) (-1994.526) (-1992.492) [-1986.748] * (-2001.925) (-1984.130) (-1990.773) [-1978.665] -- 0:04:21
179300 -- (-1999.020) (-1986.674) (-1989.464) [-1986.080] * (-1995.959) (-1987.002) (-1986.164) [-1978.386] -- 0:04:20
179400 -- (-2004.517) (-1995.230) [-1987.700] (-1984.071) * (-1985.914) (-2003.872) (-1986.377) [-1980.833] -- 0:04:20
179500 -- (-1994.943) (-1995.757) (-1990.451) [-1985.932] * [-1986.266] (-1993.938) (-1989.417) (-1979.365) -- 0:04:20
179600 -- (-1991.309) (-1992.955) (-1994.320) [-1983.960] * (-1989.524) (-1996.525) (-1991.224) [-1978.231] -- 0:04:20
179700 -- [-1991.479] (-1989.942) (-1992.659) (-1993.821) * (-1984.773) (-1997.752) (-1991.117) [-1981.561] -- 0:04:20
179800 -- (-1991.191) (-1988.438) (-1995.147) [-1992.800] * (-1987.613) (-1993.013) (-1986.874) [-1979.309] -- 0:04:20
179900 -- (-1997.931) [-1984.374] (-1988.826) (-1996.560) * (-1987.822) (-1992.037) (-1994.059) [-1984.690] -- 0:04:19
180000 -- (-1997.295) [-1985.638] (-1988.790) (-1993.206) * (-1987.737) (-1993.191) (-1988.578) [-1982.674] -- 0:04:19
Average standard deviation of split frequencies: 0.005907
180100 -- (-1993.831) (-1989.426) [-1985.499] (-1992.286) * (-1997.818) (-1990.363) (-1997.975) [-1981.867] -- 0:04:24
180200 -- (-1992.761) [-1989.554] (-1989.027) (-1995.812) * (-1987.741) (-1988.249) [-1990.538] (-1987.021) -- 0:04:23
180300 -- (-1992.143) [-1989.713] (-1992.874) (-2006.952) * (-1989.577) (-1984.238) (-1988.225) [-1981.801] -- 0:04:23
180400 -- [-1990.822] (-1992.691) (-1994.050) (-2013.968) * [-1987.469] (-1982.723) (-1986.776) (-1981.649) -- 0:04:23
180500 -- [-1992.701] (-1993.435) (-1998.155) (-2002.828) * (-1988.032) [-1985.261] (-1987.779) (-1983.417) -- 0:04:23
180600 -- [-1987.256] (-2002.098) (-1995.977) (-1989.018) * (-1996.992) [-1982.332] (-1993.468) (-1986.383) -- 0:04:23
180700 -- (-1985.440) (-2009.269) (-1992.723) [-1987.162] * (-1986.771) [-1983.970] (-1996.809) (-1987.984) -- 0:04:22
180800 -- (-1997.366) (-2003.304) (-1994.950) [-1985.596] * (-1981.845) [-1985.018] (-1997.942) (-1991.617) -- 0:04:22
180900 -- (-2000.213) (-2025.245) (-1994.543) [-1985.188] * (-1979.877) [-1981.681] (-1996.558) (-1988.762) -- 0:04:22
181000 -- (-1992.713) (-2005.944) (-1998.105) [-1986.813] * (-1982.146) [-1985.935] (-1992.276) (-1988.314) -- 0:04:22
Average standard deviation of split frequencies: 0.005872
181100 -- (-1987.784) (-2002.664) (-1994.235) [-1985.042] * [-1982.078] (-1988.918) (-1989.567) (-1987.091) -- 0:04:22
181200 -- [-1988.107] (-2000.832) (-1986.976) (-1988.580) * (-1983.047) (-1991.451) (-1989.147) [-1985.054] -- 0:04:22
181300 -- (-1987.609) (-2000.527) [-1983.589] (-1990.580) * [-1981.782] (-1996.481) (-2003.202) (-1984.429) -- 0:04:21
181400 -- (-1995.408) (-2007.016) (-1985.467) [-1985.210] * [-1980.935] (-1992.401) (-1994.575) (-1986.218) -- 0:04:21
181500 -- (-1992.812) (-1994.817) [-1984.089] (-1987.898) * [-1982.997] (-1995.605) (-1990.100) (-1989.469) -- 0:04:21
181600 -- (-1996.610) (-1995.753) [-1981.322] (-1985.985) * (-1984.203) (-2001.544) [-1986.803] (-1991.802) -- 0:04:21
181700 -- (-1985.712) (-1996.537) (-1982.767) [-1984.624] * [-1981.348] (-1993.600) (-1989.156) (-1994.754) -- 0:04:21
181800 -- (-1986.874) (-1997.257) (-1986.296) [-1984.772] * [-1981.834] (-2000.425) (-1988.150) (-1985.249) -- 0:04:21
181900 -- (-1996.972) (-2008.138) [-1984.178] (-1988.690) * [-1985.344] (-1996.579) (-1987.748) (-1985.815) -- 0:04:20
182000 -- (-1999.677) (-1998.206) (-1988.495) [-1992.519] * [-1983.685] (-1997.131) (-1987.533) (-1992.882) -- 0:04:20
Average standard deviation of split frequencies: 0.005472
182100 -- (-1993.803) (-1997.751) (-1990.586) [-1990.853] * [-1988.555] (-1997.232) (-1987.268) (-1997.146) -- 0:04:20
182200 -- (-2000.373) (-1996.937) (-1988.008) [-1992.614] * [-1977.477] (-1995.456) (-1992.791) (-1988.595) -- 0:04:20
182300 -- (-1997.044) (-1996.913) [-1987.997] (-1988.386) * [-1979.886] (-2007.480) (-1993.435) (-1988.733) -- 0:04:20
182400 -- (-2000.670) (-1992.385) (-1990.702) [-1981.686] * (-1982.262) (-2006.794) (-1990.631) [-1981.187] -- 0:04:19
182500 -- (-2006.326) (-1992.997) (-1993.098) [-1984.017] * [-1983.088] (-2004.268) (-1994.066) (-1987.265) -- 0:04:19
182600 -- (-2007.236) (-1990.597) (-1983.682) [-1983.156] * [-1980.629] (-1999.812) (-2002.782) (-1993.676) -- 0:04:19
182700 -- (-2001.760) (-1991.825) (-1986.716) [-1986.145] * [-1980.030] (-2003.704) (-1993.129) (-1993.812) -- 0:04:19
182800 -- (-1999.842) (-1999.546) [-1990.202] (-1986.618) * [-1981.525] (-1994.327) (-1990.838) (-1985.156) -- 0:04:19
182900 -- (-2001.492) (-2007.741) (-1989.106) [-1983.638] * [-1980.779] (-1996.727) (-1990.278) (-1981.545) -- 0:04:19
183000 -- (-2008.999) (-2004.318) (-1991.884) [-1985.985] * [-1983.775] (-2006.057) (-1989.918) (-1979.374) -- 0:04:18
Average standard deviation of split frequencies: 0.005734
183100 -- (-1993.438) (-1997.068) [-1988.763] (-1992.798) * (-1982.482) (-2004.232) (-1989.536) [-1979.522] -- 0:04:23
183200 -- (-1997.768) (-1994.161) [-1985.783] (-1984.446) * (-1985.387) (-1997.162) (-1990.390) [-1979.072] -- 0:04:23
183300 -- (-1996.445) (-1998.475) [-1983.207] (-1988.317) * (-1979.178) (-2004.999) (-1986.897) [-1978.888] -- 0:04:22
183400 -- (-1993.939) (-1991.230) (-1993.488) [-1984.956] * (-1982.848) (-1999.835) (-1992.601) [-1984.527] -- 0:04:22
183500 -- (-1994.955) [-1989.343] (-2000.252) (-1981.626) * [-1982.458] (-2001.708) (-1990.610) (-1991.235) -- 0:04:22
183600 -- [-1988.296] (-1985.548) (-1996.724) (-1983.686) * [-1980.373] (-2004.510) (-1986.053) (-1992.500) -- 0:04:22
183700 -- (-1988.176) (-1986.487) (-2002.726) [-1981.173] * [-1990.387] (-2011.633) (-1989.073) (-1990.477) -- 0:04:22
183800 -- (-1993.311) [-1991.196] (-1995.312) (-1989.773) * (-1987.535) (-2006.407) (-1990.956) [-1987.153] -- 0:04:22
183900 -- (-1994.355) [-1986.822] (-2003.069) (-1988.819) * (-1985.151) (-2000.121) (-1990.800) [-1981.748] -- 0:04:21
184000 -- (-1995.848) (-1998.182) [-1990.878] (-1992.487) * (-1984.699) (-1999.035) (-1989.826) [-1983.936] -- 0:04:21
Average standard deviation of split frequencies: 0.005705
184100 -- (-1991.796) (-1994.846) (-1988.450) [-1984.062] * (-1990.014) (-2005.679) (-2003.595) [-1988.072] -- 0:04:21
184200 -- (-1989.291) (-1992.740) [-1985.377] (-1978.150) * (-1990.225) (-2002.632) (-1991.635) [-1987.888] -- 0:04:21
184300 -- (-1990.975) (-1991.521) [-1989.501] (-1990.801) * (-1986.609) (-1998.856) (-1994.784) [-1987.488] -- 0:04:21
184400 -- (-1994.087) (-1992.742) [-1990.945] (-1996.326) * [-1981.592] (-2000.549) (-1992.030) (-1993.083) -- 0:04:20
184500 -- (-1989.577) [-1987.154] (-1984.368) (-2005.349) * [-1979.900] (-1999.836) (-1989.287) (-1994.740) -- 0:04:20
184600 -- (-1994.786) (-1987.049) (-1986.529) [-1990.550] * [-1983.874] (-1995.546) (-1992.765) (-1995.477) -- 0:04:20
184700 -- (-1983.481) (-1997.574) (-1990.255) [-1985.033] * [-1987.479] (-1996.716) (-1990.411) (-1996.575) -- 0:04:20
184800 -- (-1986.994) (-2005.210) [-1989.620] (-1999.946) * [-1982.920] (-1994.372) (-1995.258) (-2002.628) -- 0:04:20
184900 -- (-1988.058) (-1994.350) (-1988.472) [-1995.309] * [-1983.101] (-1998.271) (-1991.081) (-1996.032) -- 0:04:20
185000 -- [-1987.021] (-1992.967) (-1993.160) (-1995.631) * [-1985.793] (-1991.356) (-1991.046) (-1997.173) -- 0:04:19
Average standard deviation of split frequencies: 0.005673
185100 -- (-1988.720) (-1992.729) (-1990.601) [-1995.705] * [-1983.903] (-1990.998) (-1992.086) (-1991.175) -- 0:04:19
185200 -- [-1990.442] (-1999.921) (-1992.477) (-1999.127) * (-1985.622) (-1996.533) (-2001.512) [-1984.433] -- 0:04:19
185300 -- [-1990.155] (-2001.432) (-1992.510) (-1995.079) * (-1993.883) (-1991.825) (-2002.237) [-1986.976] -- 0:04:19
185400 -- (-1988.880) (-1996.850) [-1993.136] (-2004.661) * (-1990.540) [-1988.775] (-2001.850) (-1993.196) -- 0:04:19
185500 -- [-1985.821] (-1997.856) (-1992.318) (-1997.056) * [-1988.865] (-1988.241) (-1996.218) (-1994.906) -- 0:04:19
185600 -- [-1984.790] (-1990.271) (-2011.257) (-1987.861) * (-1987.919) [-1988.804] (-2002.598) (-1988.050) -- 0:04:18
185700 -- (-1986.401) [-1986.571] (-2005.128) (-1988.008) * [-1986.756] (-1986.432) (-1990.350) (-1996.533) -- 0:04:18
185800 -- [-1985.089] (-1988.922) (-2002.263) (-1988.814) * (-1988.051) (-2006.596) [-1990.109] (-2002.762) -- 0:04:18
185900 -- (-1987.952) (-1984.537) (-1994.128) [-1993.886] * [-1989.532] (-2003.754) (-1990.300) (-1994.491) -- 0:04:18
186000 -- (-1996.350) [-1983.704] (-1988.022) (-1990.458) * (-1990.939) (-1996.060) (-1994.450) [-1986.194] -- 0:04:18
Average standard deviation of split frequencies: 0.006078
186100 -- (-1995.685) [-1988.895] (-1992.817) (-1992.024) * [-1987.637] (-2004.199) (-1994.536) (-1987.800) -- 0:04:18
186200 -- (-1990.507) [-1991.560] (-1998.852) (-1993.301) * (-1985.799) (-1994.024) (-1996.408) [-1985.095] -- 0:04:17
186300 -- (-1988.374) [-1987.634] (-2005.750) (-1996.781) * (-1991.064) (-1996.159) (-1994.760) [-1981.579] -- 0:04:22
186400 -- (-1988.109) [-1986.760] (-2007.862) (-1988.416) * [-1993.372] (-1997.695) (-1993.409) (-1984.960) -- 0:04:21
186500 -- (-1985.759) (-1983.712) (-2001.486) [-1985.829] * (-1992.702) (-1999.354) (-1993.399) [-1983.676] -- 0:04:21
186600 -- (-1985.950) [-1990.532] (-1990.193) (-1984.114) * (-1995.330) (-1993.511) (-1989.672) [-1981.849] -- 0:04:21
186700 -- [-1986.316] (-1991.473) (-1992.289) (-1982.723) * (-1989.622) (-1996.797) (-1987.615) [-1983.434] -- 0:04:21
186800 -- (-1987.366) (-1991.548) (-1992.145) [-1983.141] * (-1987.096) (-2005.294) (-1990.955) [-1985.169] -- 0:04:21
186900 -- [-1978.345] (-1990.057) (-1998.447) (-1981.155) * [-1989.762] (-1993.909) (-1990.467) (-1987.878) -- 0:04:21
187000 -- [-1981.647] (-1985.146) (-2006.838) (-1980.918) * [-1986.152] (-1997.465) (-1990.339) (-1992.722) -- 0:04:20
Average standard deviation of split frequencies: 0.006044
187100 -- (-1980.455) [-1985.178] (-2001.356) (-1982.447) * (-1991.088) (-1996.792) [-1987.255] (-1992.401) -- 0:04:20
187200 -- (-1983.301) [-1983.220] (-1999.333) (-1985.155) * [-1985.911] (-1991.933) (-1996.695) (-1998.070) -- 0:04:20
187300 -- (-1979.995) [-1982.275] (-2017.024) (-1985.479) * [-1981.138] (-1983.775) (-1989.050) (-1997.151) -- 0:04:20
187400 -- [-1981.716] (-1989.103) (-1997.429) (-1983.403) * (-1982.232) [-1990.638] (-1986.373) (-2019.892) -- 0:04:20
187500 -- (-1981.788) (-1988.767) (-1992.796) [-1984.008] * [-1983.525] (-1987.996) (-1993.403) (-2006.886) -- 0:04:20
187600 -- (-1984.768) (-1994.528) (-1987.568) [-1981.496] * (-1984.087) [-1983.407] (-1999.129) (-2004.971) -- 0:04:19
187700 -- [-1988.278] (-1996.644) (-1998.341) (-1989.678) * [-1981.666] (-1986.034) (-1995.498) (-2008.414) -- 0:04:19
187800 -- (-1990.250) (-1994.251) (-1993.511) [-1986.211] * [-1979.190] (-1986.593) (-1999.439) (-1984.281) -- 0:04:19
187900 -- [-1989.677] (-1990.797) (-1989.441) (-1990.096) * [-1982.584] (-1990.170) (-1995.360) (-1986.235) -- 0:04:19
188000 -- (-1989.410) [-1986.929] (-1998.270) (-1984.993) * [-1979.596] (-1988.619) (-2001.305) (-1989.765) -- 0:04:19
Average standard deviation of split frequencies: 0.006014
188100 -- (-1982.359) (-1989.443) (-1990.900) [-1983.619] * (-1986.646) (-1991.849) (-2003.123) [-1982.885] -- 0:04:18
188200 -- (-1979.999) (-1994.837) (-1988.732) [-1979.846] * [-1986.763] (-1995.414) (-2008.081) (-1987.314) -- 0:04:18
188300 -- (-1986.886) (-1999.295) (-1990.651) [-1981.190] * (-1988.240) [-1987.730] (-2010.534) (-1982.994) -- 0:04:18
188400 -- (-1991.378) (-2000.324) (-1988.886) [-1980.299] * (-2001.355) [-1984.090] (-2001.189) (-1983.080) -- 0:04:18
188500 -- (-1994.924) (-1991.683) (-1989.949) [-1983.962] * (-2003.705) [-1987.108] (-1996.272) (-1985.411) -- 0:04:18
188600 -- (-1990.555) [-1990.311] (-1992.973) (-1989.496) * (-1989.651) (-1992.975) (-1995.630) [-1987.331] -- 0:04:18
188700 -- (-1991.700) (-1997.260) (-1989.772) [-1991.698] * (-1993.036) (-1993.066) (-1987.632) [-1987.591] -- 0:04:17
188800 -- (-1988.651) (-1996.209) [-1992.980] (-1986.197) * (-1987.335) (-1991.693) (-1987.641) [-1985.411] -- 0:04:17
188900 -- (-1995.816) (-1992.005) (-1992.681) [-1982.625] * (-1984.239) (-1994.024) (-1983.465) [-1985.385] -- 0:04:17
189000 -- (-1997.643) (-1995.922) [-1980.126] (-1985.919) * (-1986.170) (-1989.948) [-1984.896] (-1993.350) -- 0:04:17
Average standard deviation of split frequencies: 0.005695
189100 -- (-1999.355) (-1994.418) (-1978.543) [-1986.073] * (-1990.138) (-1994.858) [-1982.113] (-1991.556) -- 0:04:17
189200 -- (-1988.344) (-2003.956) [-1982.202] (-1984.657) * [-1983.905] (-1998.605) (-1986.000) (-2007.040) -- 0:04:17
189300 -- (-1987.209) (-2007.760) (-1986.216) [-1982.206] * [-1984.668] (-1996.421) (-1989.155) (-2005.523) -- 0:04:16
189400 -- [-1984.653] (-1994.789) (-1985.334) (-1993.051) * [-1982.890] (-1999.428) (-1989.110) (-1999.379) -- 0:04:21
189500 -- [-1977.337] (-1991.228) (-1986.928) (-1988.884) * [-1985.897] (-1998.299) (-1988.959) (-2008.338) -- 0:04:20
189600 -- [-1981.888] (-1997.499) (-1988.482) (-1988.427) * [-1984.721] (-1998.160) (-1995.655) (-1998.324) -- 0:04:20
189700 -- (-1983.863) (-1990.956) (-1999.131) [-1981.006] * [-1982.871] (-1998.427) (-1992.823) (-1999.069) -- 0:04:20
189800 -- [-1986.214] (-1998.393) (-1986.188) (-1984.043) * (-1989.444) [-1987.040] (-2001.530) (-1999.782) -- 0:04:20
189900 -- [-1986.572] (-1996.438) (-1995.181) (-1990.261) * [-1986.823] (-1986.604) (-1996.522) (-1995.172) -- 0:04:20
190000 -- (-1995.620) (-1991.653) (-1983.864) [-1982.698] * (-1982.861) [-1990.440] (-1997.771) (-1995.421) -- 0:04:20
Average standard deviation of split frequencies: 0.005525
190100 -- (-1988.762) (-2000.164) (-1981.577) [-1987.714] * [-1979.548] (-1991.150) (-1995.679) (-1989.055) -- 0:04:19
190200 -- (-1990.133) (-1997.067) [-1981.208] (-1992.511) * (-1991.429) (-1989.951) (-1993.245) [-1989.060] -- 0:04:19
190300 -- (-1986.921) (-2000.312) [-1983.290] (-1992.742) * [-1989.083] (-1995.168) (-1994.846) (-1984.310) -- 0:04:19
190400 -- [-1984.909] (-2003.019) (-1989.385) (-1998.590) * (-1998.010) (-1999.914) (-1995.283) [-1986.354] -- 0:04:19
190500 -- (-1985.594) (-2002.355) [-1987.243] (-1987.823) * (-2002.131) (-1994.149) (-1996.294) [-1998.355] -- 0:04:19
190600 -- (-1991.182) (-1995.663) [-1980.227] (-1990.813) * (-1993.668) [-1991.500] (-1992.854) (-1989.166) -- 0:04:19
190700 -- (-1987.977) (-1994.715) [-1977.396] (-1999.268) * (-1988.761) (-1989.073) (-1993.030) [-1987.903] -- 0:04:18
190800 -- (-1986.484) (-1989.539) [-1977.048] (-2006.574) * (-1982.398) [-1988.199] (-1998.682) (-1989.862) -- 0:04:18
190900 -- [-1984.425] (-1995.505) (-1979.672) (-2005.379) * (-1989.085) (-1990.033) (-1994.875) [-1980.905] -- 0:04:18
191000 -- [-1982.909] (-1995.447) (-1984.239) (-2006.226) * (-1990.434) (-1983.878) (-1990.737) [-1981.248] -- 0:04:18
Average standard deviation of split frequencies: 0.005283
191100 -- [-1980.965] (-1998.890) (-1980.504) (-2006.327) * (-1990.244) (-1988.480) (-1989.436) [-1986.359] -- 0:04:18
191200 -- [-1983.329] (-1995.358) (-1982.019) (-1994.676) * (-1988.181) (-1994.182) (-1985.707) [-1982.354] -- 0:04:18
191300 -- [-1982.566] (-2002.013) (-1985.721) (-2000.700) * (-1985.795) (-1991.879) [-1985.261] (-1987.932) -- 0:04:17
191400 -- [-1986.667] (-1992.754) (-1998.137) (-1996.982) * (-1995.254) (-1998.010) (-1986.484) [-1983.484] -- 0:04:17
191500 -- (-1981.536) (-1988.353) (-1997.236) [-1991.515] * (-1994.808) [-1992.496] (-1997.147) (-1986.163) -- 0:04:17
191600 -- [-1980.298] (-1992.691) (-1999.301) (-1992.300) * (-1992.132) (-1990.302) [-1988.958] (-1988.335) -- 0:04:17
191700 -- (-1988.777) (-1990.725) (-1996.449) [-1990.817] * (-1991.350) [-1990.244] (-1988.514) (-1993.972) -- 0:04:17
191800 -- [-1988.205] (-1997.055) (-1988.043) (-1994.681) * (-1990.148) [-1987.229] (-1989.543) (-1990.846) -- 0:04:17
191900 -- [-1979.992] (-1999.070) (-1981.680) (-1989.116) * [-1991.205] (-1988.876) (-1987.525) (-1990.790) -- 0:04:16
192000 -- [-1981.687] (-1997.792) (-1984.271) (-1990.908) * (-1994.197) [-1989.103] (-1992.479) (-1991.946) -- 0:04:16
Average standard deviation of split frequencies: 0.005328
192100 -- [-1989.705] (-1991.540) (-1986.103) (-1999.684) * (-1999.654) (-1988.829) [-1988.195] (-1991.073) -- 0:04:16
192200 -- [-1987.193] (-1988.218) (-1983.918) (-1998.635) * (-2003.754) (-1991.144) (-1993.260) [-1988.526] -- 0:04:16
192300 -- (-1990.625) (-1989.911) [-1986.876] (-1995.421) * (-2000.744) [-1990.781] (-1992.982) (-1983.876) -- 0:04:16
192400 -- (-1988.263) (-1982.830) [-1982.493] (-1989.426) * (-2000.906) (-1990.901) (-1992.694) [-1984.502] -- 0:04:16
192500 -- [-1980.507] (-1986.826) (-1981.068) (-1993.407) * (-1993.274) (-1997.214) (-1995.081) [-1978.234] -- 0:04:20
192600 -- (-1986.103) (-1990.324) [-1980.347] (-1992.215) * (-1998.091) (-2001.607) (-1990.729) [-1976.456] -- 0:04:19
192700 -- (-1992.323) (-1990.790) [-1980.553] (-1998.522) * (-2005.982) (-2000.838) (-1990.958) [-1983.018] -- 0:04:19
192800 -- (-1989.662) (-1983.817) [-1984.228] (-1992.491) * (-2014.032) (-2000.150) [-1991.606] (-1981.705) -- 0:04:19
192900 -- (-1991.601) (-1981.316) [-1983.798] (-1999.995) * (-1998.211) (-1999.994) (-1990.696) [-1980.636] -- 0:04:19
193000 -- (-1989.342) (-1986.706) [-1981.670] (-2000.862) * (-2002.236) (-1999.156) (-1989.958) [-1988.455] -- 0:04:19
Average standard deviation of split frequencies: 0.005159
193100 -- (-1986.953) (-1993.679) [-1983.071] (-2005.380) * (-2003.088) (-1995.738) (-1984.289) [-1982.861] -- 0:04:19
193200 -- (-1988.626) (-1994.072) [-1986.738] (-2004.710) * (-2002.262) (-1989.632) [-1984.384] (-1981.917) -- 0:04:18
193300 -- (-1992.658) (-1991.498) [-1985.848] (-2001.913) * [-1997.513] (-1999.406) (-1986.817) (-1987.598) -- 0:04:18
193400 -- [-1986.446] (-1990.542) (-1989.732) (-2016.573) * (-1997.157) (-2006.910) [-1984.883] (-1993.655) -- 0:04:18
193500 -- [-1987.603] (-1985.044) (-1988.521) (-1997.964) * (-1997.522) (-1995.936) [-1986.381] (-1987.894) -- 0:04:18
193600 -- [-1981.982] (-1986.688) (-1992.603) (-1998.092) * (-1994.795) (-1997.101) (-1993.903) [-1984.672] -- 0:04:18
193700 -- [-1981.086] (-1983.954) (-1990.961) (-1993.969) * (-1987.202) (-1993.932) (-1998.626) [-1986.778] -- 0:04:18
193800 -- (-1989.584) [-1982.487] (-1987.144) (-1988.623) * [-1983.956] (-1988.814) (-1996.918) (-1989.974) -- 0:04:17
193900 -- (-2000.507) (-1990.094) [-1981.715] (-1988.401) * (-1988.813) (-1989.429) (-1987.343) [-1987.849] -- 0:04:17
194000 -- (-1997.605) (-1988.032) [-1984.170] (-1993.185) * [-1986.034] (-1988.058) (-1989.109) (-1993.477) -- 0:04:17
Average standard deviation of split frequencies: 0.005134
194100 -- (-1990.517) (-1985.432) [-1981.716] (-1995.909) * [-1989.144] (-1992.909) (-1992.837) (-1985.880) -- 0:04:17
194200 -- (-1990.845) (-1979.395) [-1980.058] (-1993.710) * (-1992.736) (-1991.434) (-1993.645) [-1983.820] -- 0:04:17
194300 -- (-1988.166) (-1981.387) [-1979.137] (-1990.613) * (-1997.135) (-1990.548) (-1996.584) [-1988.588] -- 0:04:17
194400 -- (-1982.289) [-1987.617] (-1982.061) (-1997.215) * [-1989.516] (-1993.015) (-1996.478) (-1983.141) -- 0:04:16
194500 -- [-1987.729] (-1987.832) (-1981.759) (-1991.490) * (-1992.277) (-2001.008) (-1995.742) [-1985.189] -- 0:04:16
194600 -- (-1985.879) [-1989.687] (-1978.782) (-1993.861) * (-1994.527) (-1993.324) (-1997.773) [-1986.328] -- 0:04:16
194700 -- [-1986.511] (-1996.864) (-1977.250) (-1992.739) * (-1992.423) (-1990.264) (-2001.884) [-1984.609] -- 0:04:16
194800 -- (-1989.618) (-2000.357) [-1978.692] (-2000.189) * [-1988.112] (-1994.110) (-1997.874) (-1985.561) -- 0:04:16
194900 -- (-1993.409) (-1995.526) [-1979.956] (-2001.494) * (-1984.209) (-1992.715) (-2008.735) [-1982.107] -- 0:04:16
195000 -- (-1990.107) (-1997.062) [-1987.782] (-1993.067) * (-1990.419) (-1992.659) (-2004.953) [-1986.202] -- 0:04:15
Average standard deviation of split frequencies: 0.005244
195100 -- [-1983.835] (-1988.360) (-1988.019) (-1998.663) * [-1989.781] (-1990.264) (-1991.105) (-1984.974) -- 0:04:15
195200 -- [-1984.126] (-1985.246) (-1991.519) (-2000.684) * (-1989.960) (-1994.669) (-1996.367) [-1988.464] -- 0:04:15
195300 -- [-1985.672] (-1991.555) (-1988.510) (-1998.793) * (-1995.839) [-1994.548] (-2001.245) (-1996.455) -- 0:04:15
195400 -- (-1989.515) (-1982.820) [-1995.372] (-2000.906) * (-1989.053) (-1988.710) (-2005.568) [-1985.346] -- 0:04:15
195500 -- (-1997.455) [-1979.653] (-1983.968) (-2005.710) * [-1991.235] (-1999.391) (-2009.530) (-1990.092) -- 0:04:15
195600 -- (-1993.171) [-1985.627] (-1987.247) (-1995.897) * (-1987.014) [-1993.617] (-2004.974) (-1992.600) -- 0:04:19
195700 -- (-1994.355) [-1990.369] (-1986.801) (-1988.287) * [-1988.616] (-1991.363) (-1995.747) (-1999.215) -- 0:04:18
195800 -- (-1994.957) [-1990.303] (-1986.792) (-1988.968) * (-1984.909) [-1987.344] (-1990.668) (-1994.500) -- 0:04:18
195900 -- (-1998.633) (-1996.853) [-1985.292] (-1987.466) * (-1985.622) [-1983.878] (-1992.870) (-2001.080) -- 0:04:18
196000 -- (-1999.041) [-1989.445] (-1993.362) (-1993.681) * [-1984.598] (-1983.095) (-1989.458) (-1994.247) -- 0:04:18
Average standard deviation of split frequencies: 0.004944
196100 -- (-1994.890) [-1987.896] (-1992.040) (-2002.979) * [-1988.004] (-1987.789) (-1988.417) (-1989.071) -- 0:04:18
196200 -- (-2001.229) (-1993.368) [-1988.255] (-1995.345) * [-1986.644] (-1995.594) (-1985.666) (-1985.222) -- 0:04:18
196300 -- (-2011.594) (-1990.189) [-1987.008] (-1983.306) * (-1989.603) (-1992.529) (-1992.378) [-1983.232] -- 0:04:17
196400 -- (-2012.334) (-1993.158) (-1987.772) [-1985.324] * (-1988.784) (-1989.715) (-1997.092) [-1984.951] -- 0:04:17
196500 -- (-1997.056) (-1997.707) (-1985.875) [-1984.428] * (-1992.171) (-1986.340) (-1999.711) [-1986.266] -- 0:04:17
196600 -- (-1993.382) (-1989.939) (-1986.458) [-1981.698] * (-1990.984) [-1982.885] (-1995.219) (-1985.051) -- 0:04:17
196700 -- (-1997.482) (-1994.503) (-1987.252) [-1990.759] * (-1991.802) [-1984.517] (-1998.855) (-1986.995) -- 0:04:17
196800 -- (-1994.381) [-1987.102] (-1988.615) (-1989.254) * (-1989.441) [-1986.403] (-1995.377) (-1987.788) -- 0:04:17
196900 -- (-2001.328) [-1986.756] (-1989.023) (-1980.757) * (-1987.462) (-1992.540) (-1990.662) [-1979.257] -- 0:04:16
197000 -- (-1992.352) (-1996.268) (-1992.865) [-1983.667] * (-1984.400) [-1987.429] (-1997.051) (-1982.582) -- 0:04:16
Average standard deviation of split frequencies: 0.004781
197100 -- (-1993.432) (-1994.175) (-1988.289) [-1981.056] * (-1985.602) (-1988.700) (-1994.397) [-1989.146] -- 0:04:16
197200 -- (-2002.995) [-1986.976] (-1984.744) (-1985.738) * [-1990.414] (-2000.583) (-1995.248) (-1984.253) -- 0:04:16
197300 -- (-2004.357) (-1985.945) [-1983.161] (-1988.699) * (-1986.028) [-1991.487] (-1991.396) (-1977.905) -- 0:04:16
197400 -- (-2007.028) (-1987.670) [-1987.737] (-1992.526) * (-1988.674) (-1998.272) (-1994.857) [-1980.364] -- 0:04:16
197500 -- (-2003.446) (-1997.300) (-1983.764) [-1987.666] * (-1989.916) (-2000.116) (-1995.481) [-1979.226] -- 0:04:15
197600 -- (-1997.059) (-1997.833) [-1984.087] (-1985.838) * (-1993.794) (-1997.478) (-1989.932) [-1977.045] -- 0:04:15
197700 -- (-1992.162) (-1992.987) (-1986.969) [-1986.560] * (-1986.813) (-2003.407) (-1998.987) [-1978.978] -- 0:04:15
197800 -- (-1999.215) (-1991.808) [-1981.311] (-1981.080) * (-1983.952) (-2000.831) (-1991.297) [-1984.056] -- 0:04:15
197900 -- (-1999.456) (-1989.562) (-1978.526) [-1981.781] * [-1983.024] (-1998.671) (-1984.472) (-1985.837) -- 0:04:15
198000 -- (-1987.717) (-1990.961) [-1984.893] (-1986.098) * [-1984.717] (-1991.965) (-1989.549) (-1982.702) -- 0:04:15
Average standard deviation of split frequencies: 0.004826
198100 -- (-1986.954) (-1994.450) (-1979.085) [-1983.736] * [-1983.046] (-1992.700) (-1998.604) (-1987.219) -- 0:04:15
198200 -- (-1988.883) (-1998.648) (-1989.975) [-1978.822] * [-1986.912] (-1989.657) (-1987.745) (-1985.675) -- 0:04:14
198300 -- (-1992.172) (-1997.482) (-1987.458) [-1981.378] * (-1993.455) (-1988.849) (-1991.213) [-1982.464] -- 0:04:14
198400 -- (-1992.801) (-1999.725) (-1986.928) [-1981.174] * (-1999.359) (-1987.995) (-1991.366) [-1983.817] -- 0:04:14
198500 -- (-1997.032) (-2000.167) (-1989.266) [-1986.945] * (-1989.859) (-1985.410) (-1993.492) [-1982.283] -- 0:04:14
198600 -- [-1989.720] (-1995.143) (-1985.520) (-1979.778) * [-1988.917] (-1995.344) (-1992.023) (-1981.973) -- 0:04:14
198700 -- (-1988.429) (-1994.461) (-1983.516) [-1981.295] * (-1989.863) (-1999.896) (-1995.880) [-1981.200] -- 0:04:18
198800 -- (-1991.469) [-1991.621] (-1990.145) (-1985.521) * (-1994.892) (-2000.419) (-1989.423) [-1983.314] -- 0:04:17
198900 -- (-1996.028) [-1986.628] (-1993.658) (-1989.357) * (-1991.839) (-1995.781) (-1991.546) [-1982.746] -- 0:04:17
199000 -- (-1998.259) (-1986.121) (-1998.593) [-1984.455] * (-1996.081) (-1989.303) (-1991.449) [-1983.610] -- 0:04:17
Average standard deviation of split frequencies: 0.004530
199100 -- (-1994.664) [-1989.771] (-1995.232) (-1990.604) * (-1993.230) (-1994.428) (-1987.809) [-1980.416] -- 0:04:17
199200 -- (-1998.492) (-1989.234) (-1999.487) [-1987.992] * (-1996.829) (-1999.917) [-1986.477] (-1986.183) -- 0:04:17
199300 -- (-1998.037) (-1987.620) [-1993.094] (-2000.114) * (-2005.735) (-1996.084) (-1982.656) [-1981.577] -- 0:04:17
199400 -- (-1997.437) [-1988.212] (-2000.124) (-1995.359) * (-2000.225) (-2004.019) [-1985.797] (-1987.332) -- 0:04:16
199500 -- (-1999.827) [-1981.923] (-1993.996) (-1984.583) * (-1996.801) (-2005.150) [-1989.421] (-1995.184) -- 0:04:16
199600 -- (-2000.770) (-1986.760) (-1987.319) [-1987.275] * (-1998.265) (-1996.837) (-1991.228) [-1991.306] -- 0:04:16
199700 -- (-1996.106) [-1980.750] (-1990.287) (-1982.341) * (-1997.200) (-1996.425) (-1990.297) [-1986.447] -- 0:04:16
199800 -- (-1992.247) (-1988.467) (-1992.588) [-1981.213] * (-1998.044) (-1994.676) (-1991.237) [-1987.435] -- 0:04:16
199900 -- (-1987.807) (-1991.823) [-1987.523] (-1978.171) * (-1992.284) (-1993.726) [-1989.265] (-1986.523) -- 0:04:16
200000 -- (-1996.980) (-1988.060) (-1995.771) [-1986.086] * (-2007.199) (-1990.080) (-1992.000) [-1988.579] -- 0:04:16
Average standard deviation of split frequencies: 0.004442
200100 -- (-1992.956) [-1983.779] (-2001.119) (-1986.741) * (-2006.066) (-2002.954) [-1997.064] (-1992.511) -- 0:04:15
200200 -- (-1992.589) [-1979.257] (-1995.180) (-1986.387) * (-1992.612) (-2003.845) (-1994.866) [-1985.646] -- 0:04:15
200300 -- (-1994.406) (-1979.629) (-1998.439) [-1986.025] * (-1992.617) (-2000.350) (-1994.693) [-1985.552] -- 0:04:15
200400 -- (-1994.641) [-1980.960] (-1998.135) (-1991.090) * [-1988.547] (-2008.651) (-1996.790) (-1989.314) -- 0:04:15
200500 -- (-1999.472) [-1980.837] (-1997.453) (-1984.029) * (-1987.383) (-2003.667) (-1986.590) [-1981.902] -- 0:04:15
200600 -- (-1999.725) (-1990.002) (-1999.104) [-1984.999] * (-1991.128) (-2019.960) (-1992.598) [-1980.404] -- 0:04:15
200700 -- (-1998.672) (-1980.809) (-1994.967) [-1979.516] * (-1989.857) (-2020.492) (-1994.703) [-1981.035] -- 0:04:14
200800 -- (-1997.837) (-1989.747) (-1996.880) [-1980.598] * (-1991.006) (-2003.298) (-1993.935) [-1983.510] -- 0:04:14
200900 -- (-2004.245) (-1987.671) (-1986.123) [-1982.133] * (-1989.319) (-2011.564) (-1997.727) [-1984.568] -- 0:04:14
201000 -- (-2007.982) (-1985.850) (-1986.940) [-1978.227] * (-1985.237) (-2011.947) [-1994.158] (-1983.399) -- 0:04:14
Average standard deviation of split frequencies: 0.004351
201100 -- (-2004.012) (-1985.974) (-1985.596) [-1982.261] * [-1985.454] (-1999.494) (-1998.497) (-1982.726) -- 0:04:14
201200 -- (-2000.866) (-1991.818) (-1987.568) [-1980.699] * (-1987.521) (-1992.240) (-2002.131) [-1981.752] -- 0:04:14
201300 -- (-1994.035) (-1988.627) (-1995.367) [-1981.305] * (-1994.979) (-1995.660) (-1996.966) [-1979.818] -- 0:04:13
201400 -- (-1987.421) (-1988.437) (-1998.447) [-1983.290] * (-1990.144) (-1996.883) (-1992.346) [-1982.228] -- 0:04:13
201500 -- (-1988.772) (-1994.835) (-2003.686) [-1982.273] * [-1985.363] (-2007.390) (-1998.323) (-1986.055) -- 0:04:13
201600 -- (-1994.589) (-1984.896) (-1997.468) [-1985.437] * (-1986.605) (-2002.125) (-1999.972) [-1983.637] -- 0:04:13
201700 -- (-1989.415) [-1985.286] (-1993.838) (-1980.579) * (-1987.309) [-1994.405] (-2000.181) (-1986.835) -- 0:04:13
201800 -- (-1992.761) (-1985.897) (-1989.406) [-1984.475] * [-1985.998] (-2006.395) (-1997.606) (-1990.646) -- 0:04:17
201900 -- (-1992.685) (-1986.704) (-1984.453) [-1981.346] * (-1990.903) (-1998.814) (-1996.467) [-1985.426] -- 0:04:16
202000 -- (-2004.488) (-1983.379) [-1984.253] (-1982.047) * (-1995.200) (-2002.623) (-2003.787) [-1984.181] -- 0:04:16
Average standard deviation of split frequencies: 0.004198
202100 -- (-2005.996) [-1982.193] (-1983.047) (-1982.575) * (-1995.710) (-1998.896) (-1995.976) [-1982.251] -- 0:04:16
202200 -- (-2002.445) (-1984.429) [-1988.731] (-1985.431) * (-1989.472) (-1995.778) (-1991.700) [-1982.331] -- 0:04:16
202300 -- (-1993.772) (-1985.871) [-1979.750] (-1980.689) * (-1992.373) (-1997.812) (-1988.295) [-1981.590] -- 0:04:16
202400 -- (-1994.139) (-1986.865) [-1979.240] (-1985.378) * (-1996.054) [-1996.156] (-1988.958) (-1980.119) -- 0:04:16
202500 -- (-1991.896) [-1996.435] (-1979.199) (-1989.367) * (-1992.457) (-1994.758) (-1991.285) [-1982.965] -- 0:04:15
202600 -- (-1991.892) (-1990.226) [-1979.783] (-1985.921) * (-1992.701) (-2000.874) (-1989.891) [-1982.413] -- 0:04:15
202700 -- (-1992.259) (-1988.400) [-1982.446] (-1993.119) * (-1993.754) (-2000.768) (-1988.560) [-1990.853] -- 0:04:15
202800 -- (-1991.331) (-1988.664) [-1995.323] (-1999.295) * (-1993.782) (-1998.995) [-1986.352] (-1990.445) -- 0:04:15
202900 -- (-1987.811) [-1988.137] (-1984.287) (-1999.181) * [-1990.429] (-2002.492) (-1987.720) (-1990.970) -- 0:04:15
203000 -- [-1988.543] (-1990.986) (-1989.121) (-1995.263) * (-1994.079) (-1999.749) (-1990.428) [-1983.372] -- 0:04:15
Average standard deviation of split frequencies: 0.004176
203100 -- [-1994.057] (-1982.991) (-1997.373) (-2001.274) * (-1995.105) (-2010.093) (-1991.282) [-1982.379] -- 0:04:15
203200 -- (-1991.178) (-1985.460) (-1990.872) [-1991.634] * (-1994.340) (-1993.732) [-1991.849] (-1977.982) -- 0:04:14
203300 -- (-1997.730) [-1985.004] (-1992.457) (-1989.222) * (-1992.636) (-1991.118) (-1990.636) [-1978.259] -- 0:04:14
203400 -- (-1997.691) (-1988.422) (-1991.563) [-1990.690] * (-1990.033) (-1989.473) (-1987.610) [-1980.024] -- 0:04:14
203500 -- (-1997.862) [-1986.332] (-1990.175) (-1993.455) * [-1994.864] (-1985.043) (-1989.035) (-1985.146) -- 0:04:14
203600 -- (-2005.327) (-1986.825) [-1983.031] (-1994.548) * (-2004.706) (-1985.222) (-1996.168) [-1979.217] -- 0:04:14
203700 -- [-1994.107] (-1985.465) (-1984.023) (-1993.105) * (-2005.943) (-1989.551) (-1987.330) [-1985.763] -- 0:04:14
203800 -- (-1992.538) (-1990.358) (-1990.266) [-1990.516] * (-2002.032) (-1989.548) [-1986.583] (-1978.394) -- 0:04:13
203900 -- (-1985.940) [-1988.395] (-1992.404) (-1999.359) * (-1995.168) (-1988.843) (-1993.277) [-1979.109] -- 0:04:13
204000 -- [-1986.332] (-1990.677) (-1994.977) (-1993.586) * (-1993.521) (-1987.646) (-1992.702) [-1978.194] -- 0:04:13
Average standard deviation of split frequencies: 0.004025
204100 -- [-1991.156] (-1987.516) (-1992.147) (-2003.235) * (-2002.800) (-1988.652) (-1990.250) [-1981.158] -- 0:04:13
204200 -- (-1989.635) (-1986.056) [-1986.543] (-2018.502) * (-2004.387) [-1986.650] (-1986.397) (-1987.705) -- 0:04:13
204300 -- (-1995.329) [-1984.876] (-1991.756) (-2004.710) * (-1991.501) (-1991.334) [-1990.737] (-1990.650) -- 0:04:13
204400 -- (-1994.048) [-1981.036] (-1992.865) (-2005.936) * (-1988.230) (-1993.997) (-1992.367) [-1986.469] -- 0:04:13
204500 -- (-1996.930) [-1981.306] (-1987.169) (-1992.723) * [-1988.007] (-1984.495) (-1998.971) (-1983.960) -- 0:04:12
204600 -- [-1989.298] (-1985.082) (-1994.280) (-1993.263) * (-1991.676) [-1987.426] (-1999.046) (-1986.892) -- 0:04:12
204700 -- (-1998.636) [-1980.699] (-1992.722) (-1983.144) * [-1989.449] (-1988.442) (-2005.851) (-1998.292) -- 0:04:12
204800 -- (-1999.212) (-1979.814) [-1984.430] (-1985.818) * (-1986.182) (-1994.179) (-1992.180) [-1983.593] -- 0:04:12
204900 -- (-2004.925) [-1980.028] (-1989.143) (-1986.677) * [-1987.014] (-1993.996) (-1993.982) (-1988.216) -- 0:04:12
205000 -- (-2003.463) (-1984.553) [-1983.626] (-1990.143) * (-1991.518) (-1992.152) [-1992.426] (-1984.787) -- 0:04:15
Average standard deviation of split frequencies: 0.004398
205100 -- (-2003.911) (-1989.001) [-1983.779] (-1989.609) * [-1991.244] (-1994.499) (-1994.115) (-1986.689) -- 0:04:15
205200 -- (-2003.377) (-1984.244) (-1986.630) [-1984.125] * [-1985.633] (-1999.889) (-1995.784) (-1992.006) -- 0:04:15
205300 -- (-2001.641) (-1980.574) (-1992.386) [-1981.283] * (-1982.526) (-1998.579) (-2000.012) [-1982.743] -- 0:04:15
205400 -- (-2003.680) [-1977.472] (-1992.324) (-1984.480) * [-1981.885] (-1996.885) (-1998.236) (-1980.628) -- 0:04:15
205500 -- (-2015.903) [-1976.879] (-1989.055) (-1986.218) * [-1986.004] (-1993.934) (-2003.129) (-1985.425) -- 0:04:15
205600 -- (-2023.561) (-1984.065) (-1992.319) [-1986.512] * (-1988.837) (-1993.707) (-2012.153) [-1984.370] -- 0:04:15
205700 -- (-2007.134) [-1981.950] (-1990.116) (-1988.636) * (-1994.282) (-1998.325) (-2005.073) [-1984.019] -- 0:04:14
205800 -- (-1997.819) [-1984.904] (-1985.598) (-1993.927) * (-1994.441) (-2001.497) (-1994.486) [-1984.334] -- 0:04:14
205900 -- (-2007.502) (-1986.751) [-1985.646] (-1994.036) * (-1996.384) (-1996.577) (-1996.582) [-1985.092] -- 0:04:14
206000 -- (-2013.326) [-1982.773] (-1985.831) (-1997.700) * (-2002.007) (-1996.112) (-1995.485) [-1983.646] -- 0:04:14
Average standard deviation of split frequencies: 0.004247
206100 -- (-1996.881) (-1986.248) [-1984.550] (-1995.006) * (-1991.802) (-1991.500) (-1990.740) [-1981.305] -- 0:04:14
206200 -- (-2003.259) (-1987.431) (-1980.201) [-1997.044] * (-1989.741) (-1991.559) (-1992.322) [-1981.424] -- 0:04:14
206300 -- (-1991.214) (-1984.211) [-1983.181] (-1994.981) * (-1993.451) (-1991.177) (-1997.999) [-1983.518] -- 0:04:13
206400 -- (-1995.848) (-1981.575) [-1982.343] (-1992.222) * (-1991.044) (-1990.029) (-1991.343) [-1982.075] -- 0:04:13
206500 -- (-1998.789) [-1982.969] (-1983.284) (-1994.738) * (-1985.816) (-1989.887) [-1990.451] (-1984.031) -- 0:04:13
206600 -- (-1999.994) [-1989.261] (-1982.325) (-1988.459) * (-1987.038) (-1987.352) (-1996.248) [-1983.894] -- 0:04:13
206700 -- [-1990.483] (-1983.901) (-1979.381) (-1990.546) * (-1982.637) (-1990.523) (-1995.477) [-1980.256] -- 0:04:13
206800 -- (-1997.697) [-1984.423] (-1985.494) (-1995.289) * (-1986.474) (-1997.627) (-1998.444) [-1981.090] -- 0:04:13
206900 -- (-2003.907) (-1980.542) [-1988.544] (-1993.140) * (-1988.006) (-1994.282) (-2004.288) [-1983.419] -- 0:04:12
207000 -- (-1997.550) [-1978.537] (-1996.843) (-1990.456) * [-1992.538] (-2001.530) (-2006.427) (-1987.713) -- 0:04:12
Average standard deviation of split frequencies: 0.004290
207100 -- (-1994.773) [-1981.745] (-1993.997) (-1997.869) * (-1992.422) (-2001.858) (-2001.423) [-1983.274] -- 0:04:12
207200 -- (-1987.994) [-1981.305] (-1990.354) (-1995.236) * (-1990.380) (-1997.513) (-1993.807) [-1986.628] -- 0:04:12
207300 -- (-1993.210) [-1983.688] (-1990.052) (-1995.612) * [-1984.939] (-1999.400) (-1995.974) (-1995.886) -- 0:04:12
207400 -- [-1987.068] (-1983.467) (-1991.981) (-2001.376) * (-1995.012) (-1996.463) [-1993.801] (-1984.828) -- 0:04:12
207500 -- (-1989.426) [-1980.874] (-1986.534) (-1992.598) * (-2000.084) (-1993.603) (-1996.627) [-1988.637] -- 0:04:12
207600 -- (-1989.980) [-1983.855] (-1985.852) (-1999.128) * (-1997.565) (-2007.698) (-1997.158) [-1983.717] -- 0:04:11
207700 -- [-1991.580] (-1988.363) (-1990.985) (-2001.451) * (-1990.940) (-2009.240) (-1996.262) [-1985.478] -- 0:04:11
207800 -- (-1992.792) (-1997.989) [-1984.039] (-1990.968) * (-1988.130) (-2004.869) (-1992.284) [-1982.690] -- 0:04:11
207900 -- (-1996.788) (-1994.899) [-1983.366] (-1994.022) * (-1993.857) (-2007.627) (-1992.929) [-1981.131] -- 0:04:11
208000 -- (-1992.170) (-2001.091) [-1979.200] (-1993.348) * (-1998.543) (-2005.987) [-1984.435] (-1982.848) -- 0:04:11
Average standard deviation of split frequencies: 0.004142
208100 -- (-2006.043) (-2010.330) [-1984.342] (-1994.533) * (-1990.907) (-2001.459) (-1981.987) [-1981.579] -- 0:04:14
208200 -- (-2001.250) (-2002.723) (-1980.615) [-2000.559] * (-1997.589) (-2000.673) (-1984.272) [-1982.392] -- 0:04:14
208300 -- (-1993.259) (-1995.015) [-1983.533] (-1995.787) * (-1986.529) (-1989.329) (-1987.578) [-1984.566] -- 0:04:14
208400 -- (-1996.364) (-1991.609) (-1985.617) [-1986.733] * (-1989.896) (-1988.311) (-1988.428) [-1984.077] -- 0:04:14
208500 -- (-1990.440) [-1991.127] (-1987.045) (-1989.012) * [-1992.300] (-1985.004) (-1993.169) (-1983.714) -- 0:04:14
208600 -- (-1987.352) (-1995.729) [-1985.814] (-1988.753) * (-1983.692) (-1994.801) (-1986.170) [-1982.215] -- 0:04:14
208700 -- (-1996.178) (-1997.515) [-1987.567] (-1984.109) * (-1987.742) (-1987.381) (-1987.366) [-1982.659] -- 0:04:14
208800 -- (-1997.465) (-2011.984) (-1989.114) [-1984.145] * (-1991.255) (-1992.071) (-1993.072) [-1982.934] -- 0:04:13
208900 -- (-2000.278) [-1998.469] (-1988.212) (-1991.072) * (-1995.807) (-1992.660) (-1989.646) [-1979.198] -- 0:04:13
209000 -- (-2002.915) (-1989.536) [-1987.470] (-1998.074) * (-1992.192) (-1987.780) (-1987.461) [-1981.311] -- 0:04:13
Average standard deviation of split frequencies: 0.004378
209100 -- (-2001.523) (-1982.083) [-1987.223] (-2008.536) * (-1994.104) (-1988.271) (-1987.341) [-1979.682] -- 0:04:13
209200 -- (-1995.343) (-1983.006) [-1983.432] (-2006.507) * (-2007.229) [-1981.335] (-1994.281) (-1983.326) -- 0:04:13
209300 -- (-1999.253) [-1978.387] (-1980.276) (-2002.201) * (-2009.066) (-1988.336) (-1993.052) [-1984.510] -- 0:04:13
209400 -- (-1999.123) (-1985.705) [-1982.078] (-2002.385) * (-2004.138) (-1993.240) [-1989.895] (-1987.442) -- 0:04:12
209500 -- (-1995.447) (-1985.791) [-1985.445] (-1988.559) * (-1997.776) (-1993.546) [-1984.427] (-1985.297) -- 0:04:12
209600 -- (-1992.645) [-1991.183] (-1991.426) (-1994.825) * (-1996.462) (-1996.845) (-1991.790) [-1987.084] -- 0:04:12
209700 -- (-2003.128) (-1989.634) (-1987.227) [-1983.287] * (-1991.567) (-1996.013) [-1988.134] (-1991.139) -- 0:04:12
209800 -- (-1998.613) (-1991.161) (-1987.719) [-1987.502] * (-1988.847) (-2003.958) [-1984.907] (-1996.503) -- 0:04:12
209900 -- (-1989.496) (-1993.216) (-1990.702) [-1983.150] * (-1985.462) (-2002.182) [-1987.884] (-1987.561) -- 0:04:12
210000 -- (-1989.134) (-1989.195) [-1991.310] (-1984.332) * (-1989.492) (-1989.944) [-1986.661] (-1994.806) -- 0:04:12
Average standard deviation of split frequencies: 0.004551
210100 -- (-1990.054) (-1989.396) (-1998.137) [-1980.947] * (-1988.024) [-1989.033] (-1992.124) (-1984.720) -- 0:04:11
210200 -- (-1988.700) (-1985.593) (-1993.119) [-1982.700] * (-1991.280) (-1985.636) [-1998.099] (-1987.962) -- 0:04:11
210300 -- (-1985.699) [-1989.256] (-1987.897) (-1984.712) * (-1994.562) (-1992.806) (-1992.631) [-1983.681] -- 0:04:11
210400 -- (-1999.715) [-1981.920] (-1986.278) (-1983.132) * (-1990.436) (-2005.746) (-1992.008) [-1982.937] -- 0:04:11
210500 -- (-2003.333) (-1987.727) (-1981.272) [-1979.782] * (-1994.716) (-1998.757) (-1995.028) [-1982.942] -- 0:04:11
210600 -- (-1996.914) (-1981.996) [-1978.766] (-1977.379) * (-1991.921) (-1998.784) (-1996.103) [-1990.281] -- 0:04:11
210700 -- (-1996.660) (-1986.676) (-1978.767) [-1981.666] * (-1989.993) (-1991.024) [-1986.941] (-1988.796) -- 0:04:10
210800 -- (-2001.394) (-1982.671) [-1984.257] (-1978.696) * (-1989.226) [-1988.206] (-1992.173) (-1985.657) -- 0:04:10
210900 -- (-1997.415) [-1987.986] (-1986.166) (-1980.173) * [-1988.241] (-1995.007) (-1993.322) (-1993.424) -- 0:04:10
211000 -- (-1991.089) (-1993.531) (-1984.705) [-1985.419] * [-1985.622] (-1990.094) (-1993.643) (-1984.989) -- 0:04:10
Average standard deviation of split frequencies: 0.004273
211100 -- (-1990.373) (-1992.703) (-1995.712) [-1983.198] * (-1987.377) (-1996.363) (-1994.387) [-1984.109] -- 0:04:10
211200 -- [-1986.736] (-1993.586) (-1989.215) (-1987.412) * (-1993.808) (-1994.332) (-1985.146) [-1981.056] -- 0:04:13
211300 -- (-1984.940) (-1999.362) (-1985.923) [-1988.652] * [-1991.830] (-1995.511) (-1986.894) (-1991.378) -- 0:04:13
211400 -- (-1990.097) (-1993.729) (-1988.125) [-1987.638] * (-1992.699) (-2007.469) (-1991.993) [-1993.963] -- 0:04:13
211500 -- (-1987.572) (-1987.821) [-1980.469] (-1984.711) * (-1989.596) (-2002.120) [-1984.819] (-1994.718) -- 0:04:13
211600 -- (-1984.671) (-1990.330) (-1985.079) [-1986.851] * (-1996.115) (-1997.448) [-1986.925] (-1999.564) -- 0:04:13
211700 -- [-1985.451] (-1992.717) (-1992.350) (-1988.287) * (-1990.145) (-1994.955) [-1984.843] (-2005.665) -- 0:04:13
211800 -- (-1989.155) (-2002.183) (-1991.060) [-1988.544] * (-1991.829) (-2000.466) [-1983.933] (-1987.564) -- 0:04:13
211900 -- (-1990.509) (-1988.465) [-1990.789] (-1983.812) * (-1990.735) (-2000.171) [-1984.592] (-1981.174) -- 0:04:12
212000 -- [-1991.230] (-1985.415) (-1991.552) (-1987.713) * (-1993.820) (-2003.852) (-1990.522) [-1984.109] -- 0:04:12
Average standard deviation of split frequencies: 0.004571
212100 -- (-1994.804) (-1988.178) [-1982.151] (-1989.492) * (-1992.698) (-1996.462) (-1992.159) [-1985.027] -- 0:04:12
212200 -- (-1989.882) (-1997.424) [-1981.591] (-1987.598) * (-1993.579) (-1992.354) (-1987.417) [-1984.942] -- 0:04:12
212300 -- (-1989.022) (-1998.174) [-1982.912] (-1991.148) * (-1988.378) (-1997.389) (-1991.226) [-1989.932] -- 0:04:12
212400 -- (-1991.841) (-1999.785) [-1976.162] (-1986.084) * [-1983.454] (-2006.097) (-1992.927) (-1987.465) -- 0:04:12
212500 -- (-1988.056) (-1983.888) [-1978.750] (-1988.478) * (-1983.655) (-2001.245) [-1994.925] (-1984.885) -- 0:04:12
212600 -- (-1990.459) (-1981.253) [-1979.172] (-1989.997) * [-1985.651] (-1995.130) (-2002.036) (-1988.522) -- 0:04:11
212700 -- (-1997.704) (-1984.001) [-1982.714] (-1988.718) * (-1987.472) (-1993.350) (-2005.681) [-1989.121] -- 0:04:11
212800 -- (-2004.444) (-1986.239) [-1979.200] (-1984.229) * [-1986.629] (-1993.734) (-2005.310) (-1986.417) -- 0:04:11
212900 -- (-1997.594) (-1989.138) [-1979.531] (-1991.136) * (-1992.384) (-1997.615) (-2011.317) [-1985.294] -- 0:04:11
213000 -- (-1988.533) (-1983.722) [-1981.505] (-1994.273) * [-1994.114] (-2011.920) (-2007.985) (-1985.194) -- 0:04:11
Average standard deviation of split frequencies: 0.004675
213100 -- (-1991.084) [-1983.382] (-1983.110) (-1994.179) * (-1994.038) (-2011.433) (-2007.599) [-1987.210] -- 0:04:11
213200 -- (-1992.299) [-1982.421] (-1991.533) (-2008.399) * (-1995.754) (-2003.367) (-1997.253) [-1984.641] -- 0:04:10
213300 -- (-1996.848) [-1979.723] (-1989.136) (-2005.875) * (-1998.304) (-1999.515) (-2003.264) [-1980.637] -- 0:04:10
213400 -- (-1991.605) [-1982.098] (-1995.737) (-2002.491) * (-1995.584) (-1999.167) (-1998.150) [-1982.128] -- 0:04:10
213500 -- [-1985.278] (-1985.168) (-1988.600) (-2007.743) * (-1997.391) (-2002.927) (-1994.772) [-1986.466] -- 0:04:10
213600 -- (-1992.760) (-1983.964) [-1987.837] (-1996.768) * (-1997.574) (-1997.115) (-1998.994) [-1983.344] -- 0:04:10
213700 -- (-1990.486) (-1999.171) [-1987.666] (-1992.975) * (-1995.881) (-1997.678) (-1995.744) [-1981.115] -- 0:04:10
213800 -- [-1992.782] (-1985.293) (-1986.567) (-1993.490) * (-1991.501) (-2001.977) (-1993.590) [-1984.481] -- 0:04:10
213900 -- (-1997.573) (-1983.767) [-1985.606] (-1988.260) * [-1989.206] (-2006.922) (-1989.436) (-1989.442) -- 0:04:09
214000 -- (-1996.176) [-1983.585] (-1985.450) (-1996.346) * (-1996.107) (-2000.612) (-1988.410) [-1983.946] -- 0:04:09
Average standard deviation of split frequencies: 0.004466
214100 -- (-1995.457) (-1995.500) [-1985.838] (-1994.483) * (-1997.276) (-2004.831) (-1993.938) [-1982.851] -- 0:04:09
214200 -- (-1991.247) (-1994.112) [-1983.789] (-1992.426) * [-1994.307] (-2001.499) (-1993.399) (-1997.702) -- 0:04:09
214300 -- (-1988.694) (-1986.521) [-1983.548] (-1992.619) * (-1996.139) (-2000.946) [-1997.195] (-1993.552) -- 0:04:09
214400 -- (-1985.939) (-1983.451) [-1982.245] (-1999.955) * (-1986.782) (-1996.186) (-1994.918) [-1997.527] -- 0:04:12
214500 -- (-1992.660) [-1982.438] (-1985.992) (-1993.126) * [-1988.002] (-1999.909) (-1991.986) (-1991.440) -- 0:04:12
214600 -- (-1991.306) [-1986.509] (-1994.496) (-1998.954) * (-2001.113) (-2007.834) (-2002.368) [-1990.869] -- 0:04:12
214700 -- (-1996.822) [-1981.824] (-1991.556) (-2002.886) * (-2003.604) (-2003.490) (-2003.629) [-1991.380] -- 0:04:12
214800 -- (-1994.789) [-1983.501] (-1993.736) (-1995.801) * (-1994.258) (-1995.353) (-1997.075) [-1992.635] -- 0:04:12
214900 -- (-1996.257) [-1985.368] (-1997.456) (-1992.354) * [-1994.360] (-1996.073) (-1997.441) (-1987.958) -- 0:04:12
215000 -- (-1995.358) (-1989.591) (-1986.952) [-1987.794] * (-1998.435) (-1991.322) (-1991.046) [-1986.475] -- 0:04:11
Average standard deviation of split frequencies: 0.003943
215100 -- (-1994.595) (-1989.891) (-1985.038) [-1986.756] * (-1994.113) (-1991.800) [-1984.479] (-1987.595) -- 0:04:11
215200 -- (-1998.051) [-1988.653] (-1992.779) (-1989.320) * (-1987.861) [-1989.279] (-1996.595) (-1989.877) -- 0:04:11
215300 -- (-1998.328) [-1983.636] (-1986.409) (-1991.558) * [-1991.735] (-1992.057) (-1995.335) (-1998.729) -- 0:04:11
215400 -- (-1998.803) (-1983.880) [-1984.836] (-1991.835) * (-1991.089) (-1994.102) [-1986.650] (-1993.942) -- 0:04:11
215500 -- (-1993.391) [-1981.572] (-1988.853) (-1993.450) * [-1987.282] (-2001.253) (-1986.836) (-1992.470) -- 0:04:11
215600 -- [-1991.431] (-1986.047) (-1998.525) (-1999.321) * [-1986.997] (-2005.033) (-1985.171) (-1993.588) -- 0:04:11
215700 -- (-1990.974) [-1987.118] (-2004.789) (-1989.560) * [-1983.914] (-2001.013) (-1988.675) (-2001.420) -- 0:04:10
215800 -- [-1985.796] (-1992.726) (-2000.673) (-1991.709) * [-1990.337] (-2002.040) (-1987.513) (-2000.386) -- 0:04:10
215900 -- [-1987.075] (-1990.742) (-1995.208) (-1997.889) * (-1989.640) (-2002.687) [-1983.788] (-2011.001) -- 0:04:10
216000 -- (-1988.438) [-1985.774] (-1983.903) (-1994.747) * [-1987.597] (-2009.252) (-1983.074) (-1995.565) -- 0:04:10
Average standard deviation of split frequencies: 0.003614
216100 -- (-1996.222) (-1992.241) [-1985.712] (-1997.906) * [-1985.954] (-1999.102) (-1987.316) (-1992.637) -- 0:04:10
216200 -- (-1989.470) (-1995.684) [-1988.353] (-2003.714) * [-1985.359] (-1997.658) (-1990.283) (-1998.269) -- 0:04:10
216300 -- (-1992.869) (-1986.054) [-1979.751] (-2007.098) * [-1983.248] (-1991.712) (-1994.338) (-2001.965) -- 0:04:10
216400 -- [-1992.273] (-1990.334) (-1986.390) (-2000.823) * (-1984.357) [-1989.786] (-1994.122) (-1999.029) -- 0:04:09
216500 -- [-1986.819] (-1990.894) (-1990.279) (-1998.010) * (-1983.974) (-1994.626) [-1994.803] (-1999.138) -- 0:04:09
216600 -- (-2005.268) (-1999.075) [-1986.702] (-1992.712) * [-1989.362] (-1999.666) (-1995.485) (-2001.843) -- 0:04:09
216700 -- [-1987.511] (-1998.279) (-1996.568) (-1992.364) * (-1997.696) (-1997.084) [-1992.774] (-1997.718) -- 0:04:09
216800 -- [-1980.401] (-1991.128) (-1985.029) (-1991.950) * (-1989.934) (-1988.050) (-1998.055) [-1987.964] -- 0:04:09
216900 -- [-1980.409] (-1985.219) (-1989.223) (-1988.771) * (-1991.926) (-1988.307) (-2004.745) [-1986.079] -- 0:04:09
217000 -- (-1982.345) [-1988.910] (-1984.968) (-1994.361) * (-1989.795) (-1985.891) (-2004.786) [-1992.831] -- 0:04:08
Average standard deviation of split frequencies: 0.003783
217100 -- [-1984.673] (-1988.320) (-1990.148) (-1984.117) * [-1994.184] (-1988.368) (-2007.070) (-1987.847) -- 0:04:08
217200 -- (-1994.434) [-1990.015] (-1990.022) (-1988.651) * (-1991.994) [-1987.731] (-2003.124) (-1994.119) -- 0:04:08
217300 -- (-1992.911) (-1995.611) (-1989.629) [-1983.749] * [-1989.034] (-1985.084) (-1997.069) (-1986.819) -- 0:04:08
217400 -- (-2001.746) (-2003.212) [-1986.978] (-1984.864) * [-1988.679] (-1989.452) (-1984.012) (-1988.639) -- 0:04:08
217500 -- (-1998.706) (-1991.631) [-1982.812] (-1984.730) * (-1992.915) (-1988.421) (-1986.291) [-1988.447] -- 0:04:11
217600 -- (-1995.389) (-1985.485) (-1983.832) [-1986.879] * (-1992.142) (-1989.775) (-1989.620) [-1989.534] -- 0:04:11
217700 -- (-1995.136) (-1980.805) [-1986.361] (-1992.210) * (-1991.216) (-1990.136) [-1992.083] (-1987.677) -- 0:04:11
217800 -- (-1990.152) [-1978.248] (-1983.717) (-1993.776) * (-1995.531) (-1992.039) (-1994.031) [-1986.214] -- 0:04:11
217900 -- [-1983.129] (-2002.981) (-1984.672) (-1995.750) * (-1998.825) (-1993.037) [-1991.276] (-1994.355) -- 0:04:11
218000 -- (-1990.872) (-1988.841) (-1982.587) [-1989.593] * (-2002.839) (-2001.939) [-1986.023] (-1997.882) -- 0:04:11
Average standard deviation of split frequencies: 0.004013
218100 -- (-1987.479) [-1988.405] (-1982.727) (-1992.116) * (-2010.531) (-2008.155) [-1992.333] (-1997.470) -- 0:04:10
218200 -- (-1990.416) (-1995.520) [-1983.146] (-1992.621) * (-2001.984) (-1998.772) [-1993.514] (-1998.281) -- 0:04:10
218300 -- (-1994.828) (-1991.682) [-1981.625] (-1991.393) * (-2006.145) (-2001.868) [-1989.609] (-1994.339) -- 0:04:10
218400 -- (-1991.490) (-1988.481) [-1984.758] (-1991.978) * (-2007.402) (-1997.210) (-1999.271) [-1991.941] -- 0:04:10
218500 -- (-1999.252) (-1986.433) [-1981.428] (-1992.565) * (-2004.452) (-1993.501) [-1988.592] (-1990.340) -- 0:04:10
218600 -- (-1999.237) (-1990.281) [-1979.400] (-1988.399) * (-1994.685) (-1999.507) (-1997.116) [-1992.116] -- 0:04:10
218700 -- (-1993.843) (-1987.126) [-1993.419] (-1988.459) * (-1986.110) (-2001.387) [-1996.681] (-1993.335) -- 0:04:10
218800 -- (-1989.978) (-1984.760) (-1992.409) [-1990.000] * [-1986.281] (-2005.484) (-1994.598) (-1990.666) -- 0:04:09
218900 -- (-1997.623) [-1989.705] (-1986.966) (-1996.624) * [-1985.124] (-2006.056) (-1991.872) (-1991.719) -- 0:04:09
219000 -- (-1996.015) [-1988.254] (-1983.827) (-1999.114) * [-1989.029] (-2001.379) (-1990.423) (-1993.885) -- 0:04:09
Average standard deviation of split frequencies: 0.003810
219100 -- (-1994.994) [-1981.595] (-1982.835) (-1993.091) * [-1993.594] (-1995.027) (-1989.777) (-2013.190) -- 0:04:09
219200 -- (-1984.507) [-1983.389] (-1983.151) (-1995.503) * (-1996.092) [-1995.587] (-1987.880) (-2000.975) -- 0:04:09
219300 -- (-1985.864) (-1987.875) [-1981.530] (-2007.306) * (-1990.493) [-1991.284] (-1988.288) (-2003.373) -- 0:04:09
219400 -- (-1986.360) [-1984.850] (-1980.797) (-1991.002) * (-1993.871) [-1994.792] (-1995.572) (-2004.438) -- 0:04:09
219500 -- (-1991.589) (-1987.005) [-1980.564] (-1991.459) * (-2000.221) (-1999.818) [-1989.912] (-2002.801) -- 0:04:08
219600 -- (-1983.496) (-1986.670) [-1981.943] (-1996.802) * (-2004.942) [-1990.013] (-1987.133) (-2007.965) -- 0:04:08
219700 -- (-1986.858) [-1981.388] (-1989.096) (-1994.746) * (-2000.434) (-1992.910) [-1992.615] (-2007.919) -- 0:04:08
219800 -- (-1988.888) [-1981.890] (-1990.729) (-2000.201) * (-2001.435) (-1997.409) [-1987.182] (-2004.635) -- 0:04:08
219900 -- (-1988.122) (-1983.061) (-1988.518) [-1995.321] * (-2019.978) (-2000.626) [-1988.956] (-1996.329) -- 0:04:08
220000 -- [-1985.532] (-1982.662) (-1990.247) (-1998.826) * (-2010.587) (-1994.669) [-1985.836] (-1998.730) -- 0:04:08
Average standard deviation of split frequencies: 0.003793
220100 -- (-1988.192) [-1983.140] (-1993.748) (-1999.567) * (-2009.985) [-1987.618] (-1984.193) (-2001.470) -- 0:04:08
220200 -- [-1988.962] (-1984.155) (-1993.829) (-2003.561) * (-2000.277) (-1986.484) [-1985.321] (-1994.924) -- 0:04:07
220300 -- (-1993.310) [-1983.211] (-1993.648) (-2000.000) * (-2013.280) (-1993.099) [-1987.609] (-1987.884) -- 0:04:07
220400 -- (-1992.860) [-1988.517] (-1995.679) (-1997.278) * (-2005.691) (-1987.899) [-1994.857] (-1995.700) -- 0:04:07
220500 -- (-1988.257) [-1980.652] (-1997.220) (-1994.817) * (-2008.662) [-1989.294] (-1991.929) (-1995.937) -- 0:04:07
220600 -- (-1983.555) [-1983.596] (-1996.937) (-1999.017) * (-2008.215) [-1987.508] (-1993.741) (-1987.558) -- 0:04:10
220700 -- [-1982.559] (-1985.374) (-1982.364) (-1997.469) * (-2016.971) (-1989.263) (-1991.960) [-1985.759] -- 0:04:10
220800 -- [-1981.383] (-1988.055) (-1982.459) (-2002.099) * (-2006.581) (-1991.156) [-1992.173] (-1985.683) -- 0:04:10
220900 -- (-1981.846) (-1991.027) [-1983.225] (-2011.612) * (-2012.533) [-1990.739] (-1989.660) (-1993.636) -- 0:04:10
221000 -- [-1988.088] (-1990.059) (-1981.286) (-1999.608) * (-2005.301) [-1985.999] (-1984.966) (-1996.055) -- 0:04:10
Average standard deviation of split frequencies: 0.003897
221100 -- [-1986.475] (-1998.174) (-1980.841) (-2003.252) * (-2000.502) (-1982.477) (-1985.820) [-1987.715] -- 0:04:10
221200 -- (-1988.298) (-1997.054) [-1984.098] (-1990.120) * (-2012.435) (-1987.129) (-1997.717) [-1986.147] -- 0:04:09
221300 -- (-1992.381) (-1992.126) [-1986.418] (-1994.723) * (-1993.963) (-1989.187) [-1993.978] (-1990.879) -- 0:04:09
221400 -- (-1996.522) [-1990.506] (-1996.250) (-2002.883) * (-1995.648) (-1989.482) [-1986.514] (-1986.260) -- 0:04:09
221500 -- [-1985.169] (-1987.922) (-1985.179) (-1996.530) * (-1991.920) (-1998.661) [-1988.476] (-1987.559) -- 0:04:09
221600 -- [-1985.430] (-1991.066) (-1986.982) (-1997.029) * (-1996.727) (-2000.665) (-1986.401) [-1991.795] -- 0:04:09
221700 -- (-1991.787) [-1992.214] (-1991.527) (-2001.094) * (-2011.060) (-2002.097) (-1987.903) [-1990.200] -- 0:04:09
221800 -- (-1993.853) (-1992.156) [-1993.801] (-1999.792) * (-2013.928) (-1994.459) [-1992.868] (-1997.169) -- 0:04:09
221900 -- (-1990.146) [-1987.724] (-1991.645) (-1998.860) * (-2005.589) [-1989.557] (-1990.467) (-1994.709) -- 0:04:08
222000 -- [-1986.777] (-1999.813) (-1989.421) (-1996.935) * (-2005.741) [-1991.435] (-1995.751) (-2000.531) -- 0:04:08
Average standard deviation of split frequencies: 0.003881
222100 -- [-1988.075] (-1996.488) (-1989.058) (-1999.663) * (-2003.659) [-1994.619] (-1999.094) (-2000.217) -- 0:04:08
222200 -- (-1990.603) (-2004.157) [-1983.865] (-1996.420) * (-2009.795) (-1992.341) (-1990.470) [-1994.704] -- 0:04:08
222300 -- (-1984.079) (-2000.175) [-1983.338] (-1992.131) * (-2000.327) [-1990.954] (-1990.428) (-1998.582) -- 0:04:08
222400 -- [-1989.794] (-1996.595) (-1981.836) (-1991.103) * (-1997.273) [-1988.736] (-1984.734) (-1999.088) -- 0:04:08
222500 -- [-1986.889] (-1993.575) (-1987.957) (-1990.026) * (-1989.660) (-1992.665) [-1991.297] (-1994.790) -- 0:04:08
222600 -- (-1985.821) (-1991.753) (-1993.926) [-1991.063] * [-1991.404] (-1992.949) (-1988.103) (-1985.491) -- 0:04:07
222700 -- (-1984.394) (-1992.590) (-1985.199) [-1985.487] * (-1990.637) (-1992.088) (-1993.407) [-1984.725] -- 0:04:07
222800 -- [-1988.833] (-2002.808) (-1986.617) (-1986.689) * (-1997.089) [-1984.959] (-1990.589) (-1996.313) -- 0:04:07
222900 -- (-1986.616) (-1993.668) (-1984.019) [-1985.033] * (-1992.047) (-1986.226) [-1988.060] (-2002.908) -- 0:04:07
223000 -- (-1992.808) (-1989.001) [-1981.083] (-1987.560) * (-1988.740) (-1999.744) [-1988.787] (-1989.562) -- 0:04:07
Average standard deviation of split frequencies: 0.003983
223100 -- (-1988.356) (-1985.824) [-1984.808] (-1997.833) * (-1995.750) (-2001.753) [-1982.061] (-1986.392) -- 0:04:07
223200 -- [-1994.276] (-1989.129) (-1992.160) (-2001.155) * (-1990.617) (-1994.777) [-1983.350] (-1994.486) -- 0:04:07
223300 -- (-1994.169) [-1985.957] (-1989.443) (-2008.852) * (-1996.549) (-1995.857) (-1983.673) [-1984.708] -- 0:04:06
223400 -- (-1993.739) (-1984.524) [-1988.659] (-1991.935) * (-1995.764) (-2003.259) (-1984.441) [-1988.430] -- 0:04:06
223500 -- [-1994.453] (-1986.194) (-1990.084) (-2000.527) * (-1994.969) (-2000.515) [-1984.809] (-1987.905) -- 0:04:06
223600 -- (-2001.179) [-1983.057] (-1995.778) (-2000.971) * (-1995.988) (-1988.954) [-1982.597] (-1987.399) -- 0:04:06
223700 -- (-2002.809) [-1980.618] (-1998.749) (-1990.400) * (-2005.340) (-1988.390) [-1987.519] (-1988.725) -- 0:04:09
223800 -- (-1999.141) (-1982.748) (-2000.255) [-1996.258] * (-1997.771) (-1990.156) (-1992.268) [-1991.133] -- 0:04:09
223900 -- (-1999.371) [-1979.016] (-2001.163) (-2001.644) * (-2000.743) (-1993.951) [-1985.837] (-1997.272) -- 0:04:09
224000 -- (-2004.757) [-1981.021] (-1995.970) (-1993.073) * (-2002.361) (-1992.950) [-1984.276] (-2010.794) -- 0:04:09
Average standard deviation of split frequencies: 0.003966
224100 -- (-1996.490) [-1981.212] (-1991.439) (-1991.233) * (-1997.534) (-1987.854) [-1983.932] (-2014.113) -- 0:04:09
224200 -- (-1996.208) (-1986.360) (-1990.956) [-1993.407] * (-2002.186) [-1990.326] (-1986.337) (-2006.014) -- 0:04:09
224300 -- (-2003.324) [-1985.140] (-1988.862) (-1987.802) * (-2001.755) [-1987.318] (-1985.709) (-1996.774) -- 0:04:08
224400 -- (-2003.796) [-1985.939] (-1988.459) (-1987.545) * (-2000.101) (-1985.309) [-1982.534] (-1997.313) -- 0:04:08
224500 -- (-2002.118) (-1990.126) [-1984.253] (-1993.133) * (-2004.711) [-1985.085] (-1989.592) (-1997.353) -- 0:04:08
224600 -- (-2000.908) (-1986.768) [-1984.121] (-1998.564) * (-2011.215) (-1986.362) [-1996.681] (-1995.359) -- 0:04:08
224700 -- (-2001.901) (-1986.825) [-1982.392] (-1995.743) * (-2009.717) (-1996.832) (-1995.954) [-1994.976] -- 0:04:08
224800 -- (-1997.422) [-1986.831] (-1988.602) (-2001.728) * (-2005.750) (-2003.566) (-1994.745) [-1989.811] -- 0:04:08
224900 -- (-1998.005) (-1987.180) (-1992.576) [-1989.301] * (-2005.803) (-1997.459) [-1988.099] (-1989.167) -- 0:04:08
225000 -- (-1997.307) [-1983.708] (-1999.768) (-1992.215) * (-2005.298) (-2005.500) [-1984.358] (-1986.000) -- 0:04:08
Average standard deviation of split frequencies: 0.004187
225100 -- (-1996.893) (-1987.033) [-1993.755] (-1999.421) * (-2004.024) (-1999.918) [-1990.687] (-1989.526) -- 0:04:07
225200 -- (-1992.739) [-1992.252] (-2000.249) (-2002.949) * (-1998.835) (-1990.611) (-1994.201) [-1991.308] -- 0:04:07
225300 -- (-1993.270) [-1990.580] (-2010.370) (-2004.906) * (-1995.338) [-1986.526] (-1990.821) (-1993.396) -- 0:04:07
225400 -- (-1998.595) [-1988.044] (-2006.347) (-2007.226) * (-1991.438) [-1988.068] (-1990.705) (-1993.631) -- 0:04:07
225500 -- [-1987.808] (-1996.032) (-2009.537) (-2010.272) * (-1997.199) (-1993.086) [-1989.440] (-1994.815) -- 0:04:07
225600 -- [-1990.171] (-1998.666) (-1997.474) (-1998.530) * [-1999.432] (-2000.584) (-1990.376) (-1999.410) -- 0:04:07
225700 -- (-1994.121) (-2001.875) [-1997.991] (-1991.689) * (-1993.485) (-1995.758) [-1991.069] (-2002.348) -- 0:04:07
225800 -- [-1990.458] (-2003.148) (-1999.356) (-1992.554) * (-1997.980) (-1991.501) [-1988.934] (-1998.729) -- 0:04:06
225900 -- [-1993.714] (-1996.591) (-1992.647) (-1996.199) * (-1992.188) (-1995.903) [-1988.138] (-1991.503) -- 0:04:06
226000 -- (-1993.889) (-1989.009) (-1985.285) [-1989.556] * (-1990.595) (-1991.469) [-1989.974] (-1993.865) -- 0:04:06
Average standard deviation of split frequencies: 0.004527
226100 -- [-1987.393] (-1989.629) (-1988.403) (-1993.800) * [-1994.222] (-1996.455) (-1989.966) (-2006.459) -- 0:04:06
226200 -- [-1984.931] (-1986.753) (-1994.286) (-1988.180) * [-1991.454] (-1995.698) (-1987.123) (-1996.016) -- 0:04:06
226300 -- (-1983.199) (-1986.291) (-1995.350) [-1989.366] * [-1990.608] (-1994.931) (-1990.022) (-2001.624) -- 0:04:06
226400 -- (-1990.268) (-1988.044) (-2007.144) [-1992.862] * (-1991.003) [-1991.398] (-1995.496) (-1995.408) -- 0:04:06
226500 -- (-1988.653) [-1983.705] (-2009.854) (-1996.693) * (-1986.064) (-1991.102) (-1990.824) [-1990.517] -- 0:04:05
226600 -- (-1994.345) [-1982.029] (-1994.168) (-2002.184) * (-1990.605) (-1993.701) [-1987.866] (-1994.540) -- 0:04:05
226700 -- (-1986.840) [-1980.456] (-1998.888) (-2003.590) * (-1994.607) [-1995.386] (-1991.364) (-1995.003) -- 0:04:05
226800 -- (-1992.546) [-1976.701] (-1995.730) (-2007.708) * (-1994.719) (-1990.138) (-1990.101) [-1994.885] -- 0:04:05
226900 -- [-1990.420] (-1988.370) (-1987.132) (-2005.021) * (-1996.747) [-1990.620] (-1995.359) (-1999.863) -- 0:04:08
227000 -- (-1986.331) (-1988.613) [-1979.226] (-2010.664) * (-1990.335) [-1996.647] (-1999.084) (-2002.851) -- 0:04:08
Average standard deviation of split frequencies: 0.004387
227100 -- [-1989.617] (-1982.951) (-1990.692) (-1994.640) * (-1994.846) [-1990.485] (-1994.569) (-2006.359) -- 0:04:08
227200 -- (-1991.069) [-1985.989] (-1987.499) (-1996.691) * [-1988.302] (-1991.334) (-1992.536) (-2006.854) -- 0:04:08
227300 -- (-1999.371) (-1982.628) [-1988.375] (-1990.276) * [-1987.419] (-1992.660) (-1997.921) (-2001.533) -- 0:04:08
227400 -- (-1997.331) [-1980.063] (-1989.226) (-1990.217) * (-1986.279) (-1992.885) [-1989.229] (-2002.470) -- 0:04:08
227500 -- (-2001.278) [-1977.917] (-1993.167) (-1992.382) * [-1986.518] (-1990.213) (-1994.759) (-2003.028) -- 0:04:07
227600 -- (-1996.956) [-1977.802] (-1989.431) (-1995.943) * [-1989.092] (-2010.264) (-1996.440) (-1996.765) -- 0:04:07
227700 -- (-2002.071) [-1976.474] (-1991.044) (-1993.609) * [-1990.788] (-2010.599) (-1997.917) (-2001.617) -- 0:04:07
227800 -- (-2006.060) (-1976.841) (-1984.831) [-1991.862] * (-1991.418) (-2011.068) [-1995.171] (-1997.501) -- 0:04:07
227900 -- (-1994.317) (-1979.236) [-1988.617] (-1989.434) * (-1997.765) [-2000.495] (-1994.427) (-1997.108) -- 0:04:07
228000 -- (-1996.222) [-1979.335] (-1988.830) (-1988.920) * (-1995.581) (-1996.364) [-1990.227] (-1993.302) -- 0:04:07
Average standard deviation of split frequencies: 0.004546
228100 -- (-2000.403) [-1984.834] (-1984.149) (-1996.698) * (-1995.403) (-2000.780) (-1991.696) [-1995.132] -- 0:04:07
228200 -- (-2004.406) [-1983.904] (-1990.502) (-1993.467) * [-1989.397] (-1994.878) (-1992.661) (-2003.577) -- 0:04:06
228300 -- (-1992.102) (-1990.337) [-1990.707] (-1988.438) * [-1986.287] (-1993.092) (-1990.354) (-1996.309) -- 0:04:06
228400 -- (-1994.400) (-1986.011) [-1986.038] (-1987.866) * [-1989.283] (-1988.004) (-1992.948) (-1989.071) -- 0:04:06
228500 -- (-1999.729) (-1992.337) [-1982.618] (-1992.177) * (-1990.504) [-1987.748] (-1996.054) (-1991.011) -- 0:04:06
228600 -- (-1994.072) (-1986.781) [-1983.923] (-1988.946) * (-1995.946) [-1992.148] (-1997.976) (-1994.919) -- 0:04:06
228700 -- (-1994.734) (-1992.437) [-1982.703] (-1990.721) * (-1998.394) [-1992.584] (-1999.474) (-1993.001) -- 0:04:06
228800 -- (-1986.785) (-1986.527) [-1982.418] (-2000.736) * (-1993.274) (-1990.767) (-1994.957) [-1988.604] -- 0:04:06
228900 -- [-1993.616] (-1988.418) (-1993.820) (-1996.005) * (-1993.893) [-1991.976] (-1997.726) (-1987.901) -- 0:04:05
229000 -- (-1995.205) (-1987.501) [-1985.775] (-1987.458) * (-1991.420) (-1997.111) [-1992.027] (-1992.405) -- 0:04:05
Average standard deviation of split frequencies: 0.004877
229100 -- (-1990.530) (-1998.112) [-1985.767] (-1988.937) * (-1992.434) (-1998.259) (-1989.537) [-1991.505] -- 0:04:05
229200 -- (-1990.658) [-1987.190] (-1983.598) (-1987.019) * [-1983.202] (-1993.586) (-1996.254) (-1985.721) -- 0:04:05
229300 -- (-1990.621) (-1986.971) (-1992.760) [-1994.996] * (-1985.608) (-1993.346) (-1990.782) [-1986.321] -- 0:04:05
229400 -- (-1989.068) [-1984.081] (-1987.532) (-1995.748) * (-1995.654) (-2005.521) [-1995.375] (-1989.273) -- 0:04:05
229500 -- (-1990.530) [-1981.336] (-1982.815) (-1989.870) * [-1988.971] (-1994.563) (-1997.089) (-2002.542) -- 0:04:05
229600 -- (-1990.846) [-1978.514] (-1983.465) (-1995.300) * [-1983.117] (-1992.387) (-1995.347) (-2004.348) -- 0:04:04
229700 -- (-1992.617) [-1979.884] (-1986.067) (-2007.252) * (-1983.522) [-1990.485] (-1998.444) (-1995.025) -- 0:04:04
229800 -- [-1991.196] (-1983.731) (-1987.648) (-2016.105) * [-1979.646] (-1992.020) (-1998.282) (-1996.460) -- 0:04:04
229900 -- (-1991.146) [-1984.470] (-1990.537) (-1996.063) * [-1983.266] (-1992.297) (-1996.490) (-1992.521) -- 0:04:04
230000 -- (-1991.787) (-1982.230) [-1988.524] (-2002.101) * (-1986.692) [-1992.264] (-2004.085) (-1993.435) -- 0:04:07
Average standard deviation of split frequencies: 0.004858
230100 -- (-1998.882) [-1981.565] (-1994.430) (-2000.819) * (-1992.640) (-1986.584) [-1994.356] (-1989.560) -- 0:04:07
230200 -- (-1994.194) [-1989.397] (-2012.641) (-2003.145) * (-1990.329) [-1986.582] (-1993.196) (-1988.364) -- 0:04:07
230300 -- (-1988.899) [-1988.546] (-2012.932) (-1996.901) * (-1989.225) [-1986.691] (-2000.084) (-1982.477) -- 0:04:07
230400 -- [-1984.683] (-1985.269) (-2001.249) (-1993.214) * (-1995.275) [-1986.616] (-2005.817) (-1983.820) -- 0:04:07
230500 -- (-1990.382) [-1982.770] (-1992.146) (-1994.400) * (-1999.699) (-1986.247) (-2004.022) [-1986.489] -- 0:04:07
230600 -- [-1987.706] (-1983.590) (-1985.900) (-1990.002) * (-1996.783) (-1990.260) (-1999.255) [-1985.071] -- 0:04:06
230700 -- (-1988.049) (-1983.909) [-1984.379] (-1996.978) * (-1992.097) (-1987.545) (-2004.585) [-1990.545] -- 0:04:06
230800 -- (-1995.217) (-1984.632) [-1985.351] (-1991.376) * [-1984.798] (-1985.245) (-1991.127) (-1987.220) -- 0:04:06
230900 -- (-1999.056) (-1982.042) [-1984.621] (-1989.622) * [-1984.875] (-1986.493) (-1999.890) (-1985.442) -- 0:04:06
231000 -- (-1991.884) [-1979.981] (-1981.908) (-1992.680) * [-1982.602] (-1989.715) (-2002.447) (-1989.102) -- 0:04:06
Average standard deviation of split frequencies: 0.005185
231100 -- (-1994.940) [-1979.335] (-1988.482) (-1996.625) * [-1986.521] (-1993.774) (-1997.930) (-1985.101) -- 0:04:06
231200 -- (-1995.097) [-1978.792] (-1990.296) (-2012.718) * (-1985.277) (-2001.822) (-2006.306) [-1984.062] -- 0:04:06
231300 -- (-1989.680) [-1980.389] (-1993.157) (-2002.436) * [-1984.888] (-2006.482) (-1996.049) (-1988.940) -- 0:04:05
231400 -- (-1988.295) [-1977.499] (-1995.768) (-2003.250) * [-1991.152] (-1995.225) (-1995.522) (-1988.296) -- 0:04:05
231500 -- (-1990.859) [-1977.113] (-1991.639) (-2001.925) * (-1994.143) (-1988.982) [-1990.706] (-1994.544) -- 0:04:05
231600 -- (-1996.576) [-1978.689] (-1995.873) (-1999.621) * [-1987.237] (-1988.767) (-1992.771) (-2000.981) -- 0:04:05
231700 -- [-1991.479] (-1980.794) (-2001.567) (-1999.340) * (-1983.403) [-1988.498] (-1988.183) (-1998.417) -- 0:04:05
231800 -- (-1997.740) [-1980.773] (-2000.639) (-1994.486) * [-1983.720] (-1994.615) (-1992.457) (-1996.070) -- 0:04:05
231900 -- (-1992.378) [-1985.601] (-2003.613) (-1995.509) * [-1990.284] (-1998.161) (-1995.573) (-1995.647) -- 0:04:05
232000 -- (-2001.740) [-1984.078] (-2006.145) (-2001.067) * [-1988.841] (-2000.276) (-1990.836) (-1994.835) -- 0:04:04
Average standard deviation of split frequencies: 0.005338
232100 -- (-1991.097) [-1983.078] (-1992.798) (-2001.979) * (-1986.807) (-2002.576) [-1990.197] (-1997.582) -- 0:04:04
232200 -- (-2004.562) [-1979.578] (-1994.762) (-1986.706) * (-1987.344) (-1994.911) [-1997.222] (-1994.586) -- 0:04:04
232300 -- (-1996.508) (-1978.614) (-1987.892) [-1981.286] * [-1987.476] (-1997.489) (-1989.085) (-1989.642) -- 0:04:04
232400 -- (-1998.259) [-1983.529] (-1992.593) (-1981.829) * (-1989.445) (-1994.130) [-1986.870] (-1989.709) -- 0:04:04
232500 -- (-1989.171) (-1985.778) (-1995.119) [-1983.710] * (-1986.994) (-1993.291) [-1989.269] (-1988.768) -- 0:04:04
232600 -- [-1987.426] (-1985.473) (-1996.966) (-1983.351) * (-1988.849) (-1997.138) (-1986.492) [-1986.737] -- 0:04:04
232700 -- (-1985.048) [-1981.532] (-1989.912) (-1987.564) * [-1986.500] (-1989.864) (-1993.167) (-1987.551) -- 0:04:04
232800 -- (-1989.920) [-1982.541] (-1996.015) (-1984.176) * (-1985.782) (-2002.242) (-1988.358) [-1983.420] -- 0:04:03
232900 -- (-1992.317) [-1980.933] (-2001.114) (-1985.010) * (-1992.979) (-1993.751) (-1983.471) [-1984.288] -- 0:04:03
233000 -- [-1990.965] (-1986.456) (-1993.730) (-1986.290) * (-1982.634) (-2002.591) [-1984.071] (-1995.794) -- 0:04:03
Average standard deviation of split frequencies: 0.005545
233100 -- [-1979.395] (-1982.973) (-1995.599) (-1993.727) * [-1981.461] (-1999.981) (-1988.752) (-1993.132) -- 0:04:06
233200 -- [-1982.626] (-1988.354) (-2000.070) (-1996.877) * [-1990.287] (-1996.765) (-1988.523) (-1989.372) -- 0:04:06
233300 -- (-1979.617) [-1983.792] (-2010.491) (-1997.592) * [-1991.662] (-1997.868) (-1994.287) (-1994.651) -- 0:04:06
233400 -- (-1980.999) [-1981.301] (-1998.897) (-2008.891) * [-1988.480] (-1996.179) (-1996.238) (-1996.275) -- 0:04:06
233500 -- (-1986.268) [-1985.509] (-1997.665) (-2010.180) * [-1985.675] (-1996.658) (-1995.167) (-1996.607) -- 0:04:06
233600 -- [-1979.751] (-1983.106) (-1992.058) (-2002.555) * [-1989.617] (-1999.277) (-1996.417) (-1996.085) -- 0:04:06
233700 -- [-1985.006] (-1992.098) (-1995.467) (-1991.734) * (-1989.655) (-1998.649) (-1993.686) [-1982.133] -- 0:04:05
233800 -- (-1977.649) (-2000.049) [-1991.375] (-2002.144) * (-1988.000) (-1998.472) [-1985.422] (-1982.280) -- 0:04:05
233900 -- (-1981.733) [-1991.499] (-1989.932) (-2002.003) * (-1987.314) (-1998.807) (-2000.459) [-1988.922] -- 0:04:05
234000 -- [-1982.260] (-1992.944) (-1998.883) (-1993.465) * [-1986.445] (-2002.180) (-2000.022) (-1977.533) -- 0:04:05
Average standard deviation of split frequencies: 0.005407
234100 -- [-1979.900] (-2003.899) (-1991.305) (-1997.642) * (-1990.862) (-2006.042) (-1998.743) [-1981.453] -- 0:04:05
234200 -- [-1980.210] (-1993.971) (-1992.518) (-1993.904) * (-1982.498) (-2002.882) (-1997.177) [-1981.543] -- 0:04:05
234300 -- [-1986.724] (-1990.260) (-1994.867) (-1994.343) * [-1981.677] (-2001.349) (-1993.482) (-1983.609) -- 0:04:05
234400 -- (-1991.828) [-1991.060] (-1994.905) (-1989.448) * [-1982.185] (-2005.177) (-1992.578) (-1989.095) -- 0:04:04
234500 -- [-1984.994] (-1987.593) (-2005.156) (-1989.074) * [-1981.366] (-1998.006) (-1991.416) (-1986.616) -- 0:04:04
234600 -- [-1980.175] (-1983.157) (-2007.409) (-1993.439) * [-1985.957] (-1991.536) (-1989.271) (-1986.311) -- 0:04:04
234700 -- (-1982.770) (-1979.850) (-2006.618) [-1992.723] * [-1986.861] (-1990.527) (-1990.754) (-1993.842) -- 0:04:04
234800 -- (-1989.923) [-1983.038] (-1994.986) (-1991.249) * [-1985.686] (-1989.899) (-1988.778) (-1992.574) -- 0:04:04
234900 -- [-1980.074] (-1982.360) (-1987.809) (-1996.108) * (-1997.072) (-1990.189) [-1988.669] (-1995.598) -- 0:04:04
235000 -- [-1981.195] (-1985.234) (-1999.562) (-2001.111) * (-1999.027) (-1997.431) (-1991.463) [-1988.852] -- 0:04:04
Average standard deviation of split frequencies: 0.005154
235100 -- [-1981.893] (-1983.972) (-2001.106) (-1999.517) * (-1990.530) (-1999.031) [-1993.175] (-1992.147) -- 0:04:04
235200 -- [-1986.166] (-1985.120) (-1993.259) (-2002.688) * (-1991.706) (-1990.667) [-1990.689] (-1997.774) -- 0:04:03
235300 -- [-1988.362] (-1986.991) (-1991.685) (-2005.673) * (-1990.096) [-1990.782] (-1989.484) (-1997.647) -- 0:04:03
235400 -- (-1986.287) [-1980.987] (-1987.537) (-2005.881) * [-1982.172] (-1986.200) (-1985.727) (-1998.072) -- 0:04:03
235500 -- [-1983.952] (-1983.200) (-1988.398) (-2008.002) * (-1983.069) (-1986.103) [-1984.173] (-1998.212) -- 0:04:03
235600 -- (-1984.330) (-1988.537) [-1989.438] (-1996.321) * [-1983.840] (-1991.843) (-1981.141) (-1991.461) -- 0:04:03
235700 -- (-1991.661) [-1991.347] (-1993.521) (-1987.165) * [-1979.029] (-1986.377) (-1986.506) (-2003.493) -- 0:04:03
235800 -- (-1993.883) (-1996.161) (-1990.779) [-1988.492] * (-1980.272) (-1987.089) [-1987.827] (-1997.710) -- 0:04:03
235900 -- [-1985.686] (-2002.110) (-1989.456) (-1988.627) * [-1978.741] (-1984.707) (-1992.034) (-1995.267) -- 0:04:02
236000 -- [-1981.691] (-1998.635) (-1995.759) (-1989.632) * (-1979.870) [-1986.140] (-1992.211) (-1989.448) -- 0:04:02
Average standard deviation of split frequencies: 0.005248
236100 -- (-1981.213) (-2006.732) (-1996.880) [-1986.057] * [-1977.188] (-1985.580) (-1995.522) (-1988.202) -- 0:04:02
236200 -- (-1980.297) (-1999.262) (-1998.896) [-1988.166] * [-1979.645] (-1986.488) (-1995.999) (-1989.822) -- 0:04:05
236300 -- [-1978.622] (-1996.314) (-1996.401) (-1989.557) * [-1980.155] (-1986.964) (-1989.761) (-1998.616) -- 0:04:05
236400 -- [-1978.849] (-2001.840) (-1995.021) (-1993.634) * (-1982.824) [-1986.164] (-1991.774) (-1998.627) -- 0:04:05
236500 -- [-1982.397] (-2002.544) (-1996.464) (-1996.115) * (-1984.216) (-1982.249) (-1991.805) [-1988.603] -- 0:04:05
236600 -- [-1981.640] (-1995.961) (-1994.904) (-2000.932) * (-1983.841) [-1983.082] (-1988.261) (-1993.829) -- 0:04:05
236700 -- [-1979.108] (-1995.172) (-1990.916) (-1999.680) * [-1981.585] (-1988.627) (-1985.127) (-1993.815) -- 0:04:05
236800 -- [-1979.026] (-1989.275) (-1991.888) (-1999.670) * (-1983.983) (-1997.010) (-1991.153) [-1984.753] -- 0:04:04
236900 -- [-1979.764] (-2002.314) (-1995.929) (-2007.095) * [-1976.770] (-1988.784) (-1989.359) (-1985.880) -- 0:04:04
237000 -- [-1979.936] (-1995.088) (-1991.462) (-2000.700) * [-1981.779] (-1990.671) (-1996.315) (-1982.685) -- 0:04:04
Average standard deviation of split frequencies: 0.005110
237100 -- (-1982.966) (-1997.474) [-1992.797] (-1988.614) * (-1986.720) (-1993.577) (-1998.641) [-1982.140] -- 0:04:04
237200 -- [-1980.836] (-1993.318) (-1997.758) (-1983.510) * (-1987.442) (-1991.848) (-1998.471) [-1982.053] -- 0:04:04
237300 -- [-1985.253] (-1994.077) (-1992.520) (-1988.128) * [-1980.731] (-1998.761) (-1996.322) (-1982.093) -- 0:04:04
237400 -- (-1986.452) [-1999.534] (-2001.475) (-1990.457) * [-1979.336] (-1993.044) (-1991.569) (-1986.732) -- 0:04:04
237500 -- (-1987.326) (-2001.317) (-1995.419) [-1991.945] * [-1977.736] (-1992.961) (-1991.757) (-1990.172) -- 0:04:04
237600 -- (-1991.511) (-2001.834) (-1994.924) [-1987.384] * (-1984.579) (-1988.549) (-1988.924) [-1993.434] -- 0:04:03
237700 -- (-1989.234) (-2004.026) [-1987.797] (-1990.102) * [-1992.539] (-1992.918) (-1991.263) (-1991.332) -- 0:04:03
237800 -- (-1989.858) (-1999.690) [-1987.377] (-1991.951) * (-1995.645) (-1995.205) (-1994.092) [-1991.617] -- 0:04:03
237900 -- (-1992.375) (-1994.958) [-1989.379] (-1990.308) * [-1987.975] (-1997.962) (-1995.671) (-1987.385) -- 0:04:03
238000 -- (-1992.702) [-1994.246] (-1996.548) (-1998.878) * (-1993.498) (-1988.164) (-1999.281) [-1986.597] -- 0:04:03
Average standard deviation of split frequencies: 0.005203
238100 -- (-1991.299) (-1993.869) [-1992.871] (-2001.031) * (-1989.874) (-1991.745) (-1994.766) [-1982.664] -- 0:04:03
238200 -- (-1986.629) (-1986.831) (-1986.605) [-1995.624] * [-1986.463] (-1991.247) (-1996.368) (-1985.468) -- 0:04:03
238300 -- [-1987.715] (-1990.476) (-1996.055) (-2003.430) * (-1992.370) [-1995.779] (-1998.179) (-1990.241) -- 0:04:02
238400 -- (-1991.579) (-1993.402) [-1992.339] (-1994.324) * (-1991.279) [-1987.641] (-1999.808) (-1987.691) -- 0:04:02
238500 -- (-1993.850) (-1994.383) (-1995.018) [-1987.155] * (-1990.446) [-1994.343] (-1996.825) (-1981.375) -- 0:04:02
238600 -- (-1994.777) (-2004.662) [-1992.747] (-1993.103) * (-1987.721) (-1992.362) (-1994.040) [-1979.198] -- 0:04:02
238700 -- (-1993.562) (-2010.523) [-1988.388] (-1991.467) * (-1988.137) (-1996.189) (-1997.643) [-1979.328] -- 0:04:02
238800 -- (-1992.136) (-2010.231) (-1991.651) [-1996.488] * (-1985.341) (-1996.427) (-2001.779) [-1981.673] -- 0:04:02
238900 -- [-1986.356] (-2002.921) (-1991.425) (-1997.924) * [-1987.260] (-1990.522) (-2004.357) (-1988.501) -- 0:04:02
239000 -- [-1983.700] (-2005.171) (-1988.396) (-1997.787) * [-1981.068] (-1991.881) (-1999.947) (-1992.580) -- 0:04:01
Average standard deviation of split frequencies: 0.005574
239100 -- [-1981.958] (-2007.912) (-1988.186) (-1998.483) * [-1982.770] (-1989.145) (-2002.522) (-1988.187) -- 0:04:01
239200 -- (-1985.844) [-1986.390] (-1993.670) (-1992.252) * (-1984.141) (-1993.092) (-1996.996) [-1986.275] -- 0:04:01
239300 -- (-1988.331) (-1988.235) [-1989.197] (-1991.828) * (-1991.270) (-1988.911) (-1999.119) [-1983.991] -- 0:04:04
239400 -- (-1990.021) (-1996.480) (-1991.079) [-1990.127] * [-1979.435] (-1991.332) (-2000.742) (-1990.924) -- 0:04:04
239500 -- (-1990.547) (-1992.295) (-1987.519) [-1990.815] * (-1982.600) (-1992.496) (-2003.866) [-1979.974] -- 0:04:04
239600 -- (-2000.305) (-1986.988) (-1988.723) [-1985.518] * [-1986.883] (-1991.786) (-1999.457) (-1986.723) -- 0:04:04
239700 -- (-1989.620) (-1987.726) [-1984.545] (-1987.521) * (-1992.619) (-1988.825) (-1998.089) [-1991.892] -- 0:04:04
239800 -- (-1986.036) (-1993.182) [-1989.966] (-1991.858) * [-1993.208] (-1987.195) (-1992.681) (-1993.356) -- 0:04:04
239900 -- [-1993.574] (-1998.410) (-1994.848) (-1989.299) * (-1997.359) [-1988.380] (-1993.373) (-1994.966) -- 0:04:03
240000 -- [-1987.002] (-1995.012) (-1986.332) (-1993.285) * (-1996.770) (-1985.247) (-2009.885) [-1995.106] -- 0:04:03
Average standard deviation of split frequencies: 0.004824
240100 -- (-1990.985) (-1993.791) [-1985.717] (-1991.814) * (-1991.918) [-1992.454] (-1996.686) (-2001.254) -- 0:04:03
240200 -- (-1999.404) (-1999.878) [-1987.521] (-1985.702) * (-1988.358) (-1995.454) [-1995.436] (-1999.302) -- 0:04:03
240300 -- (-2002.057) (-1996.241) (-1987.082) [-1993.655] * (-1985.694) (-1992.379) (-1995.575) [-1988.610] -- 0:04:03
240400 -- (-1993.993) (-1990.602) [-1986.064] (-1987.295) * [-1982.645] (-2000.180) (-1994.462) (-1985.756) -- 0:04:03
240500 -- (-2001.933) (-1990.553) (-1996.470) [-1991.729] * (-1979.545) (-2000.662) (-1987.628) [-1986.662] -- 0:04:03
240600 -- (-1990.341) (-2000.258) [-1991.868] (-1992.573) * [-1982.619] (-2001.541) (-1992.591) (-1987.346) -- 0:04:03
240700 -- (-1992.521) (-1992.112) [-1991.090] (-1995.042) * [-1984.217] (-2002.201) (-1991.546) (-1985.809) -- 0:04:02
240800 -- (-1999.517) [-1994.523] (-1985.646) (-1995.040) * [-1987.722] (-1990.524) (-1988.015) (-1988.125) -- 0:04:02
240900 -- (-1996.060) (-1991.268) [-1987.305] (-1994.574) * [-1985.277] (-1993.815) (-1993.884) (-1984.268) -- 0:04:02
241000 -- (-2000.851) [-1989.875] (-1993.338) (-2007.629) * (-1990.134) (-1997.446) (-1996.517) [-1984.010] -- 0:04:02
Average standard deviation of split frequencies: 0.004746
241100 -- (-2006.196) (-1992.216) [-1988.097] (-1998.861) * (-1987.834) (-1998.717) (-2006.594) [-1979.102] -- 0:04:02
241200 -- (-2002.633) (-2000.668) [-1986.228] (-1991.973) * [-1983.698] (-2006.885) (-2007.990) (-1979.609) -- 0:04:02
241300 -- [-2002.267] (-1997.420) (-1989.020) (-1994.673) * [-1980.065] (-2002.524) (-1999.453) (-1983.026) -- 0:04:02
241400 -- (-1998.524) [-2000.415] (-1995.431) (-1996.541) * (-1984.950) (-2012.512) (-1994.556) [-1979.374] -- 0:04:01
241500 -- (-1997.284) (-1996.867) [-1993.868] (-1994.897) * (-1984.155) (-2008.046) (-1995.708) [-1984.317] -- 0:04:01
241600 -- (-1988.313) (-1998.149) [-1987.732] (-1990.084) * (-1981.477) (-2006.983) (-1994.318) [-1990.362] -- 0:04:01
241700 -- (-2004.012) (-2000.865) (-1983.094) [-1987.533] * (-1982.697) (-2005.245) (-1988.185) [-1988.551] -- 0:04:01
241800 -- (-1989.151) (-1997.159) [-1978.523] (-1988.696) * [-1982.053] (-2002.752) (-1994.012) (-1982.503) -- 0:04:01
241900 -- (-1986.406) (-1998.734) [-1977.086] (-1985.223) * (-1989.283) (-2002.436) (-1991.517) [-1984.111] -- 0:04:01
242000 -- (-1990.577) (-1997.888) [-1979.749] (-1989.804) * (-1983.382) (-1999.136) (-1989.291) [-1980.624] -- 0:04:01
Average standard deviation of split frequencies: 0.004506
242100 -- (-1985.250) (-2000.500) [-1981.096] (-1989.271) * [-1979.963] (-2006.429) (-1989.004) (-1981.901) -- 0:04:01
242200 -- (-1987.743) (-2002.336) [-1982.013] (-1995.983) * (-1981.211) (-2001.858) (-1988.870) [-1979.825] -- 0:04:00
242300 -- (-1992.038) (-2005.837) [-1978.495] (-2004.397) * (-1986.632) (-2005.652) (-1988.008) [-1983.033] -- 0:04:00
242400 -- (-1991.473) (-1998.538) [-1979.755] (-2007.693) * [-1983.870] (-1997.694) (-1990.472) (-1981.214) -- 0:04:00
242500 -- [-1981.928] (-2002.877) (-1978.498) (-2018.567) * [-1982.106] (-1996.760) (-1994.367) (-1984.634) -- 0:04:03
242600 -- [-1982.980] (-1996.580) (-1981.345) (-2006.626) * (-1982.759) (-2002.919) (-1992.921) [-1988.467] -- 0:04:03
242700 -- (-1984.406) (-2000.167) [-1978.053] (-2007.037) * (-1984.417) (-2002.295) (-1999.943) [-1989.020] -- 0:04:03
242800 -- (-1996.319) (-1995.051) [-1979.582] (-2002.138) * [-1983.244] (-2003.841) (-2002.117) (-1994.554) -- 0:04:03
242900 -- (-1992.236) (-1999.742) [-1980.603] (-1999.304) * [-1985.333] (-1992.942) (-1991.424) (-1984.057) -- 0:04:03
243000 -- [-1983.786] (-1995.319) (-1983.547) (-1992.839) * (-1995.680) (-1994.041) (-2003.325) [-1980.074] -- 0:04:02
Average standard deviation of split frequencies: 0.004818
243100 -- (-1986.053) (-1996.657) [-1978.856] (-1989.573) * [-1990.897] (-1998.886) (-1995.002) (-1984.875) -- 0:04:02
243200 -- (-1988.368) (-2000.512) [-1978.501] (-1993.375) * [-1986.473] (-2003.760) (-1999.179) (-1979.852) -- 0:04:02
243300 -- (-1984.233) (-1996.993) [-1978.994] (-1996.428) * [-1986.922] (-2004.105) (-2000.153) (-1980.688) -- 0:04:02
243400 -- (-1985.003) (-1990.334) [-1982.858] (-1994.267) * (-1988.820) (-2006.980) (-1988.865) [-1981.609] -- 0:04:02
243500 -- (-1991.426) [-1986.086] (-1982.828) (-1998.753) * (-1990.574) (-1996.659) (-1985.495) [-1977.056] -- 0:04:02
243600 -- [-1986.823] (-1987.555) (-1986.742) (-2003.744) * (-1994.807) (-1998.461) (-1987.427) [-1981.344] -- 0:04:02
243700 -- [-1985.085] (-1991.645) (-1994.603) (-1998.320) * (-1992.303) (-1990.636) [-1989.844] (-1979.962) -- 0:04:02
243800 -- (-1988.965) (-1988.184) (-1994.709) [-1986.099] * (-1994.019) (-1996.331) [-1993.834] (-1981.818) -- 0:04:01
243900 -- [-1978.839] (-1989.644) (-1992.060) (-1983.132) * (-1993.160) (-1991.512) (-1995.594) [-1979.601] -- 0:04:01
244000 -- [-1979.734] (-1995.463) (-1991.427) (-1989.025) * (-1987.764) (-1984.979) (-1997.204) [-1981.334] -- 0:04:01
Average standard deviation of split frequencies: 0.004414
244100 -- [-1980.494] (-1997.396) (-1987.960) (-1989.632) * (-1995.743) (-1984.053) (-1994.609) [-1977.888] -- 0:04:01
244200 -- (-1985.432) (-1998.068) (-1981.463) [-1993.008] * (-1995.173) [-1986.079] (-1998.697) (-1984.861) -- 0:04:01
244300 -- (-1994.798) (-1999.053) (-1982.653) [-1989.120] * (-1996.696) (-1989.562) (-1992.683) [-1985.095] -- 0:04:01
244400 -- (-1988.664) (-1990.882) (-1986.029) [-1992.342] * (-1992.567) [-1987.002] (-1994.490) (-1983.526) -- 0:04:01
244500 -- (-1988.034) (-1990.182) (-1996.640) [-1990.897] * (-1984.146) (-1989.489) (-1993.676) [-1982.442] -- 0:04:01
244600 -- [-1982.346] (-1989.311) (-2001.127) (-1993.738) * (-1978.754) [-1985.668] (-1998.058) (-1993.362) -- 0:04:00
244700 -- [-1982.804] (-2003.608) (-1994.085) (-1990.216) * [-1982.427] (-1991.219) (-1994.942) (-1988.770) -- 0:04:00
244800 -- (-1982.915) (-1991.013) [-1990.361] (-1995.800) * [-1979.903] (-1997.466) (-1995.997) (-1980.177) -- 0:04:00
244900 -- (-1984.371) [-1990.343] (-1988.006) (-1989.738) * (-1983.275) [-1984.727] (-2001.722) (-1984.108) -- 0:04:00
245000 -- [-1986.748] (-1992.271) (-1986.264) (-1987.133) * [-1984.212] (-1986.332) (-2007.649) (-1990.530) -- 0:04:00
Average standard deviation of split frequencies: 0.004504
245100 -- [-1983.224] (-1992.875) (-1987.289) (-1993.357) * (-1983.688) (-1987.196) (-2013.297) [-1995.897] -- 0:04:00
245200 -- [-1987.052] (-1997.209) (-1986.707) (-1989.935) * (-1987.641) [-1989.431] (-2006.657) (-1989.329) -- 0:04:00
245300 -- [-1987.058] (-1998.529) (-1990.030) (-1984.822) * (-1983.416) (-1988.570) (-1992.755) [-1981.323] -- 0:03:59
245400 -- (-1986.448) (-1995.384) (-1987.005) [-1988.596] * [-1980.774] (-1988.513) (-1990.059) (-1979.504) -- 0:03:59
245500 -- (-1986.565) (-1996.497) [-1991.265] (-1991.050) * [-1983.449] (-1993.057) (-1989.329) (-1978.672) -- 0:03:59
245600 -- (-1980.867) (-2001.985) (-1988.151) [-1990.777] * (-1982.836) (-1989.957) (-1991.289) [-1982.862] -- 0:04:02
245700 -- [-1976.235] (-1994.459) (-1991.677) (-1989.494) * (-1984.675) (-1996.246) (-1993.794) [-1986.055] -- 0:04:02
245800 -- [-1980.958] (-1992.731) (-1993.395) (-1995.417) * (-1979.470) (-1998.869) [-1990.995] (-1985.501) -- 0:04:02
245900 -- [-1981.114] (-1990.308) (-2001.360) (-2003.700) * [-1986.073] (-2000.048) (-1990.202) (-1983.701) -- 0:04:02
246000 -- (-1983.661) [-1988.574] (-1999.358) (-1992.116) * (-1989.529) (-1998.417) (-1995.097) [-1985.573] -- 0:04:02
Average standard deviation of split frequencies: 0.004432
246100 -- [-1981.837] (-1994.793) (-1988.761) (-1998.208) * (-1992.388) (-2017.480) [-1994.331] (-1981.802) -- 0:04:02
246200 -- (-1984.536) [-1988.612] (-1985.504) (-1997.038) * (-1989.803) (-2018.537) (-1993.414) [-1981.470] -- 0:04:01
246300 -- (-1989.296) (-1987.314) [-1989.448] (-2005.519) * (-1995.579) (-2000.966) (-1993.343) [-1980.803] -- 0:04:01
246400 -- (-1994.258) [-1985.740] (-1990.120) (-2010.298) * (-1998.632) (-2000.810) (-1992.444) [-1981.937] -- 0:04:01
246500 -- [-1982.751] (-1986.277) (-1989.965) (-2003.288) * (-2003.703) (-1998.521) (-2000.693) [-1984.261] -- 0:04:01
246600 -- (-1980.558) [-1982.591] (-1987.681) (-2007.364) * (-1998.973) (-1997.741) (-1999.607) [-1983.678] -- 0:04:01
246700 -- [-1980.095] (-1985.940) (-1989.836) (-2001.073) * (-2001.575) (-2003.602) [-1990.661] (-1986.447) -- 0:04:01
246800 -- (-1987.040) [-1989.389] (-1988.004) (-1998.557) * (-1992.650) (-2003.743) [-1987.459] (-1981.564) -- 0:04:01
246900 -- (-1990.385) [-1987.725] (-1989.275) (-2010.454) * (-1993.530) (-2009.136) [-1988.722] (-1995.254) -- 0:04:00
247000 -- [-1983.116] (-1986.160) (-1989.959) (-2012.429) * (-1992.007) (-2008.126) [-1988.537] (-1997.079) -- 0:04:00
Average standard deviation of split frequencies: 0.004468
247100 -- (-1984.332) [-1984.296] (-1997.692) (-2023.201) * (-1996.713) (-2012.291) [-1990.602] (-1989.842) -- 0:04:00
247200 -- [-1985.102] (-1984.207) (-1991.126) (-2000.574) * (-1993.089) (-2008.111) [-1985.598] (-1989.516) -- 0:04:00
247300 -- (-1988.392) [-1985.473] (-1992.672) (-1994.004) * (-1992.117) (-2005.342) [-1985.441] (-1988.563) -- 0:04:00
247400 -- [-1984.566] (-1994.473) (-2003.201) (-1986.333) * [-1988.747] (-2003.816) (-1986.944) (-1992.101) -- 0:04:00
247500 -- [-1979.112] (-1995.934) (-1984.167) (-1983.711) * (-1988.635) (-2004.270) (-1994.477) [-1986.978] -- 0:04:00
247600 -- [-1981.522] (-1996.871) (-1993.012) (-1986.250) * (-1992.486) (-2013.818) (-1996.387) [-1986.210] -- 0:04:00
247700 -- (-1985.805) (-1992.035) (-1997.401) [-1985.506] * [-1987.265] (-2008.176) (-2009.536) (-1992.240) -- 0:03:59
247800 -- (-1986.604) (-1985.078) (-1989.631) [-1983.956] * [-1984.276] (-1994.534) (-1996.082) (-1989.222) -- 0:03:59
247900 -- [-1989.842] (-1993.091) (-1995.477) (-1987.951) * [-1984.418] (-1998.398) (-1992.229) (-1991.517) -- 0:03:59
248000 -- (-1990.586) [-1991.729] (-1993.563) (-1980.206) * [-1983.129] (-2008.425) (-2001.840) (-1990.471) -- 0:03:59
Average standard deviation of split frequencies: 0.004397
248100 -- (-1990.159) (-1989.892) (-1995.302) [-1981.333] * [-1983.017] (-2002.458) (-2006.510) (-1987.065) -- 0:03:59
248200 -- (-1991.263) (-1989.949) (-1998.673) [-1981.339] * [-1984.830] (-1997.309) (-2003.827) (-1988.122) -- 0:03:59
248300 -- [-1989.070] (-1991.956) (-1989.439) (-1987.721) * [-1987.224] (-1993.550) (-2007.638) (-1983.501) -- 0:03:59
248400 -- (-1983.599) (-1993.419) (-1988.434) [-1988.180] * (-1982.351) (-1997.840) (-2008.674) [-1987.918] -- 0:03:59
248500 -- (-1982.101) (-1997.922) [-1989.851] (-1984.395) * [-1982.301] (-1998.390) (-2007.179) (-1991.579) -- 0:03:58
248600 -- [-1983.369] (-2006.039) (-1993.442) (-1987.860) * [-1986.395] (-2012.282) (-2009.033) (-1990.446) -- 0:03:58
248700 -- (-1983.131) (-2005.107) [-1985.914] (-1986.586) * (-1987.478) (-1995.825) (-1995.053) [-1990.632] -- 0:04:01
248800 -- [-1977.990] (-2000.685) (-1987.280) (-1985.019) * [-1993.683] (-1996.910) (-1992.065) (-1992.681) -- 0:04:01
248900 -- (-1982.848) (-1992.865) (-1997.191) [-1982.807] * (-2000.578) (-2001.613) [-1990.875] (-1996.064) -- 0:04:01
249000 -- (-1985.517) (-1991.618) (-1992.072) [-1980.118] * (-1997.770) [-1987.552] (-1991.355) (-1991.186) -- 0:04:01
Average standard deviation of split frequencies: 0.004162
249100 -- [-1982.095] (-1994.219) (-1993.398) (-1980.600) * (-2005.440) (-1993.718) (-1991.171) [-1989.113] -- 0:04:01
249200 -- [-1985.899] (-1982.476) (-1990.428) (-1988.517) * (-2002.359) (-1993.361) [-1992.099] (-2000.574) -- 0:04:01
249300 -- (-1985.563) [-1984.777] (-1991.633) (-1984.002) * (-1991.696) (-1997.501) [-1991.139] (-1995.675) -- 0:04:00
249400 -- (-1988.006) [-1984.621] (-2000.163) (-1984.566) * [-1992.586] (-1995.261) (-1995.072) (-1993.416) -- 0:04:00
249500 -- (-1994.268) [-1985.417] (-2000.698) (-1984.473) * (-1992.213) (-1991.154) (-1996.037) [-1992.310] -- 0:04:00
249600 -- (-1995.891) (-1981.855) (-1996.136) [-1979.618] * (-1992.170) (-1997.435) [-1991.629] (-1990.857) -- 0:04:00
249700 -- (-1985.509) (-1980.440) [-1989.143] (-1996.226) * (-1987.256) (-1998.525) (-1993.727) [-1985.431] -- 0:04:00
249800 -- (-1988.864) [-1981.906] (-1991.595) (-1988.046) * [-1986.409] (-2003.439) (-1988.217) (-1988.614) -- 0:04:00
249900 -- (-2003.880) [-1983.146] (-1992.170) (-1982.389) * (-1991.152) (-1998.887) (-1986.698) [-1986.132] -- 0:04:00
250000 -- (-1993.447) [-1981.887] (-1992.048) (-1982.832) * (-1993.379) (-1998.181) [-1989.026] (-1985.140) -- 0:04:00
Average standard deviation of split frequencies: 0.004415
250100 -- (-1998.623) (-1978.379) (-1992.549) [-1982.684] * (-1994.466) (-1996.102) (-1989.738) [-1985.775] -- 0:03:59
250200 -- (-1998.501) [-1983.119] (-1989.817) (-1986.191) * (-1996.557) (-2000.078) (-1986.939) [-1987.010] -- 0:03:59
250300 -- (-1992.515) (-1984.976) (-1984.478) [-1979.428] * [-1985.999] (-1992.093) (-1991.530) (-1987.766) -- 0:03:59
250400 -- (-1999.781) (-1995.309) (-1988.347) [-1983.505] * [-1987.265] (-2008.653) (-1991.647) (-1985.213) -- 0:03:59
250500 -- (-2004.501) (-1997.729) [-1983.417] (-1982.434) * [-1989.534] (-1999.202) (-1996.890) (-1994.382) -- 0:03:59
250600 -- (-1994.332) (-1992.793) [-1990.507] (-1985.862) * [-1990.918] (-2005.627) (-2000.543) (-1993.505) -- 0:03:59
250700 -- (-1989.340) (-1990.492) (-1986.917) [-1980.702] * (-1986.336) (-2005.643) [-1994.174] (-1992.094) -- 0:03:59
250800 -- (-1989.689) (-1993.201) (-1994.420) [-1978.913] * [-1990.326] (-1999.284) (-1993.216) (-1992.478) -- 0:03:58
250900 -- (-1987.832) (-1990.244) (-1989.893) [-1983.028] * (-1991.693) (-2002.910) [-1987.146] (-1991.648) -- 0:03:58
251000 -- (-1984.679) (-1992.853) [-1986.217] (-1989.608) * (-1992.749) (-2005.383) (-1985.190) [-1986.457] -- 0:03:58
Average standard deviation of split frequencies: 0.004450
251100 -- (-1984.437) (-1993.718) (-1986.744) [-1988.820] * (-1998.519) (-2007.338) (-1988.274) [-1986.436] -- 0:03:58
251200 -- [-1981.333] (-1996.704) (-1984.836) (-1987.356) * (-1985.198) (-1998.147) (-1990.407) [-1984.277] -- 0:03:58
251300 -- (-1990.401) (-1995.514) (-1990.531) [-1982.503] * [-1985.700] (-1999.237) (-1987.317) (-1999.880) -- 0:03:58
251400 -- (-1990.176) (-1989.071) (-1996.585) [-1979.337] * (-1986.772) [-1993.798] (-1989.200) (-1996.504) -- 0:03:58
251500 -- (-1995.332) (-1994.333) (-1993.355) [-1981.377] * (-1989.978) (-1997.579) [-1985.772] (-1994.776) -- 0:03:58
251600 -- (-1990.806) (-1990.785) (-1987.902) [-1980.448] * (-1990.633) (-1995.051) [-1988.933] (-1993.276) -- 0:03:57
251700 -- (-1990.764) (-1992.027) (-1994.006) [-1987.565] * (-1987.899) (-1996.054) [-1982.436] (-1988.873) -- 0:03:57
251800 -- (-1988.906) (-1993.853) (-1986.589) [-1981.911] * (-1991.364) (-1996.672) (-1991.510) [-1983.667] -- 0:04:00
251900 -- (-1983.945) (-2002.720) (-1993.492) [-1985.605] * (-1991.865) (-2007.715) (-1987.275) [-1981.896] -- 0:04:00
252000 -- [-1983.601] (-1999.335) (-1992.961) (-1981.688) * (-1989.364) (-2004.138) (-1993.972) [-1978.710] -- 0:04:00
Average standard deviation of split frequencies: 0.004541
252100 -- [-1986.112] (-1996.201) (-1995.655) (-1983.001) * (-1989.515) (-2005.800) [-1989.742] (-1983.431) -- 0:04:00
252200 -- (-1996.551) (-1998.961) (-1992.797) [-1981.826] * (-1995.293) (-1990.317) [-1985.413] (-1985.353) -- 0:04:00
252300 -- (-1993.715) (-1998.340) (-1989.334) [-1980.909] * (-1996.749) [-1990.925] (-1988.011) (-1995.317) -- 0:04:00
252400 -- (-1987.538) (-2008.372) (-1997.180) [-1981.180] * [-1985.505] (-1989.887) (-1989.182) (-1997.649) -- 0:03:59
252500 -- [-1982.820] (-1999.600) (-1997.095) (-1983.678) * (-1986.645) (-1996.361) (-1992.607) [-1992.085] -- 0:03:59
252600 -- [-1977.475] (-1996.810) (-1993.901) (-1987.004) * [-1988.824] (-1996.505) (-1990.114) (-1994.065) -- 0:03:59
252700 -- [-1983.497] (-1992.632) (-1999.093) (-1994.519) * (-1990.246) [-1991.613] (-1990.690) (-1991.157) -- 0:03:59
252800 -- (-1979.290) (-1996.645) (-1996.815) [-1989.992] * (-1998.961) (-1993.335) [-1989.629] (-1990.616) -- 0:03:59
252900 -- [-1992.937] (-1993.734) (-1993.047) (-2004.333) * (-1992.628) (-1992.915) [-1997.541] (-1988.357) -- 0:03:59
253000 -- (-1993.999) [-1992.089] (-2000.243) (-1999.072) * [-1995.351] (-1995.194) (-2002.510) (-1988.230) -- 0:03:59
Average standard deviation of split frequencies: 0.004628
253100 -- (-1996.973) (-1993.153) (-2001.087) [-1985.564] * (-1999.896) [-1992.370] (-2012.541) (-1993.507) -- 0:03:59
253200 -- (-1994.304) [-1988.264] (-1996.429) (-1981.210) * (-1993.720) [-1986.890] (-2006.121) (-1995.167) -- 0:03:58
253300 -- (-1993.510) (-1986.442) (-1989.823) [-1982.922] * (-1984.832) [-1992.968] (-2005.212) (-1992.044) -- 0:03:58
253400 -- (-1995.739) (-1996.232) (-1986.842) [-1981.731] * [-1983.292] (-1999.366) (-1997.735) (-1995.304) -- 0:03:58
253500 -- (-1994.457) (-1994.714) [-1982.997] (-1981.265) * [-1983.801] (-1999.553) (-1993.474) (-1993.892) -- 0:03:58
253600 -- (-1990.956) (-1998.083) (-1983.744) [-1983.149] * [-1979.449] (-1996.667) (-1988.310) (-1989.352) -- 0:03:58
253700 -- (-1985.820) (-1990.273) [-1989.838] (-1987.945) * [-1977.236] (-1992.667) (-1988.202) (-1988.289) -- 0:03:58
253800 -- [-1989.843] (-1991.338) (-1990.743) (-1988.467) * [-1980.181] (-1996.905) (-1989.986) (-1985.609) -- 0:03:58
253900 -- (-1990.046) (-2001.731) (-1994.288) [-1987.288] * [-1983.870] (-2002.221) (-1991.733) (-1992.406) -- 0:03:58
254000 -- [-1984.829] (-2001.476) (-1988.047) (-1988.643) * [-1982.506] (-1998.451) (-1989.169) (-1992.399) -- 0:03:57
Average standard deviation of split frequencies: 0.004664
254100 -- (-1983.737) (-1993.878) [-1988.876] (-1986.369) * [-1978.682] (-1993.236) (-1989.527) (-1984.866) -- 0:03:57
254200 -- (-1983.514) (-1996.950) (-1993.725) [-1986.837] * [-1980.538] (-2003.043) (-1990.320) (-1985.997) -- 0:03:57
254300 -- [-1984.690] (-1992.128) (-1994.840) (-1990.881) * [-1980.433] (-2007.515) (-1988.996) (-1990.463) -- 0:03:57
254400 -- (-1989.154) (-1993.906) (-1989.733) [-1989.341] * [-1981.625] (-1997.663) (-1990.815) (-1993.427) -- 0:03:57
254500 -- (-1982.438) (-1992.913) [-1989.339] (-1990.078) * (-1984.001) [-1994.820] (-1996.525) (-1991.583) -- 0:03:57
254600 -- (-1982.133) (-1998.076) [-1983.335] (-2001.396) * (-1984.269) (-1996.997) (-1989.133) [-1983.366] -- 0:03:57
254700 -- (-1980.510) (-1998.048) [-1984.411] (-1995.737) * [-1979.607] (-1988.486) (-1989.397) (-1985.515) -- 0:03:57
254800 -- (-1982.622) (-1999.908) [-1986.560] (-2000.873) * [-1984.494] (-1986.145) (-1988.846) (-1988.968) -- 0:03:56
254900 -- (-1984.307) (-2003.176) (-1980.112) [-1992.584] * [-1979.147] (-1998.688) (-1988.600) (-1987.566) -- 0:03:59
255000 -- [-1986.249] (-2002.888) (-1985.056) (-1992.405) * (-1984.146) [-1991.226] (-1998.801) (-1989.829) -- 0:03:59
Average standard deviation of split frequencies: 0.004539
255100 -- (-1984.847) (-1997.769) [-1981.520] (-1997.285) * [-1982.037] (-1992.018) (-1997.994) (-1989.318) -- 0:03:59
255200 -- (-1989.548) (-1994.747) [-1981.931] (-1991.125) * (-1983.342) [-1993.543] (-1996.784) (-1988.933) -- 0:03:59
255300 -- (-1990.951) (-1997.252) [-1984.803] (-1999.965) * (-1982.251) (-2006.503) (-2004.200) [-1986.805] -- 0:03:59
255400 -- (-1993.748) (-1987.160) (-1980.041) [-1995.769] * [-1978.044] (-2003.325) (-1999.969) (-1984.126) -- 0:03:59
255500 -- (-1986.221) (-1991.116) [-1984.720] (-1993.933) * [-1979.140] (-2007.108) (-2001.689) (-1992.096) -- 0:03:58
255600 -- (-1993.702) (-1991.742) [-1984.499] (-1986.034) * [-1980.786] (-1996.576) (-2000.761) (-1990.074) -- 0:03:58
255700 -- (-2006.744) (-1989.356) [-1982.600] (-1987.653) * [-1981.282] (-2006.576) (-2005.824) (-1996.217) -- 0:03:58
255800 -- (-1993.758) (-1982.097) [-1982.816] (-1987.374) * (-1983.097) (-1998.264) (-2003.175) [-1989.143] -- 0:03:58
255900 -- (-1992.593) [-1982.742] (-1990.130) (-1987.068) * [-1982.093] (-1999.123) (-2010.976) (-1990.296) -- 0:03:58
256000 -- (-1999.624) [-1981.173] (-1990.712) (-1991.544) * (-1982.848) (-2000.603) (-2000.700) [-1983.397] -- 0:03:58
Average standard deviation of split frequencies: 0.004417
256100 -- (-1992.568) (-1990.770) [-1989.997] (-1992.576) * [-1986.042] (-2002.828) (-2006.458) (-1979.511) -- 0:03:58
256200 -- [-1990.571] (-1992.672) (-1990.527) (-1993.021) * (-1982.441) (-1990.198) (-2001.739) [-1979.432] -- 0:03:58
256300 -- (-1990.658) [-1988.732] (-1987.808) (-1992.479) * [-1980.637] (-1988.250) (-2003.096) (-1979.997) -- 0:03:57
256400 -- (-1991.527) (-1988.725) [-1983.557] (-2006.417) * [-1979.762] (-1988.293) (-1991.670) (-1980.943) -- 0:03:57
256500 -- (-2001.247) [-1983.044] (-1982.000) (-2012.931) * (-1981.055) (-2000.269) (-1997.318) [-1978.690] -- 0:03:57
256600 -- (-2003.387) [-1978.533] (-1986.634) (-2011.283) * [-1988.307] (-1986.506) (-2010.778) (-1979.308) -- 0:03:57
256700 -- (-2011.918) [-1984.066] (-1982.511) (-2000.995) * (-1988.601) (-1992.902) (-2008.037) [-1978.815] -- 0:03:57
256800 -- (-2005.339) [-1981.146] (-1981.101) (-1999.350) * [-1986.100] (-1995.827) (-2006.531) (-1981.949) -- 0:03:57
256900 -- (-2004.568) (-1975.757) [-1982.280] (-1998.598) * [-1983.629] (-1994.357) (-1997.247) (-1983.723) -- 0:03:57
257000 -- (-2011.229) (-1985.205) [-1983.394] (-1995.172) * [-1984.602] (-1990.604) (-2000.144) (-1985.425) -- 0:03:57
Average standard deviation of split frequencies: 0.004504
257100 -- (-2001.667) (-1988.688) [-1982.872] (-1984.710) * [-1981.579] (-1986.909) (-2002.596) (-1993.924) -- 0:03:56
257200 -- (-2007.757) [-1987.870] (-1993.682) (-1984.118) * [-1985.416] (-1985.480) (-2003.769) (-1995.641) -- 0:03:56
257300 -- (-2010.236) (-1984.220) (-1991.925) [-1979.174] * [-1987.662] (-1982.316) (-1993.127) (-1992.611) -- 0:03:56
257400 -- (-2012.197) (-1989.474) (-1990.107) [-1982.326] * [-1988.591] (-1984.642) (-1991.132) (-1999.910) -- 0:03:56
257500 -- (-2012.464) (-1991.098) (-1997.016) [-1978.406] * (-1985.236) (-1982.702) [-1989.677] (-1992.104) -- 0:03:56
257600 -- (-2009.189) (-1987.195) (-1991.564) [-1984.310] * (-1981.639) [-1979.338] (-1986.423) (-1995.976) -- 0:03:56
257700 -- (-2000.588) [-1989.215] (-1990.732) (-1984.865) * (-1983.180) [-1980.451] (-1989.602) (-1996.721) -- 0:03:56
257800 -- (-2007.530) [-1982.954] (-1998.929) (-1985.140) * (-1990.235) (-1982.803) [-1988.500] (-2000.487) -- 0:03:56
257900 -- (-2000.717) (-1983.318) (-2000.961) [-1985.751] * (-1982.347) [-1982.367] (-1993.801) (-2014.685) -- 0:03:55
258000 -- (-1988.643) (-1984.989) (-2001.374) [-1984.384] * (-1982.058) [-1981.627] (-1990.312) (-2009.830) -- 0:03:58
Average standard deviation of split frequencies: 0.004800
258100 -- (-1987.952) (-1978.444) (-1998.726) [-1986.510] * (-1983.310) [-1982.818] (-1989.717) (-1999.094) -- 0:03:58
258200 -- (-1997.813) (-1986.627) (-1997.682) [-1989.736] * (-1984.968) [-1980.347] (-1991.479) (-1988.137) -- 0:03:58
258300 -- (-1997.242) (-1990.591) (-1994.709) [-1982.578] * (-1985.495) [-1981.827] (-1989.968) (-1994.748) -- 0:03:58
258400 -- (-2003.110) (-1989.559) (-2001.127) [-1982.834] * (-1990.976) [-1982.728] (-1998.293) (-1991.264) -- 0:03:58
258500 -- (-2005.361) [-1986.177] (-2001.874) (-1985.222) * (-1990.305) [-1983.390] (-2001.425) (-1994.344) -- 0:03:58
258600 -- (-2005.630) (-1989.960) (-1998.626) [-1985.200] * (-1994.354) [-1983.108] (-1994.486) (-1991.006) -- 0:03:57
258700 -- (-2000.560) (-1991.302) (-2004.296) [-1983.275] * (-1998.560) (-1984.471) [-1989.696] (-1985.988) -- 0:03:57
258800 -- (-2009.473) (-1987.095) (-1987.175) [-1984.367] * (-1997.595) (-1982.977) (-1993.127) [-1983.019] -- 0:03:57
258900 -- (-2004.473) (-1992.184) (-1984.228) [-1979.431] * (-1995.923) [-1980.826] (-1991.247) (-1985.400) -- 0:03:57
259000 -- (-1994.039) (-1994.973) (-1981.848) [-1978.263] * (-1989.661) (-1979.532) (-1991.186) [-1993.118] -- 0:03:57
Average standard deviation of split frequencies: 0.004833
259100 -- (-1999.131) (-1999.309) [-1982.204] (-1981.388) * (-1989.301) [-1979.466] (-1990.981) (-1988.111) -- 0:03:57
259200 -- (-1996.612) (-1996.883) (-1987.679) [-1981.565] * (-1990.129) [-1983.351] (-2002.550) (-1986.992) -- 0:03:57
259300 -- (-1995.196) (-1988.941) (-1990.533) [-1979.961] * (-1988.850) [-1981.173] (-1997.541) (-1983.162) -- 0:03:57
259400 -- (-1993.900) (-1978.289) (-1992.179) [-1984.013] * (-1996.194) [-1981.899] (-1998.897) (-1984.708) -- 0:03:56
259500 -- (-1990.675) [-1977.909] (-1990.523) (-1983.514) * (-1993.019) [-1986.876] (-2000.112) (-1991.610) -- 0:03:56
259600 -- (-1999.443) [-1976.472] (-1988.282) (-1980.670) * (-1991.048) [-1983.696] (-1990.510) (-1985.598) -- 0:03:56
259700 -- (-2000.534) [-1978.592] (-1992.200) (-1980.416) * (-1992.041) [-1981.021] (-1997.569) (-1989.116) -- 0:03:56
259800 -- (-1994.345) [-1993.919] (-1984.612) (-1985.488) * (-1995.822) (-1982.862) (-2001.102) [-1983.673] -- 0:03:56
259900 -- (-1995.821) (-1993.539) (-1982.413) [-1983.136] * (-1989.119) [-1981.944] (-1995.177) (-1989.634) -- 0:03:56
260000 -- (-2001.354) (-1989.783) (-1985.341) [-1980.105] * [-1989.371] (-1985.678) (-1994.972) (-1987.522) -- 0:03:56
Average standard deviation of split frequencies: 0.005022
260100 -- (-2005.747) (-1984.994) [-1984.755] (-1990.515) * (-1996.217) (-1991.384) (-1996.750) [-1987.093] -- 0:03:56
260200 -- (-2011.649) [-1983.486] (-1982.826) (-1995.313) * (-1991.367) (-1995.414) (-1995.667) [-1989.422] -- 0:03:55
260300 -- [-1990.307] (-1993.113) (-1986.555) (-1990.641) * (-1994.295) (-1999.089) (-1993.258) [-1986.562] -- 0:03:55
260400 -- (-1989.595) (-1993.850) (-1987.883) [-1987.476] * (-1990.576) (-1995.157) [-1992.615] (-1990.815) -- 0:03:55
260500 -- (-1998.336) [-1991.849] (-1988.579) (-1985.478) * (-1989.825) (-1991.984) [-1990.342] (-1990.263) -- 0:03:55
260600 -- (-1994.631) (-1990.855) (-1991.849) [-1987.009] * [-1991.280] (-1989.054) (-1986.215) (-1989.324) -- 0:03:55
260700 -- (-2001.996) (-1988.816) (-1997.398) [-1986.008] * (-1988.128) (-1990.490) [-1985.248] (-1994.693) -- 0:03:55
260800 -- (-1999.375) (-1985.345) (-1995.061) [-1982.653] * [-1983.611] (-1989.707) (-1986.980) (-1996.501) -- 0:03:55
260900 -- (-2011.579) [-1982.910] (-1998.283) (-1986.969) * (-1985.038) [-1990.067] (-1991.442) (-2002.951) -- 0:03:55
261000 -- (-2001.388) [-1985.284] (-2003.828) (-1987.186) * (-1991.403) [-1992.793] (-1990.232) (-1995.484) -- 0:03:55
Average standard deviation of split frequencies: 0.005053
261100 -- (-1996.035) [-1984.368] (-2003.672) (-1987.183) * (-1988.347) (-1998.020) [-1987.120] (-1999.309) -- 0:03:57
261200 -- (-1997.558) (-1984.476) (-1991.685) [-1985.135] * (-1992.286) (-1991.918) [-1985.938] (-1996.348) -- 0:03:57
261300 -- (-2002.409) [-1982.545] (-1991.029) (-1983.618) * (-1994.212) (-1987.105) [-1989.157] (-1988.997) -- 0:03:57
261400 -- (-1999.519) [-1981.103] (-1991.775) (-1991.241) * (-1995.221) [-1991.209] (-1991.477) (-1990.452) -- 0:03:57
261500 -- (-1998.648) [-1984.023] (-1994.892) (-1986.836) * (-2009.778) [-1987.985] (-1987.882) (-1992.449) -- 0:03:57
261600 -- (-2006.260) [-1989.601] (-1999.183) (-1987.231) * (-2009.075) [-1994.863] (-1985.587) (-1986.509) -- 0:03:57
261700 -- (-2004.191) (-1982.845) (-1993.004) [-1982.361] * (-2009.859) (-1985.865) (-1990.107) [-1985.135] -- 0:03:56
261800 -- (-2007.977) [-1986.926] (-1995.150) (-1982.709) * (-1993.127) [-1989.065] (-1987.173) (-1984.763) -- 0:03:56
261900 -- (-2009.825) (-1984.128) [-1990.704] (-1986.865) * (-1995.394) (-1993.884) (-1987.220) [-1986.594] -- 0:03:56
262000 -- (-2003.496) [-1987.409] (-1994.953) (-1979.050) * (-1994.544) (-1990.270) [-1989.540] (-1989.260) -- 0:03:56
Average standard deviation of split frequencies: 0.005395
262100 -- (-2004.864) (-1990.092) [-1992.563] (-1980.787) * (-1992.504) [-1987.537] (-1990.883) (-1994.882) -- 0:03:56
262200 -- (-2011.686) (-1988.285) (-1992.038) [-1980.051] * (-1987.207) [-1985.757] (-1995.924) (-1999.328) -- 0:03:56
262300 -- (-2006.181) (-1985.574) (-1998.759) [-1983.588] * (-1988.401) [-1992.455] (-1993.436) (-2003.511) -- 0:03:56
262400 -- (-2008.772) (-1980.442) (-2002.147) [-1981.448] * (-1989.538) [-1990.130] (-1994.660) (-2009.190) -- 0:03:56
262500 -- (-2002.709) (-1984.487) (-2001.221) [-1978.911] * [-1987.541] (-1990.497) (-1998.531) (-1995.503) -- 0:03:56
262600 -- (-2002.502) (-1989.370) (-1991.380) [-1982.187] * (-1988.325) (-1987.176) (-2005.865) [-1989.851] -- 0:03:55
262700 -- (-1999.176) (-1989.871) (-2009.064) [-1978.988] * [-1989.253] (-1990.929) (-2001.587) (-1986.845) -- 0:03:55
262800 -- (-1998.399) (-1992.790) (-2008.373) [-1984.676] * (-1989.269) (-1987.713) (-1998.449) [-1982.305] -- 0:03:55
262900 -- (-2003.739) [-1985.436] (-1993.633) (-1984.015) * (-1988.985) (-1991.305) (-2009.595) [-1991.886] -- 0:03:55
263000 -- (-2002.716) [-1985.465] (-2002.504) (-1986.327) * (-1991.003) (-1992.515) (-1991.024) [-1988.000] -- 0:03:55
Average standard deviation of split frequencies: 0.005424
263100 -- (-1995.886) [-1984.743] (-1999.973) (-1986.538) * (-1992.778) (-1994.485) (-1995.066) [-1985.469] -- 0:03:55
263200 -- (-1995.901) [-1984.974] (-1997.298) (-1987.161) * [-1990.754] (-2004.068) (-1995.551) (-1988.529) -- 0:03:55
263300 -- (-2003.623) (-1983.426) (-1994.713) [-1980.616] * (-1991.456) (-2002.135) (-1999.570) [-1991.280] -- 0:03:55
263400 -- (-2004.652) (-1982.191) (-1990.966) [-1981.188] * (-1992.807) (-2001.881) (-2008.439) [-1991.083] -- 0:03:54
263500 -- (-2002.444) (-1986.880) (-1992.795) [-1980.433] * [-1985.210] (-1995.416) (-2005.760) (-1998.362) -- 0:03:54
263600 -- (-1999.541) (-1987.756) (-1992.458) [-1981.194] * [-1987.495] (-1992.536) (-2008.383) (-1996.584) -- 0:03:54
263700 -- (-1994.549) [-1988.718] (-1996.510) (-1981.180) * [-1987.058] (-1991.037) (-1998.014) (-1993.200) -- 0:03:54
263800 -- (-1993.102) (-1989.942) (-1994.350) [-1982.877] * [-1986.250] (-1991.919) (-1988.959) (-2007.556) -- 0:03:54
263900 -- (-1996.822) (-1990.767) (-1999.340) [-1983.802] * [-1985.080] (-1990.733) (-1987.349) (-2004.476) -- 0:03:54
264000 -- (-1995.091) (-1990.487) (-1997.383) [-1982.973] * [-1989.342] (-1989.272) (-1987.497) (-2001.967) -- 0:03:54
Average standard deviation of split frequencies: 0.005405
264100 -- [-1987.690] (-1988.529) (-2003.099) (-1979.599) * [-1987.665] (-1990.509) (-1988.701) (-1996.469) -- 0:03:56
264200 -- (-1989.585) (-1979.895) (-1997.084) [-1980.853] * [-1987.304] (-1998.202) (-1993.448) (-1999.716) -- 0:03:56
264300 -- (-1991.075) [-1984.310] (-1998.636) (-1979.720) * (-1985.001) [-1994.834] (-1995.964) (-1999.974) -- 0:03:56
264400 -- (-1987.991) (-1982.727) (-2003.451) [-1981.033] * [-1993.615] (-1994.897) (-1989.742) (-2006.581) -- 0:03:56
264500 -- (-1988.345) (-1986.626) (-1998.399) [-1981.838] * (-2000.600) (-1991.425) [-1986.428] (-2006.239) -- 0:03:56
264600 -- (-1987.183) (-1987.784) (-2017.437) [-1980.645] * (-1997.328) (-1991.209) [-1985.156] (-2001.240) -- 0:03:56
264700 -- [-1987.672] (-1993.885) (-2014.408) (-1986.836) * (-1991.779) [-1990.548] (-1991.624) (-1996.853) -- 0:03:56
264800 -- (-1986.196) (-1982.632) (-1998.470) [-1988.139] * (-1997.968) (-1988.834) [-1987.233] (-2005.261) -- 0:03:55
264900 -- (-1994.243) [-1982.856] (-1998.047) (-1992.778) * (-1997.224) (-1989.697) [-1986.361] (-1995.261) -- 0:03:55
265000 -- (-1997.750) [-1984.886] (-1995.966) (-1989.920) * (-2004.200) (-1990.880) [-1992.740] (-1996.437) -- 0:03:55
Average standard deviation of split frequencies: 0.005790
265100 -- (-2000.692) [-1987.524] (-1996.759) (-1998.445) * (-1996.396) (-1990.664) [-1996.936] (-2000.555) -- 0:03:55
265200 -- (-1995.301) [-1979.760] (-1993.212) (-2003.683) * (-1993.658) [-1990.869] (-1987.763) (-2009.432) -- 0:03:55
265300 -- (-1997.063) [-1980.372] (-1995.379) (-1996.489) * [-1994.322] (-1996.147) (-1987.904) (-2005.150) -- 0:03:55
265400 -- (-2000.033) [-1979.386] (-1995.729) (-1992.371) * (-1990.851) (-1992.276) [-1987.627] (-2004.066) -- 0:03:55
265500 -- (-1993.962) (-1985.322) (-1997.333) [-1987.093] * (-1994.675) [-1994.813] (-1991.876) (-1991.927) -- 0:03:55
265600 -- (-1989.540) (-1990.950) (-1993.880) [-1993.297] * (-1995.131) (-1990.048) (-1987.798) [-1985.619] -- 0:03:55
265700 -- (-1997.423) [-1982.509] (-1991.846) (-1994.744) * (-2003.487) (-1988.167) (-1986.865) [-1987.403] -- 0:03:54
265800 -- (-2003.926) [-1984.186] (-1989.031) (-1991.578) * (-2002.245) (-1990.479) [-1987.020] (-1991.926) -- 0:03:54
265900 -- (-1992.438) (-1988.134) (-1985.951) [-1981.338] * (-2002.779) (-1988.172) [-1988.279] (-1993.627) -- 0:03:54
266000 -- (-2002.165) (-1987.010) (-1988.086) [-1986.989] * (-2000.097) (-1993.892) [-1986.707] (-1994.384) -- 0:03:54
Average standard deviation of split frequencies: 0.006225
266100 -- (-1998.323) [-1983.503] (-1990.845) (-1985.189) * (-1991.480) [-1988.133] (-1989.947) (-1999.842) -- 0:03:54
266200 -- (-2002.568) (-1986.411) (-1993.159) [-1985.104] * (-1993.373) [-1988.389] (-1988.932) (-1996.108) -- 0:03:54
266300 -- (-1998.249) (-1986.018) [-1980.092] (-1988.735) * (-2001.634) (-1995.501) [-1991.544] (-1993.189) -- 0:03:54
266400 -- (-1997.307) (-1994.449) [-1977.593] (-1987.735) * (-1993.032) (-2003.308) [-1988.872] (-1997.989) -- 0:03:54
266500 -- (-1994.653) (-1993.707) [-1978.642] (-1985.122) * [-1995.186] (-1999.276) (-1986.703) (-1994.828) -- 0:03:53
266600 -- (-1985.661) (-1994.719) [-1978.870] (-1982.360) * (-1990.254) (-2002.323) (-1993.245) [-1988.257] -- 0:03:53
266700 -- (-1993.915) (-1990.160) (-1983.105) [-1980.892] * [-1995.244] (-1994.192) (-2000.785) (-1991.818) -- 0:03:53
266800 -- (-1992.384) (-1991.805) (-1984.810) [-1978.972] * (-1988.534) (-1989.354) (-2003.994) [-1984.789] -- 0:03:53
266900 -- (-2001.732) (-1987.287) [-1979.622] (-1982.150) * (-1989.265) [-1986.254] (-2002.996) (-1986.785) -- 0:03:53
267000 -- (-1999.543) (-1986.287) [-1983.045] (-1989.250) * [-1984.648] (-1991.086) (-1995.525) (-1981.669) -- 0:03:53
Average standard deviation of split frequencies: 0.006301
267100 -- (-1995.774) (-1989.541) [-1978.837] (-1985.908) * [-1993.798] (-1996.907) (-2003.139) (-1987.122) -- 0:03:53
267200 -- (-1993.698) (-1994.960) [-1980.948] (-1984.964) * (-1996.732) [-1985.054] (-2001.982) (-1987.683) -- 0:03:53
267300 -- (-1991.754) (-2000.793) [-1983.325] (-1986.523) * (-2013.044) [-1986.764] (-1993.715) (-1988.227) -- 0:03:55
267400 -- (-1995.651) (-1993.084) [-1981.528] (-1984.254) * (-1993.184) (-1988.758) (-2000.965) [-1979.943] -- 0:03:55
267500 -- (-1994.818) [-1990.222] (-1984.182) (-1984.333) * (-1996.227) (-1990.688) (-1997.507) [-1981.523] -- 0:03:55
267600 -- (-1999.911) (-1987.625) (-1982.411) [-1984.532] * (-1996.623) (-1994.639) (-1995.828) [-1983.730] -- 0:03:55
267700 -- (-1995.469) (-1990.887) [-1993.242] (-1988.754) * (-1997.432) (-1995.270) (-1993.255) [-1986.640] -- 0:03:55
267800 -- (-1993.080) (-1982.271) [-1984.671] (-1989.606) * (-2003.199) (-1998.664) (-1994.770) [-1986.081] -- 0:03:55
267900 -- [-1995.396] (-1992.615) (-1980.549) (-1988.587) * (-2007.463) (-1990.716) (-1989.969) [-1981.378] -- 0:03:55
268000 -- (-1991.563) (-1994.348) [-1981.081] (-1986.338) * (-1997.564) (-1989.473) (-1996.022) [-1986.413] -- 0:03:54
Average standard deviation of split frequencies: 0.006530
268100 -- (-1993.176) (-1988.634) [-1985.152] (-1991.611) * (-2001.319) (-1993.250) (-1993.148) [-1982.510] -- 0:03:54
268200 -- (-1987.869) (-1988.546) [-1980.565] (-1986.379) * (-1998.913) [-1996.575] (-1994.964) (-1981.823) -- 0:03:54
268300 -- (-1988.711) (-2000.550) (-1987.422) [-1985.406] * (-1997.026) (-2008.950) (-2000.216) [-1985.760] -- 0:03:54
268400 -- (-1989.380) (-1988.705) [-1982.072] (-1989.526) * (-2006.067) (-1990.723) (-1992.591) [-1982.983] -- 0:03:54
268500 -- (-1992.117) (-1990.640) [-1985.225] (-1993.650) * (-1995.770) (-1991.086) (-1994.598) [-1985.547] -- 0:03:54
268600 -- (-1992.942) [-1986.991] (-1984.818) (-1989.310) * (-1999.940) (-1991.197) [-1994.865] (-1991.490) -- 0:03:54
268700 -- (-1991.858) (-1984.118) [-1979.896] (-1989.305) * (-1998.519) [-1989.457] (-1989.776) (-1989.187) -- 0:03:54
268800 -- (-1991.526) [-1982.812] (-1982.683) (-1984.371) * (-2002.236) (-1992.158) (-1988.891) [-1985.771] -- 0:03:53
268900 -- (-1987.671) (-2005.291) [-1981.677] (-1985.612) * (-1994.992) (-2001.763) [-1987.413] (-1995.174) -- 0:03:53
269000 -- (-1990.746) (-1991.727) [-1981.376] (-1988.915) * (-1997.504) (-2001.826) [-1988.221] (-1996.872) -- 0:03:53
Average standard deviation of split frequencies: 0.006554
269100 -- (-1994.434) (-1988.796) [-1984.544] (-1996.990) * (-1995.106) (-2008.584) [-1985.162] (-1988.307) -- 0:03:53
269200 -- (-2001.064) (-1998.901) [-1987.228] (-1998.591) * (-2001.786) (-1999.047) (-1985.287) [-1985.161] -- 0:03:53
269300 -- (-1997.221) (-1990.085) (-1990.747) [-1990.525] * (-1993.675) (-1997.383) (-1990.936) [-1984.114] -- 0:03:53
269400 -- [-1993.790] (-1990.871) (-1986.028) (-1994.640) * (-1992.439) [-1991.947] (-1991.184) (-1988.759) -- 0:03:53
269500 -- (-1995.884) (-1996.725) [-1985.257] (-1993.421) * (-1992.667) (-1989.084) (-1994.128) [-1981.453] -- 0:03:53
269600 -- (-1994.293) (-1992.911) [-1984.764] (-1997.667) * (-2001.349) (-1993.182) (-1991.397) [-1982.131] -- 0:03:52
269700 -- (-1996.382) (-1993.211) [-1984.165] (-1989.523) * (-2011.950) [-1991.731] (-1985.550) (-1979.766) -- 0:03:52
269800 -- (-1992.932) (-1996.461) [-1988.007] (-1990.132) * (-1995.222) (-1987.270) (-1996.777) [-1979.272] -- 0:03:52
269900 -- (-1999.635) (-1988.022) [-1985.345] (-1992.554) * (-1993.792) (-1997.118) (-1994.086) [-1978.527] -- 0:03:52
270000 -- (-1998.610) [-1981.307] (-1987.950) (-1998.244) * (-1995.955) (-1989.530) [-1985.339] (-1982.877) -- 0:03:52
Average standard deviation of split frequencies: 0.006532
270100 -- (-1994.823) [-1984.302] (-1990.099) (-1989.831) * (-1992.663) (-1991.457) (-1988.104) [-1984.233] -- 0:03:52
270200 -- (-1993.816) (-1981.557) [-1991.098] (-2004.387) * (-1993.847) (-1989.756) (-2001.471) [-1982.590] -- 0:03:52
270300 -- (-1984.730) [-1985.099] (-1991.350) (-1999.316) * (-1993.409) (-1994.310) (-1998.050) [-1979.706] -- 0:03:52
270400 -- (-1989.108) [-1979.459] (-1989.192) (-2011.636) * (-2001.927) (-1997.458) (-1999.708) [-1982.900] -- 0:03:54
270500 -- [-1992.413] (-1985.234) (-1991.061) (-1999.947) * (-1995.681) (-1988.961) (-1996.779) [-1985.894] -- 0:03:54
270600 -- (-1992.535) [-1980.662] (-1988.545) (-2002.033) * (-1991.825) (-1996.067) [-1985.848] (-1981.619) -- 0:03:54
270700 -- (-1994.992) (-1986.925) [-1983.897] (-1998.573) * (-2004.134) (-1989.383) [-1985.333] (-1978.783) -- 0:03:54
270800 -- (-1989.309) (-1987.277) [-1988.725] (-1997.752) * (-1999.315) (-1989.529) (-1986.367) [-1979.713] -- 0:03:54
270900 -- (-1990.134) [-1979.819] (-1984.143) (-2000.616) * (-2001.868) [-1992.000] (-1995.931) (-1983.623) -- 0:03:54
271000 -- (-1990.258) (-1979.215) [-1980.371] (-2003.122) * (-2001.342) (-2000.250) (-1997.159) [-1986.420] -- 0:03:54
Average standard deviation of split frequencies: 0.006854
271100 -- (-2001.500) [-1981.122] (-1982.537) (-1995.162) * (-1988.357) [-1992.418] (-1994.388) (-1990.148) -- 0:03:53
271200 -- (-1991.862) [-1982.858] (-1985.854) (-1995.692) * [-1987.074] (-1991.683) (-1998.696) (-1989.761) -- 0:03:53
271300 -- (-1990.955) [-1984.137] (-1985.209) (-2006.018) * [-1985.401] (-1988.122) (-2000.732) (-1990.816) -- 0:03:53
271400 -- (-1994.719) [-1983.083] (-1983.679) (-2009.633) * [-1986.330] (-1988.618) (-1998.449) (-1984.615) -- 0:03:53
271500 -- [-1989.468] (-1981.155) (-1983.255) (-2001.417) * (-1993.309) (-1987.801) (-2003.638) [-1983.476] -- 0:03:53
271600 -- [-1987.556] (-1984.087) (-1991.691) (-2005.437) * (-2001.595) (-1990.889) (-2010.856) [-1984.485] -- 0:03:53
271700 -- (-1987.809) [-1980.776] (-1993.709) (-2007.270) * (-2003.484) (-1992.233) (-2010.901) [-1989.325] -- 0:03:53
271800 -- (-1988.448) [-1984.436] (-1998.299) (-2002.089) * (-1998.045) (-1989.424) (-1994.050) [-1985.061] -- 0:03:53
271900 -- [-1988.045] (-1988.163) (-1996.047) (-1997.855) * (-2003.102) (-1993.957) (-1994.136) [-1985.467] -- 0:03:52
272000 -- [-1985.973] (-1989.408) (-1990.187) (-2000.421) * (-2011.213) (-1985.132) (-1990.400) [-1986.843] -- 0:03:52
Average standard deviation of split frequencies: 0.006830
272100 -- [-1986.500] (-1990.687) (-1992.132) (-2000.621) * (-1997.606) (-1987.761) (-1994.676) [-1986.454] -- 0:03:52
272200 -- [-1985.969] (-1991.611) (-2002.901) (-1996.574) * (-1996.552) (-1993.804) (-1995.482) [-1984.713] -- 0:03:52
272300 -- (-1991.866) [-1990.387] (-2000.429) (-1997.153) * [-1995.936] (-1992.873) (-1998.524) (-1988.785) -- 0:03:52
272400 -- [-1989.094] (-1987.524) (-1994.807) (-1994.951) * [-1988.432] (-1996.768) (-1993.276) (-1986.481) -- 0:03:52
272500 -- [-1995.959] (-1985.371) (-1990.071) (-1994.302) * [-1984.557] (-1993.894) (-1998.826) (-1989.085) -- 0:03:52
272600 -- (-1990.161) (-1980.594) [-1991.342] (-1992.699) * (-1983.436) (-1999.229) (-1999.467) [-1986.627] -- 0:03:52
272700 -- (-1992.535) [-1989.602] (-1989.970) (-1996.178) * [-1985.441] (-2001.514) (-2000.209) (-1982.776) -- 0:03:52
272800 -- (-1992.666) [-1988.846] (-1990.363) (-1996.546) * [-1984.653] (-2005.974) (-1997.907) (-1987.174) -- 0:03:51
272900 -- (-1993.333) (-1986.256) (-1994.681) [-1995.876] * [-1984.668] (-1996.153) (-1996.274) (-1986.444) -- 0:03:51
273000 -- [-1987.532] (-1983.302) (-1992.695) (-1996.135) * (-1991.642) (-1989.912) (-2004.736) [-1984.775] -- 0:03:51
Average standard deviation of split frequencies: 0.006853
273100 -- [-1985.167] (-1985.200) (-1997.155) (-2001.254) * [-1990.495] (-1993.637) (-2000.601) (-1985.878) -- 0:03:51
273200 -- (-1984.734) [-1989.885] (-2003.799) (-2003.916) * [-1988.791] (-1996.242) (-1997.092) (-1988.973) -- 0:03:51
273300 -- (-1987.158) [-1990.033] (-2003.475) (-2002.651) * (-1991.098) (-1991.630) (-2008.445) [-1982.499] -- 0:03:51
273400 -- [-1985.627] (-1985.679) (-2002.228) (-2000.960) * [-1990.812] (-1986.236) (-1998.265) (-1988.988) -- 0:03:51
273500 -- (-1982.580) [-1985.443] (-1994.282) (-2000.207) * (-1990.043) (-1989.051) [-1992.165] (-1987.490) -- 0:03:53
273600 -- (-1990.617) [-1985.281] (-1986.851) (-1996.903) * (-1994.851) [-1990.633] (-2002.479) (-1992.373) -- 0:03:53
273700 -- [-1988.999] (-1985.413) (-1992.132) (-1993.779) * (-1990.749) (-1993.829) (-2000.726) [-1989.235] -- 0:03:53
273800 -- (-1988.267) [-1988.746] (-2002.196) (-1994.221) * [-1991.617] (-1992.595) (-2002.700) (-1986.096) -- 0:03:53
273900 -- (-1992.594) (-1986.938) (-2004.615) [-1992.711] * (-1989.017) (-2000.854) (-2006.224) [-1983.445] -- 0:03:53
274000 -- (-1988.105) [-1986.333] (-2000.599) (-1994.951) * [-1989.707] (-2002.557) (-2002.880) (-1990.784) -- 0:03:53
Average standard deviation of split frequencies: 0.006682
274100 -- [-1988.835] (-1986.015) (-2000.555) (-2005.719) * [-1987.764] (-2005.046) (-2002.613) (-1988.141) -- 0:03:53
274200 -- [-1989.822] (-1984.200) (-1991.007) (-2006.785) * [-1986.212] (-2003.577) (-1993.792) (-1994.807) -- 0:03:52
274300 -- [-1989.427] (-1983.053) (-1995.141) (-2007.707) * [-1987.265] (-2000.807) (-1986.059) (-1996.569) -- 0:03:52
274400 -- (-1998.695) (-1985.522) [-1991.822] (-2009.417) * [-1986.678] (-2005.198) (-1988.295) (-2005.699) -- 0:03:52
274500 -- (-1992.208) [-1989.465] (-1989.025) (-2005.390) * [-1988.717] (-1998.868) (-1986.714) (-2001.549) -- 0:03:52
274600 -- [-1985.394] (-1992.799) (-1998.018) (-2002.666) * (-1989.160) (-2004.069) [-1992.927] (-2000.503) -- 0:03:52
274700 -- (-1985.884) [-1991.250] (-2012.029) (-2012.469) * (-1989.557) [-1993.230] (-1993.760) (-1993.217) -- 0:03:52
274800 -- [-1989.075] (-1995.126) (-2004.877) (-1998.783) * [-1990.138] (-1989.985) (-1987.798) (-1997.898) -- 0:03:52
274900 -- [-1988.290] (-2006.582) (-1993.362) (-1997.441) * (-1995.559) [-1989.998] (-1983.449) (-2000.364) -- 0:03:52
275000 -- (-1986.135) [-2003.195] (-1993.270) (-1997.807) * (-1991.173) (-1992.080) [-1984.532] (-1994.774) -- 0:03:52
Average standard deviation of split frequencies: 0.006265
275100 -- [-1986.524] (-2010.950) (-1988.954) (-1997.859) * (-1992.693) [-1988.830] (-1988.866) (-1996.976) -- 0:03:51
275200 -- [-1986.256] (-2005.785) (-1993.893) (-1992.017) * (-2005.151) (-1991.133) [-1986.793] (-1996.635) -- 0:03:51
275300 -- [-1987.486] (-1998.071) (-2010.123) (-1990.700) * (-2007.405) [-1992.146] (-1984.971) (-1993.446) -- 0:03:51
275400 -- [-1987.649] (-1995.604) (-2003.363) (-1991.017) * (-2014.046) (-1990.868) [-1981.116] (-1990.609) -- 0:03:51
275500 -- [-1991.596] (-1989.046) (-2002.392) (-1992.530) * (-2000.223) (-1990.347) [-1985.604] (-1985.345) -- 0:03:51
275600 -- [-1990.746] (-1993.062) (-2005.117) (-1994.841) * (-1988.377) (-1989.014) [-1984.129] (-1990.527) -- 0:03:51
275700 -- (-1986.544) [-1991.158] (-2014.669) (-1993.834) * (-1993.211) (-1992.946) (-1987.615) [-1985.454] -- 0:03:51
275800 -- (-1989.151) [-1987.695] (-2004.759) (-1995.242) * (-1991.374) (-1986.740) (-1987.617) [-1980.902] -- 0:03:51
275900 -- (-1989.265) [-1988.231] (-1993.175) (-1994.612) * (-1992.583) (-1990.156) (-1997.290) [-1981.501] -- 0:03:50
276000 -- [-1989.335] (-2005.294) (-1987.429) (-1996.707) * (-2000.978) (-1993.176) [-1990.314] (-1981.156) -- 0:03:50
Average standard deviation of split frequencies: 0.006146
276100 -- [-1986.715] (-2001.627) (-1997.420) (-1990.125) * (-2003.920) (-1989.594) (-1989.358) [-1983.015] -- 0:03:50
276200 -- (-1990.757) (-2005.396) [-1989.544] (-1989.962) * (-1994.458) (-1988.752) (-1986.838) [-1979.149] -- 0:03:50
276300 -- [-1987.219] (-1995.424) (-1993.300) (-1989.809) * (-1999.955) (-1991.283) (-1985.728) [-1980.888] -- 0:03:50
276400 -- (-1984.699) (-1991.433) (-1991.641) [-1985.090] * (-2005.037) (-1997.517) (-1986.761) [-1980.327] -- 0:03:50
276500 -- (-1987.349) (-1990.101) (-1985.121) [-1988.430] * (-1997.955) (-1989.069) (-1988.455) [-1981.652] -- 0:03:50
276600 -- (-1990.475) (-2006.812) [-1987.960] (-1991.968) * (-2002.341) (-1986.110) (-1999.820) [-1980.722] -- 0:03:52
276700 -- [-1985.089] (-2000.961) (-1988.579) (-1995.631) * (-1996.796) (-1989.081) (-1996.221) [-1979.111] -- 0:03:52
276800 -- (-1982.772) (-1998.168) [-1991.707] (-1990.293) * (-2000.017) (-1986.628) (-2000.469) [-1982.532] -- 0:03:52
276900 -- (-1985.118) (-1991.248) (-1998.188) [-1986.134] * (-1988.750) (-1986.221) (-1996.258) [-1985.201] -- 0:03:52
277000 -- (-1985.553) [-1995.966] (-1996.544) (-1992.242) * (-1994.408) (-1994.487) (-2001.514) [-1976.783] -- 0:03:52
Average standard deviation of split frequencies: 0.005831
277100 -- (-1982.790) (-1992.561) (-2000.638) [-1987.985] * (-2002.771) (-1997.479) (-1999.005) [-1983.743] -- 0:03:52
277200 -- (-1988.091) (-1989.318) [-1997.359] (-1989.897) * (-1994.877) (-1996.332) (-1996.026) [-1979.409] -- 0:03:52
277300 -- (-1989.493) [-1991.157] (-2003.254) (-1989.739) * (-2003.925) (-1997.466) (-1997.034) [-1983.530] -- 0:03:51
277400 -- [-1985.241] (-1992.706) (-1993.499) (-1994.323) * (-1997.111) (-1995.987) (-1996.272) [-1981.491] -- 0:03:51
277500 -- [-1984.443] (-1992.711) (-1989.893) (-1998.723) * (-1993.266) (-2006.148) (-1993.752) [-1982.576] -- 0:03:51
277600 -- [-1989.113] (-1993.396) (-1989.086) (-1999.192) * (-1988.844) (-2011.201) (-1995.714) [-1983.723] -- 0:03:51
277700 -- (-1984.307) (-1993.865) [-1988.439] (-1995.045) * [-1988.731] (-2011.877) (-1994.947) (-1987.354) -- 0:03:51
277800 -- (-1986.196) (-1993.040) [-1984.162] (-2001.103) * [-1987.654] (-2018.991) (-1991.986) (-1986.867) -- 0:03:51
277900 -- [-1986.465] (-1994.569) (-1982.420) (-2003.759) * [-1985.523] (-2016.002) (-1998.827) (-1986.877) -- 0:03:51
278000 -- (-1986.315) [-1996.622] (-1982.877) (-2002.368) * (-1990.156) (-2029.130) (-1996.013) [-1984.483] -- 0:03:51
Average standard deviation of split frequencies: 0.005811
278100 -- (-1985.177) (-1999.350) [-1982.808] (-2003.990) * (-1995.099) (-2020.373) (-2003.428) [-1978.917] -- 0:03:51
278200 -- (-1989.821) (-1989.005) [-1981.801] (-1990.666) * (-1996.515) (-2014.742) (-1996.314) [-1980.933] -- 0:03:50
278300 -- (-1994.828) (-1988.952) [-1981.457] (-1999.537) * (-1992.142) (-2004.303) (-1997.742) [-1982.833] -- 0:03:50
278400 -- [-1985.241] (-1994.014) (-1986.851) (-1995.448) * (-1993.755) (-2004.268) (-1993.579) [-1982.231] -- 0:03:50
278500 -- [-1985.033] (-1996.072) (-1993.750) (-2010.988) * (-1992.403) (-2010.630) (-1989.779) [-1985.403] -- 0:03:50
278600 -- [-1980.902] (-1988.218) (-1992.732) (-2002.365) * (-1992.053) (-2005.631) (-1986.971) [-1986.378] -- 0:03:50
278700 -- (-1982.467) [-1981.914] (-1992.127) (-1998.734) * (-1991.771) (-2003.684) (-1991.975) [-1985.481] -- 0:03:50
278800 -- [-1980.860] (-1984.341) (-1995.562) (-1996.508) * (-1993.120) (-2001.368) (-1990.933) [-1985.958] -- 0:03:50
278900 -- [-1981.045] (-1988.521) (-1996.045) (-1995.791) * [-1991.131] (-1999.623) (-1995.516) (-1985.514) -- 0:03:50
279000 -- [-1989.083] (-1989.645) (-2004.535) (-1992.868) * (-1997.024) (-1998.765) (-1994.639) [-1986.238] -- 0:03:49
Average standard deviation of split frequencies: 0.006127
279100 -- [-1981.216] (-1998.055) (-1996.767) (-1999.072) * (-1987.029) (-2012.517) (-1997.471) [-1985.146] -- 0:03:49
279200 -- (-1988.553) (-1993.348) (-1992.653) [-1996.885] * [-1989.658] (-1997.644) (-1999.778) (-1988.887) -- 0:03:49
279300 -- [-1980.643] (-1987.712) (-1995.772) (-1987.943) * (-1999.112) (-1992.981) (-1999.081) [-1986.556] -- 0:03:49
279400 -- [-1984.231] (-1991.332) (-1997.933) (-1985.945) * (-1992.254) (-1988.367) (-2002.545) [-1985.345] -- 0:03:49
279500 -- [-1984.245] (-1995.158) (-1997.702) (-1986.752) * (-1993.138) [-1988.437] (-1996.479) (-1983.793) -- 0:03:49
279600 -- (-1992.290) (-1991.629) (-1990.804) [-1985.379] * (-1996.798) (-1985.275) (-1996.440) [-1986.961] -- 0:03:49
279700 -- [-1990.746] (-1996.876) (-1991.780) (-1993.705) * (-1990.833) [-1982.991] (-1993.777) (-1983.409) -- 0:03:51
279800 -- [-1988.954] (-1993.680) (-1993.985) (-1992.391) * (-1991.372) (-1987.776) (-2001.412) [-1979.742] -- 0:03:51
279900 -- (-1989.079) [-1987.161] (-1993.066) (-1993.606) * (-1992.266) (-1993.434) (-1997.156) [-1980.888] -- 0:03:51
280000 -- (-1996.450) [-1986.831] (-1994.866) (-1995.605) * [-1987.475] (-1994.293) (-1994.081) (-1990.711) -- 0:03:51
Average standard deviation of split frequencies: 0.006250
280100 -- (-1992.084) (-1986.494) (-1991.921) [-1991.031] * [-1982.651] (-1989.973) (-1999.874) (-1991.569) -- 0:03:51
280200 -- [-1991.446] (-1993.881) (-2000.173) (-1988.939) * (-1994.946) [-1984.964] (-1995.166) (-1990.323) -- 0:03:51
280300 -- [-1988.148] (-1987.534) (-2005.857) (-1982.889) * (-1993.212) (-1985.476) (-2004.335) [-1986.107] -- 0:03:51
280400 -- [-1987.500] (-1992.823) (-2003.715) (-1985.214) * (-1995.892) [-1982.672] (-1999.140) (-1989.147) -- 0:03:50
280500 -- [-1982.495] (-1997.165) (-2007.638) (-1983.910) * (-1997.022) [-1982.466] (-2008.862) (-1984.157) -- 0:03:50
280600 -- [-1980.248] (-1989.312) (-1999.097) (-1994.006) * (-2002.214) [-1986.416] (-2004.763) (-1981.856) -- 0:03:50
280700 -- [-1979.201] (-1990.825) (-1993.689) (-1995.927) * (-1993.529) (-1984.578) (-2001.888) [-1980.496] -- 0:03:50
280800 -- [-1979.889] (-1994.341) (-1995.670) (-1997.384) * (-1994.083) [-1982.516] (-1995.404) (-1983.440) -- 0:03:50
280900 -- [-1985.738] (-1993.202) (-1995.854) (-2001.040) * (-1986.054) (-1985.978) (-1994.845) [-1982.721] -- 0:03:50
281000 -- (-1983.949) (-2003.247) [-1989.639] (-2001.591) * (-1986.660) (-1989.852) (-1994.926) [-1983.767] -- 0:03:50
Average standard deviation of split frequencies: 0.006083
281100 -- [-1986.934] (-2000.434) (-1995.600) (-2001.998) * (-1985.389) (-1994.888) (-1994.487) [-1985.870] -- 0:03:50
281200 -- [-1983.238] (-2005.711) (-2000.383) (-2001.406) * (-1988.583) (-1993.792) (-1995.249) [-1984.035] -- 0:03:50
281300 -- [-1981.086] (-2003.522) (-2001.167) (-2004.446) * (-1990.704) [-1987.918] (-1995.577) (-1983.967) -- 0:03:49
281400 -- [-1978.371] (-1992.223) (-1992.238) (-2006.947) * [-1990.415] (-1988.923) (-2003.174) (-1985.168) -- 0:03:49
281500 -- [-1982.003] (-1992.080) (-1995.090) (-1997.952) * (-1991.780) (-1986.876) (-1994.362) [-1985.413] -- 0:03:49
281600 -- [-1984.449] (-1988.813) (-1989.223) (-2003.960) * (-1999.465) (-1991.065) (-1992.265) [-1982.762] -- 0:03:49
281700 -- (-1985.748) [-1988.324] (-1994.620) (-1992.030) * (-1992.999) [-1981.522] (-1994.668) (-1980.631) -- 0:03:49
281800 -- [-1983.057] (-1994.399) (-1990.658) (-1994.571) * (-1999.601) (-1983.480) (-1996.233) [-1981.379] -- 0:03:49
281900 -- [-1978.935] (-1985.964) (-2001.730) (-1995.720) * (-1993.490) (-1987.038) (-1993.090) [-1980.713] -- 0:03:49
282000 -- [-1977.102] (-1993.907) (-2003.447) (-1993.548) * (-1993.372) [-1984.079] (-1992.244) (-1984.932) -- 0:03:49
Average standard deviation of split frequencies: 0.006063
282100 -- [-1982.846] (-2000.887) (-2002.080) (-1993.265) * (-1999.504) [-1979.607] (-1995.350) (-1985.359) -- 0:03:49
282200 -- [-1984.174] (-1998.898) (-1991.886) (-1993.290) * (-1995.804) [-1975.696] (-1998.947) (-1988.212) -- 0:03:48
282300 -- [-1985.005] (-1999.710) (-1991.669) (-1995.192) * [-1989.184] (-1980.802) (-2017.046) (-1994.832) -- 0:03:48
282400 -- [-1984.963] (-1996.908) (-1998.846) (-1995.331) * (-1992.249) (-1981.700) (-2005.725) [-1993.100] -- 0:03:48
282500 -- (-1995.940) (-1993.400) (-2005.106) [-1992.824] * [-1985.355] (-1976.177) (-2001.626) (-1986.313) -- 0:03:48
282600 -- (-1988.748) (-1987.579) (-2016.046) [-1989.309] * (-1997.975) [-1983.057] (-1988.664) (-1986.988) -- 0:03:48
282700 -- (-1992.065) (-1985.487) (-2008.094) [-1988.053] * (-1994.900) [-1997.329] (-1994.501) (-1992.573) -- 0:03:48
282800 -- (-1990.932) [-1988.232] (-2002.611) (-1988.580) * (-2012.896) (-1992.883) [-1988.583] (-1992.170) -- 0:03:50
282900 -- (-1991.506) [-1987.398] (-2002.503) (-1987.812) * (-2008.877) [-1992.446] (-1985.476) (-1982.933) -- 0:03:50
283000 -- [-1984.528] (-1983.955) (-1995.775) (-1986.181) * (-1999.344) (-2000.602) (-1984.464) [-1986.711] -- 0:03:50
Average standard deviation of split frequencies: 0.005660
283100 -- (-1996.836) (-1985.093) (-1994.258) [-1983.943] * (-1997.648) (-1997.396) (-1985.229) [-1981.922] -- 0:03:50
283200 -- (-1991.423) (-1986.518) (-1995.441) [-1992.422] * (-1998.306) (-1994.509) (-1994.263) [-1982.032] -- 0:03:50
283300 -- (-1988.980) [-1989.671] (-2007.675) (-1994.849) * (-1997.922) (-1991.836) (-1985.626) [-1982.832] -- 0:03:50
283400 -- [-1989.181] (-1988.354) (-1999.261) (-1995.571) * (-2005.991) (-1993.478) (-1991.236) [-1984.760] -- 0:03:50
283500 -- [-1987.279] (-1992.388) (-1989.453) (-1990.894) * (-2002.943) (-1992.391) (-1989.557) [-1982.597] -- 0:03:49
283600 -- (-1982.037) (-1992.484) (-1988.808) [-1991.877] * (-1998.756) (-1993.022) (-1988.852) [-1986.612] -- 0:03:49
283700 -- (-1986.335) (-1992.399) [-1991.563] (-1992.883) * (-1998.835) (-1997.228) (-1995.905) [-1984.833] -- 0:03:49
283800 -- [-1986.601] (-1990.378) (-1993.784) (-1988.976) * (-1994.723) [-1995.234] (-1990.158) (-1991.327) -- 0:03:49
283900 -- (-1985.523) [-1987.824] (-1997.012) (-1990.240) * (-1992.346) [-1993.339] (-1992.225) (-1989.429) -- 0:03:49
284000 -- (-1991.288) (-1991.329) [-1990.035] (-1994.023) * [-1990.700] (-1994.479) (-1990.147) (-1983.478) -- 0:03:49
Average standard deviation of split frequencies: 0.005404
284100 -- (-1991.334) [-1990.488] (-1990.095) (-1991.553) * (-1991.462) (-1988.196) (-1990.514) [-1980.778] -- 0:03:49
284200 -- (-1993.100) (-1987.597) [-1993.116] (-1996.126) * (-1996.330) (-1994.495) (-1984.282) [-1983.998] -- 0:03:49
284300 -- (-1997.295) [-1991.795] (-1988.786) (-2003.865) * (-2001.996) (-1997.178) (-1995.630) [-1982.792] -- 0:03:49
284400 -- (-1992.818) (-1997.370) [-1991.409] (-2007.670) * (-2000.633) [-1988.365] (-1992.618) (-1982.981) -- 0:03:48
284500 -- (-1997.903) [-1987.267] (-1994.006) (-2004.724) * (-2001.344) (-1986.208) (-1994.412) [-1984.525] -- 0:03:48
284600 -- [-1989.786] (-1994.103) (-1996.976) (-2001.012) * (-1999.026) (-1992.922) (-1994.932) [-1981.867] -- 0:03:48
284700 -- (-1987.751) (-1989.870) (-2006.994) [-2001.427] * (-2004.389) (-1990.078) (-1993.107) [-1981.635] -- 0:03:48
284800 -- (-1988.355) [-1996.455] (-1995.595) (-2006.924) * (-2001.086) (-1990.561) (-1988.880) [-1983.015] -- 0:03:48
284900 -- (-1986.711) [-1993.445] (-1997.824) (-2000.593) * (-1998.911) (-1993.903) (-1985.026) [-1984.541] -- 0:03:48
285000 -- (-1988.179) [-1986.989] (-2003.219) (-2000.135) * (-2001.064) (-1991.336) [-1983.531] (-1986.927) -- 0:03:48
Average standard deviation of split frequencies: 0.005431
285100 -- (-1991.749) [-1987.476] (-1990.954) (-2002.358) * (-1996.633) (-1987.028) (-1988.099) [-1982.643] -- 0:03:48
285200 -- (-1990.625) [-1985.276] (-1986.947) (-2007.853) * (-1993.918) [-1989.446] (-1990.902) (-1983.386) -- 0:03:48
285300 -- (-1985.377) [-1988.124] (-1985.659) (-2006.816) * (-1994.383) [-1984.812] (-1990.852) (-1987.482) -- 0:03:47
285400 -- [-1984.417] (-1991.314) (-1985.681) (-2001.057) * (-1993.652) [-1983.165] (-1988.161) (-1981.525) -- 0:03:47
285500 -- (-1985.815) (-1983.334) [-1988.022] (-1996.102) * (-1996.725) (-1982.587) (-1987.427) [-1980.932] -- 0:03:47
285600 -- [-1980.004] (-1992.002) (-1987.011) (-1999.245) * (-1997.270) (-1980.886) (-1993.324) [-1983.862] -- 0:03:47
285700 -- [-1977.103] (-1997.957) (-1990.806) (-1991.819) * (-2000.883) (-1988.484) (-1989.811) [-1981.578] -- 0:03:47
285800 -- [-1977.721] (-1990.171) (-1988.775) (-1995.277) * (-1999.488) [-1981.770] (-1992.420) (-1984.494) -- 0:03:47
285900 -- [-1977.866] (-1992.412) (-1990.399) (-1995.272) * (-1996.228) [-1985.704] (-1995.968) (-1981.889) -- 0:03:49
286000 -- [-1982.584] (-1997.489) (-1985.989) (-1992.051) * (-1997.452) (-1986.496) (-1991.601) [-1987.268] -- 0:03:49
Average standard deviation of split frequencies: 0.005413
286100 -- [-1979.246] (-1989.055) (-1992.638) (-1988.510) * (-1995.689) (-1990.647) (-1990.149) [-1980.857] -- 0:03:49
286200 -- (-1982.190) (-1989.325) (-1988.346) [-1989.655] * (-1995.194) [-1982.952] (-2000.322) (-1986.308) -- 0:03:49
286300 -- (-1988.519) (-1986.001) [-1988.673] (-1990.439) * (-1993.528) (-1983.551) (-1997.334) [-1992.745] -- 0:03:49
286400 -- [-1983.701] (-1989.228) (-1990.385) (-1984.535) * (-1991.863) (-1990.099) (-1995.442) [-1994.997] -- 0:03:49
286500 -- (-1986.958) (-1989.772) (-1990.968) [-1984.612] * (-1997.391) (-1987.241) (-1998.756) [-1989.136] -- 0:03:49
286600 -- (-1992.463) (-1986.872) (-1990.852) [-1986.475] * (-1988.862) (-1993.806) (-1999.525) [-1990.744] -- 0:03:49
286700 -- [-1990.718] (-1988.296) (-1997.653) (-1997.372) * (-1998.057) (-1985.208) (-1996.100) [-1988.021] -- 0:03:48
286800 -- (-1992.371) (-1990.579) (-1999.614) [-1988.965] * (-1996.514) (-1986.766) (-2002.204) [-1981.677] -- 0:03:48
286900 -- (-1990.726) (-1992.897) (-1995.509) [-1985.408] * (-1999.456) (-1990.410) (-1999.057) [-1986.097] -- 0:03:48
287000 -- (-1986.016) (-1994.770) (-2000.541) [-1986.665] * (-1991.733) (-1993.361) (-2001.427) [-1980.488] -- 0:03:48
Average standard deviation of split frequencies: 0.005534
287100 -- [-1988.957] (-1996.954) (-2000.393) (-1991.027) * (-1992.015) (-1992.656) (-2005.617) [-1981.456] -- 0:03:48
287200 -- (-1995.512) (-1998.111) [-1993.435] (-1989.231) * (-1989.477) (-1984.639) (-2008.722) [-1982.070] -- 0:03:48
287300 -- (-1993.104) (-2002.427) (-1999.513) [-1991.821] * (-1986.572) (-1994.422) (-2009.867) [-1979.468] -- 0:03:48
287400 -- (-1989.966) (-1994.688) (-2000.116) [-1991.734] * (-1990.742) [-1986.685] (-2006.555) (-1981.631) -- 0:03:48
287500 -- [-1991.226] (-1993.192) (-1999.908) (-2005.214) * (-1989.911) (-1987.430) (-2001.493) [-1986.071] -- 0:03:48
287600 -- [-1995.210] (-1997.185) (-1992.884) (-2009.113) * [-1987.425] (-1987.661) (-2003.748) (-1981.383) -- 0:03:47
287700 -- [-1995.073] (-1990.810) (-1990.342) (-2003.796) * (-1984.340) (-2001.236) (-2002.414) [-1981.620] -- 0:03:47
287800 -- [-1997.985] (-2001.171) (-1996.964) (-2007.175) * (-1986.280) (-1998.670) (-2006.713) [-1978.037] -- 0:03:47
287900 -- [-1987.646] (-2001.421) (-1991.849) (-1999.460) * (-1984.905) (-2000.208) (-2004.088) [-1980.411] -- 0:03:47
288000 -- [-1988.639] (-2009.430) (-1990.609) (-1994.646) * (-1992.195) [-1986.964] (-1997.588) (-1982.830) -- 0:03:47
Average standard deviation of split frequencies: 0.005376
288100 -- [-1984.926] (-2001.556) (-1991.672) (-1997.194) * (-1993.198) (-1992.511) (-1993.132) [-1981.631] -- 0:03:47
288200 -- (-1991.393) (-1990.437) [-1992.807] (-1998.820) * (-2001.118) [-1987.184] (-1991.562) (-1984.030) -- 0:03:47
288300 -- (-1988.473) [-1991.112] (-1991.995) (-1996.941) * (-2003.955) (-2002.216) (-1997.283) [-1982.716] -- 0:03:47
288400 -- (-1998.613) (-1989.345) (-1990.452) [-1988.810] * [-1983.438] (-1997.443) (-1994.452) (-1986.261) -- 0:03:47
288500 -- (-2003.069) (-1992.893) [-1987.189] (-1988.995) * (-1991.370) (-1999.230) (-1996.258) [-1985.014] -- 0:03:46
288600 -- [-2000.396] (-1992.337) (-1988.512) (-1987.849) * (-1992.145) (-1999.487) (-1996.540) [-1979.240] -- 0:03:46
288700 -- (-1999.276) (-1990.411) (-1997.212) [-1987.085] * (-1996.510) (-1989.083) [-1990.847] (-1981.237) -- 0:03:46
288800 -- (-1987.432) [-1986.637] (-1992.862) (-1987.383) * (-1997.185) (-1996.847) (-1995.878) [-1977.945] -- 0:03:46
288900 -- [-1988.989] (-1985.107) (-1996.085) (-1993.956) * (-1998.035) (-1990.972) (-1996.923) [-1980.249] -- 0:03:46
289000 -- (-1988.236) (-1990.565) (-2001.949) [-1983.427] * (-1996.276) (-1983.917) (-1995.889) [-1981.413] -- 0:03:48
Average standard deviation of split frequencies: 0.005216
289100 -- (-1988.676) (-1995.714) (-1994.796) [-1983.742] * (-2000.194) [-1983.537] (-1997.447) (-1982.055) -- 0:03:48
289200 -- (-1990.459) (-1988.981) (-1999.162) [-1981.774] * (-2006.226) (-1983.200) (-1997.824) [-1979.595] -- 0:03:48
289300 -- (-1990.137) (-1989.360) (-1995.305) [-1981.953] * (-2009.862) [-1977.803] (-2000.839) (-1981.877) -- 0:03:48
289400 -- (-1986.914) (-1992.018) (-1988.524) [-1983.520] * (-1995.123) (-1985.930) (-1997.426) [-1982.870] -- 0:03:48
289500 -- (-1989.667) (-1988.908) [-1988.833] (-1985.847) * (-1992.383) (-1979.178) (-1988.876) [-1983.004] -- 0:03:48
289600 -- (-1993.139) (-1991.270) (-1997.649) [-1983.510] * [-1990.134] (-1985.061) (-2002.590) (-1986.336) -- 0:03:48
289700 -- (-1992.072) (-1996.088) (-1995.013) [-1990.535] * (-1998.209) (-1987.589) (-1995.555) [-1986.557] -- 0:03:48
289800 -- (-1996.023) (-1998.373) (-2003.997) [-1985.664] * (-1998.690) (-1988.035) (-2008.643) [-1979.777] -- 0:03:47
289900 -- (-1992.622) (-2001.323) (-1997.148) [-1984.176] * (-1995.763) (-1985.821) (-1999.954) [-1978.350] -- 0:03:47
290000 -- (-1995.822) (-1991.060) (-2001.616) [-1987.076] * (-1996.567) (-1983.797) (-2002.675) [-1981.581] -- 0:03:47
Average standard deviation of split frequencies: 0.005246
290100 -- (-2008.017) (-1992.712) (-1987.340) [-1981.446] * (-1991.808) (-1981.377) (-2002.604) [-1979.160] -- 0:03:47
290200 -- (-2004.258) (-1994.882) (-1985.718) [-1992.475] * (-1996.850) [-1981.724] (-1997.109) (-1989.788) -- 0:03:47
290300 -- (-1995.768) (-1988.417) [-1988.741] (-2004.086) * (-2008.338) [-1982.490] (-2000.401) (-1985.800) -- 0:03:47
290400 -- [-1992.161] (-1991.065) (-1986.546) (-1998.993) * (-1998.647) (-1983.309) (-1996.264) [-1983.697] -- 0:03:47
290500 -- [-1993.651] (-1987.792) (-1986.205) (-1996.657) * (-1992.676) [-1988.959] (-1989.652) (-1983.991) -- 0:03:47
290600 -- (-2003.418) (-1995.477) [-1982.124] (-1989.921) * (-2005.130) (-1994.508) (-1985.888) [-1979.769] -- 0:03:47
290700 -- (-1998.767) (-1986.792) [-1986.367] (-1996.494) * (-2001.142) (-1996.540) (-1990.967) [-1979.918] -- 0:03:46
290800 -- (-1999.071) [-1984.411] (-1984.147) (-2004.255) * (-2001.685) (-1988.377) (-1995.784) [-1980.527] -- 0:03:46
290900 -- (-1993.864) [-1990.612] (-1987.773) (-1992.084) * [-1995.813] (-1990.456) (-1996.083) (-1980.344) -- 0:03:46
291000 -- [-1990.980] (-1998.259) (-1991.302) (-1994.498) * (-1995.151) (-1990.230) (-1986.871) [-1984.597] -- 0:03:46
Average standard deviation of split frequencies: 0.005042
291100 -- (-1990.875) (-2006.000) (-2001.674) [-1990.235] * (-1996.161) (-1992.393) [-1986.408] (-1989.670) -- 0:03:46
291200 -- (-1999.686) (-1991.793) [-1998.757] (-1988.339) * (-1998.981) [-1993.315] (-1995.120) (-1999.069) -- 0:03:46
291300 -- (-1997.839) (-1989.620) [-1989.136] (-1985.012) * [-1999.844] (-1988.358) (-1992.001) (-1990.056) -- 0:03:46
291400 -- (-1998.303) (-1996.263) [-1984.968] (-1979.425) * (-1996.242) (-1991.525) [-1991.669] (-1994.610) -- 0:03:46
291500 -- (-1992.355) (-1997.548) (-1984.028) [-1996.029] * [-1995.625] (-1991.224) (-2003.277) (-1995.813) -- 0:03:46
291600 -- (-2002.363) (-1994.044) (-1984.599) [-1987.791] * (-1997.445) [-1987.882] (-1995.923) (-1990.283) -- 0:03:45
291700 -- (-2002.518) [-1990.391] (-1986.488) (-1991.197) * (-1990.395) (-1989.074) (-1990.930) [-1981.623] -- 0:03:45
291800 -- (-1999.811) (-1989.248) [-1986.493] (-1988.635) * (-1996.733) (-1988.580) (-1995.551) [-1983.034] -- 0:03:45
291900 -- [-2003.457] (-1987.106) (-1996.362) (-1990.751) * (-1999.185) (-1986.738) (-2007.206) [-1987.712] -- 0:03:45
292000 -- (-2003.640) [-1990.731] (-2003.702) (-1997.897) * (-1995.677) [-1985.516] (-1991.441) (-1982.912) -- 0:03:45
Average standard deviation of split frequencies: 0.005072
292100 -- (-1990.834) [-1989.786] (-2004.034) (-2000.465) * (-1994.999) (-1982.997) (-1993.008) [-1980.630] -- 0:03:47
292200 -- (-1999.013) (-1992.479) (-2003.388) [-1997.643] * (-1999.881) (-1983.062) (-1997.778) [-1986.112] -- 0:03:47
292300 -- [-1988.608] (-1997.005) (-2003.986) (-1995.030) * (-1998.234) [-1981.061] (-1993.302) (-1992.648) -- 0:03:47
292400 -- [-1988.395] (-2000.055) (-1999.093) (-1993.709) * (-1993.787) [-1981.436] (-1998.676) (-1988.260) -- 0:03:47
292500 -- [-1989.973] (-1998.846) (-1997.605) (-1997.520) * (-1995.849) [-1988.408] (-1997.289) (-1985.556) -- 0:03:47
292600 -- [-1985.701] (-1995.146) (-1997.578) (-1990.060) * (-1992.844) (-1988.482) (-1996.850) [-1981.698] -- 0:03:47
292700 -- [-1986.179] (-1999.578) (-1998.796) (-2003.025) * (-1997.552) (-1984.111) (-1999.827) [-1987.018] -- 0:03:47
292800 -- (-1985.759) (-1990.728) [-1994.251] (-2009.187) * (-1993.065) (-1986.723) (-1998.523) [-1984.506] -- 0:03:47
292900 -- [-1991.238] (-1989.850) (-1989.811) (-2006.009) * (-1996.835) (-1987.451) (-1995.649) [-1988.369] -- 0:03:46
293000 -- (-1993.831) (-1993.117) (-1994.725) [-1994.310] * (-1987.144) (-1989.727) (-1991.789) [-1988.057] -- 0:03:46
Average standard deviation of split frequencies: 0.004869
293100 -- (-1988.329) (-1998.908) (-1991.069) [-1983.386] * [-1983.997] (-2000.594) (-1991.949) (-1982.457) -- 0:03:46
293200 -- (-1993.661) (-2007.139) [-1990.068] (-1985.461) * [-1983.743] (-1998.935) (-1991.905) (-1986.266) -- 0:03:46
293300 -- [-1988.144] (-2001.768) (-1994.768) (-1991.573) * [-1989.177] (-2000.182) (-1993.908) (-1988.630) -- 0:03:46
293400 -- [-1989.219] (-1994.142) (-1994.652) (-1996.141) * (-1989.980) (-2000.107) (-2005.683) [-1985.230] -- 0:03:46
293500 -- (-1998.115) [-1987.059] (-2001.265) (-1990.129) * (-1994.770) [-1988.427] (-1994.521) (-1990.861) -- 0:03:46
293600 -- (-1992.841) (-1991.986) (-1995.488) [-1984.363] * (-1998.974) [-1990.110] (-2002.859) (-1987.487) -- 0:03:46
293700 -- (-2003.531) [-1988.655] (-1991.010) (-1989.495) * (-1993.863) (-1988.690) (-1999.696) [-1987.164] -- 0:03:46
293800 -- (-1997.929) (-1995.879) (-1987.925) [-1989.367] * (-1995.331) (-1988.929) (-1995.937) [-1985.156] -- 0:03:45
293900 -- [-1992.134] (-1992.747) (-1988.025) (-1994.150) * [-1984.983] (-1992.887) (-1995.327) (-1984.408) -- 0:03:45
294000 -- (-2001.505) [-1988.549] (-1988.847) (-1998.275) * (-1990.280) (-1987.440) [-1989.917] (-1983.899) -- 0:03:45
Average standard deviation of split frequencies: 0.004625
294100 -- (-2002.923) (-1996.449) [-1985.994] (-1993.040) * (-1992.530) [-1990.679] (-1988.270) (-1983.215) -- 0:03:45
294200 -- (-2001.619) (-1996.022) (-1986.552) [-1987.504] * (-1989.464) (-1995.583) (-1989.136) [-1982.759] -- 0:03:45
294300 -- (-1996.372) (-1994.364) [-1985.373] (-1993.133) * [-1989.672] (-2006.211) (-1996.841) (-1983.909) -- 0:03:45
294400 -- (-1995.019) (-1989.722) [-1988.028] (-1998.027) * (-1991.675) (-2002.130) (-1986.978) [-1986.874] -- 0:03:45
294500 -- (-1994.476) (-1992.485) [-1990.465] (-1996.490) * (-1987.247) (-1998.591) (-1991.766) [-1991.263] -- 0:03:45
294600 -- (-1992.784) (-1994.415) (-1988.863) [-1985.118] * [-1986.854] (-2004.483) (-2000.091) (-1993.628) -- 0:03:45
294700 -- (-1992.546) (-1996.310) (-1989.230) [-1982.183] * [-1988.043] (-2001.288) (-1999.348) (-2002.999) -- 0:03:44
294800 -- (-1992.186) (-1993.852) (-1983.835) [-1984.681] * [-1989.557] (-1995.168) (-1994.883) (-1995.694) -- 0:03:44
294900 -- (-1997.661) (-1996.281) (-1988.873) [-1983.593] * (-1985.080) [-1993.376] (-1989.498) (-1992.791) -- 0:03:44
295000 -- (-1998.025) (-1996.666) (-1987.751) [-1982.863] * [-1984.606] (-1987.935) (-1990.899) (-1993.752) -- 0:03:44
Average standard deviation of split frequencies: 0.004791
295100 -- (-2009.491) (-1990.915) (-1993.073) [-1988.558] * (-1988.111) (-1987.908) (-2001.761) [-1990.067] -- 0:03:44
295200 -- (-2004.731) (-1986.650) [-1991.407] (-1991.741) * (-1985.168) (-1991.528) (-1990.277) [-1986.965] -- 0:03:46
295300 -- (-2007.439) [-1994.571] (-1992.077) (-1997.138) * (-1987.352) [-1990.359] (-1989.835) (-1992.764) -- 0:03:46
295400 -- (-2020.432) [-1987.806] (-1991.375) (-1987.032) * (-1994.999) [-1985.943] (-1997.997) (-1995.411) -- 0:03:46
295500 -- (-2012.794) (-1989.792) (-1993.714) [-1985.839] * (-1991.112) (-1993.002) (-1997.105) [-1988.405] -- 0:03:46
295600 -- (-2009.313) [-1987.477] (-1992.484) (-1982.666) * (-1991.626) [-1987.953] (-1994.190) (-1993.167) -- 0:03:46
295700 -- (-2002.876) [-1989.688] (-1987.567) (-1985.117) * (-1997.067) (-1993.322) [-1990.974] (-1998.579) -- 0:03:46
295800 -- (-1993.488) (-1992.522) [-1986.738] (-1988.710) * (-1997.116) (-1990.799) [-1985.365] (-1995.651) -- 0:03:46
295900 -- (-1999.501) (-1996.975) (-1988.986) [-1984.525] * (-1993.792) (-1993.829) [-1982.291] (-1993.432) -- 0:03:46
296000 -- [-1990.917] (-1996.380) (-1991.352) (-1984.359) * (-1997.821) (-1996.751) [-1982.532] (-1990.454) -- 0:03:45
Average standard deviation of split frequencies: 0.004958
296100 -- (-1994.553) (-1987.402) (-1992.864) [-1983.252] * (-1993.134) (-1995.859) [-1982.980] (-1990.082) -- 0:03:45
296200 -- (-1989.755) [-1988.213] (-1990.141) (-1982.422) * (-1988.097) (-1995.879) [-1982.821] (-2001.328) -- 0:03:45
296300 -- (-1992.731) (-1990.112) [-1991.039] (-1982.439) * (-1988.032) (-1998.894) [-1989.914] (-1991.717) -- 0:03:45
296400 -- [-1994.785] (-1989.135) (-1990.463) (-1986.568) * (-1982.687) [-1986.700] (-1986.325) (-2006.943) -- 0:03:45
296500 -- (-1991.021) [-1988.109] (-1992.112) (-1987.222) * [-1984.994] (-1986.996) (-1988.275) (-1999.016) -- 0:03:45
296600 -- (-1987.549) (-1995.109) [-1992.411] (-1989.333) * [-1979.732] (-1995.577) (-1993.265) (-1993.491) -- 0:03:45
296700 -- [-1991.181] (-2002.007) (-1995.361) (-1991.254) * [-1983.177] (-1995.566) (-1993.434) (-1994.791) -- 0:03:45
296800 -- (-1994.143) (-2001.558) [-1987.985] (-1990.401) * (-1985.017) (-1994.654) (-2003.160) [-1990.095] -- 0:03:45
296900 -- (-1989.306) (-1998.701) [-1992.776] (-1991.560) * (-1985.599) (-1993.754) [-1992.988] (-1991.430) -- 0:03:44
297000 -- [-1993.641] (-2004.338) (-1992.267) (-1987.454) * (-1983.933) (-1993.308) [-1986.933] (-1991.866) -- 0:03:44
Average standard deviation of split frequencies: 0.005121
297100 -- [-2002.126] (-2001.181) (-1995.899) (-1987.342) * (-1989.871) (-1994.884) (-1987.899) [-1987.712] -- 0:03:44
297200 -- (-2000.374) [-1995.056] (-1996.765) (-1992.333) * (-1988.999) (-1995.081) [-1986.316] (-1989.262) -- 0:03:44
297300 -- (-1994.926) (-1996.803) [-1994.515] (-1984.678) * (-1993.734) (-1991.600) [-1989.133] (-1989.889) -- 0:03:44
297400 -- (-1994.524) [-1993.230] (-1993.574) (-1990.359) * (-2001.122) (-1995.595) [-1988.510] (-1996.135) -- 0:03:44
297500 -- (-1998.289) (-2000.912) (-1987.320) [-1989.856] * (-1996.887) (-1997.739) [-1980.933] (-1989.807) -- 0:03:44
297600 -- (-2003.954) (-1987.888) [-1991.640] (-1990.939) * (-1995.716) (-1999.551) [-1980.100] (-1998.644) -- 0:03:44
297700 -- (-1999.072) (-1987.869) [-1991.745] (-1993.612) * (-1997.291) (-1999.761) [-1981.262] (-2004.178) -- 0:03:44
297800 -- (-1999.790) [-1984.008] (-1990.578) (-1995.694) * (-1996.601) (-2000.152) [-1985.927] (-1997.370) -- 0:03:44
297900 -- (-2001.972) [-1984.433] (-1998.489) (-1991.074) * (-1992.137) (-1996.367) [-1980.355] (-2011.981) -- 0:03:43
298000 -- (-2005.422) [-1985.601] (-1995.556) (-1989.122) * (-1991.150) (-1996.319) [-1979.848] (-1997.867) -- 0:03:43
Average standard deviation of split frequencies: 0.005286
298100 -- (-2004.949) (-1996.122) [-1987.152] (-1994.430) * (-1991.496) (-1990.242) [-1984.152] (-1999.097) -- 0:03:43
298200 -- (-2002.151) (-1998.332) [-1986.160] (-1992.720) * (-1990.679) (-1995.502) [-1981.782] (-1997.025) -- 0:03:43
298300 -- [-1984.813] (-1996.561) (-1988.585) (-1995.525) * (-1994.716) (-2000.963) [-1984.567] (-1996.857) -- 0:03:45
298400 -- (-1988.371) (-1997.267) (-1985.726) [-1989.580] * (-1993.644) (-1992.394) [-1989.518] (-1995.859) -- 0:03:45
298500 -- (-1992.104) (-1990.142) [-1985.984] (-1998.911) * (-1990.535) (-1988.174) [-1985.426] (-1995.207) -- 0:03:45
298600 -- [-1989.520] (-1992.559) (-1986.775) (-2002.362) * (-1987.199) (-1995.559) [-1982.045] (-1990.410) -- 0:03:45
298700 -- [-1985.146] (-1996.359) (-1993.232) (-2008.445) * (-1993.864) (-2008.092) [-1977.503] (-1989.783) -- 0:03:45
298800 -- [-1991.948] (-1998.708) (-1991.428) (-2001.651) * (-1988.559) (-1999.270) [-1978.441] (-1997.859) -- 0:03:45
298900 -- (-1986.920) [-1997.537] (-1995.001) (-1991.375) * (-1990.888) (-1993.306) [-1983.640] (-1999.355) -- 0:03:45
299000 -- [-1988.806] (-2002.318) (-1993.553) (-1994.310) * [-1988.389] (-1991.633) (-1981.375) (-2001.230) -- 0:03:45
Average standard deviation of split frequencies: 0.005042
299100 -- [-1988.725] (-2000.535) (-1995.459) (-1989.185) * (-1987.381) (-1995.810) [-1982.935] (-1997.419) -- 0:03:44
299200 -- (-1992.966) (-2005.643) [-1989.295] (-1989.959) * (-1993.910) (-1990.598) [-1982.046] (-1994.886) -- 0:03:44
299300 -- [-1989.780] (-2002.457) (-1990.625) (-1988.709) * (-1999.276) (-1991.847) [-1981.941] (-1998.610) -- 0:03:44
299400 -- (-1997.684) (-2004.304) (-1990.550) [-1987.705] * (-2004.818) (-1992.362) (-1991.973) [-2001.801] -- 0:03:44
299500 -- [-1987.355] (-2002.941) (-1988.768) (-1985.208) * [-1988.501] (-2002.038) (-1991.440) (-1999.397) -- 0:03:44
299600 -- (-1992.726) (-1999.538) (-1990.360) [-1985.037] * (-1996.562) (-1997.293) [-1992.041] (-1997.097) -- 0:03:44
299700 -- (-1992.150) (-1999.196) [-1985.757] (-1985.604) * (-2000.264) [-1990.605] (-1994.487) (-1998.288) -- 0:03:44
299800 -- (-1989.580) (-1996.554) (-1982.771) [-1987.360] * (-1994.015) (-1997.661) [-1987.074] (-1991.434) -- 0:03:44
299900 -- (-1992.259) (-1992.124) (-1986.358) [-1983.979] * [-1991.038] (-1998.276) (-1991.828) (-1988.888) -- 0:03:44
300000 -- (-1994.191) (-1995.572) (-1991.852) [-1989.318] * (-1992.315) (-1992.391) (-1994.781) [-1987.977] -- 0:03:44
Average standard deviation of split frequencies: 0.004712
300100 -- (-1987.963) (-1994.412) (-1991.701) [-1989.329] * (-1992.839) (-1996.443) [-1996.200] (-1986.799) -- 0:03:43
300200 -- (-1991.991) (-1998.846) (-1992.385) [-1984.053] * (-1992.045) (-1990.333) (-1995.372) [-1985.061] -- 0:03:43
300300 -- (-1999.739) (-1996.175) (-1995.260) [-1985.579] * (-1995.805) [-1988.091] (-2001.364) (-1992.805) -- 0:03:43
300400 -- (-1994.124) (-2001.044) (-1989.018) [-1986.157] * (-1993.607) [-1982.135] (-1996.790) (-1989.937) -- 0:03:43
300500 -- (-1994.191) (-1994.140) (-1998.295) [-1986.799] * (-1989.192) [-1985.170] (-1996.783) (-1984.941) -- 0:03:43
300600 -- [-1987.096] (-1992.970) (-1999.344) (-1985.882) * (-1991.508) [-1984.752] (-1998.480) (-1986.727) -- 0:03:43
300700 -- (-1987.105) (-1989.486) (-2000.856) [-1979.561] * (-1991.173) (-1988.597) (-1997.555) [-1988.569] -- 0:03:43
300800 -- [-1986.073] (-1993.498) (-2006.734) (-1981.340) * (-1990.477) (-1987.144) [-1992.588] (-1993.101) -- 0:03:43
300900 -- (-1989.852) (-1998.304) (-2025.238) [-1979.645] * (-1994.248) [-1985.340] (-1985.758) (-1995.005) -- 0:03:43
301000 -- (-1986.361) (-1993.722) (-2004.174) [-1981.461] * (-1992.367) [-1984.756] (-1990.797) (-1989.887) -- 0:03:42
Average standard deviation of split frequencies: 0.004516
301100 -- [-1989.075] (-1988.953) (-2003.135) (-1984.426) * (-1997.964) (-1986.958) [-1990.283] (-1996.719) -- 0:03:42
301200 -- [-1989.798] (-1990.320) (-2000.021) (-1990.724) * (-1988.616) [-1983.549] (-1990.274) (-1990.714) -- 0:03:42
301300 -- [-1988.879] (-1991.120) (-2005.466) (-1983.162) * (-1989.396) [-1986.025] (-1998.689) (-1987.907) -- 0:03:42
301400 -- [-1989.907] (-1992.689) (-2013.492) (-1988.071) * (-1992.305) [-1985.547] (-1991.129) (-1994.382) -- 0:03:44
301500 -- (-1999.506) (-1988.713) (-2004.745) [-1990.290] * (-1997.924) [-1987.443] (-1998.194) (-1996.474) -- 0:03:44
301600 -- (-2000.886) [-1985.867] (-1993.409) (-1995.991) * (-1995.838) (-1986.292) [-1990.749] (-1999.984) -- 0:03:44
301700 -- (-2000.848) (-1985.743) (-1994.559) [-1994.100] * (-1995.294) [-1986.588] (-1995.563) (-1996.196) -- 0:03:44
301800 -- [-1993.248] (-1990.002) (-1997.064) (-1986.286) * (-1992.030) [-1988.461] (-2005.661) (-1991.338) -- 0:03:44
301900 -- (-2001.464) (-1986.882) (-1996.594) [-1990.775] * (-1996.936) (-1990.464) (-1996.258) [-1982.376] -- 0:03:44
302000 -- (-2005.034) (-1989.188) (-2007.990) [-1990.441] * (-1990.727) (-2000.455) (-1992.008) [-1987.086] -- 0:03:44
Average standard deviation of split frequencies: 0.003968
302100 -- (-2003.533) [-1986.046] (-2002.134) (-1993.349) * [-1989.871] (-1992.098) (-2003.100) (-1982.869) -- 0:03:44
302200 -- (-1992.068) (-1991.080) [-1991.642] (-1988.457) * (-1992.131) [-1985.909] (-2004.883) (-1988.497) -- 0:03:43
302300 -- (-1985.628) (-1988.840) (-1991.556) [-1985.100] * [-1994.312] (-1990.363) (-1998.331) (-1990.007) -- 0:03:43
302400 -- [-1989.262] (-1991.437) (-1993.656) (-1998.380) * (-1989.672) (-1992.530) (-2003.480) [-1994.336] -- 0:03:43
302500 -- [-1988.530] (-1991.847) (-1994.288) (-1995.398) * (-1995.197) (-1999.072) (-2007.472) [-1988.664] -- 0:03:43
302600 -- (-1987.440) (-1993.075) (-1992.922) [-1985.589] * [-1990.234] (-2002.449) (-2007.138) (-2000.073) -- 0:03:43
302700 -- [-1994.852] (-2009.368) (-1993.024) (-1990.752) * (-1992.858) (-1998.799) (-2006.200) [-1990.465] -- 0:03:43
302800 -- (-1997.928) (-2002.115) [-1990.680] (-1994.055) * (-1999.331) (-2007.844) (-2009.451) [-1989.790] -- 0:03:43
302900 -- [-1993.121] (-1999.005) (-1995.778) (-1990.313) * (-1995.066) (-2005.272) (-2018.312) [-1989.364] -- 0:03:43
303000 -- (-2000.621) (-1991.896) (-1999.151) [-1986.260] * [-1995.232] (-1999.283) (-2017.161) (-1992.755) -- 0:03:43
Average standard deviation of split frequencies: 0.003687
303100 -- (-1996.585) (-1994.909) (-2003.697) [-1980.570] * [-1988.306] (-1996.194) (-2003.589) (-1989.289) -- 0:03:43
303200 -- [-1995.421] (-1995.581) (-2006.418) (-1983.944) * [-1995.370] (-1990.380) (-2002.299) (-1992.520) -- 0:03:42
303300 -- (-1994.765) (-1990.118) (-1998.758) [-1982.463] * (-1990.607) (-1988.241) (-1995.742) [-1992.525] -- 0:03:42
303400 -- (-1989.147) (-1991.353) [-1993.197] (-1981.862) * (-1992.499) [-1985.517] (-2001.217) (-1987.758) -- 0:03:42
303500 -- (-1991.681) (-1998.975) (-2001.386) [-1984.458] * (-1994.379) (-1989.702) (-1996.415) [-1988.812] -- 0:03:42
303600 -- (-1988.985) (-1999.089) (-1993.506) [-1978.696] * [-1985.469] (-1991.258) (-1995.381) (-1989.311) -- 0:03:42
303700 -- (-1990.517) (-2000.833) (-1990.336) [-1982.424] * (-1987.989) [-1990.858] (-1994.626) (-1995.471) -- 0:03:42
303800 -- (-1994.963) (-1997.445) [-1983.960] (-1989.854) * (-1989.359) [-1988.412] (-1991.093) (-1996.073) -- 0:03:42
303900 -- (-1991.194) (-1993.516) [-1988.837] (-1985.977) * [-1993.153] (-1986.787) (-1989.541) (-1996.680) -- 0:03:42
304000 -- (-1985.958) (-1999.685) [-1984.694] (-1983.463) * (-1991.109) [-1985.986] (-1987.433) (-1998.394) -- 0:03:42
Average standard deviation of split frequencies: 0.003587
304100 -- (-1987.895) (-1995.536) [-1985.316] (-1984.231) * (-1995.012) [-1989.112] (-1990.405) (-1994.068) -- 0:03:41
304200 -- (-1993.243) (-1999.836) (-1987.132) [-1988.158] * (-1991.735) [-1986.010] (-1994.473) (-1990.240) -- 0:03:41
304300 -- (-1999.575) (-1993.495) (-1987.243) [-1987.127] * (-1993.541) [-1985.845] (-1998.540) (-1993.893) -- 0:03:41
304400 -- (-1991.212) [-1985.485] (-1986.991) (-1986.720) * (-1990.304) [-1984.946] (-1999.829) (-1994.560) -- 0:03:41
304500 -- (-1992.612) (-1984.814) (-1991.539) [-1983.041] * (-1991.243) [-1986.394] (-1996.348) (-1986.615) -- 0:03:43
304600 -- (-1995.569) [-1982.907] (-1992.290) (-1979.848) * (-1992.184) [-1986.270] (-2006.373) (-1986.202) -- 0:03:43
304700 -- (-2001.331) (-1983.553) (-1989.756) [-1980.379] * (-1999.811) (-1992.406) (-2004.043) [-1986.259] -- 0:03:43
304800 -- (-2000.542) (-1986.153) (-2002.357) [-1982.686] * (-1995.643) [-1991.029] (-2007.002) (-1990.189) -- 0:03:43
304900 -- (-1995.217) (-1992.295) (-1996.767) [-1982.204] * (-1991.634) (-1994.534) [-1991.922] (-1989.209) -- 0:03:43
305000 -- (-1997.045) (-1991.878) [-1997.972] (-1991.082) * (-1995.136) (-1993.945) (-1998.727) [-1984.926] -- 0:03:43
Average standard deviation of split frequencies: 0.003663
305100 -- [-1995.441] (-1997.380) (-1994.710) (-1988.118) * (-1989.951) (-1992.967) (-1994.447) [-1991.116] -- 0:03:43
305200 -- (-1996.782) (-1998.319) (-1990.715) [-1981.646] * (-1990.787) (-1990.780) (-1995.394) [-1989.314] -- 0:03:43
305300 -- (-2000.564) (-1995.634) (-1998.817) [-1982.507] * (-1993.757) [-1986.574] (-2002.941) (-1988.397) -- 0:03:42
305400 -- (-1992.690) (-1987.859) (-1992.280) [-1985.230] * (-2003.344) [-1993.490] (-1999.562) (-1991.330) -- 0:03:42
305500 -- (-1993.452) (-1996.408) (-1996.018) [-1981.593] * (-1997.034) (-1994.169) (-2011.212) [-1989.715] -- 0:03:42
305600 -- (-2005.961) (-1995.903) (-1991.751) [-1978.737] * (-2002.536) [-1990.274] (-1997.026) (-1993.945) -- 0:03:42
305700 -- (-1998.746) (-1994.198) (-1995.197) [-1979.552] * (-2001.017) [-1986.610] (-1994.361) (-2001.834) -- 0:03:42
305800 -- (-1991.722) (-1993.365) (-1989.108) [-1979.522] * (-1996.828) [-1985.584] (-1997.806) (-1999.832) -- 0:03:42
305900 -- (-1991.037) [-1988.377] (-1992.098) (-1988.404) * (-2000.535) [-1985.480] (-1994.017) (-1993.641) -- 0:03:42
306000 -- (-1993.814) (-1989.155) (-1989.781) [-1994.987] * (-2003.847) [-1983.992] (-2003.535) (-1994.392) -- 0:03:42
Average standard deviation of split frequencies: 0.003784
306100 -- (-1992.813) (-1987.899) (-1988.293) [-1987.028] * (-1999.359) [-1987.952] (-1995.912) (-1999.325) -- 0:03:42
306200 -- (-2000.680) (-1985.098) [-1989.527] (-1989.056) * (-1996.268) (-1984.704) [-1991.120] (-1993.416) -- 0:03:42
306300 -- (-1990.178) [-1986.821] (-1984.644) (-1986.524) * (-1991.742) [-1984.033] (-1991.051) (-2004.142) -- 0:03:41
306400 -- (-1993.134) (-1996.649) (-1986.443) [-1985.785] * (-1993.216) [-1986.703] (-2000.983) (-1994.845) -- 0:03:41
306500 -- (-1989.182) (-1998.512) (-1990.580) [-1987.398] * (-1996.168) [-1987.976] (-2003.352) (-1998.292) -- 0:03:41
306600 -- (-1990.694) (-1989.807) (-2006.646) [-1986.698] * (-2005.624) [-1991.799] (-1993.777) (-1999.609) -- 0:03:41
306700 -- (-1994.305) [-1991.483] (-2001.185) (-1991.877) * (-1989.447) [-1986.512] (-2001.392) (-2008.390) -- 0:03:41
306800 -- (-1998.141) [-1993.064] (-1998.753) (-1989.232) * (-1995.464) [-1984.638] (-1994.423) (-1997.963) -- 0:03:41
306900 -- [-1989.741] (-1989.039) (-2005.994) (-1986.741) * (-1998.030) [-1982.556] (-1993.558) (-1999.286) -- 0:03:41
307000 -- [-1988.680] (-1992.697) (-2007.163) (-1989.950) * (-2000.753) [-1987.023] (-1984.103) (-1998.174) -- 0:03:41
Average standard deviation of split frequencies: 0.003858
307100 -- (-1987.523) (-1995.216) (-2012.631) [-1986.045] * (-2000.859) (-1987.522) (-1982.959) [-1994.436] -- 0:03:41
307200 -- (-1985.290) (-1998.949) (-2013.042) [-1989.053] * (-1996.718) (-1994.443) [-1987.482] (-2001.971) -- 0:03:41
307300 -- [-1992.877] (-2003.420) (-1997.549) (-1991.894) * (-1996.177) (-1992.932) (-1991.222) [-1997.311] -- 0:03:40
307400 -- (-2002.855) (-1999.893) (-1995.923) [-1984.168] * [-1994.621] (-1996.722) (-1988.294) (-1992.373) -- 0:03:40
307500 -- (-1995.894) (-2004.252) (-1992.087) [-1988.788] * (-2000.358) (-1992.525) (-1994.047) [-1990.376] -- 0:03:40
307600 -- (-2002.001) (-1999.047) [-1986.040] (-1997.000) * (-2003.172) [-1987.456] (-1987.207) (-1992.192) -- 0:03:42
307700 -- (-2001.441) (-1997.707) [-1990.292] (-1995.490) * (-2004.411) (-1984.808) [-1985.923] (-1998.593) -- 0:03:42
307800 -- (-1996.199) (-1996.574) (-1993.091) [-1991.584] * (-2000.862) (-1988.085) (-1989.543) [-1990.811] -- 0:03:42
307900 -- (-1991.677) (-1991.512) (-1995.302) [-1998.146] * (-2004.432) (-1994.550) (-1993.308) [-1986.513] -- 0:03:42
308000 -- (-1988.323) [-1989.378] (-1991.011) (-2004.160) * (-1995.956) [-1989.642] (-2005.335) (-1993.203) -- 0:03:42
Average standard deviation of split frequencies: 0.004196
308100 -- (-1994.467) [-1988.562] (-1994.918) (-2009.263) * (-1989.251) (-1988.677) (-2006.161) [-1989.656] -- 0:03:42
308200 -- (-1999.177) [-1985.021] (-1995.840) (-2001.307) * (-1994.330) (-1993.357) [-2004.002] (-1992.864) -- 0:03:42
308300 -- (-1999.847) [-1985.476] (-1995.175) (-1994.524) * [-1987.685] (-1991.800) (-1992.520) (-1997.302) -- 0:03:42
308400 -- [-1996.199] (-1984.636) (-1999.395) (-2001.602) * (-1990.285) (-1997.844) [-1992.748] (-1994.691) -- 0:03:42
308500 -- (-1994.541) [-1990.005] (-1994.893) (-1995.947) * (-1992.613) (-1993.412) [-1985.782] (-1986.224) -- 0:03:41
308600 -- (-1994.971) (-1991.652) [-1989.567] (-1991.901) * (-1986.694) (-1995.981) [-1988.947] (-1989.163) -- 0:03:41
308700 -- [-1992.307] (-1993.344) (-1987.349) (-1994.502) * (-1989.185) (-2002.459) (-1990.214) [-1989.114] -- 0:03:41
308800 -- (-1995.294) (-1992.356) [-1988.100] (-1998.598) * [-1987.607] (-2007.681) (-1990.162) (-1992.007) -- 0:03:41
308900 -- (-1992.553) (-1992.804) [-1991.033] (-2005.556) * [-1989.466] (-2002.677) (-1987.835) (-1986.771) -- 0:03:41
309000 -- (-1995.189) (-1994.404) [-1985.536] (-1997.380) * (-1988.262) (-2002.959) [-1988.953] (-1985.515) -- 0:03:41
Average standard deviation of split frequencies: 0.004138
309100 -- (-1990.567) (-1994.148) [-1986.723] (-2002.484) * (-1992.715) (-2005.360) [-1987.952] (-1985.646) -- 0:03:41
309200 -- [-1994.891] (-1991.654) (-1990.344) (-1995.760) * (-1995.644) (-1992.278) [-1985.823] (-1986.823) -- 0:03:41
309300 -- (-1990.281) (-1986.987) [-1987.294] (-1988.507) * (-1998.773) (-1994.611) (-1984.951) [-1988.389] -- 0:03:41
309400 -- (-1987.498) (-1985.348) (-1991.156) [-1988.196] * (-2000.732) (-1997.814) (-1991.927) [-1984.418] -- 0:03:40
309500 -- (-1999.726) (-1991.929) (-1991.148) [-1983.687] * (-1999.726) (-1998.150) (-1987.200) [-1985.389] -- 0:03:40
309600 -- (-2002.940) (-1989.169) [-1985.025] (-1985.071) * (-1995.407) (-2003.295) [-1985.407] (-1992.657) -- 0:03:40
309700 -- (-2003.560) [-1989.371] (-1991.271) (-1988.085) * (-1994.625) (-2008.993) [-1982.340] (-1990.988) -- 0:03:40
309800 -- (-1995.690) (-1989.348) (-1995.188) [-1987.786] * (-1998.887) (-2008.427) [-1985.501] (-1990.792) -- 0:03:40
309900 -- (-1999.566) [-1987.242] (-2003.922) (-1988.879) * (-2006.129) [-1989.933] (-1986.605) (-1996.523) -- 0:03:40
310000 -- (-1996.302) (-1988.090) (-2000.317) [-1990.210] * (-1998.218) (-1992.411) [-1984.537] (-1997.616) -- 0:03:40
Average standard deviation of split frequencies: 0.004213
310100 -- (-1996.007) (-1993.830) (-1992.343) [-1989.566] * (-1998.717) (-1995.964) [-1981.580] (-1999.183) -- 0:03:40
310200 -- (-1993.960) (-1991.285) [-1987.295] (-1988.243) * (-2000.947) (-1997.204) [-1981.395] (-1999.985) -- 0:03:40
310300 -- (-2000.941) (-1995.459) (-1989.723) [-1993.551] * (-1988.967) (-2000.946) [-1986.146] (-1998.900) -- 0:03:40
310400 -- (-1995.498) [-1989.840] (-1995.634) (-1989.677) * (-1991.350) (-1998.439) [-1987.642] (-1995.320) -- 0:03:39
310500 -- (-2002.951) (-1993.117) [-1987.362] (-1992.402) * (-1992.992) (-1992.619) [-1983.990] (-1999.845) -- 0:03:39
310600 -- (-1999.399) [-1987.462] (-1995.466) (-1987.860) * (-2005.352) (-2002.533) [-1989.191] (-2006.785) -- 0:03:39
310700 -- (-2000.667) [-1983.611] (-1996.704) (-1988.029) * (-1996.140) (-1999.402) [-1986.340] (-2005.467) -- 0:03:41
310800 -- (-2008.864) [-1988.834] (-1997.963) (-1983.603) * (-1992.026) (-1995.137) [-1982.562] (-1998.161) -- 0:03:41
310900 -- (-2002.699) (-1988.622) (-1986.859) [-1983.154] * [-1992.090] (-2005.510) (-1990.489) (-1994.982) -- 0:03:41
311000 -- (-2009.376) [-1989.738] (-1988.503) (-1979.684) * (-1994.964) (-2008.950) [-1987.792] (-2005.446) -- 0:03:41
Average standard deviation of split frequencies: 0.004198
311100 -- (-2011.096) (-1990.206) (-1988.950) [-1980.729] * [-1995.139] (-2001.717) (-1989.016) (-2020.289) -- 0:03:41
311200 -- (-2002.982) (-1996.715) [-1991.085] (-1989.517) * (-2001.026) (-1993.945) [-1991.775] (-2002.204) -- 0:03:41
311300 -- (-1997.140) (-2004.507) (-1996.117) [-1987.753] * (-1997.278) (-1986.940) [-1990.368] (-1996.366) -- 0:03:41
311400 -- (-1993.513) (-1999.831) (-1993.366) [-1977.890] * (-1997.264) (-1988.161) [-1986.218] (-2007.843) -- 0:03:41
311500 -- (-2000.430) (-1998.964) (-1995.327) [-1982.374] * (-1991.725) (-1995.514) [-1990.778] (-2005.027) -- 0:03:41
311600 -- (-1991.014) (-1999.043) (-1993.739) [-1979.651] * [-1998.627] (-1996.076) (-1994.672) (-1998.753) -- 0:03:40
311700 -- (-2002.821) (-1993.518) (-1999.115) [-1981.518] * (-1993.318) (-1995.468) [-1985.439] (-1992.017) -- 0:03:40
311800 -- (-2002.172) (-1992.852) (-1990.024) [-1978.724] * (-1991.364) (-1999.883) (-1987.299) [-1988.429] -- 0:03:40
311900 -- (-1991.570) (-1994.066) (-1992.986) [-1977.048] * (-1995.086) [-1993.671] (-1988.151) (-1990.063) -- 0:03:40
312000 -- (-1991.899) (-1999.229) (-1987.528) [-1983.859] * (-1997.028) (-1988.735) [-1987.735] (-1991.095) -- 0:03:40
Average standard deviation of split frequencies: 0.004531
312100 -- [-1994.210] (-1999.189) (-1986.720) (-1985.224) * (-2002.040) (-1987.704) (-1988.570) [-1993.052] -- 0:03:40
312200 -- (-2001.470) (-1994.284) (-1989.758) [-1991.110] * (-2007.603) [-1986.508] (-2004.720) (-1992.072) -- 0:03:40
312300 -- (-1997.722) (-1993.789) (-1987.979) [-1986.419] * (-1997.089) [-1983.181] (-2000.749) (-1996.596) -- 0:03:40
312400 -- (-1996.564) (-1992.409) (-1985.371) [-1986.426] * (-1996.801) [-1984.147] (-1995.133) (-1996.037) -- 0:03:40
312500 -- (-1999.597) (-1993.298) (-1996.981) [-1986.460] * (-1998.824) [-1986.366] (-2003.352) (-2004.569) -- 0:03:40
312600 -- (-1994.103) (-1988.327) (-1998.716) [-1986.839] * [-1991.989] (-1987.006) (-2006.092) (-2002.691) -- 0:03:39
312700 -- (-1997.582) [-1994.142] (-1994.752) (-1987.943) * (-1990.169) [-1986.358] (-1993.631) (-2012.851) -- 0:03:39
312800 -- (-1992.621) [-1988.337] (-1996.254) (-1988.199) * [-1992.338] (-1987.363) (-1990.985) (-1996.405) -- 0:03:39
312900 -- (-1991.021) [-1990.641] (-1997.244) (-1989.471) * [-1986.220] (-1994.853) (-1985.183) (-1998.259) -- 0:03:39
313000 -- [-1987.243] (-1989.369) (-2016.793) (-1992.108) * (-1989.873) (-1991.214) [-1987.495] (-1996.401) -- 0:03:39
Average standard deviation of split frequencies: 0.004601
313100 -- (-1993.291) [-1988.161] (-2009.293) (-1982.328) * (-1993.179) (-1994.276) [-1983.536] (-1993.176) -- 0:03:39
313200 -- (-1994.976) (-1992.087) (-2009.163) [-1980.474] * (-1985.033) (-1998.272) [-1988.077] (-1988.972) -- 0:03:39
313300 -- (-1996.836) (-1989.647) (-1998.409) [-1986.852] * [-1988.076] (-1996.644) (-1991.141) (-2000.467) -- 0:03:39
313400 -- [-1988.968] (-1990.268) (-1993.082) (-1984.317) * (-1986.411) (-1992.897) [-1986.408] (-2009.280) -- 0:03:39
313500 -- (-1986.082) [-1987.470] (-1996.464) (-1987.256) * (-1991.368) (-1985.235) [-1983.636] (-1987.809) -- 0:03:38
313600 -- (-1986.418) (-1992.154) (-1993.211) [-1985.765] * (-1989.706) [-1991.033] (-1987.664) (-1987.468) -- 0:03:38
313700 -- (-1996.129) (-2006.809) (-1997.468) [-1980.788] * (-1989.401) [-1989.624] (-1986.428) (-1988.796) -- 0:03:38
313800 -- (-2002.086) (-1992.869) (-1998.795) [-1981.707] * (-1991.249) [-1989.177] (-1983.371) (-1997.713) -- 0:03:40
313900 -- (-1999.259) (-1993.242) [-1992.445] (-1986.399) * (-1988.688) [-1991.039] (-1986.903) (-1993.983) -- 0:03:40
314000 -- (-1990.576) (-1988.647) (-2005.306) [-1984.154] * (-1991.521) (-1996.224) [-1987.634] (-1995.379) -- 0:03:40
Average standard deviation of split frequencies: 0.004545
314100 -- [-1990.941] (-1984.759) (-1996.255) (-1988.201) * (-1991.920) (-2003.036) [-1984.485] (-1989.561) -- 0:03:40
314200 -- (-1992.406) [-1983.514] (-1996.593) (-1990.420) * (-1988.364) (-2004.765) (-1991.642) [-1986.764] -- 0:03:40
314300 -- (-1986.785) [-1982.972] (-1991.097) (-1992.909) * (-1994.674) (-2001.371) (-1988.698) [-1992.248] -- 0:03:40
314400 -- [-1989.632] (-1982.641) (-1995.138) (-1998.330) * (-1989.543) (-2002.085) (-1988.468) [-1994.777] -- 0:03:40
314500 -- (-1988.939) (-1982.201) (-1997.972) [-1991.461] * (-1997.098) (-2010.259) (-1986.285) [-1986.457] -- 0:03:40
314600 -- (-1991.800) (-1983.020) [-1987.620] (-1994.527) * (-1994.386) (-2007.340) [-1984.979] (-1982.646) -- 0:03:40
314700 -- (-1991.049) [-1985.639] (-1985.726) (-1993.929) * (-1992.957) (-2003.911) [-1982.455] (-1986.087) -- 0:03:39
314800 -- (-1985.412) (-1985.092) (-1985.330) [-1986.894] * (-1994.908) (-2006.998) [-1985.564] (-1991.118) -- 0:03:39
314900 -- (-1988.708) (-1985.051) [-1983.025] (-1993.258) * (-1993.207) (-2001.118) [-1981.619] (-1982.684) -- 0:03:39
315000 -- (-1985.666) [-1985.016] (-1986.438) (-1990.769) * (-1993.531) (-2000.949) (-1979.533) [-1986.517] -- 0:03:39
Average standard deviation of split frequencies: 0.004786
315100 -- (-1991.691) (-1990.533) [-1988.087] (-1987.664) * (-1995.377) (-2002.854) [-1980.587] (-1990.224) -- 0:03:39
315200 -- (-1993.983) (-1986.132) [-1987.295] (-1987.306) * (-1990.330) (-2005.391) [-1979.353] (-1991.981) -- 0:03:39
315300 -- (-1990.873) [-1981.507] (-1991.338) (-1984.841) * [-1993.400] (-2001.373) (-1986.342) (-1990.130) -- 0:03:39
315400 -- (-1989.616) [-1984.521] (-1990.307) (-1985.826) * (-1987.708) (-2011.848) [-1981.425] (-1995.812) -- 0:03:39
315500 -- (-1996.540) (-1990.025) (-1996.085) [-1984.796] * (-1990.737) (-2003.936) [-1982.799] (-1988.611) -- 0:03:39
315600 -- [-1995.390] (-1986.204) (-1989.665) (-1992.826) * (-1993.871) (-1994.191) [-1982.535] (-1992.383) -- 0:03:39
315700 -- (-2000.669) (-1984.707) (-1990.698) [-1991.607] * (-1994.023) (-1996.396) [-1982.605] (-1992.280) -- 0:03:38
315800 -- (-1994.211) [-1981.550] (-1996.387) (-1987.821) * (-2001.521) [-1989.672] (-1987.730) (-1986.158) -- 0:03:38
315900 -- (-1994.948) (-1981.972) (-2001.781) [-1983.561] * (-1999.933) (-1995.290) (-1983.732) [-1985.939] -- 0:03:38
316000 -- (-1992.488) [-1991.563] (-1995.335) (-1985.620) * (-1994.687) (-1996.923) [-1980.066] (-1990.715) -- 0:03:38
Average standard deviation of split frequencies: 0.004559
316100 -- (-1987.828) (-1991.793) (-1994.531) [-1988.833] * (-1997.415) (-1996.737) (-1982.713) [-1989.269] -- 0:03:38
316200 -- (-1986.869) (-1990.774) (-1991.174) [-1990.403] * (-1994.594) (-1990.997) [-1980.580] (-1992.973) -- 0:03:38
316300 -- (-1982.917) [-1990.529] (-1999.336) (-1983.377) * (-1996.240) (-1994.344) (-1980.529) [-1996.121] -- 0:03:38
316400 -- (-1986.079) (-1993.853) (-2000.335) [-1979.166] * (-1990.889) (-2003.289) [-1977.560] (-1998.842) -- 0:03:38
316500 -- [-1986.891] (-1996.383) (-1997.468) (-1981.597) * (-1993.078) (-1997.108) [-1978.125] (-1994.075) -- 0:03:38
316600 -- [-1985.403] (-1999.260) (-1989.856) (-1982.825) * (-2001.652) (-1990.447) [-1981.547] (-1993.457) -- 0:03:38
316700 -- (-1986.687) [-1985.524] (-1988.389) (-1983.322) * (-2000.170) (-1988.230) [-1980.125] (-1984.507) -- 0:03:37
316800 -- (-1989.739) (-1992.758) (-1984.205) [-1981.694] * (-2009.262) (-1994.421) [-1982.866] (-1983.309) -- 0:03:37
316900 -- (-1990.476) (-1994.980) (-1986.986) [-1980.985] * (-2012.095) (-1988.083) [-1981.625] (-1981.584) -- 0:03:39
317000 -- (-1995.944) (-1999.157) (-1985.722) [-1980.584] * (-2006.164) (-1993.670) [-1981.018] (-1998.840) -- 0:03:39
Average standard deviation of split frequencies: 0.004246
317100 -- (-1999.044) (-1994.256) (-1988.097) [-1982.441] * (-2015.935) [-1994.179] (-1996.527) (-1995.135) -- 0:03:39
317200 -- (-2000.106) (-1998.849) [-1988.903] (-1986.795) * (-2007.621) [-1985.066] (-1989.149) (-1991.867) -- 0:03:39
317300 -- (-2011.361) (-1993.332) (-1985.397) [-1986.510] * (-2011.246) (-1989.652) [-1990.293] (-1991.795) -- 0:03:39
317400 -- (-2011.232) (-1996.440) (-1983.978) [-1985.607] * (-1997.282) (-1987.017) [-1983.911] (-1983.345) -- 0:03:39
317500 -- (-2003.422) [-1990.910] (-1985.488) (-1990.773) * (-1996.254) (-1992.229) (-1986.063) [-1977.731] -- 0:03:39
317600 -- [-1988.913] (-1987.058) (-1986.961) (-1982.616) * (-1999.928) (-1991.869) (-1988.065) [-1981.246] -- 0:03:39
317700 -- (-1988.940) (-1998.626) (-1988.382) [-1980.893] * (-1998.604) (-1995.721) (-1985.038) [-1988.113] -- 0:03:39
317800 -- (-1988.834) (-2009.210) (-1990.339) [-1981.309] * [-1998.894] (-1996.528) (-1985.329) (-1989.428) -- 0:03:38
317900 -- (-1989.747) (-2005.742) [-1987.101] (-1982.131) * (-1989.612) (-1995.588) [-1983.725] (-1984.378) -- 0:03:38
318000 -- (-1992.876) (-2014.379) (-1989.651) [-1985.356] * (-1999.137) (-2003.775) [-1985.895] (-1982.758) -- 0:03:38
Average standard deviation of split frequencies: 0.004191
318100 -- (-2001.269) (-2019.478) (-1985.175) [-1986.202] * (-1990.928) (-1999.226) (-1988.136) [-1979.651] -- 0:03:38
318200 -- (-2005.975) (-2003.689) [-1986.359] (-1989.854) * (-1993.988) (-1997.945) [-1986.812] (-1983.719) -- 0:03:38
318300 -- (-2003.905) (-2010.375) (-1987.831) [-1990.869] * (-2001.461) (-1998.803) [-1981.105] (-1989.590) -- 0:03:38
318400 -- (-2002.121) (-2011.480) (-1988.184) [-1994.771] * (-2007.808) (-1997.213) (-1978.598) [-1988.595] -- 0:03:38
318500 -- (-1996.080) (-2010.365) [-1985.459] (-1988.763) * (-1997.666) (-1990.760) [-1979.197] (-2000.212) -- 0:03:38
318600 -- (-1997.881) (-1991.914) [-1985.131] (-1985.086) * (-1994.421) (-1991.073) [-1980.163] (-1989.951) -- 0:03:38
318700 -- (-1996.831) [-1991.439] (-1991.477) (-1991.746) * (-1997.784) (-2000.948) [-1978.023] (-1991.078) -- 0:03:38
318800 -- (-1994.515) [-1986.121] (-1998.195) (-1992.912) * (-1998.724) (-1998.102) [-1978.300] (-1988.981) -- 0:03:37
318900 -- (-2000.977) (-1989.661) [-1993.937] (-1989.996) * (-1995.442) (-2001.365) [-1978.960] (-1995.995) -- 0:03:37
319000 -- (-1994.022) (-1990.143) (-2002.041) [-1987.677] * (-1991.265) (-1988.662) [-1980.542] (-1994.636) -- 0:03:37
Average standard deviation of split frequencies: 0.004388
319100 -- [-1989.355] (-1988.955) (-1997.971) (-1989.604) * (-1990.510) (-1995.868) [-1981.377] (-1994.369) -- 0:03:37
319200 -- (-1993.134) [-1984.509] (-1989.363) (-1990.364) * (-1993.123) (-1987.965) [-1980.040] (-1988.943) -- 0:03:37
319300 -- (-1985.660) [-1988.227] (-1995.814) (-1987.699) * [-1989.524] (-1987.789) (-1978.605) (-1995.106) -- 0:03:37
319400 -- (-1987.497) (-1991.778) (-1999.279) [-1981.170] * (-1995.682) (-1990.287) [-1984.959] (-1999.851) -- 0:03:37
319500 -- (-1991.696) (-1992.816) (-2000.564) [-1984.839] * (-1987.081) (-1994.222) [-1983.241] (-1996.822) -- 0:03:37
319600 -- (-1993.709) [-1985.673] (-1999.997) (-1987.696) * (-1988.223) (-1988.977) [-1982.883] (-1998.492) -- 0:03:37
319700 -- (-1997.645) (-1987.527) (-1996.573) [-1984.029] * [-1987.067] (-1995.633) (-1986.587) (-1991.731) -- 0:03:37
319800 -- (-1998.648) (-1994.578) (-1991.136) [-1979.417] * (-1984.090) (-1996.155) [-1983.664] (-1998.488) -- 0:03:36
319900 -- (-1997.042) (-2002.578) (-1991.611) [-1979.910] * [-1982.545] (-1992.099) (-1988.102) (-2006.644) -- 0:03:36
320000 -- (-1995.543) (-1995.575) (-1993.233) [-1981.510] * (-1987.134) (-1994.811) [-1981.686] (-2000.240) -- 0:03:38
Average standard deviation of split frequencies: 0.004081
320100 -- (-1990.491) [-1993.695] (-1998.430) (-1986.007) * (-1986.230) (-1989.807) [-1979.078] (-1999.873) -- 0:03:38
320200 -- (-1992.794) (-1995.025) (-1992.192) [-1988.299] * (-1987.975) (-1996.236) [-1980.408] (-2000.687) -- 0:03:38
320300 -- (-1989.475) (-1985.804) [-1990.702] (-1996.579) * (-1986.705) [-1987.873] (-1979.788) (-2004.087) -- 0:03:38
320400 -- (-1987.452) (-1991.780) (-1992.343) [-1988.450] * (-1987.865) (-1993.001) (-1985.895) [-1993.585] -- 0:03:38
320500 -- [-1988.633] (-1994.146) (-2003.607) (-1997.586) * [-1983.794] (-1997.546) (-1983.831) (-2007.034) -- 0:03:38
320600 -- (-1992.611) (-1991.804) (-1994.441) [-1996.199] * (-1982.948) [-1990.061] (-1990.533) (-2000.261) -- 0:03:38
320700 -- (-1987.715) (-1993.852) [-1992.919] (-1999.043) * [-1981.850] (-1990.354) (-1983.803) (-1994.967) -- 0:03:38
320800 -- [-1985.114] (-1994.594) (-1991.448) (-1997.822) * (-1983.498) (-1993.582) (-1986.326) [-1984.789] -- 0:03:38
320900 -- [-1987.401] (-2003.268) (-1997.462) (-1992.135) * (-1992.366) (-1992.558) (-1989.649) [-1985.819] -- 0:03:37
321000 -- [-1986.345] (-2006.624) (-1997.481) (-1987.898) * (-1993.813) (-1997.627) (-1986.821) [-1983.939] -- 0:03:37
Average standard deviation of split frequencies: 0.004487
321100 -- (-1995.872) (-1997.584) (-2001.732) [-1980.485] * (-1991.878) (-1993.093) (-1985.662) [-1980.423] -- 0:03:37
321200 -- (-1994.505) (-1996.943) (-1995.978) [-1985.792] * (-1991.291) (-1997.484) (-1992.956) [-1981.881] -- 0:03:37
321300 -- (-1989.495) [-1992.141] (-2011.461) (-1985.158) * (-1987.533) (-1993.255) (-1993.781) [-1981.970] -- 0:03:37
321400 -- (-1999.826) (-1989.073) (-2011.578) [-1983.573] * (-1988.584) (-1988.826) [-1988.200] (-1986.917) -- 0:03:37
321500 -- (-1997.117) (-1990.099) (-2001.163) [-1980.752] * (-1991.077) (-1995.878) [-1985.136] (-1988.215) -- 0:03:37
321600 -- (-1992.878) (-1993.723) (-1994.647) [-1980.560] * (-1982.853) (-1992.482) (-1989.497) [-1987.984] -- 0:03:37
321700 -- [-1992.125] (-1990.554) (-1999.510) (-1983.372) * [-1982.358] (-1992.499) (-1997.359) (-1985.678) -- 0:03:37
321800 -- (-1988.096) (-1986.470) (-1991.208) [-1982.893] * (-1980.390) (-1998.241) [-1990.258] (-1990.535) -- 0:03:37
321900 -- (-1990.330) (-1984.144) (-1992.180) [-1981.138] * (-1988.113) (-1998.205) (-1986.007) [-1983.281] -- 0:03:36
322000 -- (-1990.826) (-1978.341) (-1995.235) [-1989.730] * [-1987.124] (-2000.929) (-1985.212) (-1988.559) -- 0:03:36
Average standard deviation of split frequencies: 0.004934
322100 -- (-1997.990) (-1983.646) (-1989.693) [-1984.472] * [-1990.854] (-1998.326) (-1990.111) (-1992.592) -- 0:03:36
322200 -- (-1994.713) [-1984.637] (-1990.060) (-1996.608) * (-1994.222) (-1995.916) [-1985.707] (-1992.724) -- 0:03:36
322300 -- (-1996.630) [-1981.406] (-1992.231) (-1990.070) * (-1993.468) (-2002.421) [-1983.024] (-1998.304) -- 0:03:36
322400 -- (-1989.951) [-1983.834] (-1996.969) (-1981.720) * (-1995.367) (-1998.244) [-1982.297] (-1998.181) -- 0:03:36
322500 -- (-1988.850) (-1988.458) (-1998.020) [-1981.142] * (-2002.833) (-1989.817) (-1987.942) [-1980.875] -- 0:03:36
322600 -- (-1995.139) (-1988.041) (-2004.296) [-1981.444] * (-1997.304) (-1992.505) [-1980.997] (-1982.116) -- 0:03:36
322700 -- (-1994.847) (-1991.479) (-2001.382) [-1977.477] * (-1988.246) (-1993.340) [-1981.612] (-1985.740) -- 0:03:36
322800 -- [-1993.031] (-1984.259) (-1998.700) (-1979.089) * [-1983.594] (-2001.411) (-1987.784) (-1986.875) -- 0:03:36
322900 -- (-1994.080) (-1980.880) (-2001.154) [-1979.982] * (-1987.319) (-1992.542) [-1983.250] (-1988.982) -- 0:03:35
323000 -- (-1995.197) (-1980.114) (-2003.215) [-1981.126] * (-1992.202) (-1989.153) [-1984.888] (-1998.362) -- 0:03:35
Average standard deviation of split frequencies: 0.004917
323100 -- (-1991.539) (-1984.978) (-1997.190) [-1976.657] * (-1984.247) (-1995.788) [-1983.313] (-1988.139) -- 0:03:37
323200 -- (-1996.020) (-1980.631) (-1992.723) [-1981.409] * [-1984.719] (-1987.243) (-1986.470) (-1989.238) -- 0:03:37
323300 -- (-1995.115) (-1980.663) (-1994.809) [-1980.959] * [-1986.895] (-1988.097) (-1988.470) (-1987.322) -- 0:03:37
323400 -- (-1998.198) (-1983.145) (-2004.020) [-1982.843] * (-1986.257) [-1989.869] (-1986.466) (-1982.655) -- 0:03:37
323500 -- (-1993.619) (-1988.424) (-2000.992) [-1985.577] * (-1984.362) (-1987.892) [-1986.403] (-1981.556) -- 0:03:37
323600 -- [-1991.189] (-1983.068) (-1998.373) (-1980.675) * (-1993.939) (-1991.717) [-1991.302] (-1985.166) -- 0:03:37
323700 -- (-1993.642) [-1982.424] (-1997.865) (-1989.609) * (-1991.744) [-1988.693] (-1987.927) (-1986.664) -- 0:03:37
323800 -- (-1992.914) [-1984.418] (-1997.602) (-1991.015) * (-1997.730) (-1990.100) [-1983.712] (-1985.196) -- 0:03:37
323900 -- (-1989.468) [-1982.213] (-1988.965) (-2001.269) * (-1995.323) (-2002.218) (-1993.406) [-1984.326] -- 0:03:37
324000 -- (-1998.009) [-1991.138] (-2000.892) (-1996.086) * (-1994.825) (-1993.133) [-1988.208] (-1984.517) -- 0:03:36
Average standard deviation of split frequencies: 0.004820
324100 -- (-1994.751) (-1987.467) (-1994.237) [-1982.167] * [-1983.465] (-1990.691) (-1991.932) (-1982.441) -- 0:03:36
324200 -- (-1992.190) (-1988.028) [-1988.422] (-1986.438) * (-1980.413) [-1989.907] (-1992.664) (-1979.110) -- 0:03:36
324300 -- (-1990.178) (-1991.244) (-1997.109) [-1987.317] * (-1980.383) (-1994.420) (-1992.580) [-1981.973] -- 0:03:36
324400 -- (-1991.410) [-1982.614] (-1993.995) (-1990.501) * (-1980.748) (-1996.313) (-1989.006) [-1984.378] -- 0:03:36
324500 -- (-1987.786) [-1983.966] (-1992.981) (-1995.614) * [-1984.436] (-1993.184) (-1992.039) (-1987.527) -- 0:03:36
324600 -- (-1993.962) [-1979.505] (-1989.541) (-1990.917) * (-1983.309) (-2001.337) [-1991.713] (-1992.061) -- 0:03:36
324700 -- (-1998.536) [-1980.343] (-1989.897) (-1994.260) * [-1982.478] (-1995.063) (-1986.857) (-1991.857) -- 0:03:36
324800 -- (-1996.203) [-1982.701] (-1994.266) (-1995.727) * [-1983.386] (-1998.834) (-1990.829) (-1999.761) -- 0:03:36
324900 -- [-1992.309] (-1986.930) (-1996.964) (-2000.686) * [-1983.129] (-1995.458) (-1996.007) (-1995.601) -- 0:03:36
325000 -- [-1992.708] (-1988.248) (-1995.384) (-1998.526) * [-1977.390] (-1988.332) (-1990.604) (-2005.647) -- 0:03:36
Average standard deviation of split frequencies: 0.004680
325100 -- (-1995.890) [-1985.590] (-1988.782) (-1985.922) * (-1982.641) (-1993.889) [-1986.464] (-1995.221) -- 0:03:35
325200 -- (-1992.847) (-1989.306) (-2000.141) [-1981.220] * [-1986.171] (-1989.585) (-1994.040) (-1986.411) -- 0:03:35
325300 -- (-1996.298) (-1984.449) (-1991.814) [-1980.721] * (-1989.319) [-1981.734] (-1991.604) (-1988.870) -- 0:03:35
325400 -- (-1993.282) [-1980.954] (-1992.669) (-1979.807) * (-1990.426) [-1984.998] (-1989.715) (-1988.912) -- 0:03:35
325500 -- (-2000.196) [-1985.781] (-1993.939) (-1984.066) * (-1987.050) [-1987.468] (-1984.279) (-1987.018) -- 0:03:35
325600 -- (-1999.657) (-1984.193) (-1991.261) [-1983.543] * (-1985.605) (-1992.466) [-1982.782] (-1986.866) -- 0:03:35
325700 -- (-1997.449) (-1980.320) (-1985.149) [-1980.734] * [-1983.089] (-1992.815) (-1988.668) (-1989.246) -- 0:03:35
325800 -- (-1999.821) [-1980.991] (-1991.033) (-1989.995) * [-1980.134] (-1988.282) (-1990.275) (-1990.440) -- 0:03:35
325900 -- (-1998.095) [-1980.059] (-1987.611) (-1994.851) * (-1984.317) (-1989.207) (-2000.612) [-1986.680] -- 0:03:35
326000 -- (-1991.708) [-1985.335] (-1990.280) (-1995.202) * [-1980.426] (-1998.175) (-1991.945) (-1995.397) -- 0:03:35
Average standard deviation of split frequencies: 0.004749
326100 -- (-1991.726) [-1983.038] (-1993.707) (-2006.289) * [-1978.556] (-1988.942) (-1992.832) (-2001.144) -- 0:03:34
326200 -- (-1994.105) [-1985.907] (-1989.824) (-1993.949) * [-1978.907] (-1986.735) (-1992.903) (-1995.100) -- 0:03:36
326300 -- (-1993.901) (-1987.760) (-1992.466) [-1987.067] * [-1980.566] (-1994.303) (-1994.186) (-2000.673) -- 0:03:36
326400 -- (-1991.972) (-1986.460) [-1989.674] (-1988.024) * [-1981.108] (-1990.472) (-1995.273) (-1989.498) -- 0:03:36
326500 -- (-1991.204) (-1988.165) (-1992.341) [-1985.456] * (-1979.176) (-1994.811) (-1991.364) [-1991.189] -- 0:03:36
326600 -- (-1993.096) [-1984.434] (-1991.626) (-1992.834) * (-1985.803) (-1980.851) [-1988.800] (-1985.763) -- 0:03:36
326700 -- (-1994.689) [-1982.896] (-1987.515) (-1989.106) * (-1985.846) [-1979.790] (-1991.601) (-1990.467) -- 0:03:36
326800 -- (-1993.284) (-1991.231) [-1988.053] (-1993.328) * [-1978.091] (-1985.545) (-1988.424) (-1993.566) -- 0:03:36
326900 -- (-1993.704) (-1991.304) (-1988.008) [-1983.798] * [-1982.164] (-1999.003) (-1995.975) (-2002.731) -- 0:03:36
327000 -- (-1998.882) [-1990.213] (-1992.957) (-1987.268) * [-1979.399] (-2010.897) (-1987.469) (-1998.352) -- 0:03:36
Average standard deviation of split frequencies: 0.004857
327100 -- (-2000.579) [-1983.118] (-1991.805) (-1989.715) * (-1984.682) (-2004.659) [-1992.557] (-1992.387) -- 0:03:36
327200 -- (-2005.287) [-1981.951] (-1989.495) (-1990.325) * (-1986.749) (-2007.156) [-1990.285] (-1995.257) -- 0:03:35
327300 -- (-1997.906) (-1983.088) (-1988.179) [-1985.684] * [-1985.811] (-1988.177) (-1992.002) (-1993.207) -- 0:03:35
327400 -- (-1997.976) [-1987.872] (-1989.899) (-1989.384) * (-1993.396) (-1985.285) [-1991.647] (-1992.813) -- 0:03:35
327500 -- (-2012.533) [-1993.494] (-1992.285) (-1986.429) * (-1986.580) [-1985.223] (-1995.729) (-1988.018) -- 0:03:35
327600 -- (-2012.362) (-1995.442) (-1994.820) [-1983.196] * (-1983.630) [-1983.299] (-1995.691) (-1990.783) -- 0:03:35
327700 -- (-2002.632) (-1987.469) (-1995.231) [-1980.369] * (-1986.694) (-1991.030) (-1993.848) [-1987.389] -- 0:03:35
327800 -- (-2004.776) (-1986.760) (-1988.470) [-1976.903] * [-1987.704] (-1984.273) (-1991.209) (-1990.516) -- 0:03:35
327900 -- (-1998.525) (-1985.403) (-1992.739) [-1981.087] * (-1986.673) (-1988.098) (-1990.315) [-1994.127] -- 0:03:35
328000 -- (-1996.867) (-1985.071) (-1987.159) [-1983.925] * [-1989.808] (-1988.130) (-1988.608) (-1993.270) -- 0:03:35
Average standard deviation of split frequencies: 0.005131
328100 -- (-1990.019) [-1987.145] (-1986.033) (-1984.770) * (-1985.665) [-1991.702] (-1987.843) (-1996.578) -- 0:03:35
328200 -- (-1996.472) (-1987.935) (-1988.512) [-1989.138] * (-1989.309) [-1988.797] (-1994.510) (-1996.473) -- 0:03:34
328300 -- [-1989.570] (-1988.834) (-1990.116) (-1990.414) * (-1987.117) (-1985.105) (-2007.405) [-1982.833] -- 0:03:34
328400 -- (-1992.616) (-1984.323) [-1987.728] (-1993.553) * (-1989.019) (-1994.901) (-1989.696) [-1980.351] -- 0:03:34
328500 -- (-1992.840) (-1983.655) [-1987.123] (-2000.346) * (-1987.017) (-1991.158) (-1992.536) [-1982.855] -- 0:03:34
328600 -- [-1990.375] (-1983.226) (-1985.128) (-2006.657) * (-1989.116) (-1986.255) (-1989.995) [-1986.808] -- 0:03:34
328700 -- (-1991.359) (-1985.139) [-1988.727] (-2012.082) * [-1982.116] (-1983.023) (-1995.902) (-1989.113) -- 0:03:34
328800 -- (-1991.020) [-1983.641] (-1984.578) (-2004.849) * (-1983.017) [-1984.472] (-1998.730) (-1991.702) -- 0:03:34
328900 -- (-1989.397) [-1987.282] (-1990.035) (-1993.024) * [-1981.953] (-1994.962) (-2006.155) (-1987.763) -- 0:03:34
329000 -- (-2004.743) (-1990.160) [-1992.457] (-1990.725) * [-1985.056] (-1993.623) (-2003.948) (-1991.903) -- 0:03:34
Average standard deviation of split frequencies: 0.005114
329100 -- (-2008.063) [-1986.050] (-1993.017) (-1996.520) * [-1983.374] (-1989.465) (-1994.179) (-1985.510) -- 0:03:34
329200 -- (-2004.160) [-1986.278] (-1987.707) (-1993.263) * (-1992.829) (-1994.333) (-1999.546) [-1981.683] -- 0:03:33
329300 -- (-2007.778) (-1992.942) (-1996.674) [-1992.450] * (-1989.882) (-1989.293) (-2008.688) [-1983.688] -- 0:03:35
329400 -- (-1996.847) (-1984.609) (-1998.965) [-1988.239] * (-1993.223) [-1992.956] (-2007.841) (-1983.902) -- 0:03:35
329500 -- (-2006.678) (-1996.508) (-2009.015) [-1990.835] * (-1990.321) (-1990.483) (-1998.536) [-1988.815] -- 0:03:35
329600 -- [-2005.362] (-1993.325) (-2006.586) (-1985.772) * (-1994.553) (-1991.907) (-1998.986) [-1985.603] -- 0:03:35
329700 -- (-2001.979) (-1989.240) (-1995.386) [-1989.555] * (-1995.176) (-1990.922) (-1998.372) [-1983.739] -- 0:03:35
329800 -- (-1996.842) [-1983.464] (-1996.916) (-1996.287) * (-1988.601) [-1986.358] (-1995.510) (-1987.470) -- 0:03:35
329900 -- (-1993.002) (-1987.481) (-1991.362) [-1985.062] * (-1987.698) [-1981.758] (-1992.951) (-1987.418) -- 0:03:35
330000 -- (-1993.130) [-1985.741] (-1995.636) (-1985.160) * (-1996.274) [-1978.270] (-1992.758) (-1986.937) -- 0:03:35
Average standard deviation of split frequencies: 0.004977
330100 -- (-1994.801) (-1986.588) (-1993.964) [-1985.167] * (-1994.151) (-1978.900) (-2000.645) [-1992.567] -- 0:03:35
330200 -- (-2004.924) (-1985.698) (-1998.923) [-1983.385] * (-1993.701) [-1977.037] (-1990.035) (-1995.987) -- 0:03:35
330300 -- (-2003.831) (-1990.355) (-2008.153) [-1979.413] * (-1990.074) [-1980.853] (-1996.755) (-1991.386) -- 0:03:34
330400 -- (-2010.536) (-1989.238) (-2006.271) [-1977.114] * (-1989.295) [-1986.309] (-1990.366) (-1992.002) -- 0:03:34
330500 -- (-2010.869) (-1986.509) (-2003.218) [-1978.247] * (-1989.829) [-1980.868] (-1994.053) (-1990.846) -- 0:03:34
330600 -- (-2000.177) (-1986.688) (-2002.917) [-1983.423] * (-1986.879) (-1978.975) (-1991.652) [-1982.813] -- 0:03:34
330700 -- (-1995.023) (-1984.720) (-2003.209) [-1984.922] * (-1984.163) [-1979.353] (-1988.231) (-1986.666) -- 0:03:34
330800 -- [-1993.902] (-1990.766) (-2000.546) (-1988.533) * (-1987.393) [-1976.748] (-1988.350) (-1989.467) -- 0:03:34
330900 -- (-1992.619) [-1992.365] (-1995.296) (-1988.463) * (-1979.916) [-1977.562] (-1988.611) (-1986.344) -- 0:03:34
331000 -- (-1990.662) [-1989.142] (-1994.264) (-1990.878) * [-1980.393] (-1982.236) (-1989.312) (-1986.639) -- 0:03:34
Average standard deviation of split frequencies: 0.004880
331100 -- (-1996.874) [-1986.349] (-1996.445) (-1991.181) * (-1985.326) [-1977.676] (-1989.550) (-1984.773) -- 0:03:34
331200 -- (-1999.694) (-1986.438) (-2005.064) [-1987.319] * (-1982.894) [-1979.007] (-1992.991) (-1988.224) -- 0:03:34
331300 -- (-1996.301) (-1992.742) (-1997.561) [-1986.887] * [-1986.580] (-1978.092) (-1988.829) (-1993.070) -- 0:03:33
331400 -- (-2001.569) (-1989.946) (-1992.941) [-1987.412] * (-1989.111) [-1980.360] (-1993.276) (-1995.351) -- 0:03:33
331500 -- (-2002.683) [-1988.392] (-1994.768) (-1991.393) * (-1986.637) [-1982.224] (-2000.912) (-1990.020) -- 0:03:33
331600 -- (-1992.700) [-1982.775] (-1985.739) (-1996.646) * (-1987.446) [-1983.275] (-1996.341) (-1997.661) -- 0:03:33
331700 -- (-1993.390) (-1984.101) [-1986.765] (-1985.788) * (-1994.065) [-1984.177] (-1998.020) (-1997.132) -- 0:03:33
331800 -- (-1987.927) (-1980.750) (-1999.981) [-1986.809] * (-2001.660) [-1985.824] (-2003.046) (-1997.541) -- 0:03:33
331900 -- (-1993.384) (-1984.370) (-1989.115) [-1985.334] * (-1996.526) [-1989.964] (-2000.398) (-2007.063) -- 0:03:33
332000 -- (-1994.092) (-1991.357) [-1984.363] (-1987.165) * [-1993.424] (-1990.812) (-1994.478) (-2016.469) -- 0:03:33
Average standard deviation of split frequencies: 0.005110
332100 -- (-1997.493) (-1988.129) [-1983.288] (-1988.769) * (-2000.028) [-1993.264] (-1993.074) (-2011.010) -- 0:03:33
332200 -- (-1994.242) (-1983.738) [-1986.853] (-1997.635) * (-1991.426) [-1985.742] (-1993.990) (-2000.049) -- 0:03:33
332300 -- (-1995.823) (-1982.592) [-1993.109] (-1985.545) * (-1994.242) (-1992.105) (-2001.335) [-1992.616] -- 0:03:34
332400 -- (-1996.654) [-1981.680] (-1992.857) (-1994.038) * [-1993.705] (-1988.846) (-2011.270) (-1987.015) -- 0:03:34
332500 -- (-2003.163) [-1979.908] (-1991.994) (-1988.470) * (-1989.673) [-1987.809] (-2002.560) (-1985.169) -- 0:03:34
332600 -- (-2003.448) [-1977.311] (-1995.448) (-1985.688) * (-1988.038) (-1992.806) (-2000.334) [-1991.700] -- 0:03:34
332700 -- (-2003.934) [-1982.854] (-1990.951) (-1991.789) * [-1986.288] (-1990.477) (-1999.328) (-1990.847) -- 0:03:34
332800 -- (-2000.805) [-1984.490] (-1988.309) (-1989.944) * (-1991.300) (-1992.314) (-2006.142) [-1986.027] -- 0:03:34
332900 -- (-2006.035) (-1989.329) (-1987.319) [-1987.656] * [-1985.886] (-1989.481) (-1994.942) (-1986.410) -- 0:03:34
333000 -- (-1995.345) (-1991.494) [-1990.050] (-1990.366) * [-1975.435] (-1986.794) (-1991.862) (-1982.757) -- 0:03:34
Average standard deviation of split frequencies: 0.005336
333100 -- (-2004.243) [-1991.275] (-1995.367) (-1986.954) * (-1980.682) [-1981.930] (-1997.155) (-1983.850) -- 0:03:34
333200 -- (-1998.610) [-1990.149] (-1984.889) (-1989.668) * [-1981.661] (-1977.068) (-1992.666) (-1982.278) -- 0:03:34
333300 -- (-2004.490) [-1979.818] (-1985.409) (-1989.329) * (-1982.316) [-1984.744] (-1994.049) (-1982.144) -- 0:03:34
333400 -- (-2003.873) (-1978.051) [-1986.529] (-1984.658) * (-1981.874) (-1985.197) (-1992.094) [-1988.811] -- 0:03:33
333500 -- (-1996.615) [-1980.129] (-1989.073) (-1986.693) * [-1983.806] (-1988.171) (-1993.482) (-1998.240) -- 0:03:33
333600 -- (-1998.853) (-1986.581) (-1987.164) [-1987.427] * (-1982.222) [-1983.513] (-1989.209) (-1995.276) -- 0:03:33
333700 -- (-2000.436) (-1988.468) [-1987.044] (-1985.866) * [-1979.041] (-1985.546) (-1986.483) (-1996.097) -- 0:03:33
333800 -- (-1990.562) (-1981.397) (-1984.856) [-1980.831] * [-1982.961] (-1984.409) (-1991.560) (-1997.788) -- 0:03:33
333900 -- (-1991.839) (-1985.498) (-1989.343) [-1980.069] * [-1979.468] (-1987.364) (-1993.227) (-1997.964) -- 0:03:33
334000 -- (-1991.140) (-1990.462) (-1991.584) [-1981.565] * [-1987.528] (-1988.193) (-1988.716) (-1988.624) -- 0:03:33
Average standard deviation of split frequencies: 0.005482
334100 -- (-1988.553) (-1991.183) (-1998.812) [-1981.578] * [-1984.629] (-1991.179) (-1986.155) (-1989.930) -- 0:03:33
334200 -- (-1988.541) (-1990.855) (-2006.717) [-1979.821] * [-1980.853] (-1990.049) (-1987.259) (-1983.598) -- 0:03:33
334300 -- (-1991.931) [-1989.361] (-1998.206) (-1978.988) * (-1983.552) (-1988.194) (-1992.572) [-1977.435] -- 0:03:33
334400 -- (-1991.582) (-1985.556) (-1996.941) [-1979.526] * (-1988.013) (-1995.001) (-1998.190) [-1980.871] -- 0:03:32
334500 -- (-1987.491) [-1980.198] (-1987.069) (-1982.688) * [-1982.899] (-1986.762) (-1999.796) (-1984.219) -- 0:03:32
334600 -- (-1995.346) [-1980.641] (-1992.364) (-1983.248) * (-1985.566) (-1987.101) (-1993.403) [-1981.723] -- 0:03:32
334700 -- (-1992.101) [-1982.069] (-1998.900) (-1988.245) * (-1987.685) (-1986.568) [-1988.305] (-1983.167) -- 0:03:32
334800 -- (-1987.410) (-1984.845) [-1992.641] (-1983.718) * (-1987.799) (-1985.065) (-1990.699) [-1981.756] -- 0:03:32
334900 -- (-1984.788) (-1981.570) (-1991.315) [-1981.354] * [-1984.343] (-1987.060) (-1995.160) (-1987.575) -- 0:03:32
335000 -- (-2005.278) [-1984.441] (-1993.161) (-1989.203) * (-1986.139) [-1981.933] (-2003.528) (-1989.057) -- 0:03:32
Average standard deviation of split frequencies: 0.005424
335100 -- [-1988.652] (-1990.729) (-1996.337) (-1991.817) * [-1984.860] (-1995.058) (-2002.381) (-1981.996) -- 0:03:32
335200 -- (-1989.423) (-1985.700) (-2000.771) [-1986.236] * (-1984.394) (-2004.523) (-1999.694) [-1979.239] -- 0:03:32
335300 -- (-1986.757) (-1988.368) (-2005.356) [-1983.591] * (-1984.694) (-2001.973) (-1996.976) [-1981.471] -- 0:03:32
335400 -- [-1985.325] (-1986.304) (-2006.506) (-1980.294) * (-1996.203) [-1991.434] (-1988.395) (-1981.858) -- 0:03:34
335500 -- (-1994.181) [-1983.565] (-2003.987) (-1986.495) * (-1985.884) (-1990.951) (-1989.701) [-1982.781] -- 0:03:33
335600 -- (-1992.961) [-1983.802] (-1998.022) (-1992.395) * (-1997.146) (-1994.164) (-1992.558) [-1982.763] -- 0:03:33
335700 -- (-1992.158) [-1986.137] (-2008.442) (-1998.388) * (-1987.977) [-1984.835] (-1996.438) (-1983.423) -- 0:03:33
335800 -- (-1992.935) [-1982.800] (-2003.968) (-2007.388) * (-1989.660) (-1994.246) (-1995.779) [-1980.383] -- 0:03:33
335900 -- (-1996.440) [-1981.029] (-1994.287) (-1997.683) * [-1987.746] (-1990.293) (-1991.168) (-1990.580) -- 0:03:33
336000 -- (-1990.125) [-1980.398] (-1990.858) (-2005.425) * (-1998.427) [-1984.455] (-2001.153) (-1992.954) -- 0:03:33
Average standard deviation of split frequencies: 0.005530
336100 -- (-1993.402) [-1981.745] (-1990.057) (-1997.406) * (-2003.766) [-1985.948] (-1994.929) (-1988.035) -- 0:03:33
336200 -- (-1991.381) [-1980.426] (-1995.093) (-1995.598) * (-1997.186) (-1986.423) (-2004.477) [-1985.976] -- 0:03:33
336300 -- (-1997.969) [-1980.102] (-1991.605) (-1991.023) * (-1992.850) (-1986.376) (-2001.504) [-1985.085] -- 0:03:33
336400 -- (-1993.801) (-1985.803) [-1987.992] (-1993.902) * [-1982.475] (-1991.581) (-1997.518) (-1983.123) -- 0:03:33
336500 -- (-1995.478) (-1985.334) [-1984.746] (-1999.713) * (-1987.833) (-2011.763) (-1998.352) [-1981.258] -- 0:03:32
336600 -- (-1999.037) (-1981.477) [-1989.653] (-1995.890) * (-1993.417) [-1994.700] (-1999.986) (-1981.093) -- 0:03:32
336700 -- (-1994.801) (-1983.761) (-1999.790) [-1987.686] * [-1981.310] (-1992.812) (-2000.495) (-1981.370) -- 0:03:32
336800 -- (-2006.684) (-1980.441) (-2000.097) [-1981.889] * [-1982.344] (-1993.121) (-2000.435) (-1987.872) -- 0:03:32
336900 -- (-2006.530) [-1983.984] (-1998.230) (-1986.841) * [-1981.341] (-1997.593) (-1995.405) (-1984.573) -- 0:03:32
337000 -- (-2005.599) (-1984.251) [-1992.466] (-1987.762) * (-1982.211) (-1996.908) (-2003.734) [-1982.154] -- 0:03:32
Average standard deviation of split frequencies: 0.005432
337100 -- (-2008.453) (-1981.000) (-1989.013) [-1991.374] * (-1983.506) (-1992.080) (-1997.336) [-1979.977] -- 0:03:32
337200 -- (-2000.952) [-1978.109] (-1989.588) (-1998.341) * (-1985.505) (-1989.130) (-1995.984) [-1978.135] -- 0:03:32
337300 -- (-1997.826) [-1981.765] (-1988.595) (-2003.464) * (-1989.189) [-1983.398] (-1996.492) (-1986.721) -- 0:03:32
337400 -- (-1997.780) (-1983.366) [-1982.042] (-1997.276) * [-1981.830] (-1986.669) (-1998.793) (-1993.902) -- 0:03:32
337500 -- (-1995.834) (-1980.009) [-1981.253] (-1996.197) * [-1981.649] (-1987.883) (-1996.049) (-1990.832) -- 0:03:32
337600 -- (-1997.323) [-1979.816] (-1987.941) (-1998.830) * (-1988.512) [-1989.052] (-1997.011) (-1988.773) -- 0:03:31
337700 -- (-1992.801) [-1981.337] (-1987.429) (-2001.503) * (-2002.081) (-1996.303) (-2001.490) [-1988.963] -- 0:03:31
337800 -- (-1996.471) [-1978.776] (-1983.841) (-1999.589) * [-1989.067] (-1986.092) (-1990.529) (-2001.562) -- 0:03:31
337900 -- (-1994.723) [-1983.317] (-1984.061) (-1997.846) * (-1987.206) [-1983.651] (-1991.865) (-1991.732) -- 0:03:31
338000 -- (-1990.053) [-1986.963] (-1989.032) (-1998.131) * [-1985.649] (-1993.695) (-1994.105) (-1998.170) -- 0:03:31
Average standard deviation of split frequencies: 0.005218
338100 -- [-1987.790] (-1989.551) (-1986.475) (-1990.112) * (-1982.293) [-1993.749] (-1991.634) (-1991.222) -- 0:03:31
338200 -- (-1994.829) (-1989.054) [-1988.953] (-1985.225) * [-1983.882] (-1993.258) (-1991.180) (-1983.106) -- 0:03:31
338300 -- (-1985.952) (-1993.241) [-1986.052] (-1981.257) * [-1981.799] (-2003.162) (-1995.208) (-1982.526) -- 0:03:31
338400 -- (-1994.254) (-1987.774) [-1989.222] (-1982.503) * [-1981.859] (-2009.834) (-1989.644) (-1984.060) -- 0:03:31
338500 -- (-1992.142) (-1987.464) [-1989.260] (-1980.989) * [-1978.088] (-1999.962) (-1989.173) (-1984.982) -- 0:03:33
338600 -- (-1998.706) (-1995.501) [-1983.297] (-1982.692) * [-1977.923] (-2000.372) (-1983.279) (-1988.255) -- 0:03:32
338700 -- (-2001.037) [-1987.866] (-1985.096) (-1996.540) * [-1980.524] (-1996.134) (-1983.673) (-1989.779) -- 0:03:32
338800 -- (-1995.356) (-1987.768) (-1980.132) [-1991.300] * [-1982.409] (-1990.156) (-1985.347) (-1984.747) -- 0:03:32
338900 -- (-1995.438) (-1989.989) [-1981.203] (-1995.719) * [-1985.638] (-1995.264) (-1983.078) (-1990.968) -- 0:03:32
339000 -- (-1993.310) (-1990.137) [-1985.297] (-1994.252) * (-1991.821) (-1999.149) (-1998.679) [-1981.014] -- 0:03:32
Average standard deviation of split frequencies: 0.005122
339100 -- (-1987.115) (-1995.000) [-1981.527] (-1995.082) * (-1986.981) (-1999.124) (-1986.518) [-1985.613] -- 0:03:32
339200 -- (-1985.174) [-1988.138] (-1984.901) (-1988.822) * (-1990.136) (-1997.529) [-1985.147] (-1992.427) -- 0:03:32
339300 -- (-1981.586) (-1991.308) (-1984.029) [-1982.287] * (-1992.297) (-1989.322) [-1982.227] (-1998.046) -- 0:03:32
339400 -- (-1986.494) (-1993.139) (-1997.095) [-1986.261] * (-1986.429) (-1990.366) [-1980.132] (-1998.499) -- 0:03:32
339500 -- (-1982.640) (-1994.815) [-1987.285] (-1988.628) * [-1985.793] (-1989.068) (-1979.642) (-1989.074) -- 0:03:32
339600 -- (-1987.951) (-1998.685) (-1994.034) [-1987.074] * (-1982.733) (-1990.646) [-1979.383] (-1987.997) -- 0:03:31
339700 -- (-1988.421) (-1988.199) [-1983.917] (-1983.091) * [-1984.041] (-2003.877) (-1984.880) (-1990.343) -- 0:03:31
339800 -- (-2000.379) (-1993.564) (-1985.338) [-1983.893] * [-1984.697] (-2002.969) (-1982.683) (-1985.039) -- 0:03:31
339900 -- (-1993.857) (-1982.689) (-1981.793) [-1984.976] * [-1981.781] (-2005.437) (-1981.677) (-1991.725) -- 0:03:31
340000 -- (-1991.195) (-1990.985) [-1988.576] (-1989.539) * [-1980.723] (-1996.710) (-1988.200) (-1991.168) -- 0:03:31
Average standard deviation of split frequencies: 0.005029
340100 -- (-1988.770) (-1988.906) [-1991.006] (-1987.591) * [-1983.938] (-1991.461) (-1986.539) (-1987.904) -- 0:03:31
340200 -- (-1986.377) [-1985.632] (-1990.565) (-1987.571) * (-1982.427) (-1999.090) (-1984.378) [-1993.526] -- 0:03:31
340300 -- [-1983.451] (-1988.808) (-1988.994) (-1988.040) * [-1983.545] (-1988.674) (-1990.237) (-1986.516) -- 0:03:31
340400 -- (-1989.045) (-1989.885) (-1983.719) [-1985.497] * (-1988.745) (-1988.238) (-1983.569) [-1986.875] -- 0:03:31
340500 -- (-1983.941) [-1989.189] (-1982.733) (-1986.353) * [-1984.293] (-1994.427) (-1984.440) (-1987.549) -- 0:03:31
340600 -- (-1992.836) (-2000.956) [-1983.680] (-1985.512) * (-1980.240) (-2000.479) [-1983.825] (-1988.980) -- 0:03:31
340700 -- (-1986.106) [-1985.688] (-1986.185) (-1982.533) * [-1981.545] (-1990.582) (-1997.890) (-1988.702) -- 0:03:30
340800 -- (-1984.016) (-1991.656) (-1982.573) [-1981.924] * (-1987.076) (-1994.443) [-1988.241] (-1999.276) -- 0:03:30
340900 -- (-1979.764) (-1989.036) (-1984.653) [-1981.241] * (-1986.046) (-1994.180) [-1987.653] (-1995.740) -- 0:03:30
341000 -- (-1978.036) (-1995.628) [-1978.635] (-1986.286) * (-1987.111) (-1982.159) [-1982.331] (-1990.717) -- 0:03:30
Average standard deviation of split frequencies: 0.005092
341100 -- (-1982.261) (-1999.574) [-1986.918] (-1987.294) * (-1989.146) (-1984.360) [-1983.483] (-1990.748) -- 0:03:30
341200 -- [-1981.902] (-2007.319) (-1986.556) (-1989.865) * [-1983.970] (-1983.686) (-1986.904) (-1993.407) -- 0:03:30
341300 -- (-1988.858) (-2003.373) [-1982.733] (-2001.159) * (-1996.777) [-1984.485] (-1986.401) (-1993.855) -- 0:03:30
341400 -- (-1990.646) (-2002.047) [-1983.499] (-1995.737) * (-1989.446) (-2000.917) [-1988.599] (-1995.469) -- 0:03:30
341500 -- [-1988.296] (-2003.291) (-1980.476) (-2001.260) * [-1989.404] (-1991.688) (-1988.163) (-1995.776) -- 0:03:30
341600 -- (-1986.860) (-1989.836) [-1983.021] (-1994.570) * (-1992.530) [-1990.023] (-1988.604) (-1992.337) -- 0:03:32
341700 -- [-1984.611] (-1999.982) (-1987.829) (-1992.339) * (-2000.342) [-1988.096] (-1979.782) (-2003.125) -- 0:03:31
341800 -- [-1985.250] (-1993.884) (-1987.029) (-1990.338) * [-1989.185] (-1984.093) (-1982.766) (-2005.939) -- 0:03:31
341900 -- [-1984.516] (-1999.297) (-1984.818) (-1991.228) * [-1984.477] (-1983.083) (-1993.200) (-2001.205) -- 0:03:31
342000 -- [-1979.594] (-1998.964) (-1985.569) (-1992.167) * (-1989.242) [-1984.831] (-1992.435) (-2002.889) -- 0:03:31
Average standard deviation of split frequencies: 0.005315
342100 -- [-1981.098] (-1992.048) (-1989.783) (-1988.354) * (-1986.882) (-1985.868) [-1980.901] (-1992.302) -- 0:03:31
342200 -- [-1983.273] (-1991.880) (-1993.897) (-1988.031) * (-1988.447) (-1982.754) [-1983.214] (-1997.148) -- 0:03:31
342300 -- [-1983.792] (-1990.594) (-1999.691) (-1984.490) * (-1982.850) [-1984.778] (-1995.061) (-1999.719) -- 0:03:31
342400 -- [-1982.351] (-1986.873) (-1991.746) (-1985.803) * [-1981.650] (-1989.505) (-1983.657) (-2008.856) -- 0:03:31
342500 -- [-1979.362] (-1990.517) (-1989.011) (-1984.792) * (-1983.892) [-1980.974] (-1981.456) (-2009.822) -- 0:03:31
342600 -- [-1978.172] (-1995.681) (-1996.698) (-1985.578) * (-1987.066) [-1981.195] (-1988.121) (-2003.601) -- 0:03:31
342700 -- (-1983.211) (-1996.126) (-1986.891) [-1988.248] * (-1983.484) [-1981.735] (-1983.591) (-2001.258) -- 0:03:30
342800 -- (-1979.525) (-1994.841) (-1987.664) [-1984.180] * (-1985.646) [-1981.323] (-1984.501) (-2004.810) -- 0:03:30
342900 -- (-1982.091) (-1996.941) [-1989.627] (-1987.385) * (-1984.926) [-1985.137] (-1986.468) (-1994.505) -- 0:03:30
343000 -- [-1984.293] (-1998.588) (-1986.302) (-1990.628) * [-1983.634] (-1980.151) (-1990.071) (-1995.319) -- 0:03:30
Average standard deviation of split frequencies: 0.005063
343100 -- (-1985.081) (-1991.179) (-1993.354) [-1988.241] * (-1998.991) [-1978.241] (-1983.531) (-1996.917) -- 0:03:30
343200 -- [-1981.400] (-1989.797) (-1991.948) (-1987.563) * (-1986.960) [-1987.064] (-1986.064) (-1998.835) -- 0:03:30
343300 -- [-1984.754] (-1987.121) (-1987.724) (-1989.251) * (-1987.848) (-1995.788) [-1990.366] (-2004.272) -- 0:03:30
343400 -- (-1989.805) (-1985.727) [-1984.660] (-1989.067) * (-1990.536) (-2006.644) [-1986.174] (-2003.591) -- 0:03:30
343500 -- (-1986.959) (-1991.399) [-1982.461] (-1988.330) * [-1984.997] (-1989.804) (-1994.906) (-2000.119) -- 0:03:30
343600 -- (-1984.970) (-1990.953) [-1978.608] (-1988.377) * (-1990.480) (-2000.850) [-1987.375] (-2001.030) -- 0:03:30
343700 -- (-1986.441) (-1988.182) [-1983.640] (-1989.041) * (-1993.320) (-2005.108) [-1986.331] (-2003.844) -- 0:03:30
343800 -- (-1986.478) (-1986.756) [-1983.386] (-1992.093) * (-1989.930) [-1988.769] (-1986.486) (-1999.267) -- 0:03:29
343900 -- (-1988.178) [-1986.435] (-1985.291) (-2011.226) * [-1979.584] (-1988.619) (-1988.049) (-1996.110) -- 0:03:29
344000 -- (-1989.164) [-1986.601] (-1990.989) (-2011.205) * [-1982.795] (-1990.812) (-1987.323) (-1998.857) -- 0:03:29
Average standard deviation of split frequencies: 0.005010
344100 -- (-1993.236) (-1986.171) [-1987.574] (-2014.351) * [-1984.560] (-1989.516) (-1988.017) (-1992.314) -- 0:03:29
344200 -- (-1998.247) (-1985.885) [-1988.596] (-1991.863) * (-1990.898) (-1986.547) [-1982.044] (-1999.277) -- 0:03:29
344300 -- (-2002.280) [-1987.639] (-1994.459) (-1986.104) * [-1984.720] (-1987.861) (-1984.570) (-1991.825) -- 0:03:29
344400 -- [-1991.529] (-1989.521) (-1986.001) (-1993.363) * (-1991.549) [-1987.449] (-1979.669) (-1986.712) -- 0:03:29
344500 -- (-1995.106) (-1992.370) [-1989.752] (-1997.152) * [-1982.245] (-1990.429) (-1977.938) (-1986.951) -- 0:03:29
344600 -- (-1990.464) (-1995.311) [-1983.971] (-1987.349) * (-1982.763) (-1987.689) [-1977.866] (-1989.658) -- 0:03:29
344700 -- (-1998.973) (-1985.952) (-1979.864) [-1990.584] * (-1981.843) (-1984.692) [-1982.128] (-1995.419) -- 0:03:31
344800 -- (-1995.396) (-1987.574) [-1977.131] (-1997.845) * [-1980.752] (-1986.142) (-1985.541) (-1985.613) -- 0:03:30
344900 -- (-1989.651) (-1986.754) [-1980.819] (-1991.520) * [-1982.703] (-1985.397) (-1985.773) (-1988.283) -- 0:03:30
345000 -- (-1986.471) [-1984.588] (-1983.267) (-1988.228) * [-1981.122] (-1980.177) (-1988.861) (-1991.745) -- 0:03:30
Average standard deviation of split frequencies: 0.005033
345100 -- (-1982.201) (-1988.211) [-1981.296] (-1986.632) * [-1983.269] (-1982.423) (-1991.808) (-1998.092) -- 0:03:30
345200 -- (-1990.794) (-1992.842) [-1985.254] (-1988.164) * [-1984.200] (-1990.279) (-1990.931) (-1994.710) -- 0:03:30
345300 -- (-1993.111) [-1993.860] (-1984.783) (-1994.653) * [-1980.089] (-1987.914) (-1997.391) (-1991.828) -- 0:03:30
345400 -- [-1990.431] (-1997.458) (-1987.058) (-1991.763) * [-1983.426] (-1985.079) (-1988.465) (-1994.245) -- 0:03:30
345500 -- (-1982.105) (-1999.357) (-1990.804) [-1989.277] * (-1983.306) [-1985.440] (-1992.170) (-1984.976) -- 0:03:30
345600 -- (-1986.426) [-1988.347] (-1991.052) (-1992.237) * (-1990.195) [-1983.916] (-1989.131) (-1985.783) -- 0:03:30
345700 -- [-1986.278] (-2003.137) (-1993.638) (-1993.508) * (-1990.161) [-1986.311] (-1988.728) (-1986.948) -- 0:03:30
345800 -- (-1983.491) (-2002.649) [-1987.360] (-1994.957) * (-1989.199) (-1984.749) [-1981.850] (-1994.896) -- 0:03:29
345900 -- [-1981.219] (-1998.543) (-1986.165) (-1993.127) * [-1985.180] (-1997.158) (-1989.140) (-1996.676) -- 0:03:29
346000 -- (-1979.650) (-1998.946) [-1983.601] (-1998.231) * (-1989.542) [-1991.959] (-1986.616) (-2011.739) -- 0:03:29
Average standard deviation of split frequencies: 0.005175
346100 -- (-1982.048) (-2007.731) [-1982.136] (-2001.838) * (-1990.708) (-1990.085) [-1979.937] (-2001.222) -- 0:03:29
346200 -- (-1982.433) (-1994.755) [-1979.462] (-2007.933) * (-1987.569) (-1991.679) [-1984.820] (-2009.992) -- 0:03:29
346300 -- (-1993.614) (-1995.673) [-1981.428] (-2004.434) * [-1985.059] (-1989.006) (-1987.655) (-2010.959) -- 0:03:29
346400 -- [-1992.463] (-1993.870) (-1981.895) (-1997.918) * (-1979.905) (-1990.172) [-1985.115] (-2019.268) -- 0:03:29
346500 -- (-1984.811) (-1989.761) [-1982.062] (-2009.470) * (-1990.832) [-1987.554] (-1980.925) (-2007.787) -- 0:03:29
346600 -- (-1989.554) (-1992.854) [-1982.299] (-1999.001) * (-1989.223) (-1988.392) [-1984.778] (-2019.311) -- 0:03:29
346700 -- [-1989.185] (-1989.030) (-1985.517) (-1993.664) * [-1981.515] (-1989.685) (-1982.485) (-2019.646) -- 0:03:29
346800 -- [-1991.006] (-1987.291) (-1996.223) (-1992.610) * [-1981.885] (-1986.822) (-1984.872) (-2025.297) -- 0:03:29
346900 -- [-1985.555] (-1986.421) (-1995.083) (-1997.994) * [-1980.206] (-1994.843) (-1985.452) (-2010.116) -- 0:03:28
347000 -- (-1982.865) [-1981.263] (-1994.211) (-1994.104) * [-1979.083] (-1996.351) (-1980.049) (-1999.452) -- 0:03:28
Average standard deviation of split frequencies: 0.005198
347100 -- (-1982.530) [-1985.486] (-1990.445) (-1990.002) * (-1981.621) (-1992.107) [-1978.683] (-2003.533) -- 0:03:28
347200 -- [-1980.173] (-1987.241) (-1986.973) (-1991.833) * (-1978.709) (-1983.546) [-1982.874] (-2001.965) -- 0:03:28
347300 -- [-1982.038] (-1990.709) (-1991.549) (-1995.389) * (-1979.206) (-1984.522) [-1981.410] (-2000.799) -- 0:03:28
347400 -- [-1983.541] (-1990.334) (-1994.630) (-1992.247) * (-1978.581) (-1985.136) [-1982.243] (-2005.073) -- 0:03:28
347500 -- (-1985.863) (-1991.607) (-1996.865) [-1990.266] * (-1981.554) (-1987.958) [-1980.584] (-1995.523) -- 0:03:28
347600 -- (-1987.753) [-1990.186] (-1996.634) (-1999.568) * (-1983.907) (-1989.763) [-1980.542] (-1999.254) -- 0:03:28
347700 -- (-1985.173) [-1994.549] (-1996.889) (-2000.129) * (-1996.357) [-1987.606] (-1981.278) (-2005.080) -- 0:03:28
347800 -- [-1992.837] (-1998.089) (-1993.641) (-1993.017) * (-1994.499) (-1984.339) [-1985.658] (-2016.624) -- 0:03:30
347900 -- (-1988.882) (-1991.908) (-1992.543) [-1987.403] * [-1993.104] (-1988.821) (-1988.681) (-2021.064) -- 0:03:29
348000 -- [-1985.720] (-1991.448) (-1990.810) (-1987.115) * (-1995.582) (-1986.291) [-1984.161] (-2020.832) -- 0:03:29
Average standard deviation of split frequencies: 0.004875
348100 -- [-1988.790] (-1986.707) (-1990.325) (-1984.899) * (-2007.310) [-1982.659] (-1989.204) (-2003.340) -- 0:03:29
348200 -- [-1979.621] (-1993.445) (-1985.638) (-1987.964) * (-1993.760) [-1983.351] (-1991.530) (-2002.277) -- 0:03:29
348300 -- [-1983.069] (-2002.775) (-1980.045) (-1983.200) * [-1988.959] (-1985.028) (-1998.677) (-2007.096) -- 0:03:29
348400 -- [-1979.321] (-1989.630) (-2000.695) (-1987.925) * (-1990.427) [-1981.174] (-1997.394) (-1998.540) -- 0:03:29
348500 -- [-1983.252] (-1993.144) (-1994.944) (-1987.736) * [-1986.946] (-1981.413) (-1995.803) (-1994.819) -- 0:03:29
348600 -- [-1982.729] (-1996.155) (-1997.494) (-1989.349) * (-1988.947) [-1978.553] (-1989.775) (-1997.276) -- 0:03:29
348700 -- [-1982.024] (-1996.351) (-1989.931) (-1987.743) * (-1992.412) (-1980.895) [-1990.736] (-1995.514) -- 0:03:29
348800 -- [-1981.894] (-1991.392) (-1998.422) (-1988.294) * (-1996.229) (-1982.861) [-1987.333] (-1995.359) -- 0:03:29
348900 -- [-1983.043] (-1994.418) (-1998.117) (-1992.406) * (-1990.006) (-1982.825) [-1988.944] (-1996.666) -- 0:03:29
349000 -- [-1983.947] (-1998.843) (-1993.277) (-1992.671) * [-1987.408] (-1983.990) (-1983.239) (-1995.592) -- 0:03:28
Average standard deviation of split frequencies: 0.004744
349100 -- [-1985.455] (-1997.235) (-1992.051) (-1996.523) * (-1987.737) [-1981.242] (-1994.792) (-1988.746) -- 0:03:28
349200 -- (-1982.542) (-2003.211) [-1984.476] (-1997.511) * (-1988.541) [-1982.922] (-1995.991) (-1988.494) -- 0:03:28
349300 -- (-1984.023) (-1998.709) [-1985.480] (-1999.461) * (-1991.849) [-1981.610] (-1994.246) (-1990.536) -- 0:03:28
349400 -- [-1982.836] (-1995.616) (-1985.751) (-1993.267) * (-1990.978) [-1981.548] (-1993.683) (-1994.866) -- 0:03:28
349500 -- [-1985.496] (-1989.321) (-1995.710) (-1991.820) * (-1994.064) [-1982.877] (-1994.388) (-1995.474) -- 0:03:28
349600 -- [-1986.109] (-1987.767) (-1994.160) (-1998.342) * (-1989.210) [-1986.286] (-1997.338) (-1994.675) -- 0:03:28
349700 -- (-1986.212) [-1983.134] (-1990.118) (-1990.721) * (-1987.100) [-1979.422] (-1996.504) (-1994.707) -- 0:03:28
349800 -- [-1982.277] (-1987.289) (-1986.633) (-1992.053) * (-1989.626) [-1982.411] (-1989.254) (-2000.117) -- 0:03:28
349900 -- (-1986.863) (-1995.409) [-1987.425] (-1992.645) * (-1991.515) [-1980.476] (-1984.618) (-1987.552) -- 0:03:28
350000 -- (-1983.624) (-1992.093) [-1986.771] (-1997.063) * (-1985.343) [-1981.827] (-1986.423) (-1991.919) -- 0:03:28
Average standard deviation of split frequencies: 0.004501
350100 -- [-1983.850] (-1990.197) (-1999.965) (-1994.361) * (-1983.278) [-1980.239] (-1989.125) (-1992.545) -- 0:03:27
350200 -- (-1983.870) (-1984.348) [-1992.849] (-1989.612) * (-1980.812) [-1981.683] (-1991.474) (-1985.160) -- 0:03:27
350300 -- (-1982.157) (-1985.111) (-1987.193) [-1983.613] * (-1987.652) [-1978.788] (-1983.044) (-1992.645) -- 0:03:27
350400 -- [-1982.094] (-1987.828) (-1985.917) (-1986.704) * (-1988.943) (-1979.859) [-1983.348] (-1988.032) -- 0:03:27
350500 -- [-1985.976] (-1987.207) (-1978.140) (-1985.707) * [-1982.564] (-1983.559) (-1977.762) (-1995.056) -- 0:03:27
350600 -- (-1992.763) [-1990.031] (-1984.279) (-1985.707) * (-1982.802) (-1981.533) [-1981.907] (-1993.844) -- 0:03:27
350700 -- (-1994.646) (-1990.175) [-1979.689] (-1994.492) * [-1985.386] (-1987.571) (-1989.310) (-1996.352) -- 0:03:27
350800 -- [-1992.469] (-2004.433) (-1982.633) (-1996.123) * (-1987.486) (-1999.196) (-1999.088) [-1993.761] -- 0:03:27
350900 -- (-1982.441) (-1993.763) [-1981.647] (-1991.067) * [-1981.177] (-1994.219) (-1993.029) (-1993.320) -- 0:03:29
351000 -- [-1981.049] (-2003.800) (-1987.988) (-1996.937) * (-1993.137) (-1982.615) [-1986.899] (-1991.794) -- 0:03:28
Average standard deviation of split frequencies: 0.004334
351100 -- [-1980.823] (-2001.887) (-1984.614) (-1996.421) * (-1986.783) (-1984.693) [-1984.814] (-1991.929) -- 0:03:28
351200 -- [-1982.471] (-1988.410) (-1990.243) (-1996.022) * (-1986.316) [-1984.230] (-1993.539) (-1990.394) -- 0:03:28
351300 -- [-1979.530] (-1985.236) (-1988.214) (-1995.770) * (-1986.558) (-1986.242) (-1999.211) [-1986.312] -- 0:03:28
351400 -- [-1983.489] (-1986.191) (-1979.006) (-1994.297) * (-1983.774) [-1981.854] (-1990.947) (-1989.073) -- 0:03:28
351500 -- [-1982.493] (-1992.303) (-1982.791) (-1991.847) * [-1984.561] (-1984.034) (-1988.065) (-1995.828) -- 0:03:28
351600 -- (-1983.431) (-1997.586) [-1981.748] (-1987.199) * (-1983.825) (-1991.013) [-1991.312] (-1996.555) -- 0:03:28
351700 -- [-1982.696] (-1985.659) (-1988.941) (-1991.132) * [-1982.389] (-1984.709) (-1988.060) (-1999.525) -- 0:03:28
351800 -- [-1990.258] (-1987.248) (-1983.789) (-1990.329) * (-1982.133) [-1993.521] (-1987.292) (-1997.306) -- 0:03:28
351900 -- (-1992.627) (-1994.148) [-1984.644] (-1990.250) * (-1987.780) (-1996.285) [-1985.683] (-1999.234) -- 0:03:28
352000 -- [-1984.287] (-1993.683) (-1984.572) (-1989.193) * (-1990.747) (-2001.624) [-1989.418] (-1997.078) -- 0:03:28
Average standard deviation of split frequencies: 0.004322
352100 -- [-1983.604] (-1999.443) (-1981.624) (-1990.497) * [-1983.575] (-1991.792) (-1984.967) (-1999.653) -- 0:03:27
352200 -- (-1982.324) (-1998.853) [-1985.507] (-1986.365) * (-1983.253) (-2000.605) [-1985.533] (-1994.363) -- 0:03:27
352300 -- [-1981.532] (-2000.812) (-1993.169) (-1991.671) * (-1981.550) (-2001.341) [-1980.164] (-1995.378) -- 0:03:27
352400 -- [-1979.943] (-1995.252) (-1988.462) (-1992.148) * (-1976.679) (-1992.385) [-1976.934] (-1991.808) -- 0:03:27
352500 -- (-1981.827) (-1989.009) [-1985.678] (-1991.874) * (-1979.334) (-1993.720) (-1980.807) [-1988.695] -- 0:03:27
352600 -- [-1977.452] (-1988.831) (-1988.132) (-1994.451) * [-1979.874] (-1993.252) (-1981.746) (-1988.876) -- 0:03:27
352700 -- [-1979.859] (-1990.305) (-1992.107) (-2001.455) * [-1983.804] (-1992.248) (-1980.266) (-1999.708) -- 0:03:27
352800 -- (-1984.570) (-2006.666) [-1985.851] (-1997.064) * (-1990.737) (-1992.660) [-1981.079] (-1990.760) -- 0:03:27
352900 -- (-1985.493) (-2009.315) (-1987.984) [-1991.119] * (-1994.084) (-1983.114) [-1979.037] (-1991.631) -- 0:03:27
353000 -- (-1985.727) (-2007.462) [-1987.694] (-2002.704) * (-1986.341) (-1985.148) [-1982.450] (-1996.102) -- 0:03:27
Average standard deviation of split frequencies: 0.004309
353100 -- [-1983.785] (-2014.460) (-1983.387) (-1997.861) * (-1983.618) [-1981.679] (-1982.805) (-2000.374) -- 0:03:27
353200 -- [-1980.608] (-2000.119) (-1983.342) (-2003.075) * [-1982.501] (-1982.510) (-1982.437) (-1996.128) -- 0:03:26
353300 -- [-1981.881] (-1994.793) (-1985.817) (-2002.304) * (-1983.108) (-1988.705) [-1981.423] (-1999.424) -- 0:03:26
353400 -- [-1984.449] (-1993.583) (-1982.979) (-2008.301) * (-1985.960) [-1983.521] (-1989.806) (-1991.670) -- 0:03:26
353500 -- [-1980.456] (-1992.427) (-1980.566) (-1995.897) * [-1988.774] (-1984.526) (-1984.421) (-1997.208) -- 0:03:26
353600 -- (-1987.054) (-1994.829) [-1981.646] (-1994.170) * (-1981.631) (-1986.095) [-1987.566] (-1993.177) -- 0:03:26
353700 -- (-1990.037) (-1998.481) [-1979.896] (-1994.117) * (-1987.800) (-1988.097) [-1983.333] (-1999.548) -- 0:03:26
353800 -- (-1992.873) (-1999.323) [-1982.219] (-1996.633) * (-1993.844) (-1990.488) [-1985.154] (-1993.292) -- 0:03:26
353900 -- (-1990.695) (-1998.178) [-1985.368] (-1993.438) * (-1989.475) (-1991.544) [-1983.225] (-1994.410) -- 0:03:26
354000 -- (-1995.252) (-1995.365) [-1984.976] (-1994.997) * (-1995.472) [-1985.717] (-1981.350) (-1991.626) -- 0:03:28
Average standard deviation of split frequencies: 0.004412
354100 -- (-1996.104) (-1997.650) [-1989.953] (-2003.516) * (-1988.622) (-1988.441) [-1989.570] (-1994.721) -- 0:03:27
354200 -- [-1993.262] (-2000.707) (-1989.592) (-2009.927) * (-1990.071) [-1983.383] (-1985.982) (-1993.246) -- 0:03:27
354300 -- (-1994.646) (-1999.097) [-1988.621] (-2008.015) * (-1989.106) [-1987.951] (-1987.555) (-1987.325) -- 0:03:27
354400 -- (-1989.015) (-1989.324) [-1984.129] (-2009.810) * (-1987.980) [-1986.615] (-1985.701) (-1988.145) -- 0:03:27
354500 -- (-1986.930) (-1998.964) [-1984.716] (-2003.947) * (-1988.747) (-1990.923) (-1990.298) [-1990.797] -- 0:03:27
354600 -- (-1994.885) (-1995.823) [-1981.351] (-2003.100) * (-2007.419) [-1995.084] (-1998.627) (-1993.854) -- 0:03:27
354700 -- (-1996.226) (-1992.206) [-1988.062] (-2005.495) * (-1994.885) [-1990.839] (-1997.535) (-1993.043) -- 0:03:27
354800 -- (-2000.221) [-1986.888] (-1993.859) (-1998.137) * (-1997.776) [-1983.434] (-1996.015) (-1991.310) -- 0:03:27
354900 -- (-2005.301) [-1992.993] (-1990.233) (-2006.028) * (-1989.085) [-1989.486] (-1994.407) (-1993.165) -- 0:03:27
355000 -- [-1989.777] (-1989.494) (-1984.616) (-2010.364) * (-1987.319) (-1988.003) (-1990.431) [-1991.618] -- 0:03:27
Average standard deviation of split frequencies: 0.004436
355100 -- (-1992.277) [-1986.652] (-1987.024) (-2007.318) * (-1995.754) [-1985.427] (-1990.751) (-1994.204) -- 0:03:27
355200 -- (-1984.999) (-1990.763) [-1985.932] (-2008.387) * (-2003.074) (-1984.755) [-1989.828] (-1991.829) -- 0:03:26
355300 -- (-1985.069) (-1997.274) [-1980.898] (-2003.622) * (-1990.954) [-1982.705] (-1990.216) (-1991.041) -- 0:03:26
355400 -- (-1986.644) (-1994.170) [-1982.448] (-2004.074) * (-1993.046) (-1984.539) [-1988.226] (-1997.108) -- 0:03:26
355500 -- [-1987.195] (-1996.721) (-1981.743) (-2010.779) * [-1984.192] (-1990.276) (-2001.544) (-1991.608) -- 0:03:26
355600 -- [-1981.775] (-2008.223) (-1986.216) (-2012.629) * (-1988.934) (-1988.911) (-1997.827) [-1983.866] -- 0:03:26
355700 -- [-1988.561] (-1996.087) (-1987.905) (-2010.600) * (-1983.968) [-1990.780] (-2000.427) (-1990.461) -- 0:03:26
355800 -- [-1985.578] (-1991.586) (-1985.472) (-2010.521) * [-1983.421] (-1992.366) (-1994.468) (-1991.476) -- 0:03:26
355900 -- [-1981.833] (-1988.732) (-1987.259) (-2006.702) * [-1978.814] (-1991.583) (-1993.071) (-1990.992) -- 0:03:26
356000 -- [-1979.622] (-1998.539) (-1991.144) (-2008.913) * [-1979.495] (-1988.979) (-1991.940) (-1990.032) -- 0:03:26
Average standard deviation of split frequencies: 0.004425
356100 -- [-1979.276] (-1993.499) (-1997.760) (-2019.433) * [-1981.278] (-1997.877) (-1998.985) (-1985.782) -- 0:03:26
356200 -- [-1982.242] (-1989.771) (-2005.728) (-2003.096) * [-1986.010] (-1990.707) (-2005.867) (-1990.628) -- 0:03:26
356300 -- [-1983.096] (-1990.779) (-1997.108) (-2005.431) * (-1982.960) [-1984.441] (-1998.853) (-1991.561) -- 0:03:25
356400 -- [-1978.160] (-1997.204) (-1989.467) (-2003.606) * [-1978.443] (-1991.770) (-1999.961) (-1998.940) -- 0:03:25
356500 -- (-1977.361) (-1985.182) [-1993.255] (-2007.727) * [-1977.629] (-1999.391) (-2005.684) (-1997.805) -- 0:03:25
356600 -- (-1986.294) [-1980.380] (-2002.038) (-2003.958) * [-1981.038] (-1994.263) (-2006.820) (-1990.795) -- 0:03:25
356700 -- (-1986.379) [-1985.208] (-2002.166) (-2008.852) * [-1982.538] (-1996.154) (-2011.140) (-1997.699) -- 0:03:25
356800 -- (-1984.669) [-1983.744] (-1995.240) (-1997.738) * (-1987.035) [-1989.223] (-2008.645) (-1992.162) -- 0:03:25
356900 -- (-1990.616) [-1982.242] (-2000.631) (-2003.910) * [-1995.179] (-1987.769) (-2006.643) (-1989.804) -- 0:03:25
357000 -- [-1981.847] (-1986.990) (-1989.694) (-2003.911) * (-1994.570) [-1984.166] (-2010.445) (-1990.095) -- 0:03:25
Average standard deviation of split frequencies: 0.004487
357100 -- [-1983.867] (-1988.807) (-1990.279) (-2001.692) * [-1989.214] (-1985.518) (-2007.572) (-1989.609) -- 0:03:27
357200 -- [-1985.430] (-1990.110) (-1991.042) (-2004.523) * (-1991.513) (-1982.649) (-2002.541) [-1982.866] -- 0:03:26
357300 -- (-1990.097) (-1988.451) [-1982.251] (-2009.397) * (-1990.377) (-1991.769) (-1999.235) [-1984.084] -- 0:03:26
357400 -- (-1990.677) [-1985.122] (-1992.622) (-2004.161) * (-1990.072) (-1985.077) (-1989.199) [-1985.925] -- 0:03:26
357500 -- (-1989.500) (-1984.888) [-1988.992] (-1998.429) * (-1989.335) [-1984.890] (-1985.975) (-1990.390) -- 0:03:26
357600 -- (-1990.935) (-1983.292) [-1985.883] (-1998.916) * (-1986.734) (-1985.993) [-1990.536] (-1987.858) -- 0:03:26
357700 -- (-1988.100) (-1986.116) [-1981.197] (-2006.446) * [-1985.317] (-1997.584) (-1991.653) (-1982.996) -- 0:03:26
357800 -- (-1989.632) [-1985.663] (-1982.163) (-1992.980) * [-1992.844] (-1999.623) (-1996.749) (-1984.563) -- 0:03:26
357900 -- (-1990.911) (-1989.416) [-1985.390] (-1996.027) * [-1987.127] (-1994.693) (-1991.262) (-1993.535) -- 0:03:26
358000 -- (-1994.872) (-1988.741) [-1981.142] (-1996.056) * (-1987.137) (-2002.350) (-1991.805) [-1988.163] -- 0:03:26
Average standard deviation of split frequencies: 0.004551
358100 -- (-1995.565) [-1987.123] (-1983.771) (-1991.712) * [-1996.324] (-1996.048) (-1988.136) (-1995.612) -- 0:03:26
358200 -- (-1994.871) (-1993.894) (-1984.708) [-1988.814] * (-1990.705) (-1994.257) [-1986.699] (-1989.896) -- 0:03:26
358300 -- (-1989.176) (-1986.611) [-1981.083] (-1995.185) * (-1990.564) (-1990.169) [-1989.880] (-1999.768) -- 0:03:25
358400 -- (-1992.735) [-1981.256] (-1986.328) (-1998.231) * (-1992.678) (-1997.174) [-1992.413] (-1995.139) -- 0:03:25
358500 -- (-1990.111) (-1985.449) [-1983.129] (-2000.927) * (-1989.838) (-1988.720) [-1987.369] (-2004.647) -- 0:03:25
358600 -- (-1999.105) (-1981.925) [-1983.840] (-2000.056) * [-1985.193] (-1987.202) (-1994.273) (-1997.698) -- 0:03:25
358700 -- (-1990.046) [-1980.998] (-1990.064) (-1989.578) * [-1989.024] (-1986.621) (-2001.669) (-1999.542) -- 0:03:25
358800 -- (-1984.735) [-1984.502] (-1991.940) (-1996.253) * (-1987.009) [-1982.560] (-2005.721) (-1998.543) -- 0:03:25
358900 -- (-1989.374) [-1982.987] (-1995.232) (-1996.097) * (-1989.104) [-1979.734] (-1997.482) (-1997.174) -- 0:03:25
359000 -- (-1987.968) [-1979.905] (-1994.455) (-1998.654) * (-1993.731) [-1984.427] (-1999.215) (-1994.845) -- 0:03:25
Average standard deviation of split frequencies: 0.004500
359100 -- (-1994.990) [-1979.196] (-1991.688) (-2006.129) * (-1997.798) [-1986.774] (-1998.702) (-1999.274) -- 0:03:25
359200 -- (-1997.111) [-1979.535] (-1998.720) (-2001.581) * (-2000.992) (-1996.309) [-1994.440] (-1995.516) -- 0:03:25
359300 -- (-1995.348) [-1977.226] (-1991.421) (-1999.710) * (-1998.952) [-1995.385] (-1990.851) (-1996.039) -- 0:03:25
359400 -- (-1992.896) [-1980.781] (-1987.932) (-1998.477) * (-2004.373) [-1998.080] (-1994.084) (-1994.604) -- 0:03:24
359500 -- (-1994.162) [-1980.426] (-1984.090) (-1992.760) * (-1995.104) [-1989.381] (-1988.677) (-1998.416) -- 0:03:24
359600 -- (-1991.189) [-1985.701] (-1981.432) (-1993.503) * [-1982.435] (-1987.133) (-1995.739) (-1997.476) -- 0:03:24
359700 -- (-1988.287) [-1982.356] (-1979.958) (-1992.711) * [-1984.282] (-1986.182) (-1995.113) (-1999.986) -- 0:03:24
359800 -- (-1993.281) (-1991.941) [-1978.725] (-1991.831) * [-1984.186] (-1982.091) (-2003.631) (-1992.900) -- 0:03:24
359900 -- (-1982.615) (-1997.934) [-1985.015] (-1992.387) * [-1979.791] (-1985.818) (-2000.977) (-1996.008) -- 0:03:24
360000 -- (-1989.943) (-1996.468) [-1984.634] (-1995.214) * (-1980.205) [-1981.882] (-2003.037) (-2006.101) -- 0:03:24
Average standard deviation of split frequencies: 0.004338
360100 -- (-1985.991) (-1999.696) [-1984.922] (-1997.147) * [-1980.614] (-1990.765) (-1994.745) (-2001.076) -- 0:03:26
360200 -- [-1985.131] (-1998.575) (-1982.774) (-1996.580) * [-1980.726] (-1991.071) (-1994.303) (-2004.204) -- 0:03:26
360300 -- (-1990.792) (-1990.844) [-1988.042] (-1990.097) * [-1979.177] (-2002.759) (-1998.487) (-1997.267) -- 0:03:25
360400 -- (-1983.840) (-1995.762) [-1989.467] (-1990.728) * [-1977.784] (-1993.554) (-1994.861) (-1993.602) -- 0:03:25
360500 -- [-1981.431] (-1987.233) (-1984.853) (-1993.764) * [-1977.235] (-1994.967) (-1990.533) (-1994.167) -- 0:03:25
360600 -- [-1977.597] (-1995.215) (-1991.676) (-1992.232) * [-1981.749] (-1996.616) (-1995.383) (-1999.699) -- 0:03:25
360700 -- [-1989.713] (-1989.839) (-1990.524) (-2001.850) * (-1979.777) (-1999.865) [-1989.035] (-2004.060) -- 0:03:25
360800 -- [-1982.708] (-1992.126) (-1993.828) (-1993.357) * [-1981.202] (-1998.125) (-1988.765) (-1991.590) -- 0:03:25
360900 -- [-1984.542] (-2000.002) (-1990.154) (-1996.801) * [-1980.811] (-2000.501) (-1998.173) (-1999.545) -- 0:03:25
361000 -- (-1985.210) [-1987.931] (-1985.827) (-2002.549) * [-1987.147] (-1996.722) (-1994.250) (-1992.823) -- 0:03:25
Average standard deviation of split frequencies: 0.004027
361100 -- (-1994.967) (-1992.985) [-1985.184] (-1998.554) * [-1978.733] (-1991.593) (-1995.838) (-1997.378) -- 0:03:25
361200 -- (-2004.858) (-1988.960) [-1986.160] (-1988.401) * [-1984.795] (-1989.140) (-1996.219) (-2002.129) -- 0:03:25
361300 -- (-2002.196) (-1988.992) [-1979.875] (-1992.503) * [-1982.554] (-1995.060) (-1998.578) (-2000.701) -- 0:03:25
361400 -- (-2000.099) (-1988.794) [-1982.876] (-1998.589) * (-1980.438) [-1993.061] (-2005.368) (-1998.293) -- 0:03:24
361500 -- (-1988.420) (-1987.400) [-1983.409] (-2000.099) * (-1985.630) [-1985.960] (-1995.908) (-1997.495) -- 0:03:24
361600 -- (-1986.337) (-1985.690) [-1980.467] (-1997.526) * [-1984.416] (-1986.138) (-2001.974) (-1992.405) -- 0:03:24
361700 -- (-1990.524) [-1984.316] (-1981.742) (-1990.414) * (-1987.009) [-1988.812] (-2002.733) (-1992.668) -- 0:03:24
361800 -- (-1988.630) (-1982.116) [-1980.823] (-1996.521) * (-1992.721) [-1986.954] (-2001.711) (-1995.739) -- 0:03:24
361900 -- (-1984.064) [-1983.379] (-1982.943) (-1989.375) * (-1988.222) [-1984.055] (-2000.164) (-1987.842) -- 0:03:24
362000 -- [-1985.169] (-1984.194) (-1995.083) (-1996.058) * (-1986.788) [-1984.224] (-2000.228) (-1989.333) -- 0:03:24
Average standard deviation of split frequencies: 0.003756
362100 -- (-1987.381) [-1980.502] (-1985.237) (-1989.367) * [-1986.049] (-1984.572) (-1990.360) (-1989.613) -- 0:03:24
362200 -- [-1984.012] (-1983.726) (-1988.238) (-1992.863) * [-1984.002] (-1991.271) (-1994.547) (-1992.405) -- 0:03:24
362300 -- (-1981.147) [-1982.827] (-1989.660) (-1996.779) * [-1981.793] (-1991.326) (-1998.542) (-1986.875) -- 0:03:24
362400 -- [-1985.629] (-1982.005) (-1987.645) (-1991.965) * [-1983.335] (-1987.568) (-2001.753) (-1988.923) -- 0:03:24
362500 -- (-1996.419) (-1980.629) [-1987.647] (-1991.475) * [-1983.567] (-1984.460) (-1996.797) (-1989.629) -- 0:03:24
362600 -- (-1990.015) (-1983.545) [-1982.351] (-1989.654) * [-1980.672] (-1993.956) (-1998.886) (-1988.592) -- 0:03:23
362700 -- (-1985.250) [-1988.138] (-1992.157) (-1994.433) * (-1986.032) [-1996.259] (-2003.956) (-1989.020) -- 0:03:23
362800 -- [-1981.030] (-1998.321) (-1991.173) (-1993.814) * (-1985.741) (-1985.435) (-2000.761) [-1987.637] -- 0:03:23
362900 -- [-1987.469] (-1992.181) (-1995.446) (-1990.949) * (-1982.914) (-1995.036) [-1991.654] (-1994.145) -- 0:03:23
363000 -- (-1985.257) [-1993.237] (-1997.429) (-1996.128) * [-1981.986] (-1997.529) (-2003.632) (-2003.000) -- 0:03:23
Average standard deviation of split frequencies: 0.003671
363100 -- [-1981.647] (-1989.024) (-1999.353) (-1993.868) * [-1985.964] (-1999.898) (-1994.575) (-2000.999) -- 0:03:23
363200 -- [-1984.971] (-1988.730) (-1986.554) (-1993.536) * (-1984.709) (-1992.697) (-1994.183) [-1986.757] -- 0:03:25
363300 -- [-1980.799] (-1988.290) (-1984.770) (-1997.696) * [-1984.732] (-1987.386) (-1998.861) (-1989.845) -- 0:03:25
363400 -- [-1986.011] (-1992.548) (-1989.782) (-2001.098) * [-1985.921] (-1987.805) (-1991.660) (-1989.421) -- 0:03:24
363500 -- [-1984.565] (-1989.227) (-1985.048) (-2000.121) * (-1989.746) [-1982.546] (-1994.463) (-1992.051) -- 0:03:24
363600 -- [-1982.817] (-1988.766) (-1985.967) (-2002.851) * (-1994.641) [-1982.729] (-1993.859) (-1992.125) -- 0:03:24
363700 -- (-1989.147) (-1994.239) [-1982.158] (-1999.865) * (-1998.119) [-1983.429] (-2006.904) (-1989.547) -- 0:03:24
363800 -- (-1988.533) (-1994.853) [-1981.643] (-1990.771) * (-1986.045) [-1984.366] (-1996.745) (-1994.352) -- 0:03:24
363900 -- (-1988.827) [-1990.875] (-1984.103) (-1990.677) * (-1992.595) [-1982.758] (-2009.210) (-1991.379) -- 0:03:24
364000 -- (-2000.733) [-1988.135] (-1983.829) (-1993.912) * (-1995.359) [-1982.329] (-2000.607) (-1994.205) -- 0:03:24
Average standard deviation of split frequencies: 0.003810
364100 -- (-1991.289) (-1991.731) [-1983.334] (-1991.949) * (-2009.865) [-1984.425] (-2010.312) (-1992.621) -- 0:03:24
364200 -- (-1985.846) (-1991.649) [-1987.992] (-1990.130) * (-2002.798) [-1984.237] (-2003.278) (-1990.925) -- 0:03:24
364300 -- [-1981.156] (-1984.672) (-1987.265) (-1991.636) * (-2000.154) [-1981.772] (-1993.775) (-1985.862) -- 0:03:24
364400 -- [-1987.218] (-1982.270) (-1985.545) (-1999.200) * [-1990.577] (-1986.725) (-1994.601) (-1990.047) -- 0:03:24
364500 -- (-1990.386) [-1978.911] (-1992.819) (-2005.616) * [-1989.572] (-1986.959) (-1989.370) (-1990.053) -- 0:03:23
364600 -- (-1993.001) (-1980.925) [-1985.752] (-1994.229) * (-1984.143) (-1991.684) [-1988.594] (-2005.799) -- 0:03:23
364700 -- (-1996.838) (-1984.448) [-1983.756] (-1997.007) * [-1983.699] (-1995.593) (-1989.693) (-2008.935) -- 0:03:23
364800 -- (-1998.769) (-1983.754) [-1985.395] (-2002.927) * [-1986.193] (-1994.858) (-1990.917) (-1999.904) -- 0:03:23
364900 -- (-1994.812) (-1980.715) [-1988.389] (-1994.296) * [-1987.133] (-1990.831) (-1992.063) (-1995.554) -- 0:03:23
365000 -- (-2003.230) [-1978.679] (-1984.976) (-1988.457) * (-1985.217) [-1993.722] (-1993.155) (-1997.434) -- 0:03:23
Average standard deviation of split frequencies: 0.003946
365100 -- (-1993.675) [-1984.880] (-1986.398) (-1992.532) * [-1992.738] (-1998.776) (-1999.967) (-2003.995) -- 0:03:23
365200 -- (-2002.498) (-1986.887) (-1983.608) [-1983.314] * (-1992.892) [-1990.335] (-1995.608) (-2011.354) -- 0:03:23
365300 -- (-1982.851) (-1984.996) [-1984.476] (-1989.464) * [-1992.067] (-1992.108) (-1997.180) (-1987.409) -- 0:03:23
365400 -- [-1981.915] (-1985.677) (-1993.117) (-1996.138) * (-1984.841) [-1981.562] (-1992.279) (-1997.540) -- 0:03:23
365500 -- [-1982.181] (-1981.618) (-1987.433) (-2001.276) * [-1987.831] (-1990.023) (-1985.397) (-1993.887) -- 0:03:23
365600 -- [-1983.144] (-1981.680) (-1991.050) (-1990.183) * (-1986.650) (-1983.754) [-1983.541] (-1999.710) -- 0:03:23
365700 -- [-1980.117] (-1986.227) (-1986.712) (-1996.870) * [-1987.851] (-1984.610) (-1987.816) (-1996.270) -- 0:03:22
365800 -- [-1981.111] (-1988.373) (-1988.098) (-1998.248) * [-1985.568] (-1984.330) (-1985.744) (-1990.078) -- 0:03:22
365900 -- [-1981.424] (-1982.715) (-1995.674) (-1993.053) * (-1996.923) (-1980.614) [-1985.339] (-1986.561) -- 0:03:22
366000 -- (-1983.080) [-1984.396] (-1988.539) (-1985.202) * (-1992.269) (-1982.959) (-1988.503) [-1983.582] -- 0:03:22
Average standard deviation of split frequencies: 0.004010
366100 -- [-1982.481] (-1985.662) (-1985.292) (-1996.445) * [-1986.929] (-1989.778) (-1997.315) (-1985.003) -- 0:03:22
366200 -- [-1982.314] (-1986.732) (-1984.245) (-1996.456) * (-1981.435) [-1981.910] (-1997.626) (-1986.140) -- 0:03:22
366300 -- (-1991.607) (-1981.116) [-1982.241] (-1987.116) * (-1991.068) (-1986.032) (-1994.967) [-1985.352] -- 0:03:24
366400 -- (-1993.912) [-1982.587] (-1989.578) (-1983.994) * (-1991.847) (-1983.150) [-1997.149] (-1990.900) -- 0:03:24
366500 -- (-1992.077) (-1993.453) (-1991.313) [-1983.711] * [-1991.644] (-1985.445) (-1993.828) (-1995.728) -- 0:03:23
366600 -- (-1985.828) (-1990.054) [-1983.111] (-1988.813) * (-1988.977) [-1983.430] (-1991.881) (-1993.505) -- 0:03:23
366700 -- (-1985.587) (-1987.511) [-1979.300] (-1993.678) * (-1986.786) [-1982.328] (-1988.413) (-1994.655) -- 0:03:23
366800 -- (-1982.403) [-1981.944] (-1980.968) (-1997.784) * (-1985.855) [-1982.697] (-1987.023) (-1988.498) -- 0:03:23
366900 -- (-1979.933) (-1984.506) [-1981.788] (-1997.384) * (-1983.989) [-1977.452] (-1989.231) (-1983.174) -- 0:03:23
367000 -- (-1994.882) (-1993.547) [-1988.386] (-2008.600) * (-1991.932) (-1980.666) [-1984.168] (-1989.659) -- 0:03:23
Average standard deviation of split frequencies: 0.004108
367100 -- (-1985.877) [-1984.987] (-1989.239) (-2003.660) * (-1991.489) (-1985.742) [-1986.040] (-1998.045) -- 0:03:23
367200 -- [-1980.800] (-1980.330) (-1983.430) (-2007.769) * (-1991.942) (-1987.316) [-1987.023] (-1992.567) -- 0:03:23
367300 -- (-1984.231) [-1983.681] (-1984.124) (-2011.106) * (-1987.019) (-1982.663) [-1987.500] (-1985.773) -- 0:03:23
367400 -- (-1995.340) (-1988.619) [-1978.536] (-2007.380) * (-1987.657) [-1987.503] (-1985.562) (-1998.070) -- 0:03:23
367500 -- (-1993.965) (-1985.713) [-1979.893] (-1999.152) * (-1988.231) [-1987.959] (-1985.981) (-1988.807) -- 0:03:23
367600 -- (-1990.804) (-1989.479) [-1988.359] (-1995.944) * [-1991.301] (-1996.307) (-1985.723) (-1996.392) -- 0:03:23
367700 -- [-1985.487] (-1982.547) (-1983.803) (-2000.790) * (-1989.188) (-2005.602) [-1984.622] (-1995.395) -- 0:03:22
367800 -- [-1982.527] (-1981.159) (-1980.837) (-2001.117) * [-1992.592] (-1995.099) (-1988.905) (-1993.167) -- 0:03:22
367900 -- (-1981.197) (-1984.510) [-1981.244] (-2000.147) * [-1995.523] (-1996.224) (-1994.582) (-1987.670) -- 0:03:22
368000 -- (-1986.340) [-1984.823] (-1983.246) (-2001.370) * (-1990.368) [-1986.348] (-1988.684) (-1994.658) -- 0:03:22
Average standard deviation of split frequencies: 0.004207
368100 -- (-1986.175) (-1985.608) [-1982.152] (-2000.075) * [-1986.001] (-1984.650) (-1993.322) (-1997.054) -- 0:03:22
368200 -- [-1984.670] (-1987.060) (-1995.905) (-2005.132) * (-1984.208) [-1985.190] (-1987.840) (-2005.613) -- 0:03:22
368300 -- (-1983.360) [-1984.667] (-1988.785) (-1995.813) * [-1984.365] (-1982.980) (-1984.910) (-2002.768) -- 0:03:22
368400 -- [-1983.800] (-1991.829) (-1992.294) (-1999.027) * [-1983.571] (-1984.394) (-1985.950) (-2004.476) -- 0:03:22
368500 -- [-1987.087] (-1993.003) (-1985.933) (-1993.290) * (-1979.695) [-1984.525] (-1984.899) (-1997.398) -- 0:03:22
368600 -- (-1982.456) (-1999.636) [-1982.163] (-1992.843) * (-1982.139) (-1988.936) [-1984.692] (-1997.169) -- 0:03:22
368700 -- [-1982.257] (-1993.828) (-1989.015) (-1990.285) * [-1980.083] (-1992.646) (-1985.057) (-1992.518) -- 0:03:22
368800 -- [-1983.550] (-1998.920) (-1989.267) (-1991.402) * (-1989.747) (-1988.338) [-1981.704] (-1986.864) -- 0:03:21
368900 -- [-1984.050] (-1986.643) (-1983.820) (-1985.393) * (-1992.232) (-1985.439) [-1989.313] (-1988.035) -- 0:03:21
369000 -- [-1981.236] (-1988.096) (-1989.787) (-1985.252) * (-1993.076) [-1986.392] (-1987.689) (-1990.604) -- 0:03:21
Average standard deviation of split frequencies: 0.004049
369100 -- (-1980.905) (-1990.813) (-1998.819) [-1980.156] * (-1994.826) [-1985.985] (-1986.823) (-1993.081) -- 0:03:21
369200 -- (-1986.077) (-1994.884) (-1999.429) [-1984.921] * (-2001.772) [-1982.855] (-1985.628) (-1993.725) -- 0:03:21
369300 -- [-1988.570] (-2001.093) (-1994.538) (-1994.647) * (-1998.726) (-1989.521) [-1992.902] (-1994.141) -- 0:03:21
369400 -- [-1985.348] (-2004.268) (-1990.312) (-1990.153) * (-1994.751) [-1979.862] (-1989.351) (-1996.755) -- 0:03:23
369500 -- (-1985.618) (-2003.717) [-1983.264] (-1993.852) * (-1993.439) [-1980.830] (-1990.925) (-1998.871) -- 0:03:23
369600 -- (-1988.357) (-1994.874) [-1991.644] (-1988.168) * (-1990.118) [-1980.874] (-1999.870) (-1999.844) -- 0:03:22
369700 -- [-1988.422] (-1995.054) (-1989.159) (-1986.722) * (-1994.075) [-1982.106] (-1995.698) (-1997.707) -- 0:03:22
369800 -- (-1992.906) (-1988.397) [-1994.791] (-1985.300) * (-1997.333) [-1982.943] (-1999.440) (-1994.768) -- 0:03:22
369900 -- (-1986.931) (-1987.810) (-1994.093) [-1986.828] * (-2001.852) [-1986.129] (-1994.947) (-1992.294) -- 0:03:22
370000 -- (-1989.402) (-1994.930) (-1991.871) [-1988.417] * (-1994.134) [-1990.544] (-1996.180) (-1995.093) -- 0:03:22
Average standard deviation of split frequencies: 0.004330
370100 -- [-1986.219] (-1988.957) (-1993.021) (-1990.700) * (-1997.220) [-1983.942] (-1996.997) (-1998.985) -- 0:03:22
370200 -- [-1986.541] (-1993.295) (-1994.696) (-1993.585) * (-1990.373) (-1987.370) (-2003.642) [-1993.332] -- 0:03:22
370300 -- (-1984.076) [-1989.036] (-1994.484) (-2003.825) * (-1997.476) [-1985.874] (-2006.946) (-1997.024) -- 0:03:22
370400 -- (-1982.028) [-1984.559] (-1996.125) (-2003.886) * (-1985.032) (-1985.564) (-2008.693) [-1989.683] -- 0:03:22
370500 -- [-1984.783] (-1980.687) (-2000.812) (-2004.149) * (-1988.459) [-1982.781] (-2010.239) (-1990.006) -- 0:03:22
370600 -- (-1987.438) [-1985.912] (-2001.547) (-2000.796) * [-1989.652] (-1985.016) (-1998.852) (-1991.581) -- 0:03:22
370700 -- (-1979.703) [-1986.938] (-2002.850) (-1997.082) * [-1991.441] (-1985.255) (-1995.865) (-1996.272) -- 0:03:22
370800 -- [-1983.284] (-1985.132) (-1989.617) (-1999.633) * (-1997.163) [-1981.688] (-1995.475) (-1995.428) -- 0:03:21
370900 -- [-1984.977] (-1986.101) (-1996.239) (-2007.076) * (-1993.684) [-1978.705] (-1988.587) (-1994.642) -- 0:03:21
371000 -- (-1993.239) (-1988.585) (-1994.405) [-1998.733] * (-1987.565) [-1977.718] (-1987.269) (-1993.078) -- 0:03:21
Average standard deviation of split frequencies: 0.004209
371100 -- (-2001.848) (-1988.367) (-1996.556) [-1989.590] * [-1982.526] (-1986.616) (-1991.122) (-1993.659) -- 0:03:21
371200 -- [-1988.350] (-1995.271) (-2010.589) (-1994.571) * [-1982.126] (-1993.451) (-1990.950) (-1992.627) -- 0:03:21
371300 -- (-1984.894) (-1996.267) (-2005.677) [-1991.902] * [-1981.573] (-1987.101) (-1992.074) (-1995.468) -- 0:03:21
371400 -- [-1983.462] (-1992.676) (-2004.541) (-2003.837) * [-1984.037] (-1987.854) (-1992.943) (-1999.276) -- 0:03:21
371500 -- (-1986.915) (-1993.582) [-1986.727] (-2002.674) * [-1983.387] (-1988.036) (-1989.502) (-1995.736) -- 0:03:21
371600 -- [-1987.474] (-1994.296) (-1995.102) (-1997.324) * (-1987.925) (-1988.895) [-1988.839] (-1994.087) -- 0:03:21
371700 -- [-1984.497] (-1996.462) (-1997.795) (-1995.606) * (-1992.326) [-1987.236] (-1990.717) (-1996.550) -- 0:03:21
371800 -- [-1986.701] (-1999.594) (-1998.032) (-1996.692) * (-2002.803) [-1985.806] (-2001.620) (-1992.725) -- 0:03:21
371900 -- (-1985.259) (-1995.172) (-2000.903) [-1991.464] * (-2000.743) (-1989.984) [-1987.288] (-2004.548) -- 0:03:20
372000 -- (-1984.896) (-1997.796) (-2002.892) [-1989.517] * (-2018.708) [-1988.789] (-1985.210) (-1999.525) -- 0:03:20
Average standard deviation of split frequencies: 0.004126
372100 -- [-1982.783] (-1995.556) (-2003.489) (-1988.543) * (-2008.135) [-1983.315] (-1994.123) (-2003.483) -- 0:03:20
372200 -- [-1982.250] (-1994.761) (-1994.648) (-1993.592) * (-2005.047) [-1980.114] (-1990.101) (-1996.460) -- 0:03:20
372300 -- [-1979.695] (-1996.354) (-1997.411) (-1996.493) * (-1991.200) [-1981.296] (-1996.246) (-1993.607) -- 0:03:20
372400 -- (-1986.310) [-1996.732] (-1997.410) (-1995.481) * [-1983.076] (-1986.634) (-1993.058) (-1996.556) -- 0:03:22
372500 -- [-1982.517] (-2001.757) (-1996.887) (-1990.702) * (-1987.734) [-1981.494] (-1990.102) (-1993.508) -- 0:03:22
372600 -- (-1986.720) (-1994.583) [-1990.181] (-1992.617) * (-1984.738) (-1978.239) (-1994.187) [-1986.609] -- 0:03:22
372700 -- [-1981.303] (-1989.170) (-1991.713) (-1994.800) * (-1988.320) (-1982.723) [-2001.154] (-1987.170) -- 0:03:21
372800 -- [-1981.014] (-1994.885) (-1993.763) (-1996.615) * [-1986.853] (-1980.062) (-1998.850) (-1991.700) -- 0:03:21
372900 -- [-1984.545] (-1991.401) (-1993.638) (-1990.996) * (-1987.068) (-1983.271) (-1991.195) [-1993.068] -- 0:03:21
373000 -- (-1984.000) [-1988.249] (-1993.049) (-1994.856) * (-1986.431) [-1988.266] (-1988.856) (-1989.240) -- 0:03:21
Average standard deviation of split frequencies: 0.004114
373100 -- (-1983.536) [-1982.636] (-1998.215) (-1994.697) * (-1984.353) [-1987.462] (-1986.847) (-1991.527) -- 0:03:21
373200 -- (-1988.750) [-1982.891] (-1994.456) (-1987.097) * (-1988.724) [-1990.560] (-1985.929) (-1988.152) -- 0:03:21
373300 -- (-1987.874) (-1986.780) (-1992.381) [-1995.863] * (-1984.780) (-1992.755) (-1995.836) [-1986.449] -- 0:03:21
373400 -- (-1988.113) [-1982.444] (-1988.763) (-1997.128) * (-1986.802) [-1983.324] (-1992.048) (-1990.105) -- 0:03:21
373500 -- (-1992.172) (-2000.951) [-1994.234] (-1995.211) * [-1980.452] (-1987.484) (-1994.750) (-1986.802) -- 0:03:21
373600 -- [-1988.055] (-2018.004) (-2002.376) (-1999.019) * (-1983.493) [-1984.732] (-1996.554) (-1994.824) -- 0:03:21
373700 -- (-1985.475) [-1993.997] (-2002.963) (-1999.250) * (-1987.757) [-1981.942] (-1993.288) (-1998.535) -- 0:03:21
373800 -- (-1992.948) [-1985.677] (-1997.419) (-2001.492) * (-1991.394) [-1984.345] (-2005.614) (-1992.134) -- 0:03:21
373900 -- (-1987.735) (-1995.698) [-1986.757] (-1998.103) * (-1986.479) [-1983.696] (-2003.329) (-1991.713) -- 0:03:20
374000 -- (-1986.830) (-1998.110) [-1985.292] (-1995.149) * (-1986.359) [-1982.929] (-2008.138) (-1983.861) -- 0:03:20
Average standard deviation of split frequencies: 0.003744
374100 -- (-1992.904) (-1996.764) [-1990.305] (-1995.353) * (-1988.049) [-1985.363] (-1998.724) (-1983.652) -- 0:03:20
374200 -- [-1989.673] (-2001.046) (-1985.196) (-2005.563) * (-1990.472) (-1987.703) (-2002.185) [-1983.018] -- 0:03:20
374300 -- (-1982.331) (-1995.268) [-1985.129] (-2003.181) * (-1986.782) [-1980.833] (-1998.263) (-1987.010) -- 0:03:20
374400 -- [-1984.166] (-2000.275) (-1990.746) (-2009.576) * (-1988.741) [-1979.462] (-1993.808) (-1994.201) -- 0:03:20
374500 -- (-1991.343) (-2003.526) [-1989.459] (-1995.442) * (-1991.964) [-1983.124] (-2004.830) (-1997.762) -- 0:03:20
374600 -- [-1989.788] (-1999.913) (-1992.041) (-1997.686) * (-1989.970) [-1980.754] (-1998.146) (-1990.936) -- 0:03:20
374700 -- [-1990.592] (-2004.242) (-1994.534) (-2004.145) * [-1995.137] (-1985.781) (-1998.609) (-1995.835) -- 0:03:20
374800 -- (-1988.058) (-1997.423) [-1995.893] (-1998.495) * (-1997.916) [-1987.071] (-1988.731) (-2001.698) -- 0:03:20
374900 -- [-1987.377] (-1998.538) (-2007.614) (-1997.843) * (-2002.808) (-1984.636) [-1989.585] (-2001.561) -- 0:03:20
375000 -- (-1987.948) (-1996.241) (-1996.854) [-1997.930] * (-2002.052) [-1981.039] (-1987.982) (-1995.673) -- 0:03:20
Average standard deviation of split frequencies: 0.003482
375100 -- [-1990.049] (-1989.107) (-2001.159) (-1996.300) * (-1996.952) (-1981.955) [-1987.990] (-1991.923) -- 0:03:19
375200 -- (-1987.531) (-1992.438) (-2002.165) [-1990.327] * (-1990.130) (-1982.457) [-1993.401] (-1998.532) -- 0:03:19
375300 -- (-1992.589) [-1989.468] (-2001.126) (-1995.584) * (-1987.416) [-1984.087] (-1992.480) (-1993.137) -- 0:03:19
375400 -- (-1991.885) [-1990.488] (-1996.216) (-1998.197) * (-1997.335) [-1985.393] (-1998.276) (-2000.091) -- 0:03:21
375500 -- [-1987.072] (-1988.318) (-1989.349) (-1993.959) * (-1996.638) [-1983.094] (-1997.991) (-2000.258) -- 0:03:21
375600 -- (-1994.046) (-1987.307) (-1997.648) [-1984.049] * (-2007.377) [-1985.970] (-1994.750) (-1992.660) -- 0:03:21
375700 -- (-1986.306) [-1989.293] (-1994.517) (-1987.832) * (-1991.926) (-1987.732) (-1992.882) [-1991.391] -- 0:03:21
375800 -- (-1988.960) (-1987.463) [-1993.069] (-1990.704) * (-1994.301) (-1990.257) (-1990.479) [-1991.698] -- 0:03:20
375900 -- (-1994.248) [-1983.380] (-1990.739) (-1992.385) * (-1990.681) [-1985.713] (-1991.644) (-2007.808) -- 0:03:20
376000 -- (-1992.870) (-1992.072) (-1988.386) [-1990.279] * (-1989.960) [-1989.186] (-1994.741) (-2001.258) -- 0:03:20
Average standard deviation of split frequencies: 0.003115
376100 -- [-1994.999] (-1989.970) (-1998.868) (-1984.892) * (-1989.357) [-1990.105] (-1992.819) (-2000.390) -- 0:03:20
376200 -- (-1996.485) (-1990.562) (-1985.945) [-1986.005] * [-1987.322] (-1993.650) (-2001.406) (-1996.268) -- 0:03:20
376300 -- (-2001.330) [-1984.618] (-1989.847) (-1992.454) * [-1988.240] (-1991.091) (-2003.306) (-1999.621) -- 0:03:20
376400 -- (-1996.507) (-1982.202) [-1988.300] (-1986.251) * [-1984.757] (-1987.438) (-1998.261) (-2000.354) -- 0:03:20
376500 -- (-1993.197) (-1987.995) (-1986.745) [-1985.696] * [-1988.389] (-1994.056) (-1996.036) (-2003.742) -- 0:03:20
376600 -- (-2002.417) (-2001.287) (-1993.075) [-1987.643] * [-1986.676] (-1995.566) (-1987.874) (-2005.123) -- 0:03:20
376700 -- (-1999.381) (-1993.451) [-1989.393] (-1993.016) * [-1986.302] (-1988.349) (-1984.804) (-2003.403) -- 0:03:20
376800 -- (-1993.236) [-1983.922] (-1989.589) (-1995.750) * (-1985.330) [-1981.358] (-1998.214) (-2002.016) -- 0:03:20
376900 -- (-1993.990) (-1982.463) [-1987.943] (-1990.666) * (-1988.287) [-1980.697] (-1990.410) (-2003.682) -- 0:03:20
377000 -- (-1994.440) [-1987.323] (-1987.226) (-1987.153) * (-1990.760) [-1981.994] (-1990.036) (-1990.550) -- 0:03:19
Average standard deviation of split frequencies: 0.002785
377100 -- (-2006.133) (-1988.914) (-1989.005) [-1983.908] * (-1993.909) [-1979.802] (-1994.934) (-1987.061) -- 0:03:19
377200 -- (-1996.618) [-1979.773] (-1987.017) (-1997.934) * (-1989.994) (-1985.095) (-2000.121) [-1981.663] -- 0:03:19
377300 -- (-1995.943) [-1983.953] (-1986.522) (-1991.765) * (-1994.879) (-1981.908) (-2005.576) [-1987.235] -- 0:03:19
377400 -- (-1993.407) [-1984.783] (-1989.560) (-1991.333) * (-1998.115) [-1978.143] (-1997.700) (-1991.855) -- 0:03:19
377500 -- (-1998.583) (-1985.624) (-1984.126) [-1986.083] * (-2001.503) [-1981.138] (-1989.231) (-1989.340) -- 0:03:19
377600 -- (-1994.966) (-1982.402) [-1990.960] (-1994.172) * (-1993.757) [-1980.509] (-1993.913) (-1988.735) -- 0:03:19
377700 -- (-1991.327) [-1985.645] (-1989.085) (-1997.791) * (-1985.287) (-1982.896) [-1997.734] (-1989.211) -- 0:03:19
377800 -- [-1987.836] (-1985.825) (-1990.849) (-1995.043) * (-1984.863) [-1985.159] (-1998.859) (-1986.214) -- 0:03:19
377900 -- (-1989.131) (-1989.486) (-1992.269) [-2000.160] * (-1986.505) [-1978.321] (-2002.722) (-1993.582) -- 0:03:19
378000 -- [-1990.803] (-1988.167) (-2004.902) (-1995.130) * (-1989.717) [-1980.474] (-1993.969) (-1998.439) -- 0:03:19
Average standard deviation of split frequencies: 0.002671
378100 -- (-1994.709) [-1984.818] (-1998.492) (-1995.587) * (-1992.448) [-1983.316] (-1999.472) (-2008.746) -- 0:03:19
378200 -- (-1991.425) [-1982.963] (-1999.609) (-1993.445) * (-1994.993) [-1981.812] (-1993.937) (-2010.982) -- 0:03:18
378300 -- (-1987.851) [-1987.610] (-1990.902) (-2000.978) * (-1991.652) [-1981.988] (-1996.723) (-2001.295) -- 0:03:18
378400 -- (-1990.690) [-1988.122] (-1995.760) (-2001.891) * (-1985.503) [-1985.464] (-1997.731) (-2002.559) -- 0:03:18
378500 -- (-1994.344) [-1985.142] (-1997.869) (-2003.966) * (-1988.226) (-1987.937) (-1999.811) [-1994.658] -- 0:03:20
378600 -- (-1999.631) [-1983.062] (-1992.343) (-2004.191) * (-1992.492) [-1986.127] (-2003.544) (-2001.184) -- 0:03:20
378700 -- (-2002.907) (-1982.038) [-1988.756] (-2003.980) * (-1987.444) [-1984.323] (-1997.555) (-2002.886) -- 0:03:20
378800 -- (-1997.663) [-1981.588] (-1995.750) (-2005.775) * (-1987.226) [-1980.498] (-1996.667) (-2005.826) -- 0:03:20
378900 -- (-1999.920) [-1982.822] (-1994.441) (-2015.596) * (-1990.181) [-1980.429] (-1996.262) (-2009.084) -- 0:03:19
379000 -- (-2003.623) [-1990.596] (-1988.166) (-2002.830) * (-1990.220) [-1980.416] (-1994.604) (-2004.600) -- 0:03:19
Average standard deviation of split frequencies: 0.002451
379100 -- (-1997.101) (-1987.591) [-1990.993] (-1995.829) * [-1984.064] (-1986.414) (-1984.141) (-1992.203) -- 0:03:19
379200 -- (-1994.317) [-1988.748] (-1990.316) (-1992.572) * [-1984.315] (-1992.843) (-1989.476) (-2004.739) -- 0:03:19
379300 -- [-1985.878] (-1994.073) (-1987.912) (-1990.193) * (-1994.054) (-1995.889) [-1985.811] (-1997.130) -- 0:03:19
379400 -- (-1985.073) (-1993.484) [-1989.527] (-1991.327) * (-1992.344) (-1994.277) [-1988.000] (-2002.398) -- 0:03:19
379500 -- [-1984.351] (-1998.130) (-1987.048) (-2000.027) * (-1994.456) (-2000.019) [-1990.658] (-2004.231) -- 0:03:19
379600 -- (-1985.370) (-1987.247) [-1987.874] (-1998.955) * (-1993.726) [-1993.196] (-1989.306) (-2001.188) -- 0:03:19
379700 -- [-1983.645] (-1993.190) (-1987.990) (-1995.842) * [-1988.495] (-1993.782) (-1984.900) (-2000.100) -- 0:03:19
379800 -- (-1986.004) (-1990.939) [-1986.106] (-1990.830) * (-1999.799) [-1986.973] (-1999.205) (-1993.196) -- 0:03:19
379900 -- [-1993.213] (-1989.782) (-1989.049) (-2001.670) * (-1998.386) [-1985.642] (-1989.947) (-1992.813) -- 0:03:19
380000 -- (-1982.738) [-1982.926] (-1987.705) (-1999.396) * (-1997.749) [-1988.716] (-1990.578) (-1993.760) -- 0:03:19
Average standard deviation of split frequencies: 0.002374
380100 -- (-1986.764) (-1987.034) [-1987.891] (-1995.985) * (-1992.982) [-1979.608] (-1982.574) (-1999.090) -- 0:03:18
380200 -- (-1997.320) (-1987.166) (-1992.147) [-1995.370] * (-1986.589) [-1982.510] (-1990.731) (-2012.121) -- 0:03:18
380300 -- (-1994.315) [-1982.010] (-1990.850) (-1997.842) * (-1988.109) (-1989.316) [-1984.691] (-2001.417) -- 0:03:18
380400 -- (-1997.679) [-1981.910] (-1988.274) (-1991.579) * (-1985.254) [-1982.538] (-1984.250) (-1999.409) -- 0:03:18
380500 -- (-1995.017) [-1979.357] (-1985.500) (-2001.682) * (-1985.183) (-1981.503) [-1986.762] (-1992.614) -- 0:03:18
380600 -- (-2000.816) (-1981.236) (-1998.982) [-1986.216] * [-1992.310] (-1980.065) (-1983.651) (-1999.345) -- 0:03:18
380700 -- (-1998.529) [-1982.775] (-2002.189) (-1988.822) * [-1985.448] (-1983.328) (-1983.372) (-1998.780) -- 0:03:18
380800 -- (-2000.210) (-1982.013) (-1997.094) [-1987.201] * (-1989.467) (-1989.193) [-1978.062] (-1995.628) -- 0:03:18
380900 -- (-1993.187) (-1990.177) [-1991.138] (-1998.199) * (-1987.020) (-1989.078) [-1983.565] (-1989.005) -- 0:03:18
381000 -- [-1987.344] (-1989.908) (-1993.508) (-1993.269) * (-1998.478) (-1986.071) [-1986.439] (-1990.994) -- 0:03:18
Average standard deviation of split frequencies: 0.002509
381100 -- (-1994.610) (-1992.967) (-1999.080) [-1994.252] * (-2000.050) (-1983.132) [-1985.471] (-1997.341) -- 0:03:18
381200 -- [-1992.696] (-1994.763) (-2001.773) (-1995.422) * [-1990.153] (-1984.357) (-1982.410) (-1993.900) -- 0:03:18
381300 -- (-1987.516) (-1991.784) (-1999.584) [-1984.975] * (-1990.047) [-1983.111] (-1986.801) (-1999.351) -- 0:03:17
381400 -- (-1986.180) (-1986.456) (-2007.860) [-1985.870] * (-1986.613) (-1989.828) [-1982.809] (-1989.095) -- 0:03:17
381500 -- (-1989.888) (-1988.221) (-2000.851) [-1986.579] * (-1987.106) (-1996.725) (-1989.125) [-1989.240] -- 0:03:17
381600 -- (-1992.147) (-1988.133) (-1997.274) [-1986.878] * (-1991.424) (-2001.226) (-1986.145) [-1990.386] -- 0:03:19
381700 -- (-1994.538) (-1985.872) (-1999.286) [-1988.903] * (-1988.313) (-2000.899) (-1984.474) [-1991.372] -- 0:03:19
381800 -- [-1988.770] (-1989.570) (-1996.570) (-1994.039) * (-1993.417) (-2002.014) [-1977.604] (-1988.091) -- 0:03:19
381900 -- (-1987.878) (-1989.333) [-1988.563] (-1991.874) * (-1995.512) (-2001.640) [-1983.351] (-1991.818) -- 0:03:19
382000 -- (-1991.721) (-1992.435) [-1989.033] (-1989.496) * (-1998.362) (-1999.189) [-1986.512] (-1993.254) -- 0:03:18
Average standard deviation of split frequencies: 0.002432
382100 -- [-1983.188] (-1997.130) (-1989.741) (-1992.208) * (-1986.398) (-2004.815) [-1984.811] (-1997.161) -- 0:03:18
382200 -- (-1992.087) (-1998.007) [-1985.361] (-1992.687) * [-1988.185] (-2002.254) (-1982.879) (-2000.584) -- 0:03:18
382300 -- (-1990.483) (-1993.681) [-1990.276] (-1994.848) * [-1988.982] (-1997.855) (-1980.745) (-1992.878) -- 0:03:18
382400 -- [-1984.445] (-1999.802) (-1995.940) (-1998.558) * (-1986.278) (-1993.457) (-1980.450) [-1985.813] -- 0:03:18
382500 -- (-1981.843) (-1997.357) (-1990.032) [-1992.518] * (-1994.523) (-1988.384) [-1983.629] (-1985.785) -- 0:03:18
382600 -- [-1995.054] (-2009.482) (-1997.670) (-1998.013) * (-1990.172) (-1992.023) (-1981.821) [-1982.410] -- 0:03:18
382700 -- [-1993.450] (-1998.116) (-1991.989) (-1997.218) * (-1994.339) (-1990.855) [-1981.899] (-1982.489) -- 0:03:18
382800 -- (-1989.839) (-2000.639) [-1990.994] (-1994.068) * (-1986.098) (-1988.862) [-1981.160] (-1980.997) -- 0:03:18
382900 -- (-1994.315) (-1995.529) [-1989.777] (-1993.309) * (-1991.912) (-1990.381) [-1982.872] (-1979.486) -- 0:03:18
383000 -- [-1986.453] (-1994.187) (-1988.502) (-1993.044) * (-1993.283) (-1990.955) [-1981.870] (-1987.977) -- 0:03:18
Average standard deviation of split frequencies: 0.002531
383100 -- [-1986.642] (-1988.422) (-1989.484) (-1996.370) * (-1994.179) [-1988.710] (-1994.208) (-1980.379) -- 0:03:18
383200 -- [-1985.826] (-1988.001) (-1991.052) (-2000.323) * (-2003.604) (-1985.642) (-1986.220) [-1976.368] -- 0:03:17
383300 -- [-1987.041] (-1994.690) (-1992.468) (-2005.018) * (-1995.325) [-1987.682] (-1993.083) (-1981.403) -- 0:03:17
383400 -- [-1983.133] (-1985.776) (-1991.105) (-2009.129) * (-1989.907) [-1986.257] (-1991.925) (-1984.973) -- 0:03:17
383500 -- (-1984.523) [-1982.753] (-1990.175) (-1996.263) * (-1996.205) (-1986.349) (-1996.328) [-1983.081] -- 0:03:17
383600 -- (-1982.320) [-1984.571] (-1990.593) (-1999.120) * (-2000.538) (-1987.517) (-1994.601) [-1987.192] -- 0:03:17
383700 -- (-1980.469) (-1991.263) [-1992.538] (-2008.650) * (-1992.458) (-1988.349) (-1990.765) [-1983.709] -- 0:03:17
383800 -- [-1980.824] (-1990.682) (-1984.210) (-1996.330) * (-1991.036) [-1989.107] (-1988.510) (-1987.852) -- 0:03:17
383900 -- [-1985.640] (-1987.285) (-1985.334) (-1993.147) * (-1999.108) [-1985.255] (-1995.230) (-1986.146) -- 0:03:17
384000 -- (-1992.692) (-1985.560) [-1989.258] (-1997.781) * (-1997.852) [-1988.344] (-1992.257) (-1983.859) -- 0:03:17
Average standard deviation of split frequencies: 0.002630
384100 -- [-1990.385] (-1992.235) (-1994.863) (-1992.570) * (-2000.619) (-1986.747) (-1996.729) [-1978.002] -- 0:03:17
384200 -- (-1989.540) (-1989.624) (-1996.260) [-1991.218] * (-1997.528) (-1994.179) (-1991.678) [-1979.585] -- 0:03:17
384300 -- (-1990.215) [-1986.842] (-1996.163) (-1993.522) * (-2003.738) (-1998.827) (-1990.549) [-1980.652] -- 0:03:17
384400 -- (-1989.699) (-1988.520) (-1986.865) [-1988.924] * (-1993.406) (-1995.884) (-1996.796) [-1983.479] -- 0:03:16
384500 -- [-1987.944] (-1996.790) (-1988.366) (-1990.013) * (-1996.341) (-1997.448) (-2000.764) [-1983.764] -- 0:03:16
384600 -- [-1980.460] (-1998.521) (-1986.385) (-1991.628) * (-1996.096) [-1989.969] (-1992.681) (-1981.053) -- 0:03:18
384700 -- [-1983.840] (-2005.043) (-1990.420) (-1990.144) * (-1993.282) (-1986.725) [-1992.237] (-1985.120) -- 0:03:18
384800 -- (-1980.387) (-1994.205) [-1994.452] (-1993.997) * (-1993.114) (-1995.991) (-1993.299) [-1986.254] -- 0:03:18
384900 -- (-1983.985) [-1989.548] (-1996.159) (-1990.295) * (-1990.768) (-1993.241) (-1997.890) [-1982.307] -- 0:03:18
385000 -- [-1984.571] (-1989.922) (-1991.691) (-1996.747) * (-1987.976) (-1987.223) (-1991.140) [-1977.408] -- 0:03:18
Average standard deviation of split frequencies: 0.002413
385100 -- (-1988.604) [-1989.922] (-1996.052) (-2008.562) * (-1992.163) (-1989.867) (-1993.429) [-1978.949] -- 0:03:17
385200 -- [-1982.157] (-1995.817) (-1992.429) (-1996.539) * (-1996.056) (-1986.665) (-1988.362) [-1979.818] -- 0:03:17
385300 -- (-1982.116) [-1990.667] (-1993.887) (-1997.067) * (-1996.703) [-1988.506] (-1998.709) (-1985.430) -- 0:03:17
385400 -- [-1980.279] (-1993.754) (-1986.903) (-1996.180) * (-1993.483) (-1987.210) (-1993.523) [-1991.273] -- 0:03:17
385500 -- [-1981.114] (-1998.773) (-1984.561) (-1993.279) * [-1984.156] (-1986.590) (-1992.068) (-1988.550) -- 0:03:17
385600 -- (-1979.808) (-1998.142) (-1988.607) [-1983.544] * [-1986.271] (-1987.855) (-1988.560) (-1986.813) -- 0:03:17
385700 -- [-1979.243] (-1999.923) (-1990.683) (-1988.286) * (-1984.651) (-1984.689) (-1990.856) [-1985.324] -- 0:03:17
385800 -- [-1977.259] (-2007.510) (-1983.285) (-1987.531) * (-1987.295) (-1994.155) [-1993.869] (-1989.403) -- 0:03:17
385900 -- [-1980.330] (-2001.390) (-1986.504) (-1989.326) * (-1992.032) (-1994.719) (-1991.078) [-1988.640] -- 0:03:17
386000 -- [-1977.372] (-2001.709) (-1992.933) (-1990.717) * (-1992.896) (-1992.978) (-1996.676) [-1988.184] -- 0:03:17
Average standard deviation of split frequencies: 0.002546
386100 -- [-1978.575] (-2004.264) (-1988.166) (-1986.666) * (-1993.081) (-1991.962) (-1989.798) [-1985.605] -- 0:03:17
386200 -- [-1980.443] (-1999.313) (-1994.064) (-1989.464) * (-1993.531) (-1991.788) (-1989.817) [-1982.451] -- 0:03:17
386300 -- [-1985.847] (-1998.207) (-2003.184) (-1991.200) * (-1992.260) (-1998.040) (-1997.420) [-1986.418] -- 0:03:16
386400 -- (-1989.683) [-1992.693] (-2010.619) (-1992.875) * (-1993.927) (-1991.877) (-2005.894) [-1981.213] -- 0:03:16
386500 -- (-1983.636) [-1990.297] (-2001.435) (-1990.752) * (-1992.501) (-1995.487) (-2003.696) [-1980.784] -- 0:03:16
386600 -- (-1984.540) (-1990.446) (-2004.267) [-1989.379] * (-1985.408) (-1988.872) [-1989.021] (-1985.920) -- 0:03:16
386700 -- (-1984.543) [-1985.800] (-2002.156) (-1994.264) * [-1985.156] (-1995.637) (-1987.967) (-1992.213) -- 0:03:16
386800 -- [-1979.579] (-1985.689) (-1996.423) (-1990.697) * [-1989.357] (-1996.280) (-1989.663) (-1992.713) -- 0:03:16
386900 -- (-1983.199) [-1984.267] (-1997.052) (-1991.569) * (-1984.894) (-1994.291) (-1986.496) [-1981.276] -- 0:03:16
387000 -- [-1985.021] (-1989.294) (-2000.957) (-1993.465) * [-1987.992] (-1993.856) (-1986.706) (-1985.444) -- 0:03:16
Average standard deviation of split frequencies: 0.002609
387100 -- (-1984.261) [-1990.378] (-2007.788) (-1991.455) * [-1985.452] (-1989.927) (-1994.066) (-1984.249) -- 0:03:16
387200 -- (-1982.857) [-1986.114] (-2001.309) (-1988.471) * (-1991.963) [-1987.564] (-1994.894) (-1988.427) -- 0:03:16
387300 -- (-1985.346) (-1996.084) (-2007.352) [-1987.334] * (-1994.560) (-1993.060) (-1992.329) [-1991.493] -- 0:03:16
387400 -- (-1984.497) (-1987.466) (-2004.442) [-1990.923] * (-1996.507) (-1993.842) (-1985.178) [-1984.093] -- 0:03:16
387500 -- [-1986.727] (-1987.987) (-2001.464) (-1995.331) * (-2002.624) (-1999.604) [-1983.520] (-1982.446) -- 0:03:16
387600 -- [-1986.329] (-1987.435) (-1990.913) (-1996.763) * (-1993.922) (-1992.194) [-1981.832] (-1985.715) -- 0:03:15
387700 -- (-1988.370) (-1983.321) [-1987.209] (-1992.733) * (-1997.098) (-1993.857) [-1986.905] (-1987.684) -- 0:03:17
387800 -- (-1986.255) (-1991.407) [-1987.771] (-1985.962) * (-2001.593) (-1997.984) (-1990.758) [-1988.377] -- 0:03:17
387900 -- [-1987.212] (-1994.977) (-1987.646) (-1986.019) * (-1992.190) (-1992.768) (-1992.575) [-1983.745] -- 0:03:17
388000 -- [-1982.262] (-1990.259) (-1987.759) (-1990.467) * [-1986.268] (-1993.993) (-1986.468) (-1981.841) -- 0:03:17
Average standard deviation of split frequencies: 0.002498
388100 -- [-1982.312] (-1997.271) (-1990.181) (-1992.983) * [-1985.400] (-1991.906) (-1986.552) (-1984.286) -- 0:03:17
388200 -- [-1981.748] (-1992.713) (-1995.920) (-1986.034) * [-1987.907] (-1996.432) (-1990.176) (-1984.972) -- 0:03:16
388300 -- [-1980.728] (-1997.328) (-1994.610) (-1989.670) * (-1989.381) (-1999.389) (-1994.268) [-1984.524] -- 0:03:16
388400 -- [-1985.178] (-1990.824) (-1996.877) (-1992.199) * (-1989.605) (-1995.768) (-2005.972) [-1984.471] -- 0:03:16
388500 -- [-1983.000] (-1983.221) (-2000.570) (-1995.697) * (-1989.297) (-1993.854) [-1989.313] (-1984.275) -- 0:03:16
388600 -- (-1984.742) [-1982.376] (-2011.040) (-1995.144) * [-1988.224] (-2000.368) (-1987.165) (-1987.605) -- 0:03:16
388700 -- (-1985.051) [-1981.439] (-2003.530) (-1993.019) * (-1991.410) (-1993.729) (-1996.353) [-1980.625] -- 0:03:16
388800 -- [-1989.250] (-1980.305) (-2008.292) (-1992.512) * (-1988.851) (-1996.932) (-1994.995) [-1982.855] -- 0:03:16
388900 -- (-1995.636) [-1981.192] (-1991.969) (-1990.220) * (-1987.058) (-1998.059) (-2006.178) [-1982.476] -- 0:03:16
389000 -- (-1989.772) [-1985.770] (-1988.088) (-1989.938) * (-2002.749) (-2003.237) (-1988.046) [-1982.667] -- 0:03:16
Average standard deviation of split frequencies: 0.002353
389100 -- (-1986.531) [-1982.221] (-1992.096) (-1989.395) * (-1999.748) (-1998.394) (-1984.575) [-1986.163] -- 0:03:16
389200 -- (-1989.708) [-1981.658] (-1991.977) (-1998.743) * (-1998.786) (-2000.693) (-1988.018) [-1983.056] -- 0:03:16
389300 -- (-1990.865) [-1978.400] (-1986.730) (-2001.909) * (-1996.368) (-1997.207) (-1983.016) [-1981.533] -- 0:03:16
389400 -- (-1991.833) [-1981.854] (-1984.845) (-2000.323) * (-1991.587) (-1997.578) [-1982.211] (-1982.067) -- 0:03:16
389500 -- (-1985.686) [-1983.364] (-1990.538) (-1998.373) * (-1993.816) (-1987.493) [-1983.418] (-1985.623) -- 0:03:15
389600 -- [-1984.225] (-1989.141) (-1987.152) (-1992.184) * (-1987.371) (-1988.219) [-1981.177] (-1993.341) -- 0:03:15
389700 -- (-1982.200) [-1981.514] (-1991.076) (-1987.692) * (-1992.811) (-1997.410) (-1983.057) [-1980.525] -- 0:03:15
389800 -- [-1983.287] (-1983.084) (-1995.606) (-1987.832) * (-1993.119) (-1998.117) (-1983.125) [-1985.191] -- 0:03:15
389900 -- (-1988.140) [-1978.124] (-1999.381) (-1990.576) * (-1988.464) (-1994.477) [-1982.212] (-1987.050) -- 0:03:15
390000 -- (-1987.131) [-1981.651] (-2005.450) (-1995.216) * (-1991.062) (-1993.735) [-1979.181] (-1985.283) -- 0:03:15
Average standard deviation of split frequencies: 0.002209
390100 -- [-1985.044] (-1979.872) (-2003.991) (-1997.011) * (-1990.297) (-1982.967) [-1979.034] (-1983.826) -- 0:03:15
390200 -- (-1986.446) [-1976.359] (-2001.471) (-1996.784) * (-1989.784) (-1992.597) [-1981.662] (-1986.259) -- 0:03:15
390300 -- (-1986.607) [-1981.065] (-2005.787) (-1995.394) * (-1991.242) (-1989.372) (-1981.647) [-1980.557] -- 0:03:15
390400 -- [-1985.952] (-1978.549) (-2009.701) (-1999.970) * (-1990.332) (-1989.653) [-1984.962] (-1983.520) -- 0:03:15
390500 -- [-1981.493] (-1979.816) (-2003.324) (-1994.224) * (-1996.819) [-1990.463] (-1991.476) (-1996.895) -- 0:03:15
390600 -- [-1988.345] (-1985.212) (-2011.685) (-2001.795) * (-2004.247) (-1984.055) (-1987.186) [-1988.183] -- 0:03:15
390700 -- (-1984.547) [-1984.973] (-2000.295) (-1998.378) * (-2000.647) [-1981.904] (-1991.201) (-1992.058) -- 0:03:14
390800 -- (-1992.026) (-1985.810) [-1997.750] (-2003.337) * (-1999.989) [-1984.568] (-1989.609) (-1989.332) -- 0:03:16
390900 -- (-1988.445) [-1989.894] (-2005.052) (-1994.596) * (-1996.682) [-1982.325] (-1979.319) (-1984.887) -- 0:03:16
391000 -- (-1990.155) (-1979.825) (-1993.879) [-1985.238] * (-1993.618) (-1986.015) (-1981.157) [-1988.062] -- 0:03:16
Average standard deviation of split frequencies: 0.002100
391100 -- (-1987.114) [-1985.377] (-1995.228) (-1988.460) * (-1997.677) (-1985.822) (-1983.499) [-1984.298] -- 0:03:16
391200 -- [-1976.158] (-1985.055) (-1997.241) (-1995.857) * (-1984.291) (-1980.050) (-1989.180) [-1982.032] -- 0:03:16
391300 -- (-1979.631) [-1981.624] (-1994.637) (-1987.199) * (-1988.296) (-1981.807) (-1990.303) [-1984.157] -- 0:03:16
391400 -- (-1995.523) (-1984.723) (-1994.629) [-1987.436] * (-1992.056) [-1980.484] (-1992.713) (-1983.790) -- 0:03:15
391500 -- [-1987.688] (-1993.136) (-1995.317) (-1988.838) * (-1989.655) (-1976.492) [-1985.241] (-1989.338) -- 0:03:15
391600 -- (-1994.268) (-2001.948) (-1996.130) [-1992.352] * (-1991.966) [-1978.262] (-1990.943) (-1988.765) -- 0:03:15
391700 -- [-1991.007] (-1990.052) (-1992.800) (-1990.306) * (-1999.931) (-1983.017) [-1989.936] (-1992.043) -- 0:03:15
391800 -- (-1999.116) (-1998.007) (-1990.900) [-1990.832] * (-2001.942) [-1980.954] (-1995.067) (-1987.432) -- 0:03:15
391900 -- [-1984.610] (-1995.907) (-1991.865) (-1990.642) * (-2005.585) [-1980.175] (-2000.115) (-1991.476) -- 0:03:15
392000 -- (-1982.964) (-2000.333) [-1987.881] (-1986.689) * (-1989.747) [-1984.931] (-2001.728) (-1986.017) -- 0:03:15
Average standard deviation of split frequencies: 0.002095
392100 -- (-1981.934) (-2002.467) (-1988.318) [-1989.574] * (-1994.732) [-1980.098] (-1989.592) (-1993.525) -- 0:03:15
392200 -- (-1983.584) (-2013.866) (-1995.335) [-1987.673] * (-1999.006) [-1985.894] (-1982.673) (-1997.631) -- 0:03:15
392300 -- [-1981.240] (-2005.897) (-1991.561) (-1990.869) * (-2000.077) (-1985.013) [-1979.804] (-2006.228) -- 0:03:15
392400 -- (-1986.916) (-2000.356) (-1992.168) [-1988.956] * (-1993.501) (-1986.751) [-1983.755] (-1992.572) -- 0:03:15
392500 -- (-1994.847) (-2004.756) [-1994.666] (-1989.911) * (-2003.522) (-1994.694) [-1982.402] (-1997.119) -- 0:03:15
392600 -- [-1985.244] (-2011.690) (-1992.129) (-1988.648) * (-2007.176) (-1993.437) [-1985.432] (-1999.387) -- 0:03:14
392700 -- [-1981.376] (-2002.201) (-1998.100) (-1990.840) * (-1997.292) (-1984.448) [-1980.649] (-2007.797) -- 0:03:14
392800 -- [-1981.033] (-2003.758) (-1996.272) (-1996.100) * (-1995.144) (-1985.023) [-1980.301] (-2001.041) -- 0:03:14
392900 -- [-1976.551] (-1999.037) (-1992.790) (-1997.514) * (-1987.514) [-1980.300] (-1982.380) (-1995.211) -- 0:03:14
393000 -- [-1977.685] (-1991.800) (-1991.043) (-1992.070) * (-1985.802) [-1980.630] (-1983.329) (-1997.062) -- 0:03:14
Average standard deviation of split frequencies: 0.002089
393100 -- [-1979.533] (-2013.842) (-1987.162) (-1989.923) * (-1987.922) [-1981.941] (-1980.977) (-2000.301) -- 0:03:14
393200 -- (-1980.869) (-2010.660) [-1985.196] (-1995.133) * (-1992.111) [-1980.159] (-1988.969) (-2001.002) -- 0:03:14
393300 -- [-1981.242] (-2007.231) (-1984.575) (-1992.436) * (-1993.334) [-1984.354] (-1991.420) (-1994.478) -- 0:03:14
393400 -- (-1986.505) (-1996.696) [-1987.621] (-1994.554) * (-1992.395) [-1985.677] (-1989.581) (-1987.900) -- 0:03:14
393500 -- (-1993.113) (-1996.436) [-1987.365] (-1986.918) * (-1995.847) (-1986.617) [-1986.939] (-1987.952) -- 0:03:14
393600 -- [-1985.135] (-2001.069) (-1989.437) (-1986.891) * (-1994.764) [-1983.509] (-1987.854) (-1989.455) -- 0:03:14
393700 -- [-1984.013] (-2005.587) (-1991.819) (-1982.433) * (-1995.257) [-1983.843] (-1988.656) (-1990.732) -- 0:03:14
393800 -- [-1983.925] (-2003.181) (-1993.600) (-1990.247) * (-1995.981) [-1987.959] (-1992.621) (-1993.417) -- 0:03:13
393900 -- (-1986.615) (-1998.379) (-1998.750) [-1984.803] * (-1993.476) [-1982.444] (-1989.747) (-1990.921) -- 0:03:15
394000 -- [-1983.051] (-2008.813) (-2000.364) (-1989.996) * (-1994.916) [-1983.516] (-1986.586) (-1996.185) -- 0:03:15
Average standard deviation of split frequencies: 0.001880
394100 -- [-1982.360] (-2005.458) (-1997.686) (-2001.073) * [-1989.955] (-1987.089) (-1984.829) (-1993.035) -- 0:03:15
394200 -- [-1980.405] (-2012.326) (-1992.042) (-2002.275) * [-1991.105] (-1987.733) (-1986.323) (-1994.274) -- 0:03:15
394300 -- [-1985.550] (-2009.244) (-1991.127) (-1993.111) * (-1989.286) [-1980.254] (-1994.010) (-1999.278) -- 0:03:15
394400 -- (-1980.565) (-2005.016) (-1984.225) [-1986.538] * (-1984.429) [-1979.493] (-1984.804) (-2002.290) -- 0:03:15
394500 -- (-1983.455) (-2008.443) [-1982.977] (-1986.630) * (-1992.604) (-1982.014) [-1980.911] (-2000.339) -- 0:03:14
394600 -- [-1985.116] (-2002.141) (-1986.041) (-1986.680) * (-1985.809) (-1987.527) [-1982.716] (-1999.266) -- 0:03:14
394700 -- (-1995.711) (-2001.143) [-1987.615] (-1992.233) * (-1992.940) (-1988.270) [-1980.156] (-1996.175) -- 0:03:14
394800 -- [-1983.499] (-1993.605) (-1989.099) (-1990.135) * (-1994.268) (-1984.406) [-1978.890] (-1995.848) -- 0:03:14
394900 -- (-1990.673) [-1991.285] (-1988.619) (-1992.679) * (-1993.647) (-1982.468) [-1981.262] (-1998.474) -- 0:03:14
395000 -- (-1983.371) (-1990.098) (-1989.971) [-1988.657] * (-1996.369) [-1985.499] (-1980.950) (-2005.766) -- 0:03:14
Average standard deviation of split frequencies: 0.001806
395100 -- [-1981.219] (-1995.851) (-1991.313) (-1996.281) * (-1992.439) (-1988.720) [-1978.570] (-2000.391) -- 0:03:14
395200 -- [-1980.993] (-1993.218) (-1990.881) (-1987.040) * (-1991.959) (-1991.029) [-1977.799] (-1996.894) -- 0:03:14
395300 -- [-1981.139] (-1991.249) (-1996.693) (-1992.248) * (-1996.893) (-1985.127) (-1985.863) [-1988.723] -- 0:03:14
395400 -- (-1982.798) (-1994.165) [-1993.266] (-1990.746) * (-1994.498) (-1994.210) [-1987.186] (-1992.578) -- 0:03:14
395500 -- [-1990.037] (-1996.923) (-1992.177) (-1991.814) * (-1994.772) (-1995.123) [-1985.729] (-1994.287) -- 0:03:14
395600 -- [-1988.183] (-1993.556) (-2004.850) (-1993.425) * (-2000.921) (-1996.419) (-1991.981) [-1992.915] -- 0:03:14
395700 -- (-1987.237) [-1990.426] (-2003.423) (-1999.140) * (-2002.719) (-1995.546) [-1990.225] (-1990.950) -- 0:03:13
395800 -- [-1986.198] (-1997.420) (-1998.405) (-1988.443) * (-1998.109) (-1995.080) (-1991.348) [-1988.645] -- 0:03:13
395900 -- (-1992.346) (-1992.225) [-1994.644] (-1986.765) * (-1993.275) [-1992.082] (-2001.717) (-1986.609) -- 0:03:13
396000 -- [-1986.233] (-1993.122) (-1996.359) (-1990.981) * [-1986.892] (-1988.642) (-2001.968) (-1988.542) -- 0:03:13
Average standard deviation of split frequencies: 0.001700
396100 -- [-1984.697] (-1995.911) (-1999.849) (-1989.296) * (-1994.009) (-1992.222) (-2000.059) [-1991.618] -- 0:03:13
396200 -- [-1984.630] (-1990.953) (-1996.049) (-1984.732) * [-1992.919] (-1995.940) (-2000.024) (-1998.699) -- 0:03:13
396300 -- (-1985.385) (-1995.192) (-1998.970) [-1987.624] * (-1990.735) [-1990.104] (-1996.278) (-1992.556) -- 0:03:13
396400 -- (-2000.632) [-1991.269] (-1991.683) (-1987.992) * (-1980.573) [-1983.363] (-1995.140) (-1988.237) -- 0:03:13
396500 -- (-1998.271) (-1996.539) [-1991.783] (-1987.508) * (-1983.657) [-1992.057] (-1995.256) (-1992.227) -- 0:03:13
396600 -- [-1994.493] (-1991.824) (-1991.130) (-1989.846) * (-1979.444) [-1986.313] (-1998.540) (-2005.932) -- 0:03:13
396700 -- (-1997.854) [-1989.836] (-1990.910) (-1993.076) * [-1984.211] (-1984.490) (-1992.018) (-2004.123) -- 0:03:13
396800 -- (-1998.640) (-1984.852) (-2003.872) [-1987.185] * [-1984.348] (-1982.524) (-2000.402) (-2008.368) -- 0:03:13
396900 -- (-1988.230) [-1989.154] (-1992.212) (-1989.184) * (-1985.820) [-1981.275] (-2000.459) (-1997.438) -- 0:03:12
397000 -- (-1991.165) [-1990.375] (-2002.160) (-1990.629) * (-1982.811) [-1984.108] (-1999.680) (-2011.318) -- 0:03:14
Average standard deviation of split frequencies: 0.001628
397100 -- [-1990.639] (-1998.216) (-1990.131) (-1989.755) * (-1990.366) [-1982.401] (-2000.584) (-2010.589) -- 0:03:14
397200 -- [-1984.860] (-1999.903) (-1989.326) (-1987.328) * (-1989.690) [-1988.834] (-2002.544) (-2003.542) -- 0:03:14
397300 -- [-1984.518] (-1996.026) (-1988.668) (-1985.459) * (-1981.869) [-1980.819] (-1998.454) (-1997.624) -- 0:03:14
397400 -- [-1983.372] (-1999.096) (-1989.102) (-1987.711) * (-1984.278) [-1978.532] (-1995.512) (-2000.285) -- 0:03:14
397500 -- [-1985.440] (-2009.929) (-1989.031) (-1993.371) * [-1981.053] (-1977.757) (-1997.796) (-1994.054) -- 0:03:14
397600 -- (-1983.860) (-2004.896) (-1989.518) [-1990.039] * (-1986.301) [-1977.444] (-1990.953) (-1992.907) -- 0:03:13
397700 -- [-1981.044] (-1997.687) (-1998.925) (-1993.232) * (-1987.969) [-1979.853] (-1992.271) (-1998.426) -- 0:03:13
397800 -- [-1981.716] (-2000.307) (-1993.978) (-1997.659) * (-1987.928) [-1975.969] (-1991.224) (-2004.480) -- 0:03:13
397900 -- [-1982.327] (-2010.524) (-1992.209) (-1994.575) * [-1996.372] (-1976.045) (-1986.675) (-1998.986) -- 0:03:13
398000 -- [-1985.852] (-2001.970) (-1995.733) (-1997.610) * (-1991.381) [-1983.350] (-1985.831) (-1988.444) -- 0:03:13
Average standard deviation of split frequencies: 0.001658
398100 -- [-1985.492] (-2001.948) (-1989.850) (-2001.442) * (-1990.445) (-1988.880) (-1987.318) [-1986.475] -- 0:03:13
398200 -- [-1981.675] (-2005.616) (-1993.471) (-2005.148) * (-1995.693) [-1979.813] (-1979.875) (-1993.693) -- 0:03:13
398300 -- [-1983.112] (-2000.181) (-1994.774) (-2005.397) * (-1995.904) [-1979.518] (-1984.575) (-2000.425) -- 0:03:13
398400 -- [-1981.768] (-2000.758) (-1991.822) (-1995.516) * (-1990.890) [-1982.493] (-1988.073) (-1987.418) -- 0:03:13
398500 -- [-1982.492] (-1998.633) (-1989.723) (-1995.959) * (-1990.798) (-1987.036) [-1985.240] (-1989.762) -- 0:03:13
398600 -- (-1986.382) (-1998.106) [-1991.497] (-1995.837) * (-1988.379) [-1986.967] (-1985.398) (-1988.462) -- 0:03:13
398700 -- (-1981.195) (-1989.183) [-1990.020] (-1994.710) * (-1990.287) [-1985.947] (-1990.713) (-1988.900) -- 0:03:13
398800 -- [-1977.075] (-1993.655) (-1988.717) (-1992.146) * (-1991.682) (-1989.610) [-1983.153] (-1993.378) -- 0:03:12
398900 -- [-1978.763] (-1987.218) (-1990.493) (-1996.344) * [-1998.529] (-1987.288) (-1987.279) (-1994.128) -- 0:03:12
399000 -- [-1977.058] (-1991.968) (-1991.632) (-1998.402) * (-1995.129) (-1995.858) [-1985.920] (-1986.604) -- 0:03:12
Average standard deviation of split frequencies: 0.001788
399100 -- [-1982.725] (-1987.956) (-1993.912) (-1991.132) * (-1986.231) (-1989.308) [-1987.305] (-1987.592) -- 0:03:12
399200 -- [-1982.282] (-1985.359) (-1990.362) (-1994.519) * (-1983.372) (-1985.195) [-1978.454] (-2000.855) -- 0:03:12
399300 -- (-1985.245) [-1984.349] (-1989.201) (-2000.834) * (-1993.291) [-1982.906] (-1983.156) (-1998.198) -- 0:03:12
399400 -- (-1998.632) [-1983.894] (-1994.826) (-1996.542) * (-2005.983) [-1978.808] (-1983.993) (-1997.969) -- 0:03:12
399500 -- [-1988.278] (-1988.074) (-1987.178) (-2006.056) * (-1994.862) [-1979.440] (-1984.492) (-1993.243) -- 0:03:12
399600 -- (-1986.923) (-1988.468) (-1987.497) [-1995.061] * (-1999.178) (-1978.508) [-1986.316] (-1995.467) -- 0:03:12
399700 -- [-1986.213] (-1988.795) (-1994.817) (-1997.767) * (-2003.768) [-1977.023] (-1993.546) (-1997.381) -- 0:03:12
399800 -- [-1980.024] (-1995.472) (-1999.115) (-1996.011) * (-1999.361) [-1977.403] (-1983.577) (-1992.217) -- 0:03:12
399900 -- [-1983.424] (-1991.775) (-1997.548) (-1993.315) * (-2011.042) (-1982.826) [-1983.522] (-1994.618) -- 0:03:12
400000 -- [-1981.734] (-1993.576) (-1995.135) (-2000.647) * (-2005.141) (-1986.727) [-1990.265] (-1992.555) -- 0:03:12
Average standard deviation of split frequencies: 0.001717
400100 -- (-1988.759) [-1990.672] (-2001.568) (-1999.065) * (-1994.077) (-1986.310) (-1992.220) [-1991.097] -- 0:03:13
400200 -- (-1993.832) [-1990.433] (-1995.929) (-1994.513) * (-1999.422) (-1986.334) [-1986.265] (-1990.485) -- 0:03:13
400300 -- (-1992.411) (-1987.850) [-1992.788] (-1994.369) * (-1991.582) (-1982.989) [-1980.136] (-1993.610) -- 0:03:13
400400 -- (-1995.856) [-1988.567] (-1992.954) (-1995.023) * (-1996.610) [-1983.471] (-1990.598) (-1989.106) -- 0:03:13
400500 -- [-1990.159] (-1992.006) (-1990.205) (-1993.004) * (-1990.098) (-1986.517) (-1982.844) [-1988.880] -- 0:03:13
400600 -- [-1994.971] (-1993.231) (-2001.472) (-1992.341) * (-1999.925) (-1989.213) (-1987.766) [-1983.830] -- 0:03:13
400700 -- (-1996.687) (-1986.532) (-2000.053) [-1989.854] * (-2000.866) (-1990.500) [-1985.863] (-1985.203) -- 0:03:12
400800 -- (-2002.383) [-1986.797] (-1997.588) (-1987.232) * (-1995.540) (-1993.142) [-1983.782] (-1987.044) -- 0:03:12
400900 -- (-2005.941) (-1987.222) [-1987.421] (-1987.205) * [-1985.543] (-1996.365) (-1986.751) (-1987.802) -- 0:03:12
401000 -- (-2001.379) [-1988.500] (-1998.431) (-1987.338) * [-1982.178] (-1989.916) (-1990.035) (-1987.584) -- 0:03:12
Average standard deviation of split frequencies: 0.001880
401100 -- (-2003.320) (-1991.977) (-1997.161) [-1986.193] * [-1980.892] (-1985.401) (-1983.499) (-1989.440) -- 0:03:12
401200 -- (-1999.133) (-1988.693) (-1999.425) [-1984.341] * [-1979.195] (-1988.332) (-1989.629) (-1989.362) -- 0:03:12
401300 -- (-1990.146) (-1996.028) [-1990.132] (-1996.073) * [-1985.406] (-1989.190) (-1997.788) (-1998.023) -- 0:03:12
401400 -- [-1985.706] (-1987.811) (-1985.306) (-1993.285) * (-1983.008) [-1986.505] (-1991.941) (-1995.915) -- 0:03:12
401500 -- [-1985.820] (-1989.866) (-1992.432) (-1989.110) * [-1986.359] (-1983.535) (-1986.397) (-1995.291) -- 0:03:12
401600 -- [-1984.529] (-1988.554) (-1991.836) (-1991.217) * [-1984.265] (-1988.035) (-1986.945) (-2013.323) -- 0:03:12
401700 -- (-1982.586) [-1990.906] (-2005.909) (-1988.788) * (-1990.565) (-1989.213) [-1993.372] (-2000.822) -- 0:03:12
401800 -- [-1982.515] (-1995.038) (-2013.723) (-1990.157) * [-1990.791] (-1984.307) (-1993.989) (-1998.104) -- 0:03:12
401900 -- [-1987.660] (-1991.586) (-1995.170) (-1990.160) * (-1989.392) [-1991.261] (-1994.680) (-2001.659) -- 0:03:11
402000 -- (-1989.195) (-1996.292) [-1991.687] (-1987.701) * (-1986.451) (-1986.119) (-1999.218) [-1991.822] -- 0:03:11
Average standard deviation of split frequencies: 0.001708
402100 -- (-1990.478) (-1997.562) [-1992.999] (-1995.045) * (-1991.430) (-1991.854) (-1991.792) [-1986.056] -- 0:03:11
402200 -- (-1994.323) (-2005.115) (-1994.514) [-1991.163] * (-1993.989) [-1983.803] (-1996.861) (-1985.934) -- 0:03:11
402300 -- (-1990.375) (-2006.676) (-1997.776) [-1989.487] * (-2002.221) (-1988.078) (-1992.537) [-1988.193] -- 0:03:11
402400 -- (-1992.356) (-1998.377) [-1994.874] (-1992.465) * (-2004.490) (-1991.155) [-1986.859] (-1995.121) -- 0:03:11
402500 -- (-1996.894) (-1998.731) [-1989.964] (-1989.787) * (-1999.371) [-1986.087] (-1988.331) (-1990.125) -- 0:03:11
402600 -- [-1993.375] (-1994.313) (-1989.961) (-1990.440) * (-1991.463) [-1979.562] (-1988.393) (-1998.904) -- 0:03:11
402700 -- (-1998.603) (-1999.570) (-1991.457) [-1986.945] * (-1991.426) (-1982.781) [-1987.138] (-1991.398) -- 0:03:11
402800 -- (-1998.417) (-1988.794) (-1997.426) [-1986.247] * (-1989.183) (-1982.272) (-1989.830) [-1984.344] -- 0:03:11
402900 -- (-1998.901) (-1992.729) (-1994.582) [-1994.421] * [-1987.566] (-1981.085) (-1991.982) (-1989.176) -- 0:03:11
403000 -- (-1991.032) (-1989.581) (-1995.860) [-1991.988] * (-1989.311) [-1978.169] (-1997.843) (-1988.113) -- 0:03:11
Average standard deviation of split frequencies: 0.001637
403100 -- (-1994.400) (-2001.494) (-1993.811) [-1989.789] * (-1990.291) [-1977.846] (-1992.806) (-1992.473) -- 0:03:12
403200 -- (-1994.719) (-1999.536) (-1998.121) [-1992.697] * (-1989.017) [-1977.207] (-1987.560) (-1994.994) -- 0:03:12
403300 -- (-1987.585) [-1992.797] (-1993.490) (-1993.653) * [-1988.287] (-1981.545) (-1995.214) (-1998.252) -- 0:03:12
403400 -- (-1988.805) [-1992.418] (-1999.152) (-1998.323) * (-1986.616) [-1979.540] (-1990.608) (-1993.218) -- 0:03:12
403500 -- (-1987.033) (-2007.414) (-2000.051) [-1997.259] * (-1986.018) [-1983.643] (-1994.344) (-1992.623) -- 0:03:12
403600 -- (-1991.013) (-1988.842) (-2000.955) [-1993.679] * [-1982.047] (-1981.077) (-2000.546) (-1997.601) -- 0:03:12
403700 -- (-1983.500) (-1994.960) [-1991.582] (-1990.917) * [-1982.441] (-1981.221) (-1996.280) (-1992.239) -- 0:03:12
403800 -- [-1983.383] (-1997.359) (-1996.644) (-1996.331) * [-1983.773] (-1983.155) (-1996.709) (-1992.413) -- 0:03:11
403900 -- (-1988.106) (-2008.510) [-1997.533] (-1993.836) * (-1985.728) (-1985.302) [-1983.729] (-1990.523) -- 0:03:11
404000 -- [-1989.354] (-2001.464) (-1997.188) (-1992.107) * (-1993.416) [-1982.060] (-1989.439) (-1985.946) -- 0:03:11
Average standard deviation of split frequencies: 0.001800
404100 -- (-1983.096) (-1999.276) [-1992.094] (-1987.859) * (-1999.803) (-1980.195) [-1987.339] (-1992.165) -- 0:03:11
404200 -- [-1980.942] (-1987.618) (-1991.129) (-1993.038) * (-1996.308) [-1983.162] (-1991.493) (-1999.223) -- 0:03:11
404300 -- (-1975.526) [-1987.316] (-1994.593) (-1999.011) * (-1991.602) [-1984.003] (-1989.427) (-1995.197) -- 0:03:11
404400 -- [-1975.535] (-1984.852) (-1992.503) (-1998.008) * (-1999.161) [-1978.603] (-1990.550) (-1997.023) -- 0:03:11
404500 -- [-1978.024] (-1993.354) (-1994.219) (-1989.728) * (-1992.689) (-1979.250) [-1991.062] (-1999.392) -- 0:03:11
404600 -- [-1982.871] (-1996.942) (-1999.793) (-1989.370) * (-1987.041) [-1981.028] (-1992.214) (-2001.266) -- 0:03:11
404700 -- (-1982.570) [-1986.206] (-2004.949) (-1987.916) * (-1989.599) (-1979.158) (-1996.077) [-1990.817] -- 0:03:11
404800 -- (-1982.477) (-1997.324) (-2001.032) [-1989.307] * (-1993.402) [-1982.289] (-1996.388) (-1988.771) -- 0:03:11
404900 -- [-1975.835] (-1993.585) (-1996.308) (-1987.852) * (-1992.104) [-1980.254] (-1984.477) (-1992.946) -- 0:03:11
405000 -- [-1976.920] (-2000.372) (-1996.811) (-1987.668) * (-1990.831) [-1986.090] (-1989.280) (-1987.324) -- 0:03:10
Average standard deviation of split frequencies: 0.001728
405100 -- [-1981.073] (-2002.751) (-2007.022) (-1993.516) * (-1990.104) [-1985.497] (-1986.342) (-1986.337) -- 0:03:10
405200 -- [-1982.218] (-1998.146) (-2013.272) (-1995.699) * (-1992.319) (-1989.856) [-1986.938] (-2000.761) -- 0:03:10
405300 -- [-1982.421] (-1993.200) (-2004.633) (-1994.081) * (-1991.008) (-1985.447) [-1987.696] (-2003.826) -- 0:03:10
405400 -- [-1978.717] (-1999.252) (-2007.078) (-1991.937) * (-1991.366) [-1981.369] (-1982.197) (-1997.883) -- 0:03:10
405500 -- [-1980.625] (-1992.742) (-1993.664) (-2001.982) * [-1990.428] (-1990.470) (-1979.914) (-2000.518) -- 0:03:10
405600 -- [-1978.826] (-1987.776) (-1991.220) (-1992.833) * (-1988.929) [-1987.270] (-1980.411) (-1999.836) -- 0:03:10
405700 -- [-1981.453] (-1986.618) (-1988.109) (-2001.830) * (-1983.572) [-1985.602] (-1987.282) (-2007.022) -- 0:03:10
405800 -- [-1976.323] (-1988.298) (-1984.103) (-2002.671) * [-1985.347] (-1985.123) (-1988.622) (-2002.132) -- 0:03:10
405900 -- [-1978.446] (-1995.972) (-1989.448) (-2002.365) * [-1986.596] (-1982.931) (-1990.367) (-1994.649) -- 0:03:10
406000 -- [-1990.550] (-1994.779) (-1987.734) (-2001.150) * (-1990.476) (-1984.306) [-1986.091] (-1994.765) -- 0:03:11
Average standard deviation of split frequencies: 0.001592
406100 -- (-1985.584) (-1990.210) [-1988.343] (-1993.838) * (-1987.339) (-1993.430) [-1983.045] (-2000.728) -- 0:03:11
406200 -- [-1981.497] (-1998.948) (-1992.421) (-1991.362) * (-1993.372) (-1988.958) [-1980.968] (-2003.119) -- 0:03:11
406300 -- [-1978.072] (-1988.014) (-1988.806) (-1993.324) * (-1998.059) (-1990.469) [-1981.288] (-1997.829) -- 0:03:11
406400 -- (-1983.533) (-1985.841) [-1985.582] (-1992.775) * (-1994.776) [-1983.728] (-1986.789) (-1992.326) -- 0:03:11
406500 -- (-1982.728) (-1991.654) [-1986.657] (-1994.342) * (-1990.298) [-1983.166] (-1986.486) (-2006.095) -- 0:03:11
406600 -- [-1987.989] (-1996.947) (-1992.146) (-2000.671) * [-1988.594] (-1991.101) (-1986.422) (-1987.311) -- 0:03:11
406700 -- (-1985.653) (-1995.757) (-1989.686) [-1992.600] * [-1989.054] (-1986.692) (-1991.616) (-1989.125) -- 0:03:11
406800 -- (-1981.634) (-1990.968) [-1984.581] (-1993.940) * [-1984.938] (-1981.345) (-1997.983) (-1992.020) -- 0:03:11
406900 -- [-1983.626] (-1988.778) (-1993.401) (-1987.916) * (-1984.822) [-1985.704] (-2008.369) (-2005.980) -- 0:03:10
407000 -- (-1985.258) [-1986.570] (-1994.773) (-1998.579) * [-1985.204] (-1989.534) (-2002.075) (-2003.847) -- 0:03:10
Average standard deviation of split frequencies: 0.001588
407100 -- (-1980.843) (-1985.609) (-1987.089) [-1988.759] * (-1979.637) [-1982.469] (-2010.302) (-1996.707) -- 0:03:10
407200 -- [-1982.183] (-1984.872) (-1989.210) (-1989.841) * (-1980.365) (-1993.341) (-1999.288) [-1993.598] -- 0:03:10
407300 -- [-1981.851] (-1987.456) (-1990.670) (-1991.877) * (-1983.958) (-1991.597) (-2005.271) [-1991.777] -- 0:03:10
407400 -- (-1981.383) [-1984.672] (-1988.767) (-1999.444) * [-1988.998] (-1995.210) (-2000.590) (-1985.496) -- 0:03:10
407500 -- [-1981.116] (-1993.459) (-1996.296) (-1988.179) * [-1989.842] (-1989.613) (-2001.666) (-1991.340) -- 0:03:10
407600 -- [-1978.847] (-1991.646) (-1997.014) (-1989.675) * (-1993.136) [-1985.855] (-1993.622) (-1990.133) -- 0:03:10
407700 -- [-1980.556] (-1983.924) (-1997.750) (-1997.006) * (-1998.204) [-1979.684] (-1995.091) (-1990.275) -- 0:03:10
407800 -- (-1985.411) [-1983.768] (-2003.806) (-1992.669) * (-1998.842) [-1983.950] (-1995.617) (-1990.582) -- 0:03:10
407900 -- (-1983.013) (-1986.815) (-2001.540) [-1984.229] * (-2005.064) [-1986.844] (-1985.567) (-1999.498) -- 0:03:10
408000 -- [-1979.495] (-1985.399) (-2002.807) (-1991.772) * (-2004.188) [-1988.635] (-1985.806) (-1996.549) -- 0:03:10
Average standard deviation of split frequencies: 0.001848
408100 -- [-1982.422] (-1988.261) (-2006.356) (-1996.511) * (-2005.858) (-1989.045) [-1984.350] (-1993.432) -- 0:03:09
408200 -- [-1982.748] (-1994.084) (-2002.505) (-1997.858) * (-1993.262) [-1986.298] (-1983.558) (-1997.624) -- 0:03:09
408300 -- [-1983.027] (-1994.702) (-1995.090) (-1997.892) * (-1991.761) (-1986.886) [-1987.024] (-1993.902) -- 0:03:09
408400 -- [-1984.737] (-1991.446) (-2000.565) (-1993.805) * (-1996.039) [-1982.596] (-1991.867) (-1994.615) -- 0:03:09
408500 -- (-1986.389) [-1985.672] (-2003.279) (-2005.891) * (-1996.156) [-1978.262] (-1993.283) (-1993.282) -- 0:03:09
408600 -- [-1981.573] (-1987.860) (-1997.363) (-2009.886) * (-1998.672) [-1979.686] (-1997.685) (-1993.561) -- 0:03:09
408700 -- [-1980.610] (-1991.800) (-1993.241) (-2002.879) * (-1994.400) [-1985.320] (-2001.130) (-1995.993) -- 0:03:09
408800 -- [-1988.643] (-1997.405) (-1994.961) (-1995.442) * [-1991.798] (-1987.060) (-1994.930) (-1992.665) -- 0:03:09
408900 -- [-1983.316] (-1991.003) (-1997.184) (-2002.896) * (-1993.881) [-1987.014] (-1999.349) (-1991.623) -- 0:03:09
409000 -- [-1981.900] (-1984.890) (-1993.616) (-2000.094) * [-1986.346] (-1991.274) (-1999.162) (-1994.272) -- 0:03:10
Average standard deviation of split frequencies: 0.001744
409100 -- (-1979.914) (-1987.396) (-1994.100) [-1992.891] * (-1987.634) [-1986.637] (-1999.572) (-1991.706) -- 0:03:10
409200 -- [-1980.445] (-1988.403) (-1996.876) (-1998.923) * [-1988.093] (-1994.823) (-1994.043) (-2000.369) -- 0:03:10
409300 -- (-1980.326) [-1983.360] (-2002.545) (-1998.772) * [-1991.081] (-1994.086) (-2002.538) (-2002.871) -- 0:03:10
409400 -- [-1982.736] (-1984.091) (-1993.508) (-1997.482) * (-2006.866) (-1983.988) [-1988.128] (-2007.916) -- 0:03:10
409500 -- (-1989.196) [-1981.487] (-2000.889) (-1991.214) * (-2012.287) (-1985.532) [-1986.843] (-2017.899) -- 0:03:10
409600 -- (-1998.337) [-1982.477] (-1998.043) (-1996.251) * (-2001.588) [-1983.070] (-1991.664) (-2008.421) -- 0:03:10
409700 -- (-1996.798) [-1979.576] (-1989.402) (-2007.163) * (-1999.058) [-1981.390] (-1990.415) (-2009.086) -- 0:03:10
409800 -- (-1997.880) [-1977.934] (-1994.186) (-1995.043) * (-2004.229) [-1976.224] (-1993.743) (-2013.445) -- 0:03:10
409900 -- (-2000.013) [-1980.891] (-1999.591) (-1989.341) * (-1998.707) (-1978.005) [-1989.156] (-2004.709) -- 0:03:10
410000 -- (-1996.044) [-1980.542] (-1994.478) (-1988.788) * (-2002.483) (-1984.959) (-1992.566) [-1993.415] -- 0:03:09
Average standard deviation of split frequencies: 0.001708
410100 -- (-1998.435) [-1980.827] (-1991.915) (-1989.345) * (-1995.156) [-1984.076] (-1990.919) (-1997.207) -- 0:03:09
410200 -- (-1994.522) [-1983.212] (-2005.892) (-1991.911) * (-1996.247) [-1980.272] (-1986.363) (-1996.000) -- 0:03:09
410300 -- (-2003.247) [-1985.353] (-2016.390) (-1996.641) * (-1992.275) [-1984.314] (-1996.097) (-1999.119) -- 0:03:09
410400 -- (-1996.935) [-1988.535] (-2002.625) (-2004.617) * [-1986.522] (-1993.768) (-1994.008) (-1997.703) -- 0:03:09
410500 -- (-1989.843) [-1984.355] (-2007.025) (-2002.859) * (-1984.131) [-1981.773] (-1987.879) (-1995.721) -- 0:03:09
410600 -- (-1987.788) [-1990.280] (-2003.272) (-1999.158) * (-1984.936) [-1988.385] (-1986.340) (-1992.529) -- 0:03:09
410700 -- [-1984.785] (-1990.795) (-1994.045) (-1994.973) * (-1982.752) (-1993.682) [-1985.890] (-1994.557) -- 0:03:09
410800 -- (-1992.132) (-1990.688) (-1993.462) [-1989.888] * (-1985.849) (-1997.482) (-1982.545) [-1986.223] -- 0:03:09
410900 -- (-1997.983) (-1994.794) (-1992.850) [-1993.970] * [-1987.906] (-2004.191) (-1994.348) (-1993.073) -- 0:03:09
411000 -- (-1996.175) [-1984.048] (-2001.330) (-1992.030) * (-1988.364) (-2002.870) (-1999.361) [-1993.574] -- 0:03:09
Average standard deviation of split frequencies: 0.001900
411100 -- (-1991.910) [-1986.639] (-2003.214) (-1997.278) * (-1991.727) (-2006.571) (-1992.535) [-1985.495] -- 0:03:09
411200 -- [-1987.324] (-1982.214) (-2000.363) (-2002.563) * (-1987.130) (-2003.856) [-1979.743] (-1980.815) -- 0:03:09
411300 -- (-1991.818) [-1984.885] (-1993.817) (-1998.666) * (-1995.004) (-2005.145) (-1986.806) [-1985.152] -- 0:03:08
411400 -- (-1986.839) [-1980.615] (-1993.554) (-1993.532) * (-1992.429) (-1999.813) (-1989.970) [-1983.379] -- 0:03:08
411500 -- [-1987.628] (-1983.618) (-1993.513) (-1991.985) * (-1991.006) (-1995.199) (-1987.699) [-1984.468] -- 0:03:08
411600 -- (-1992.350) [-1981.371] (-1995.226) (-1993.589) * (-1989.168) (-2000.924) (-1987.833) [-1986.407] -- 0:03:08
411700 -- (-1998.726) (-1982.102) [-1996.402] (-2000.351) * [-2002.174] (-1995.379) (-1996.492) (-1984.690) -- 0:03:08
411800 -- (-1988.904) [-1979.257] (-1997.214) (-1996.666) * (-2002.204) [-1988.724] (-1989.579) (-1993.505) -- 0:03:08
411900 -- (-1994.553) [-1976.789] (-1993.125) (-1994.436) * (-1986.590) [-1991.592] (-1987.697) (-1994.172) -- 0:03:08
412000 -- (-2006.505) (-1980.024) (-1992.770) [-1987.099] * [-1985.729] (-1987.710) (-1991.911) (-1990.890) -- 0:03:09
Average standard deviation of split frequencies: 0.001895
412100 -- (-1994.513) [-1982.433] (-1998.380) (-1991.331) * (-1990.586) [-1988.073] (-1996.317) (-1998.555) -- 0:03:09
412200 -- (-1991.794) [-1983.035] (-2006.686) (-1992.374) * (-1991.296) [-1989.820] (-1998.702) (-1987.049) -- 0:03:09
412300 -- [-1990.148] (-1982.894) (-1995.693) (-1989.723) * [-1989.316] (-1990.470) (-1999.817) (-1993.390) -- 0:03:09
412400 -- (-1997.497) [-1984.663] (-1991.814) (-1998.624) * (-1990.217) (-1995.115) (-2002.161) [-1991.215] -- 0:03:09
412500 -- (-1999.611) [-1986.777] (-1992.095) (-1996.314) * [-1985.843] (-1998.592) (-1998.763) (-1991.094) -- 0:03:09
412600 -- (-1990.786) (-1987.299) (-1992.347) [-1991.342] * (-1983.469) [-1988.277] (-1993.673) (-1991.781) -- 0:03:09
412700 -- [-1990.369] (-1985.956) (-1987.371) (-1996.299) * (-1987.957) [-1989.301] (-1998.699) (-1987.983) -- 0:03:09
412800 -- (-1985.990) [-1985.930] (-1989.560) (-1997.112) * [-1984.381] (-1991.923) (-1993.367) (-1996.487) -- 0:03:09
412900 -- (-1989.015) (-1987.557) [-1994.565] (-1998.237) * (-1982.595) (-2000.164) [-1988.565] (-1990.112) -- 0:03:09
413000 -- (-1989.453) [-1982.880] (-1992.880) (-1993.294) * (-1988.668) (-2000.486) (-1993.934) [-1990.245] -- 0:03:09
Average standard deviation of split frequencies: 0.002151
413100 -- (-1991.040) (-1989.110) [-1988.777] (-1987.162) * [-1981.531] (-2002.925) (-1991.632) (-1989.985) -- 0:03:08
413200 -- (-2004.492) [-1982.247] (-1987.376) (-1985.143) * [-1979.909] (-1997.286) (-1998.093) (-1992.393) -- 0:03:08
413300 -- (-1993.289) [-1981.135] (-1995.230) (-1988.399) * (-1984.189) (-1998.185) [-1993.842] (-1994.526) -- 0:03:08
413400 -- (-1995.175) [-1979.967] (-1994.653) (-1993.435) * [-1986.327] (-1996.909) (-1987.084) (-1992.634) -- 0:03:08
413500 -- (-1990.938) (-1982.650) (-2006.526) [-1992.869] * (-1985.828) (-2005.782) (-1993.690) [-1990.207] -- 0:03:08
413600 -- (-1990.263) [-1986.697] (-2007.625) (-1992.052) * (-1993.843) (-1994.629) (-1995.769) [-1987.093] -- 0:03:08
413700 -- (-1994.734) [-1981.923] (-2009.767) (-1996.298) * (-1989.028) (-1992.309) (-1998.533) [-1992.391] -- 0:03:08
413800 -- (-2005.617) (-1989.277) (-1999.198) [-1984.804] * [-1985.177] (-1994.180) (-1999.050) (-1997.425) -- 0:03:08
413900 -- (-1996.253) (-1986.834) (-2004.313) [-1986.656] * [-1987.978] (-1994.677) (-1986.117) (-1992.086) -- 0:03:08
414000 -- (-1997.017) (-1986.303) (-2005.368) [-1989.031] * [-1988.115] (-1999.213) (-1986.706) (-1994.762) -- 0:03:08
Average standard deviation of split frequencies: 0.002016
414100 -- (-1995.279) [-1988.349] (-1995.279) (-1984.603) * (-1983.623) (-1999.322) [-1984.682] (-1992.411) -- 0:03:08
414200 -- [-1989.693] (-1994.077) (-1987.349) (-1988.013) * (-1980.784) (-1992.362) [-1985.785] (-1990.687) -- 0:03:08
414300 -- (-1998.708) (-1991.308) [-1987.735] (-1986.475) * [-1979.869] (-1990.332) (-1991.182) (-1992.228) -- 0:03:08
414400 -- [-1989.866] (-1985.028) (-1985.822) (-1992.184) * [-1982.462] (-1993.034) (-1993.833) (-1986.202) -- 0:03:07
414500 -- [-1985.786] (-1986.562) (-1992.226) (-1990.276) * [-1982.047] (-1991.146) (-1993.066) (-1988.979) -- 0:03:07
414600 -- (-1991.304) (-1982.752) (-1993.323) [-1990.213] * [-1983.765] (-1989.789) (-1989.757) (-1986.032) -- 0:03:07
414700 -- (-1989.993) [-1982.111] (-1990.336) (-1993.285) * (-1986.708) (-1995.190) (-1985.376) [-1985.583] -- 0:03:07
414800 -- (-1993.333) [-1982.766] (-2007.268) (-1994.175) * [-1979.200] (-1992.788) (-1989.490) (-1991.180) -- 0:03:07
414900 -- (-1987.228) (-1987.360) (-1996.660) [-1992.191] * [-1979.269] (-1993.571) (-1991.283) (-1992.623) -- 0:03:07
415000 -- [-1986.677] (-1985.733) (-1990.714) (-1999.770) * [-1986.099] (-1993.638) (-1990.664) (-1994.852) -- 0:03:07
Average standard deviation of split frequencies: 0.001752
415100 -- [-1988.327] (-1987.635) (-1998.644) (-2000.495) * (-1987.613) (-1988.680) [-1996.862] (-2002.640) -- 0:03:08
415200 -- [-1985.549] (-1997.056) (-1998.501) (-1997.336) * [-1983.440] (-1985.710) (-1991.884) (-2002.804) -- 0:03:08
415300 -- [-1984.332] (-1998.835) (-2013.820) (-1994.808) * [-1979.125] (-1985.071) (-1990.979) (-2004.141) -- 0:03:08
415400 -- [-1990.319] (-1992.620) (-2013.856) (-2002.979) * [-1979.781] (-1988.303) (-1991.511) (-1994.445) -- 0:03:08
415500 -- (-1990.336) [-1990.181] (-2003.678) (-2003.721) * [-1978.685] (-1986.516) (-1992.917) (-1993.433) -- 0:03:08
415600 -- (-1987.211) [-1986.378] (-1997.536) (-1996.047) * [-1978.497] (-1988.762) (-1988.083) (-1993.231) -- 0:03:08
415700 -- [-1984.144] (-1994.570) (-2000.586) (-1992.269) * (-1979.160) (-1997.221) (-1991.663) [-1990.598] -- 0:03:08
415800 -- (-1983.040) [-1982.561] (-1994.929) (-1990.252) * [-1983.158] (-1994.559) (-2005.543) (-1992.397) -- 0:03:08
415900 -- (-1986.836) [-1980.884] (-1993.541) (-1989.020) * [-1980.778] (-2000.472) (-2007.567) (-1996.539) -- 0:03:08
416000 -- (-1985.658) (-1985.378) (-1997.858) [-1987.736] * [-1980.074] (-1994.193) (-1998.801) (-1988.799) -- 0:03:08
Average standard deviation of split frequencies: 0.001780
416100 -- (-1996.450) [-1984.461] (-1995.290) (-1990.812) * [-1986.908] (-2003.781) (-1987.837) (-1997.506) -- 0:03:08
416200 -- (-1990.318) [-1980.858] (-1989.644) (-1986.476) * (-1992.365) (-2002.130) [-1984.830] (-1994.327) -- 0:03:07
416300 -- [-1987.972] (-1992.207) (-1986.442) (-1988.055) * (-1994.468) (-1996.579) [-1984.267] (-1985.437) -- 0:03:07
416400 -- (-1990.846) (-1992.182) [-1987.979] (-1985.310) * [-1989.294] (-1997.447) (-1984.037) (-1983.213) -- 0:03:07
416500 -- (-1987.206) (-1992.529) (-1994.121) [-1987.795] * (-1985.883) (-2008.992) [-1984.118] (-1983.767) -- 0:03:07
416600 -- (-1988.790) (-1996.083) (-1997.456) [-1993.425] * [-1985.846] (-2008.901) (-1978.780) (-1991.055) -- 0:03:07
416700 -- (-1995.943) [-1982.980] (-1990.866) (-1990.357) * (-1992.692) (-2008.132) [-1977.382] (-1984.219) -- 0:03:07
416800 -- (-1995.758) [-1978.771] (-1987.278) (-1991.446) * (-1985.478) (-2011.999) [-1977.357] (-1988.869) -- 0:03:07
416900 -- (-2002.905) [-1980.587] (-1992.017) (-1995.088) * (-1982.092) (-2000.658) [-1976.614] (-1990.180) -- 0:03:07
417000 -- (-1996.928) (-1996.016) (-1986.922) [-1990.133] * (-1980.396) (-2000.758) (-1982.202) [-1986.407] -- 0:03:07
Average standard deviation of split frequencies: 0.001808
417100 -- (-1997.357) [-1989.724] (-1989.548) (-1991.091) * [-1979.504] (-2000.202) (-1984.833) (-1991.007) -- 0:03:07
417200 -- (-1995.964) (-1991.786) (-1994.414) [-1995.462] * [-1987.729] (-2000.304) (-1984.690) (-1986.361) -- 0:03:07
417300 -- (-2001.745) (-1983.482) (-1996.803) [-1999.110] * (-1990.128) (-1996.138) (-1986.173) [-1983.921] -- 0:03:07
417400 -- (-2002.638) [-1980.382] (-1996.449) (-1999.117) * (-1987.866) (-2004.157) [-1983.782] (-1987.295) -- 0:03:07
417500 -- (-1996.707) [-1979.973] (-1998.992) (-1993.701) * (-1993.606) (-1997.995) (-1988.740) [-1982.430] -- 0:03:06
417600 -- (-1996.406) [-1981.136] (-2000.641) (-1996.190) * (-1989.478) (-2000.141) (-1989.782) [-1982.938] -- 0:03:06
417700 -- (-1994.202) (-1983.559) (-2003.393) [-1992.259] * (-1991.783) (-1986.625) [-1999.134] (-1983.835) -- 0:03:06
417800 -- (-1990.943) [-1981.261] (-1993.731) (-1999.035) * [-1986.026] (-1994.758) (-1994.677) (-1984.279) -- 0:03:06
417900 -- (-1988.646) (-1982.982) [-1992.343] (-1993.411) * [-1990.928] (-1987.385) (-1989.761) (-1986.326) -- 0:03:06
418000 -- (-1992.643) [-1983.806] (-1994.319) (-1990.868) * [-1985.127] (-1988.132) (-1987.433) (-1992.365) -- 0:03:06
Average standard deviation of split frequencies: 0.002190
418100 -- (-1995.745) (-1987.369) (-1993.752) [-1992.470] * (-1991.876) [-1985.805] (-1985.197) (-1992.031) -- 0:03:06
418200 -- [-1984.085] (-1990.995) (-1992.029) (-1998.478) * (-1982.517) (-1985.238) (-1983.136) [-1983.188] -- 0:03:07
418300 -- (-1986.689) (-1994.641) [-1985.233] (-2006.448) * [-1982.806] (-1990.936) (-1984.678) (-1981.262) -- 0:03:07
418400 -- (-1986.066) (-1994.380) [-1985.775] (-1994.543) * (-1984.992) (-1990.515) [-1978.635] (-1982.389) -- 0:03:07
418500 -- (-1988.990) (-1992.369) [-1983.983] (-1991.389) * (-1987.712) [-1987.925] (-1981.329) (-1984.855) -- 0:03:07
418600 -- (-1992.475) [-1988.455] (-1981.791) (-1996.735) * (-1991.108) (-1982.903) [-1979.735] (-1989.166) -- 0:03:07
418700 -- (-1995.112) (-1984.018) [-1979.632] (-1995.089) * (-1988.980) (-1993.754) [-1978.092] (-1997.101) -- 0:03:07
418800 -- (-1995.528) [-1985.851] (-1980.093) (-1989.292) * (-1988.666) (-1989.762) (-1981.525) [-1983.561] -- 0:03:07
418900 -- (-1990.190) (-1997.387) [-1980.074] (-1988.097) * (-1991.127) (-1991.154) (-1985.402) [-1987.621] -- 0:03:07
419000 -- (-1999.248) (-1987.912) [-1982.865] (-1990.601) * [-1986.231] (-2003.267) (-1990.409) (-1982.526) -- 0:03:07
Average standard deviation of split frequencies: 0.002185
419100 -- (-1993.984) (-1983.660) [-1987.335] (-1992.384) * (-1991.957) (-1991.402) (-1989.307) [-1980.197] -- 0:03:07
419200 -- (-1991.836) [-1980.902] (-1986.151) (-1995.786) * [-1983.897] (-1995.841) (-1994.106) (-1981.276) -- 0:03:07
419300 -- (-1987.383) (-1983.332) [-1985.690] (-1989.428) * [-1982.957] (-1992.969) (-1988.844) (-1982.556) -- 0:03:06
419400 -- (-1986.619) (-1980.765) [-1984.553] (-1987.786) * [-1983.604] (-1983.391) (-2003.923) (-1985.692) -- 0:03:06
419500 -- (-1985.922) [-1984.011] (-1997.431) (-1991.576) * (-1987.301) (-1987.326) (-1994.377) [-1986.852] -- 0:03:06
419600 -- (-1987.276) [-1983.574] (-1995.440) (-1996.208) * (-1985.457) (-1983.452) (-2000.366) [-1981.554] -- 0:03:06
419700 -- (-1993.334) [-1984.912] (-1994.634) (-2000.734) * [-1982.936] (-1985.369) (-2001.373) (-1982.127) -- 0:03:06
419800 -- (-2000.638) (-1984.805) [-1989.970] (-1997.866) * (-1989.555) (-1990.257) (-2008.052) [-1980.681] -- 0:03:06
419900 -- (-1989.997) [-1984.236] (-1985.557) (-2000.272) * [-1987.195] (-1990.678) (-2000.830) (-1984.937) -- 0:03:06
420000 -- (-1990.768) [-1979.312] (-1988.477) (-2003.235) * (-2000.385) (-1987.156) (-1995.110) [-1985.799] -- 0:03:06
Average standard deviation of split frequencies: 0.002180
420100 -- (-1990.441) [-1982.259] (-1990.160) (-1997.222) * (-2007.177) [-1990.295] (-2005.823) (-1984.521) -- 0:03:06
420200 -- (-1992.528) [-1985.199] (-1989.452) (-1992.004) * (-2005.046) (-1990.003) (-2008.900) [-1983.697] -- 0:03:06
420300 -- (-1989.666) (-1988.112) [-1992.930] (-1999.493) * (-1993.676) (-1989.790) (-2006.598) [-1989.175] -- 0:03:06
420400 -- (-1988.227) [-1983.636] (-1995.218) (-1995.134) * (-1993.284) [-1980.185] (-2000.175) (-1994.812) -- 0:03:06
420500 -- (-1986.741) [-1986.817] (-2002.972) (-1992.627) * (-1990.443) [-1980.616] (-2008.288) (-1997.037) -- 0:03:06
420600 -- (-1984.987) [-1982.297] (-1989.385) (-1990.776) * (-1988.716) [-1981.544] (-2014.903) (-1998.733) -- 0:03:05
420700 -- (-1991.804) (-1985.623) [-1987.713] (-2001.338) * (-1991.502) (-1981.867) (-2013.796) [-1990.508] -- 0:03:05
420800 -- (-1988.745) [-1981.947] (-1989.354) (-2000.811) * (-1990.260) [-1981.010] (-1998.836) (-1996.493) -- 0:03:05
420900 -- [-1983.258] (-1988.818) (-1983.879) (-1997.358) * (-1998.249) [-1984.299] (-1993.039) (-1998.543) -- 0:03:05
421000 -- (-1988.999) [-1985.350] (-1995.902) (-1996.797) * (-1991.186) [-1981.475] (-1992.051) (-1998.558) -- 0:03:05
Average standard deviation of split frequencies: 0.002206
421100 -- [-1985.527] (-1982.388) (-1999.670) (-1991.825) * (-1991.505) [-1981.802] (-1995.949) (-2001.525) -- 0:03:05
421200 -- (-1994.941) [-1981.260] (-1985.890) (-1987.296) * (-1998.026) [-1980.294] (-1995.639) (-2010.469) -- 0:03:06
421300 -- (-1990.320) [-1981.489] (-1984.204) (-1984.157) * (-2005.280) [-1983.994] (-1993.236) (-2002.853) -- 0:03:06
421400 -- (-1990.172) (-1989.559) [-1978.473] (-1991.602) * (-1997.573) [-1980.809] (-1990.977) (-1994.373) -- 0:03:06
421500 -- (-1984.568) (-1998.949) [-1979.039] (-1986.816) * (-1997.583) [-1979.685] (-1994.330) (-1989.328) -- 0:03:06
421600 -- (-1992.500) (-1990.704) [-1977.485] (-1990.360) * (-1999.542) [-1982.943] (-2000.134) (-1991.874) -- 0:03:06
421700 -- (-1995.781) (-1996.993) [-1976.647] (-1992.163) * (-1994.922) (-1987.594) (-2002.699) [-1986.549] -- 0:03:06
421800 -- (-1995.326) (-1986.893) [-1981.054] (-1989.143) * (-1998.693) [-1981.262] (-1990.321) (-1985.271) -- 0:03:06
421900 -- (-1994.702) (-1987.924) [-1983.662] (-1990.460) * (-1992.969) (-1983.672) (-1991.146) [-1984.261] -- 0:03:06
422000 -- (-1994.393) (-1984.544) [-1980.121] (-1989.965) * (-1984.949) (-1980.066) (-1996.078) [-1981.636] -- 0:03:06
Average standard deviation of split frequencies: 0.002170
422100 -- (-1993.986) (-1983.027) [-1981.038] (-1989.659) * (-1995.566) (-1986.348) (-1998.797) [-1984.530] -- 0:03:06
422200 -- (-2006.487) [-1990.027] (-1988.676) (-1993.269) * (-2001.323) (-1983.863) (-1998.060) [-1982.472] -- 0:03:06
422300 -- (-1995.747) (-1988.472) [-1983.198] (-1992.786) * (-1998.355) (-1981.094) (-1992.932) [-1983.481] -- 0:03:06
422400 -- (-1999.794) (-1988.893) (-1981.218) [-1996.120] * (-1989.257) (-1983.570) (-1992.593) [-1988.800] -- 0:03:05
422500 -- (-1991.393) (-1990.661) [-1979.313] (-1992.570) * (-1992.170) [-1979.115] (-1989.292) (-1986.810) -- 0:03:05
422600 -- (-1987.613) (-1994.776) [-1981.238] (-1990.726) * (-1989.948) [-1985.161] (-1986.056) (-1985.261) -- 0:03:05
422700 -- (-1993.941) (-1999.961) [-1983.181] (-1995.309) * (-2007.472) (-1995.784) (-1987.426) [-1980.110] -- 0:03:05
422800 -- [-1989.479] (-1989.483) (-1989.332) (-1994.478) * (-2002.516) (-1986.848) [-1987.380] (-1982.751) -- 0:03:05
422900 -- (-1987.864) [-1989.679] (-1982.876) (-1989.461) * (-1995.967) (-1994.152) (-1990.350) [-1985.823] -- 0:03:05
423000 -- [-1986.678] (-1988.328) (-1990.639) (-1988.597) * (-2000.023) (-1993.304) [-1992.144] (-1987.665) -- 0:03:05
Average standard deviation of split frequencies: 0.002355
423100 -- (-1987.967) (-1991.511) [-1983.912] (-1992.792) * (-1996.795) [-2000.606] (-1985.365) (-1987.389) -- 0:03:05
423200 -- (-1993.826) (-1979.934) [-1981.095] (-1994.710) * (-1992.265) (-1994.384) [-1987.282] (-1984.461) -- 0:03:05
423300 -- (-1989.049) [-1981.827] (-1985.668) (-1988.825) * (-1995.663) (-1994.767) (-1989.451) [-1983.184] -- 0:03:05
423400 -- [-1992.505] (-1981.343) (-1991.239) (-1988.033) * (-2002.955) (-1999.979) (-1994.534) [-1980.270] -- 0:03:05
423500 -- (-1990.320) [-1982.769] (-1987.620) (-1986.796) * (-1995.152) [-1986.804] (-1992.824) (-1979.442) -- 0:03:05
423600 -- [-1988.235] (-1982.252) (-1989.545) (-1990.438) * (-1995.382) (-1988.113) (-1994.701) [-1982.832] -- 0:03:05
423700 -- (-1992.771) [-1984.864] (-1992.871) (-1990.081) * (-1996.097) (-1989.229) (-1999.635) [-1980.508] -- 0:03:04
423800 -- [-1983.588] (-1981.259) (-1996.199) (-1985.843) * (-1994.176) (-1993.295) (-1992.917) [-1981.488] -- 0:03:04
423900 -- (-1987.474) [-1982.639] (-1990.692) (-1989.812) * (-1998.059) (-1996.994) (-1993.074) [-1983.836] -- 0:03:04
424000 -- (-1997.869) (-1988.365) [-1987.938] (-1993.201) * (-2001.283) (-1994.528) (-1995.608) [-1978.361] -- 0:03:04
Average standard deviation of split frequencies: 0.002413
424100 -- (-1995.772) [-1984.306] (-1984.069) (-1996.256) * (-1993.822) (-1991.020) (-1990.165) [-1976.633] -- 0:03:04
424200 -- (-1990.219) (-1991.258) [-1984.530] (-1996.724) * (-1991.444) (-2000.902) (-1990.381) [-1980.404] -- 0:03:04
424300 -- (-1991.269) (-1984.819) [-1985.020] (-1999.839) * (-1995.110) (-1998.066) [-1990.071] (-1981.088) -- 0:03:05
424400 -- [-1986.836] (-1992.612) (-1983.427) (-1991.498) * (-1994.093) (-2006.089) [-1988.656] (-1983.246) -- 0:03:05
424500 -- (-1994.623) (-1986.270) [-1988.674] (-1989.681) * (-1987.056) (-2000.047) [-1985.181] (-1984.388) -- 0:03:05
424600 -- (-1995.333) [-1986.140] (-1984.329) (-1994.783) * [-1981.370] (-1993.954) (-1996.703) (-1984.027) -- 0:03:05
424700 -- [-1996.474] (-1990.655) (-1986.558) (-1996.971) * (-1986.623) (-1989.736) (-1993.192) [-1985.154] -- 0:03:05
424800 -- (-1990.044) (-1988.896) [-1983.110] (-1998.307) * (-1978.990) (-1992.090) (-1993.818) [-1983.906] -- 0:03:05
424900 -- (-1994.434) [-1984.262] (-1980.147) (-1991.856) * (-1975.108) (-2001.882) (-1992.084) [-1986.153] -- 0:03:05
425000 -- (-1999.262) (-1986.523) [-1980.211] (-1988.765) * (-1985.422) (-1995.452) [-1993.509] (-1992.003) -- 0:03:05
Average standard deviation of split frequencies: 0.002439
425100 -- (-1989.764) (-1986.553) [-1980.605] (-1993.021) * (-1984.105) [-1993.700] (-1987.023) (-1992.121) -- 0:03:05
425200 -- (-1989.384) [-1980.678] (-1979.655) (-1998.017) * [-1983.476] (-1998.083) (-1984.390) (-1992.597) -- 0:03:05
425300 -- (-1994.049) (-1983.717) [-1978.800] (-1998.455) * (-1984.747) (-2004.634) [-1986.936] (-1991.260) -- 0:03:05
425400 -- (-1990.257) [-1984.539] (-1979.122) (-1999.271) * [-1990.605] (-1989.263) (-1990.400) (-1996.041) -- 0:03:05
425500 -- (-1992.550) (-1992.878) [-1978.543] (-2001.779) * (-1994.144) (-1992.809) (-1989.045) [-1988.169] -- 0:03:04
425600 -- (-1988.768) (-1984.736) [-1979.785] (-1996.757) * [-1992.061] (-1997.511) (-1990.613) (-1999.100) -- 0:03:04
425700 -- (-1988.313) [-1985.827] (-1990.468) (-1993.572) * (-1994.336) (-1991.739) [-1993.231] (-2002.891) -- 0:03:04
425800 -- (-1987.164) [-1985.895] (-1989.707) (-1989.833) * (-1997.177) (-2007.862) [-1985.248] (-1993.778) -- 0:03:04
425900 -- (-1984.801) (-1983.833) [-1988.394] (-1989.357) * (-1998.754) (-2000.152) (-1983.159) [-1986.568] -- 0:03:04
426000 -- (-1997.793) [-1986.738] (-1987.981) (-1995.098) * (-1995.207) (-2001.434) [-1987.198] (-1989.021) -- 0:03:04
Average standard deviation of split frequencies: 0.002655
426100 -- (-1992.605) [-1979.731] (-1985.471) (-1985.720) * (-1996.370) (-1997.247) [-1992.632] (-1990.904) -- 0:03:04
426200 -- (-1992.074) [-1979.831] (-1983.280) (-1985.943) * (-1990.459) (-1998.472) (-1990.694) [-1987.825] -- 0:03:04
426300 -- (-1992.579) (-1981.380) [-1985.645] (-1987.950) * (-1985.583) (-1988.057) [-1989.303] (-1983.808) -- 0:03:04
426400 -- (-1989.086) [-1982.559] (-1980.826) (-1988.089) * [-1984.095] (-1996.658) (-1991.032) (-1989.793) -- 0:03:04
426500 -- (-1993.758) (-1987.253) [-1981.116] (-1984.445) * [-1982.271] (-2001.796) (-1989.837) (-1993.199) -- 0:03:04
426600 -- (-1988.312) (-1997.587) [-1979.809] (-1996.152) * [-1983.191] (-1998.585) (-1990.892) (-1992.204) -- 0:03:04
426700 -- (-1987.778) (-2001.313) [-1981.501] (-2004.439) * [-1986.973] (-1997.774) (-1992.577) (-1986.182) -- 0:03:04
426800 -- (-1991.990) (-1988.876) (-1984.221) [-1993.784] * [-1991.541] (-1994.654) (-1996.688) (-1986.452) -- 0:03:03
426900 -- (-1990.007) [-1986.713] (-1990.133) (-1993.844) * (-1993.042) (-1987.043) (-1992.319) [-1986.646] -- 0:03:03
427000 -- (-1989.830) (-1989.619) [-1987.995] (-2001.399) * (-1991.674) (-2006.340) (-1996.098) [-1982.497] -- 0:03:03
Average standard deviation of split frequencies: 0.002491
427100 -- [-1990.086] (-1991.206) (-1987.518) (-2001.360) * (-1988.282) (-2007.206) (-1993.058) [-1981.676] -- 0:03:03
427200 -- [-1986.790] (-1996.477) (-1987.605) (-2004.896) * (-1982.571) (-1992.575) (-1998.275) [-1983.825] -- 0:03:03
427300 -- (-1990.310) [-1987.740] (-1992.131) (-1994.655) * (-1991.542) (-1995.310) (-2003.786) [-1987.523] -- 0:03:03
427400 -- (-1994.028) [-1986.197] (-2004.022) (-1995.298) * (-1987.459) [-1983.800] (-1996.146) (-1987.781) -- 0:03:04
427500 -- [-1987.957] (-1984.524) (-1991.825) (-1998.965) * (-1998.300) (-1984.686) (-1997.741) [-1987.141] -- 0:03:04
427600 -- (-1988.708) (-1992.009) (-1995.219) [-1990.533] * [-1985.467] (-1982.618) (-1995.421) (-1985.103) -- 0:03:04
427700 -- [-1985.877] (-1983.337) (-1997.596) (-1990.010) * (-1993.259) (-1982.920) (-2004.498) [-1982.990] -- 0:03:04
427800 -- [-1986.502] (-1988.232) (-2000.139) (-1989.610) * (-1990.830) [-1984.556] (-2008.391) (-1987.815) -- 0:03:04
427900 -- [-1990.824] (-1991.648) (-2008.307) (-1989.447) * [-1990.969] (-1990.546) (-2011.813) (-1993.662) -- 0:03:04
428000 -- [-1995.720] (-1990.779) (-2011.122) (-1992.409) * [-1987.455] (-1989.135) (-1997.074) (-2002.691) -- 0:03:04
Average standard deviation of split frequencies: 0.002517
428100 -- (-2001.475) (-2002.861) (-2011.619) [-1987.542] * (-1986.829) [-1987.027] (-2011.169) (-1993.936) -- 0:03:04
428200 -- (-1996.606) (-1997.333) (-2015.965) [-1984.593] * [-1982.942] (-1987.369) (-1991.413) (-2009.584) -- 0:03:04
428300 -- (-1996.315) (-1989.699) (-2013.276) [-1987.440] * [-1986.548] (-1992.425) (-1993.635) (-1997.989) -- 0:03:04
428400 -- (-1991.982) (-1993.037) (-2000.905) [-1986.671] * (-1984.473) (-1994.719) (-1987.645) [-1985.924] -- 0:03:04
428500 -- (-1992.061) (-1992.386) (-2005.953) [-1986.482] * (-1987.840) (-1997.480) (-1989.032) [-1984.635] -- 0:03:04
428600 -- [-1989.079] (-2002.340) (-2010.538) (-1985.267) * (-1995.964) (-1986.952) (-1990.439) [-1990.366] -- 0:03:03
428700 -- (-1991.717) (-2004.810) [-1989.680] (-1995.490) * (-1996.690) (-1990.821) (-1992.843) [-1986.346] -- 0:03:03
428800 -- (-1994.005) (-2004.392) (-1996.222) [-1990.278] * (-1993.659) (-1988.133) [-1988.658] (-1987.527) -- 0:03:03
428900 -- (-1999.034) (-2009.515) [-1986.532] (-1992.944) * (-1991.143) (-1983.815) [-1987.132] (-1985.679) -- 0:03:03
429000 -- (-1998.063) (-2002.071) [-1988.877] (-1993.860) * (-1990.305) (-1987.260) [-1987.892] (-1993.540) -- 0:03:03
Average standard deviation of split frequencies: 0.002510
429100 -- (-1997.048) (-1992.791) [-1990.751] (-1994.141) * (-1988.380) [-1986.444] (-1984.550) (-1989.526) -- 0:03:03
429200 -- (-1997.189) (-1998.876) (-1999.796) [-1989.271] * (-1989.777) [-1983.803] (-1982.860) (-1985.504) -- 0:03:03
429300 -- (-1993.583) (-2000.579) (-1995.959) [-1986.795] * (-1988.786) (-1982.423) (-1987.675) [-1980.414] -- 0:03:03
429400 -- (-1997.604) (-1997.979) [-1988.455] (-1995.522) * (-1993.249) [-1981.025] (-1988.175) (-1986.744) -- 0:03:03
429500 -- (-1999.353) (-1999.720) [-1979.829] (-2006.893) * (-1999.749) (-1982.614) [-1987.807] (-1986.783) -- 0:03:03
429600 -- (-1999.086) (-2000.933) [-1983.257] (-1999.944) * (-1997.898) (-1983.718) (-1984.908) [-1990.443] -- 0:03:03
429700 -- (-1991.013) (-1998.401) [-1980.849] (-1994.153) * (-1996.023) (-1992.648) [-1986.400] (-1988.341) -- 0:03:03
429800 -- (-2004.563) [-1992.718] (-1987.720) (-1995.459) * (-1994.255) (-1991.829) (-1991.381) [-1983.338] -- 0:03:03
429900 -- (-2000.884) (-1985.502) [-1985.337] (-1999.652) * (-1986.070) [-1990.426] (-1988.208) (-1983.621) -- 0:03:03
430000 -- (-2010.282) (-1985.256) [-1983.985] (-1992.728) * (-1989.621) (-1986.519) (-1986.925) [-1981.773] -- 0:03:02
Average standard deviation of split frequencies: 0.002442
430100 -- (-2004.300) (-1985.400) [-1984.034] (-1990.169) * (-1995.161) (-1984.881) (-1993.573) [-1979.011] -- 0:03:02
430200 -- (-1999.871) [-1989.854] (-1982.512) (-1996.035) * (-1998.920) [-1984.579] (-2001.170) (-1987.809) -- 0:03:02
430300 -- (-1999.441) (-1993.576) [-1986.676] (-2004.334) * (-1997.759) (-1984.860) (-2000.917) [-1988.320] -- 0:03:04
430400 -- (-1999.324) (-1997.894) [-1982.385] (-1991.254) * (-1996.879) (-1987.558) (-2001.190) [-1984.203] -- 0:03:03
430500 -- (-1996.199) (-1996.608) (-1982.980) [-1985.024] * (-1992.713) (-1983.241) (-2002.376) [-1985.390] -- 0:03:03
430600 -- (-1999.869) (-1998.348) [-1984.377] (-1985.224) * (-1987.420) [-1980.603] (-1995.682) (-1986.885) -- 0:03:03
430700 -- (-2001.200) (-1991.783) [-1982.164] (-1982.792) * (-1984.204) [-1979.941] (-1989.158) (-1985.523) -- 0:03:03
430800 -- (-1997.428) (-1993.560) [-1981.083] (-1986.842) * (-1979.697) [-1979.498] (-1991.359) (-1986.995) -- 0:03:03
430900 -- (-1994.623) (-1995.998) [-1985.540] (-1985.287) * [-1980.284] (-1981.183) (-1996.119) (-1987.603) -- 0:03:03
431000 -- [-1985.447] (-1987.237) (-1980.941) (-1985.890) * [-1983.924] (-1984.711) (-1993.947) (-1992.821) -- 0:03:03
Average standard deviation of split frequencies: 0.002530
431100 -- (-1990.063) (-2000.480) (-1990.288) [-1986.633] * (-1985.269) [-1984.445] (-1995.481) (-1990.206) -- 0:03:03
431200 -- (-1996.300) (-2000.886) (-1986.680) [-1982.361] * (-1984.365) [-1983.225] (-1991.874) (-1994.155) -- 0:03:03
431300 -- (-2002.934) (-1996.352) (-1991.503) [-1987.016] * (-1987.228) (-1988.929) [-1992.151] (-1997.987) -- 0:03:03
431400 -- (-1996.318) (-1999.012) (-1986.480) [-1982.804] * (-1988.401) [-1979.034] (-1995.704) (-1987.517) -- 0:03:03
431500 -- (-1999.279) (-1994.815) [-1985.374] (-1982.822) * [-1989.195] (-1983.254) (-1993.480) (-1987.408) -- 0:03:03
431600 -- (-1995.402) (-1992.919) [-1980.874] (-1984.371) * (-1988.167) (-1983.221) (-1993.748) [-1980.702] -- 0:03:03
431700 -- (-1998.656) [-1988.863] (-1980.924) (-1985.372) * (-1993.016) [-1983.904] (-1993.585) (-1985.443) -- 0:03:02
431800 -- (-1992.845) (-1990.554) [-1983.482] (-1987.723) * (-1989.311) [-1984.413] (-1993.709) (-1980.530) -- 0:03:02
431900 -- (-1993.411) (-1990.242) [-1986.490] (-1985.385) * (-1994.224) (-1986.842) (-1987.329) [-1978.629] -- 0:03:02
432000 -- (-1992.884) (-1989.296) (-1982.420) [-1982.204] * (-1993.150) (-1983.761) (-1991.468) [-1979.093] -- 0:03:02
Average standard deviation of split frequencies: 0.002462
432100 -- (-1993.633) [-1983.638] (-1994.187) (-1987.668) * (-1998.060) [-1983.441] (-1997.340) (-1980.998) -- 0:03:02
432200 -- (-1992.221) [-1982.812] (-1985.511) (-1993.018) * (-1996.143) [-1981.811] (-1992.855) (-1986.340) -- 0:03:02
432300 -- (-1994.287) [-1982.422] (-1984.218) (-1984.932) * (-1988.251) [-1984.597] (-1993.557) (-1981.079) -- 0:03:02
432400 -- (-1993.277) (-1995.028) (-1996.167) [-1985.304] * (-2002.705) (-1986.011) (-1997.418) [-1981.415] -- 0:03:02
432500 -- [-1994.255] (-2000.494) (-1994.009) (-1986.973) * (-1990.902) (-1989.341) (-1989.119) [-1986.884] -- 0:03:02
432600 -- (-2002.571) [-1985.859] (-1991.653) (-1991.713) * (-1995.153) [-1983.154] (-1986.553) (-1994.468) -- 0:03:02
432700 -- (-2000.757) (-1983.416) [-1981.952] (-1998.412) * (-1991.842) [-1988.423] (-1987.778) (-1990.792) -- 0:03:02
432800 -- (-1994.972) (-1979.978) [-1981.273] (-2000.031) * (-1994.196) [-1984.475] (-2000.917) (-1986.338) -- 0:03:02
432900 -- (-1999.520) [-1980.816] (-1987.492) (-1999.246) * (-1988.962) [-1982.686] (-1997.055) (-1994.868) -- 0:03:02
433000 -- (-2000.497) (-1979.078) [-1988.804] (-1996.469) * (-1999.169) [-1984.039] (-1993.810) (-1990.478) -- 0:03:02
Average standard deviation of split frequencies: 0.002518
433100 -- (-2000.013) [-1983.850] (-1984.049) (-1999.130) * (-1995.597) [-1984.268] (-1992.613) (-1994.798) -- 0:03:01
433200 -- (-1991.335) [-1983.916] (-1984.922) (-1993.340) * (-1998.789) [-1983.145] (-1993.113) (-1992.499) -- 0:03:01
433300 -- [-1986.019] (-1988.942) (-1985.039) (-1995.465) * (-1992.405) (-1988.670) (-1988.625) [-1988.429] -- 0:03:01
433400 -- (-1988.239) (-1987.106) [-1982.070] (-2004.046) * (-1996.525) [-1986.432] (-1992.546) (-1989.564) -- 0:03:03
433500 -- (-1986.453) (-1983.496) [-1982.512] (-1998.785) * [-1983.544] (-1993.516) (-1998.521) (-1991.290) -- 0:03:02
433600 -- (-1987.936) (-1979.694) [-1982.481] (-2003.254) * (-1981.335) (-1994.236) (-2006.206) [-1988.373] -- 0:03:02
433700 -- [-1988.175] (-1985.850) (-1984.445) (-2004.422) * [-1981.832] (-1995.836) (-2001.220) (-1992.626) -- 0:03:02
433800 -- (-1990.457) (-1986.230) [-1984.371] (-1998.088) * [-1983.437] (-1994.233) (-1985.572) (-1994.357) -- 0:03:02
433900 -- (-1994.869) (-1981.631) [-1988.110] (-1999.204) * (-1989.149) (-1998.484) [-1989.972] (-1996.143) -- 0:03:02
434000 -- (-1998.727) (-1982.988) [-1980.261] (-1999.146) * [-1985.723] (-2001.317) (-1985.615) (-1992.628) -- 0:03:02
Average standard deviation of split frequencies: 0.002513
434100 -- (-1994.151) (-1991.275) [-1982.670] (-1993.541) * (-1986.014) (-2001.682) [-1984.251] (-1991.403) -- 0:03:02
434200 -- (-1997.744) (-1991.220) [-1980.310] (-1996.828) * (-1986.199) (-2007.634) [-1987.730] (-1989.178) -- 0:03:02
434300 -- (-2002.187) (-1991.667) [-1981.555] (-1994.099) * (-1984.591) (-2003.136) [-1984.069] (-1988.724) -- 0:03:02
434400 -- (-2001.964) (-2001.699) [-1985.637] (-1991.127) * [-1983.375] (-2007.883) (-1988.697) (-2004.778) -- 0:03:02
434500 -- (-2008.718) [-1996.617] (-1990.012) (-1993.212) * [-1983.689] (-1997.319) (-1998.176) (-1998.376) -- 0:03:02
434600 -- (-1995.022) (-1998.842) (-2000.157) [-1985.188] * [-1983.475] (-2003.329) (-1996.649) (-2002.271) -- 0:03:02
434700 -- [-1994.132] (-1996.882) (-1992.586) (-1990.610) * [-1991.116] (-1998.541) (-2003.651) (-2012.266) -- 0:03:02
434800 -- (-1999.534) [-1991.961] (-1995.911) (-1988.012) * [-1990.305] (-1991.688) (-1992.295) (-2007.648) -- 0:03:01
434900 -- (-1993.468) (-1994.114) (-1989.950) [-1991.429] * [-1988.723] (-1991.921) (-1991.586) (-2000.916) -- 0:03:01
435000 -- (-1991.834) (-1998.966) [-1984.842] (-1999.779) * (-1978.600) [-1989.939] (-1987.894) (-1996.627) -- 0:03:01
Average standard deviation of split frequencies: 0.002445
435100 -- [-1984.970] (-1998.369) (-1986.719) (-1988.323) * [-1980.957] (-1990.102) (-1987.882) (-1996.549) -- 0:03:01
435200 -- (-1986.448) (-2000.073) [-1983.728] (-1985.395) * (-1985.862) [-1989.497] (-1985.569) (-1993.688) -- 0:03:01
435300 -- [-1982.185] (-1992.547) (-1982.663) (-1997.990) * [-1982.574] (-1986.395) (-1992.957) (-2002.542) -- 0:03:01
435400 -- (-1987.323) (-1994.801) [-1983.598] (-2004.421) * [-1982.670] (-1988.383) (-1995.005) (-2004.645) -- 0:03:01
435500 -- (-1985.994) (-1997.304) [-1984.812] (-2009.627) * (-1982.220) (-1991.944) [-1993.043] (-1998.209) -- 0:03:01
435600 -- (-1986.119) (-2001.538) [-1984.082] (-2005.234) * [-1981.936] (-1988.294) (-1998.229) (-1999.044) -- 0:03:01
435700 -- [-1989.510] (-1994.781) (-1990.516) (-2000.341) * (-1991.309) [-1990.110] (-1996.639) (-2004.864) -- 0:03:01
435800 -- (-1993.208) (-1990.525) [-1981.079] (-1998.157) * (-1996.421) (-1996.287) [-1993.790] (-2007.549) -- 0:03:01
435900 -- (-1987.036) (-1992.503) [-1985.750] (-1996.581) * (-1986.348) [-1989.647] (-1989.435) (-2009.072) -- 0:03:01
436000 -- (-1994.066) (-1989.577) [-1984.183] (-2010.499) * (-1984.632) (-1990.838) [-1997.322] (-2013.690) -- 0:03:01
Average standard deviation of split frequencies: 0.002316
436100 -- (-1998.864) (-1987.276) [-1985.377] (-2001.394) * [-1978.766] (-1993.279) (-2000.159) (-2004.990) -- 0:03:01
436200 -- [-1985.650] (-1986.820) (-1999.651) (-1999.168) * [-1982.853] (-1989.203) (-1992.721) (-2001.700) -- 0:03:00
436300 -- [-1984.973] (-1990.962) (-1983.608) (-2006.174) * [-1983.589] (-1989.593) (-1985.066) (-1992.074) -- 0:03:00
436400 -- (-1985.530) [-1985.150] (-1987.361) (-2004.089) * [-1982.533] (-1995.030) (-1986.972) (-1999.039) -- 0:03:00
436500 -- (-1990.938) [-1989.736] (-1987.861) (-1993.833) * [-1982.821] (-1993.308) (-1989.529) (-2005.330) -- 0:03:02
436600 -- (-1987.888) (-1982.103) [-1986.213] (-1996.920) * (-1987.534) (-2003.721) [-1988.315] (-1997.789) -- 0:03:01
436700 -- [-1988.869] (-1987.003) (-1985.631) (-1992.006) * [-1981.412] (-2009.193) (-1992.723) (-1992.005) -- 0:03:01
436800 -- (-1985.291) [-1988.119] (-1986.263) (-2001.915) * [-1979.580] (-2001.718) (-2004.525) (-1994.824) -- 0:03:01
436900 -- (-1987.800) (-1988.096) (-1984.226) [-1995.138] * [-1985.489] (-1991.275) (-2003.199) (-1993.143) -- 0:03:01
437000 -- (-1987.253) (-1990.697) (-1985.911) [-1990.478] * [-1983.493] (-1999.737) (-1998.321) (-1988.754) -- 0:03:01
Average standard deviation of split frequencies: 0.002218
437100 -- (-1988.251) (-1997.579) [-1987.784] (-1990.404) * [-1982.708] (-1996.732) (-1997.873) (-1985.745) -- 0:03:01
437200 -- (-1988.466) (-1994.644) (-1989.299) [-1995.565] * (-1983.994) [-1999.324] (-2003.322) (-1986.793) -- 0:03:01
437300 -- (-1983.544) (-1989.830) [-1986.149] (-2009.123) * [-1985.097] (-1991.849) (-1998.205) (-1992.499) -- 0:03:01
437400 -- [-1984.138] (-1983.716) (-1986.387) (-2007.327) * (-1984.314) [-1988.393] (-1996.215) (-2000.104) -- 0:03:01
437500 -- (-1987.359) [-1984.364] (-1982.418) (-2010.550) * (-1987.049) [-1995.531] (-1995.321) (-1996.969) -- 0:03:01
437600 -- [-1987.038] (-1987.165) (-1985.199) (-2008.817) * (-1986.184) (-1993.172) [-1991.213] (-1989.781) -- 0:03:01
437700 -- (-1984.107) (-1988.155) [-1990.662] (-1995.648) * [-1981.839] (-1984.411) (-1991.009) (-1995.516) -- 0:03:01
437800 -- (-1985.213) (-1988.531) [-1989.053] (-1989.490) * (-1981.981) (-1989.927) [-1990.450] (-2003.324) -- 0:03:01
437900 -- (-1984.297) [-1983.976] (-1985.009) (-1988.922) * [-1980.632] (-1986.231) (-1992.508) (-1997.779) -- 0:03:00
438000 -- [-1981.524] (-1989.379) (-1985.977) (-1989.723) * [-1985.707] (-1986.970) (-1992.079) (-1992.904) -- 0:03:00
Average standard deviation of split frequencies: 0.002121
438100 -- [-1982.985] (-1990.463) (-1984.911) (-1997.292) * (-1992.291) (-1988.306) (-1995.225) [-1989.254] -- 0:03:00
438200 -- (-1988.840) (-1983.292) [-1988.975] (-1995.768) * (-1992.973) [-1985.707] (-1989.356) (-1996.885) -- 0:03:00
438300 -- (-1984.261) [-1983.217] (-1992.635) (-2006.111) * (-1990.255) (-1991.839) [-1990.980] (-1988.261) -- 0:03:00
438400 -- (-1986.263) [-1983.985] (-1993.318) (-2002.777) * (-1983.476) (-1993.437) (-2001.579) [-1985.862] -- 0:03:00
438500 -- (-1993.724) [-1988.009] (-1991.995) (-2001.440) * (-1988.244) [-1994.439] (-1997.831) (-1994.878) -- 0:03:00
438600 -- (-1992.058) (-1985.056) [-1987.134] (-1994.673) * [-1985.908] (-2005.206) (-1993.515) (-1999.494) -- 0:03:00
438700 -- (-1990.583) [-1979.980] (-1985.779) (-1996.779) * [-1982.757] (-1999.104) (-1993.748) (-1990.883) -- 0:03:00
438800 -- (-1985.885) (-1985.900) (-1989.345) [-1989.994] * (-1984.458) (-2005.240) (-1994.513) [-1991.618] -- 0:03:00
438900 -- (-1995.192) [-1986.111] (-1993.255) (-1994.445) * (-1984.074) (-1997.049) (-2001.479) [-1987.224] -- 0:03:00
439000 -- (-1989.873) (-1986.196) [-1986.597] (-1992.938) * (-1990.137) (-1997.814) (-1991.769) [-1987.881] -- 0:03:00
Average standard deviation of split frequencies: 0.001840
439100 -- (-1986.194) (-1982.597) [-1993.467] (-1992.095) * (-1995.157) (-1998.369) [-1991.863] (-1995.466) -- 0:03:00
439200 -- [-1987.287] (-1986.348) (-1992.870) (-1991.205) * [-1990.325] (-1993.356) (-1992.989) (-1994.887) -- 0:03:00
439300 -- (-1988.804) [-1985.778] (-1983.778) (-1989.880) * (-1982.961) (-1992.288) (-1991.100) [-1990.460] -- 0:02:59
439400 -- [-1993.453] (-1992.436) (-1982.912) (-1999.211) * [-1979.955] (-1996.583) (-1989.501) (-2002.147) -- 0:02:59
439500 -- (-1993.802) (-1990.697) [-1985.215] (-1991.767) * [-1983.749] (-1994.574) (-1988.102) (-2004.134) -- 0:03:01
439600 -- (-1992.126) (-1991.837) [-1984.144] (-1993.516) * [-1978.987] (-1994.143) (-1987.615) (-2009.278) -- 0:03:01
439700 -- (-1986.588) (-1999.176) [-1981.523] (-1992.766) * [-1982.868] (-2001.912) (-1990.025) (-1997.891) -- 0:03:00
439800 -- (-1982.025) (-1996.418) [-1984.640] (-1990.513) * [-1983.274] (-2014.379) (-1987.785) (-1992.686) -- 0:03:00
439900 -- (-1982.739) (-1995.739) [-1984.121] (-1990.064) * (-1985.643) (-1997.533) (-1991.911) [-1987.804] -- 0:03:00
440000 -- [-1979.301] (-1992.078) (-1983.744) (-1983.905) * [-1982.689] (-1996.742) (-1991.900) (-1990.904) -- 0:03:00
Average standard deviation of split frequencies: 0.001775
440100 -- [-1980.605] (-1991.922) (-1984.536) (-1988.609) * [-1986.875] (-1996.016) (-1997.019) (-1990.052) -- 0:03:00
440200 -- (-1980.568) (-1994.957) [-1981.805] (-1988.942) * [-1983.181] (-1990.996) (-2003.807) (-1994.401) -- 0:03:00
440300 -- [-1980.118] (-1986.305) (-1981.511) (-1992.760) * [-1982.723] (-1989.801) (-1995.337) (-1995.395) -- 0:03:00
440400 -- [-1980.433] (-1991.652) (-1982.467) (-1990.087) * [-1984.236] (-1990.622) (-1989.312) (-1987.781) -- 0:03:00
440500 -- [-1982.948] (-1996.032) (-1989.279) (-1990.183) * [-1982.921] (-1991.514) (-1988.259) (-1986.323) -- 0:03:00
440600 -- [-1984.206] (-1991.247) (-1984.612) (-1986.204) * (-1988.100) (-1991.204) (-1993.141) [-1987.001] -- 0:03:00
440700 -- [-1983.195] (-1998.114) (-1981.569) (-1985.484) * (-1991.646) [-1989.232] (-1991.424) (-1986.784) -- 0:03:00
440800 -- (-1984.313) (-2000.201) [-1982.750] (-1988.681) * (-1997.451) (-1992.756) (-1999.266) [-1992.161] -- 0:03:00
440900 -- (-1982.873) (-1991.133) [-1985.172] (-1992.802) * (-1990.280) (-1994.392) (-2005.042) [-1989.702] -- 0:03:00
441000 -- (-1982.247) (-1994.195) [-1984.868] (-1989.066) * (-1984.990) (-1992.596) (-1999.780) [-1992.595] -- 0:02:59
Average standard deviation of split frequencies: 0.001771
441100 -- (-1989.994) (-2004.588) [-1981.456] (-1989.125) * [-1986.409] (-1999.816) (-2008.825) (-1996.349) -- 0:02:59
441200 -- (-1993.634) (-1986.918) (-1982.506) [-1988.970] * [-1988.013] (-2002.442) (-2010.716) (-1991.856) -- 0:02:59
441300 -- (-1994.194) (-1993.935) [-1985.824] (-2001.533) * [-1988.709] (-1998.666) (-1998.121) (-1990.594) -- 0:02:59
441400 -- (-1985.305) [-1987.917] (-1992.664) (-1995.078) * (-1990.143) (-2009.689) (-1991.152) [-1987.819] -- 0:02:59
441500 -- [-1982.518] (-1989.777) (-1982.052) (-2001.402) * (-1989.968) (-2000.169) [-1989.165] (-1988.927) -- 0:02:59
441600 -- [-1985.447] (-1995.055) (-1984.499) (-1987.070) * [-1984.377] (-1997.817) (-1995.250) (-1984.588) -- 0:02:59
441700 -- [-1982.130] (-1987.830) (-1986.689) (-1987.114) * [-1988.491] (-1998.745) (-1996.152) (-1993.675) -- 0:02:59
441800 -- (-1986.180) (-1986.865) [-1984.687] (-1985.777) * [-1983.556] (-1997.424) (-1988.400) (-2000.568) -- 0:02:59
441900 -- (-1988.449) (-1986.190) [-1984.242] (-1987.468) * (-1989.788) (-2001.710) [-1991.643] (-1995.231) -- 0:02:59
442000 -- (-1995.225) (-1988.907) [-1984.542] (-1994.842) * [-1984.461] (-1995.246) (-1984.410) (-1995.643) -- 0:02:59
Average standard deviation of split frequencies: 0.001767
442100 -- (-1991.573) (-1985.530) [-1986.544] (-1996.214) * (-1995.745) (-2000.257) [-1986.842] (-1993.363) -- 0:02:59
442200 -- (-1991.122) (-1986.445) [-1979.085] (-1988.627) * (-2001.393) (-1998.692) [-1987.053] (-1995.541) -- 0:02:59
442300 -- (-1992.657) [-1986.104] (-1986.793) (-1992.057) * (-2003.321) (-1995.556) (-1990.577) [-1987.983] -- 0:02:59
442400 -- (-1992.437) [-1985.089] (-1992.737) (-1990.727) * (-2001.020) [-1990.524] (-1994.573) (-1991.804) -- 0:03:00
442500 -- [-1989.442] (-1983.526) (-1995.663) (-1992.683) * (-2000.975) [-1982.207] (-1990.246) (-1987.170) -- 0:03:00
442600 -- (-1991.176) [-1982.075] (-1990.637) (-1992.481) * (-1998.224) (-1984.930) (-1991.886) [-1988.115] -- 0:03:00
442700 -- (-1994.941) [-1985.843] (-1986.098) (-1990.519) * (-1991.957) (-1988.324) (-1990.994) [-1988.520] -- 0:03:00
442800 -- (-1999.202) (-1985.409) [-1983.226] (-1987.375) * (-1996.100) (-1994.091) [-1993.377] (-1990.666) -- 0:02:59
442900 -- (-2003.150) [-1984.992] (-1986.626) (-1987.711) * (-1991.038) (-1997.880) (-1995.400) [-1990.865] -- 0:02:59
443000 -- (-2008.120) [-1987.940] (-1983.686) (-1997.314) * (-1992.913) [-1989.420] (-1988.987) (-1988.579) -- 0:02:59
Average standard deviation of split frequencies: 0.001884
443100 -- (-2007.070) (-1993.239) [-1979.299] (-1994.353) * (-1992.868) [-1984.694] (-1992.644) (-1988.131) -- 0:02:59
443200 -- (-2000.458) (-1992.377) [-1980.842] (-1990.236) * (-2009.923) [-1988.687] (-1995.695) (-1992.973) -- 0:02:59
443300 -- (-2002.898) [-1987.240] (-1985.744) (-1991.190) * (-2003.925) (-1987.875) (-1993.038) [-1996.407] -- 0:02:59
443400 -- (-1995.798) (-1991.473) [-1988.680] (-1988.463) * (-2008.085) [-1989.882] (-1988.637) (-1996.979) -- 0:02:59
443500 -- (-2001.561) [-1991.898] (-1989.737) (-1987.287) * (-2004.413) [-1990.533] (-1986.508) (-1991.638) -- 0:02:59
443600 -- (-1999.847) (-1992.761) (-1990.289) [-1985.030] * (-2010.134) [-1989.097] (-1990.702) (-1996.619) -- 0:02:59
443700 -- (-1994.448) [-1988.311] (-1992.780) (-1987.418) * (-1999.211) [-1987.714] (-1991.258) (-1998.114) -- 0:02:59
443800 -- (-1996.896) (-1989.042) [-1989.507] (-1991.140) * (-1994.179) [-1990.673] (-1996.729) (-1997.471) -- 0:02:59
443900 -- (-2002.022) (-1994.511) [-1986.907] (-1990.928) * [-1994.076] (-1997.425) (-1992.603) (-2001.257) -- 0:02:59
444000 -- (-1997.345) (-1995.304) (-1982.347) [-1985.574] * [-1990.515] (-1996.635) (-2000.423) (-1997.909) -- 0:02:59
Average standard deviation of split frequencies: 0.002062
444100 -- (-2010.787) (-1992.618) [-1981.226] (-1988.749) * [-1992.083] (-1994.148) (-1991.831) (-2001.936) -- 0:02:58
444200 -- (-2005.321) (-1993.731) [-1984.862] (-1988.908) * [-1994.176] (-1994.756) (-1993.014) (-1997.255) -- 0:02:58
444300 -- (-2001.706) [-1992.231] (-1990.329) (-1988.334) * [-1990.109] (-2001.237) (-2000.892) (-1993.857) -- 0:02:58
444400 -- (-2000.645) (-1988.569) (-1986.651) [-1989.054] * [-1987.541] (-2001.201) (-1995.993) (-1991.236) -- 0:02:58
444500 -- (-2009.841) (-1995.664) [-1984.820] (-1985.064) * (-1989.529) (-1994.199) (-1994.174) [-1993.274] -- 0:02:58
444600 -- (-2008.679) (-1996.393) [-1987.512] (-1993.441) * (-1994.165) (-2002.370) [-1995.757] (-2003.397) -- 0:02:58
444700 -- (-1999.272) [-2001.079] (-1985.667) (-1988.190) * [-1991.348] (-2005.506) (-1986.127) (-1990.479) -- 0:02:58
444800 -- (-1996.981) (-1999.994) (-1986.368) [-1985.953] * (-1992.444) (-2004.071) [-1988.974] (-1999.402) -- 0:02:58
444900 -- (-1991.505) (-1997.774) [-1983.978] (-1985.476) * (-1992.737) (-1994.886) [-1990.316] (-1992.871) -- 0:02:58
445000 -- [-1986.109] (-2001.465) (-1986.233) (-1987.653) * (-1994.889) (-1990.822) [-1987.477] (-1988.732) -- 0:02:58
Average standard deviation of split frequencies: 0.002057
445100 -- [-1987.500] (-2010.339) (-1986.436) (-1988.821) * (-1996.396) [-1989.317] (-1988.271) (-1997.154) -- 0:02:58
445200 -- (-1988.700) (-1994.629) [-1984.323] (-1991.934) * (-1993.685) (-1989.990) (-1997.766) [-1986.347] -- 0:02:58
445300 -- (-1987.569) (-1993.184) [-1977.318] (-1989.002) * (-1994.679) (-1986.769) (-2002.610) [-1990.872] -- 0:02:59
445400 -- (-1988.669) (-1992.201) [-1981.179] (-1990.153) * [-1987.433] (-1990.075) (-2000.395) (-1992.524) -- 0:02:59
445500 -- (-1992.329) (-1993.607) [-1982.564] (-1985.722) * (-2009.872) (-1997.813) (-1994.467) [-1989.257] -- 0:02:59
445600 -- (-1992.024) (-1991.210) [-1984.344] (-1994.168) * (-1996.100) (-2008.874) [-1992.939] (-1992.133) -- 0:02:59
445700 -- (-1992.727) (-1991.295) [-1991.362] (-1991.388) * (-1993.471) (-2003.706) [-1993.325] (-1996.428) -- 0:02:59
445800 -- (-2000.190) (-1986.534) [-1992.657] (-1992.246) * (-1986.554) (-2005.311) [-1985.927] (-1987.190) -- 0:02:59
445900 -- (-1993.910) (-1987.398) [-1980.466] (-1992.840) * [-1991.769] (-1999.600) (-1986.564) (-1989.579) -- 0:02:58
446000 -- (-1988.159) [-1981.391] (-1981.357) (-1990.314) * [-1984.649] (-2003.614) (-1990.159) (-1990.741) -- 0:02:58
Average standard deviation of split frequencies: 0.002355
446100 -- (-1994.213) (-1986.253) [-1980.745] (-1991.110) * (-1987.037) (-1991.306) [-1986.035] (-1991.209) -- 0:02:58
446200 -- (-2001.564) (-1991.054) [-1979.186] (-2001.412) * [-1982.816] (-1994.940) (-1986.978) (-1995.583) -- 0:02:58
446300 -- (-1994.221) (-1996.893) [-1984.259] (-1990.459) * [-1984.378] (-1997.981) (-1989.234) (-2002.300) -- 0:02:58
446400 -- (-1992.310) (-2002.259) [-1983.537] (-1991.678) * (-1986.779) (-2002.537) [-1990.347] (-1997.008) -- 0:02:58
446500 -- (-1991.863) (-2001.869) [-1983.832] (-1993.911) * [-1979.690] (-1996.759) (-1992.330) (-1989.661) -- 0:02:58
446600 -- [-1989.600] (-2013.945) (-1986.078) (-1992.156) * (-1982.046) [-1990.277] (-2000.930) (-1991.822) -- 0:02:58
446700 -- (-1988.106) (-2009.286) (-1983.620) [-1987.475] * [-1981.351] (-1994.162) (-1996.088) (-1996.265) -- 0:02:58
446800 -- [-1991.356] (-2003.052) (-1982.511) (-1986.794) * [-1985.700] (-1999.615) (-1990.578) (-2002.438) -- 0:02:58
446900 -- (-1986.761) (-2002.497) [-1994.248] (-1987.099) * (-1989.169) (-1993.315) [-1988.256] (-1995.458) -- 0:02:58
447000 -- (-1992.124) (-2006.408) (-1992.864) [-1984.069] * (-1994.860) [-1991.932] (-1984.973) (-1990.143) -- 0:02:58
Average standard deviation of split frequencies: 0.002500
447100 -- [-1985.010] (-2008.785) (-1991.832) (-1991.594) * (-1991.994) (-1994.078) [-1988.108] (-1997.056) -- 0:02:58
447200 -- [-1984.473] (-2009.147) (-1995.018) (-1989.642) * (-1990.781) (-1995.569) [-1986.803] (-1997.509) -- 0:02:58
447300 -- [-1990.573] (-1996.469) (-1996.030) (-1991.841) * [-1988.956] (-1994.579) (-1988.431) (-1993.622) -- 0:02:57
447400 -- (-1987.542) (-1993.702) (-1986.705) [-1987.025] * [-1992.306] (-1999.275) (-1991.804) (-1993.354) -- 0:02:57
447500 -- [-1989.952] (-1993.545) (-1990.075) (-1996.428) * [-1985.102] (-1991.230) (-1993.076) (-1999.928) -- 0:02:57
447600 -- [-1986.706] (-1991.509) (-1991.557) (-1993.600) * [-1988.085] (-1986.966) (-1993.230) (-1990.111) -- 0:02:57
447700 -- [-1990.992] (-1990.908) (-1991.813) (-1992.358) * [-1989.259] (-1985.815) (-1992.009) (-1989.037) -- 0:02:57
447800 -- (-1994.511) [-1987.785] (-1997.027) (-1991.018) * (-1990.526) [-1988.062] (-1991.409) (-1986.413) -- 0:02:57
447900 -- (-1989.041) (-1988.718) (-1992.429) [-1986.480] * (-1991.293) (-1985.759) [-1985.392] (-1989.615) -- 0:02:57
448000 -- (-1984.148) (-1989.983) (-2003.721) [-1984.357] * (-1994.665) [-1986.001] (-1984.901) (-1994.914) -- 0:02:57
Average standard deviation of split frequencies: 0.002495
448100 -- (-1987.832) (-2002.281) (-1994.422) [-1986.973] * (-1989.109) [-1981.913] (-1982.985) (-1999.836) -- 0:02:57
448200 -- [-1986.932] (-2005.307) (-1983.553) (-1983.907) * (-1980.821) (-1986.521) [-1983.850] (-1996.977) -- 0:02:57
448300 -- (-1985.835) (-2001.883) (-1982.728) [-1987.063] * [-1984.845] (-1981.984) (-1989.704) (-1999.081) -- 0:02:58
448400 -- (-1986.803) (-1997.401) [-1984.353] (-1984.147) * [-1983.824] (-1983.115) (-1987.902) (-2000.290) -- 0:02:58
448500 -- (-1993.593) (-1994.690) (-1984.956) [-1979.019] * [-1983.297] (-1982.862) (-2001.922) (-1997.667) -- 0:02:58
448600 -- (-1992.802) (-1991.733) (-1986.585) [-1983.529] * (-1985.806) [-1981.135] (-2003.362) (-1999.986) -- 0:02:58
448700 -- (-1993.399) (-1988.995) [-1989.699] (-1986.776) * (-1987.560) [-1979.789] (-2001.081) (-1998.296) -- 0:02:58
448800 -- [-1988.929] (-1997.764) (-1988.142) (-1989.704) * (-1995.080) [-1981.578] (-2002.621) (-1997.949) -- 0:02:58
448900 -- (-1989.406) (-1996.902) [-1984.348] (-1983.190) * [-1986.768] (-1984.732) (-1993.015) (-1997.739) -- 0:02:58
449000 -- (-2008.491) (-2000.580) (-1987.026) [-1983.063] * [-1983.244] (-1983.362) (-2000.631) (-1993.535) -- 0:02:57
Average standard deviation of split frequencies: 0.002399
449100 -- (-2000.884) (-1998.945) (-1981.991) [-1987.385] * (-1986.942) [-1986.406] (-1997.788) (-1991.822) -- 0:02:57
449200 -- [-1989.883] (-2004.447) (-1979.036) (-1987.067) * [-1986.679] (-1987.113) (-1992.747) (-1995.867) -- 0:02:57
449300 -- (-1988.231) (-2012.733) [-1984.342] (-1995.460) * (-1981.097) [-1979.446] (-1995.032) (-1992.864) -- 0:02:57
449400 -- [-1984.657] (-2007.381) (-1981.413) (-1997.563) * (-1986.169) [-1987.034] (-1999.791) (-1996.825) -- 0:02:57
449500 -- (-1983.466) (-2009.304) [-1980.191] (-2001.688) * [-1983.839] (-1987.345) (-1996.261) (-1999.295) -- 0:02:57
449600 -- (-1986.346) (-2007.518) [-1983.694] (-1994.753) * (-1985.920) (-1985.167) (-1998.260) [-1988.924] -- 0:02:57
449700 -- (-1989.285) (-1999.715) [-1982.051] (-1992.651) * [-1983.881] (-1991.263) (-1990.633) (-2001.683) -- 0:02:57
449800 -- (-1992.860) (-1999.151) [-1980.443] (-1989.898) * [-1985.926] (-1987.631) (-2001.378) (-1995.822) -- 0:02:57
449900 -- (-1989.864) (-1993.053) [-1985.263] (-1986.977) * [-1984.489] (-1987.810) (-1996.866) (-1996.208) -- 0:02:57
450000 -- (-1990.341) (-1997.114) [-1985.885] (-1987.698) * [-1984.972] (-1993.947) (-1996.912) (-2000.201) -- 0:02:57
Average standard deviation of split frequencies: 0.002214
450100 -- (-1991.751) (-1994.855) [-1985.863] (-1993.343) * [-1985.177] (-1991.341) (-1997.156) (-2007.266) -- 0:02:57
450200 -- (-1991.460) (-1995.136) [-1987.028] (-1993.018) * [-1988.785] (-1992.611) (-2000.459) (-2007.182) -- 0:02:57
450300 -- (-2002.104) (-2003.034) [-1984.292] (-1990.504) * (-1984.653) [-1992.219] (-1998.046) (-2002.004) -- 0:02:57
450400 -- (-2006.249) (-1996.135) [-1985.900] (-1998.473) * [-1980.585] (-1988.098) (-1993.713) (-1996.144) -- 0:02:56
450500 -- (-2000.496) (-1991.303) [-1979.629] (-1989.525) * (-1984.813) [-1989.624] (-2001.556) (-1997.778) -- 0:02:56
450600 -- (-2010.111) (-1992.788) [-1985.588] (-1996.249) * (-1981.311) (-1990.400) (-1992.966) [-1992.883] -- 0:02:56
450700 -- (-1999.123) [-1983.117] (-1985.098) (-1993.439) * [-1980.963] (-1995.312) (-1997.043) (-1989.711) -- 0:02:56
450800 -- (-1992.960) (-1999.321) [-1985.387] (-1986.036) * [-1984.727] (-1997.370) (-1992.442) (-1987.676) -- 0:02:56
450900 -- (-2002.500) (-1993.306) [-1986.408] (-1988.967) * [-1982.718] (-2001.723) (-1998.951) (-1987.313) -- 0:02:56
451000 -- (-2002.346) (-1993.691) [-1986.837] (-1983.833) * (-1979.414) (-1994.423) (-1995.504) [-1992.607] -- 0:02:56
Average standard deviation of split frequencies: 0.002388
451100 -- [-1986.808] (-1990.088) (-1989.594) (-1999.297) * [-1979.334] (-1987.537) (-1987.425) (-1995.420) -- 0:02:56
451200 -- [-1988.798] (-1992.617) (-1998.541) (-1999.219) * (-1981.338) [-1990.668] (-1990.291) (-1992.644) -- 0:02:56
451300 -- (-1993.933) (-1988.545) (-1990.389) [-1990.304] * (-1982.030) (-1991.317) [-1983.900] (-1996.310) -- 0:02:56
451400 -- (-2009.565) (-1987.219) (-1984.753) [-1986.069] * (-1988.366) (-1991.111) [-1981.018] (-1990.228) -- 0:02:57
451500 -- (-1993.378) (-1987.875) [-1985.925] (-1985.663) * (-1984.145) (-1998.130) [-1976.964] (-1992.423) -- 0:02:57
451600 -- [-1991.260] (-1990.931) (-1988.427) (-1985.678) * (-1984.303) (-1990.491) [-1977.303] (-2001.914) -- 0:02:57
451700 -- (-1998.015) (-2000.307) (-1992.986) [-1986.923] * (-1992.600) (-1988.866) [-1981.602] (-1995.615) -- 0:02:57
451800 -- (-1991.181) (-2003.582) (-1994.276) [-1981.109] * (-1990.502) [-1990.456] (-1985.034) (-1998.109) -- 0:02:57
451900 -- (-1985.138) (-1998.137) (-1990.172) [-1985.618] * (-1995.438) (-1994.384) [-1981.255] (-1996.701) -- 0:02:57
452000 -- (-1987.065) (-1997.987) (-1985.888) [-1982.905] * (-1996.742) (-1986.361) [-1983.619] (-1995.507) -- 0:02:57
Average standard deviation of split frequencies: 0.002532
452100 -- (-1993.166) (-2003.832) (-1987.841) [-1984.554] * (-2003.308) (-1985.200) [-1979.781] (-1993.130) -- 0:02:56
452200 -- (-1998.860) (-2006.452) (-1986.852) [-1986.398] * (-2003.553) (-1993.722) [-1978.125] (-1995.037) -- 0:02:56
452300 -- (-1991.660) (-2007.508) [-1981.205] (-1984.754) * (-1991.822) (-1985.769) [-1979.129] (-1985.552) -- 0:02:56
452400 -- (-1992.807) (-2010.245) (-1987.383) [-1978.098] * (-1987.654) (-1989.906) [-1981.273] (-1985.312) -- 0:02:56
452500 -- (-1991.282) (-2017.699) (-1984.170) [-1984.888] * [-1992.512] (-1994.763) (-1977.208) (-1992.721) -- 0:02:56
452600 -- (-1993.288) (-2005.359) (-1984.719) [-1990.206] * [-1984.764] (-2003.058) (-1978.647) (-1988.351) -- 0:02:56
452700 -- (-1991.717) (-2001.731) [-1980.706] (-1982.895) * [-1988.061] (-1997.339) (-1975.968) (-1998.092) -- 0:02:56
452800 -- (-1992.811) (-2002.656) [-1980.314] (-1985.090) * (-1985.208) (-1990.540) [-1979.467] (-1992.007) -- 0:02:56
452900 -- (-1992.003) (-2002.336) [-1978.581] (-1990.850) * (-1983.932) (-1992.604) [-1981.083] (-1989.525) -- 0:02:56
453000 -- (-1988.279) (-2002.797) [-1981.060] (-1990.869) * (-1985.381) (-1993.361) [-1982.739] (-1988.535) -- 0:02:56
Average standard deviation of split frequencies: 0.002526
453100 -- (-1986.997) (-2007.098) [-1977.853] (-1988.204) * (-1991.301) (-1990.299) [-1985.131] (-1986.510) -- 0:02:56
453200 -- (-1991.569) (-2004.083) [-1982.283] (-1988.181) * (-1996.646) (-1996.146) [-1982.390] (-1991.539) -- 0:02:56
453300 -- (-1995.071) (-1999.772) (-1980.097) [-1986.173] * (-1998.178) (-1990.307) [-1984.811] (-1993.983) -- 0:02:56
453400 -- (-1986.812) (-1999.533) [-1978.407] (-1982.131) * (-1998.031) (-1991.600) [-1981.467] (-1991.071) -- 0:02:56
453500 -- (-1985.221) (-1998.731) [-1983.334] (-1983.084) * (-1996.499) [-1987.620] (-1987.755) (-1993.953) -- 0:02:55
453600 -- (-1989.425) (-1990.638) (-1984.187) [-1981.745] * (-1994.919) [-1988.542] (-1995.188) (-1989.403) -- 0:02:55
453700 -- (-1995.343) (-1993.422) (-1983.953) [-1986.184] * (-1990.338) (-1987.713) (-1996.505) [-1986.697] -- 0:02:55
453800 -- [-1988.788] (-1997.140) (-1988.324) (-1989.100) * (-1997.864) [-1983.960] (-1993.101) (-1985.641) -- 0:02:55
453900 -- (-1994.040) (-1999.135) (-1985.863) [-1985.441] * (-1992.557) [-1983.819] (-1989.308) (-1994.619) -- 0:02:55
454000 -- (-1998.009) (-2002.488) (-1985.021) [-1988.931] * (-1992.552) (-1986.533) [-1987.489] (-1996.776) -- 0:02:55
Average standard deviation of split frequencies: 0.002640
454100 -- [-1988.103] (-1995.091) (-1986.822) (-1986.669) * (-1995.815) [-1986.621] (-1983.499) (-1990.253) -- 0:02:55
454200 -- (-1990.147) (-1999.812) [-1983.413] (-1979.663) * (-1993.272) (-1987.242) [-1987.189] (-1998.098) -- 0:02:55
454300 -- (-1989.071) (-1999.872) (-1988.069) [-1981.211] * (-1999.917) (-1987.328) [-1989.555] (-1999.371) -- 0:02:55
454400 -- (-1997.605) (-1998.519) [-1986.451] (-1984.985) * (-1996.112) [-1987.288] (-1985.862) (-1998.709) -- 0:02:55
454500 -- (-1998.030) (-1997.269) [-1984.953] (-1986.518) * (-1996.755) (-1987.051) (-1979.918) [-1987.192] -- 0:02:56
454600 -- (-1992.272) (-1992.366) (-1986.320) [-1986.052] * (-1997.541) (-1985.171) (-1982.621) [-1991.236] -- 0:02:56
454700 -- (-1995.391) (-1985.427) (-1987.575) [-1983.207] * (-1999.127) [-1987.196] (-1982.227) (-1997.287) -- 0:02:56
454800 -- (-1989.350) [-1986.581] (-1989.992) (-1983.878) * (-2005.139) [-1984.743] (-1981.351) (-1992.590) -- 0:02:56
454900 -- (-1992.976) (-1985.217) [-1988.713] (-1981.279) * (-2008.531) (-1990.175) [-1983.143] (-1988.845) -- 0:02:56
455000 -- (-1990.925) [-1986.627] (-1994.664) (-1986.107) * (-2001.197) (-1992.541) [-1982.550] (-1993.771) -- 0:02:56
Average standard deviation of split frequencies: 0.002604
455100 -- (-1987.962) [-1986.407] (-1993.797) (-1992.007) * (-1996.679) (-1986.621) [-1981.867] (-1998.900) -- 0:02:56
455200 -- (-1999.951) [-1984.745] (-1996.285) (-1990.455) * (-1995.435) (-1990.403) (-1981.531) [-1993.147] -- 0:02:55
455300 -- (-1996.760) (-1987.130) [-1987.272] (-1994.412) * (-1992.686) (-1995.231) [-1983.372] (-1992.017) -- 0:02:55
455400 -- [-1992.977] (-1987.894) (-1989.018) (-1991.913) * (-1996.621) (-1996.688) (-1984.907) [-1986.541] -- 0:02:55
455500 -- (-1993.846) [-1988.941] (-1986.150) (-1986.955) * (-1995.790) (-1994.053) [-1981.905] (-1986.427) -- 0:02:55
455600 -- (-1995.957) (-1994.608) [-1983.018] (-1987.762) * [-1985.139] (-1988.982) (-1985.256) (-1986.954) -- 0:02:55
455700 -- (-1997.489) (-1996.671) [-1984.485] (-1983.557) * (-1984.963) (-1986.436) [-1984.613] (-1999.272) -- 0:02:55
455800 -- (-1995.657) (-2009.520) (-1985.825) [-1985.254] * (-1987.078) (-1982.435) [-1983.745] (-1995.517) -- 0:02:55
455900 -- (-1992.241) (-2001.610) (-1983.590) [-1979.752] * (-1991.776) (-1988.861) [-1982.380] (-1992.083) -- 0:02:55
456000 -- (-1995.150) (-2001.293) [-1983.508] (-1983.756) * (-1992.592) [-1986.408] (-1985.998) (-1998.197) -- 0:02:55
Average standard deviation of split frequencies: 0.002598
456100 -- (-1993.486) (-2008.021) (-1983.927) [-1985.957] * (-2000.222) (-1985.651) [-1982.371] (-1992.919) -- 0:02:55
456200 -- (-1993.133) (-2010.321) (-1983.864) [-1985.944] * (-2002.833) (-1984.453) (-1982.279) [-1997.938] -- 0:02:55
456300 -- (-1993.215) (-2015.270) (-1989.616) [-1989.601] * (-2004.684) [-1990.409] (-1986.591) (-1993.238) -- 0:02:55
456400 -- (-1998.665) (-2003.245) [-1992.562] (-1990.848) * (-1996.105) (-1992.872) [-1984.586] (-1995.730) -- 0:02:55
456500 -- [-1995.346] (-1997.667) (-1996.920) (-1991.700) * (-1992.548) (-1992.580) [-1984.049] (-2001.339) -- 0:02:55
456600 -- [-1991.262] (-1989.754) (-1989.810) (-1991.278) * (-1997.697) (-1988.607) [-1978.960] (-1990.786) -- 0:02:54
456700 -- (-1992.141) (-1994.375) [-1985.485] (-1990.361) * (-1991.755) (-1994.471) [-1980.763] (-1988.348) -- 0:02:54
456800 -- (-1993.651) (-1990.475) [-1988.427] (-1993.570) * (-1984.432) [-1990.707] (-1985.261) (-1989.383) -- 0:02:54
456900 -- (-2004.119) (-1998.258) [-1990.725] (-2005.057) * (-1989.111) (-1989.484) [-1981.245] (-1993.338) -- 0:02:54
457000 -- (-1997.737) (-2004.996) [-1982.714] (-2002.899) * (-1995.449) (-1991.756) [-1980.679] (-1994.122) -- 0:02:54
Average standard deviation of split frequencies: 0.002327
457100 -- (-1991.365) (-1998.080) [-1981.164] (-2003.403) * (-1990.091) (-1984.070) (-1980.163) [-1991.335] -- 0:02:54
457200 -- (-2001.980) (-1998.818) [-1979.484] (-2008.697) * (-1992.713) (-1981.480) [-1982.633] (-1989.843) -- 0:02:54
457300 -- (-1993.827) (-1994.905) [-1984.529] (-2001.736) * (-1988.911) [-1983.059] (-1985.305) (-1992.156) -- 0:02:54
457400 -- (-1991.316) (-1991.446) [-1985.580] (-2010.174) * [-1985.912] (-1987.627) (-1990.961) (-1989.308) -- 0:02:54
457500 -- (-1993.387) (-1996.338) [-1980.963] (-1997.001) * (-1991.396) [-1984.657] (-1991.219) (-1988.506) -- 0:02:55
457600 -- (-1991.807) [-1989.175] (-1986.637) (-1994.649) * [-1990.994] (-1987.173) (-1988.086) (-1991.055) -- 0:02:55
457700 -- (-1995.824) (-1996.079) [-1981.980] (-1995.767) * (-1992.903) [-1986.666] (-1986.398) (-1985.073) -- 0:02:55
457800 -- (-1990.655) (-1998.859) [-1978.118] (-2001.784) * (-1993.578) [-1983.921] (-1982.015) (-1990.991) -- 0:02:55
457900 -- (-1996.309) (-1999.358) [-1977.297] (-1995.163) * (-1991.911) [-1977.760] (-1995.910) (-1990.735) -- 0:02:55
458000 -- (-1998.865) (-1992.668) [-1978.731] (-1997.344) * (-1991.383) [-1983.259] (-1999.866) (-1997.047) -- 0:02:55
Average standard deviation of split frequencies: 0.002381
458100 -- (-1992.929) [-1988.065] (-1982.981) (-1994.807) * (-1992.448) [-1981.564] (-1990.979) (-1990.495) -- 0:02:55
458200 -- (-1998.488) (-1990.443) [-1982.128] (-1992.987) * (-1991.268) [-1977.736] (-1984.994) (-1999.689) -- 0:02:55
458300 -- (-1994.896) (-1988.868) [-1981.112] (-1999.089) * (-1992.596) [-1985.255] (-1988.890) (-1994.710) -- 0:02:54
458400 -- (-2005.875) (-1987.098) [-1981.886] (-1992.221) * (-1990.912) [-1984.749] (-1991.819) (-1995.211) -- 0:02:54
458500 -- (-1996.777) (-1989.626) (-1984.162) [-1987.106] * (-1991.982) (-1990.182) (-1991.280) [-1985.668] -- 0:02:54
458600 -- (-1997.373) (-1991.551) [-1984.574] (-1986.349) * (-1991.603) (-1993.939) (-1991.946) [-1987.770] -- 0:02:54
458700 -- (-1995.975) (-1983.323) [-1985.704] (-1991.713) * [-1991.457] (-1984.308) (-1994.398) (-2001.212) -- 0:02:54
458800 -- (-1994.889) [-1985.398] (-1997.264) (-1987.609) * (-1992.336) (-1989.808) [-1992.753] (-1995.056) -- 0:02:54
458900 -- (-1993.314) (-1983.575) (-1986.832) [-1992.862] * [-1986.228] (-1996.332) (-1985.252) (-1991.088) -- 0:02:54
459000 -- (-1994.470) (-1991.842) [-1987.393] (-1996.981) * (-1991.065) (-1986.208) [-1984.618] (-1993.613) -- 0:02:54
Average standard deviation of split frequencies: 0.002229
459100 -- (-1999.377) (-1994.273) [-1991.563] (-1990.408) * (-1994.265) [-1990.699] (-1991.025) (-1990.625) -- 0:02:54
459200 -- (-2000.490) [-1987.843] (-1995.914) (-1985.293) * (-1998.458) (-1986.717) [-1982.456] (-1995.108) -- 0:02:54
459300 -- (-1989.575) (-1992.023) (-1997.288) [-1983.225] * (-2002.177) (-1993.803) [-1981.407] (-1992.781) -- 0:02:54
459400 -- (-1989.736) (-1997.095) (-2000.792) [-1984.960] * (-2002.246) [-1995.405] (-1987.348) (-1993.343) -- 0:02:54
459500 -- [-1984.774] (-1998.429) (-1999.587) (-1985.672) * (-1996.910) (-1995.011) (-1984.360) [-1992.984] -- 0:02:54
459600 -- (-1995.818) (-1997.655) [-1985.586] (-1991.737) * (-1993.704) [-1994.111] (-1988.094) (-1996.751) -- 0:02:54
459700 -- (-1991.428) (-2002.948) [-1989.225] (-1988.024) * (-1998.190) (-1993.907) [-1988.209] (-2000.847) -- 0:02:53
459800 -- (-1995.265) (-2001.686) [-1985.592] (-1995.887) * (-2003.510) (-2001.469) [-1984.103] (-1995.451) -- 0:02:53
459900 -- (-1997.710) (-2010.865) [-1983.126] (-1992.450) * (-2001.053) (-1996.313) [-1982.691] (-2006.747) -- 0:02:53
460000 -- (-1995.278) (-2000.124) [-1990.210] (-1991.564) * (-2002.382) (-1987.393) [-1982.779] (-2015.452) -- 0:02:53
Average standard deviation of split frequencies: 0.002342
460100 -- (-1991.901) (-1998.782) (-1997.900) [-1991.911] * (-1999.389) (-1987.337) [-1981.899] (-2018.314) -- 0:02:53
460200 -- (-1990.936) (-1999.886) (-1989.809) [-1987.569] * (-1995.793) [-1994.015] (-1991.047) (-2004.094) -- 0:02:53
460300 -- (-1997.872) (-1997.653) (-1993.075) [-1983.679] * (-1993.868) (-1986.314) [-1987.442] (-1995.131) -- 0:02:53
460400 -- (-2001.565) (-1997.189) (-1984.943) [-1983.816] * (-1989.368) (-1986.415) [-1990.382] (-1994.073) -- 0:02:53
460500 -- (-1996.834) (-2002.787) (-1979.489) [-1983.069] * (-2006.492) (-1986.167) [-1988.667] (-2003.422) -- 0:02:53
460600 -- (-1996.855) (-2000.765) (-1983.834) [-1982.709] * (-1999.429) [-1983.332] (-1999.617) (-2003.661) -- 0:02:54
460700 -- (-1989.974) (-1998.499) (-1979.690) [-1983.382] * (-1990.404) [-1985.755] (-1992.149) (-1995.517) -- 0:02:54
460800 -- [-1987.362] (-1994.958) (-1983.169) (-1988.788) * (-2001.973) (-1985.263) [-1983.613] (-1996.143) -- 0:02:54
460900 -- [-1985.758] (-1998.141) (-1982.364) (-1994.499) * (-2007.197) [-1990.261] (-1984.089) (-1994.884) -- 0:02:54
461000 -- [-1985.159] (-1993.831) (-1988.349) (-1991.580) * (-2005.439) [-1989.543] (-1986.854) (-1985.947) -- 0:02:54
Average standard deviation of split frequencies: 0.002482
461100 -- (-1990.871) (-1996.670) [-1983.805] (-1996.690) * (-1991.536) (-1985.831) (-1991.223) [-1992.089] -- 0:02:54
461200 -- [-1989.567] (-1991.660) (-1984.909) (-1997.802) * (-1997.050) [-1983.477] (-1987.686) (-2004.000) -- 0:02:54
461300 -- (-1991.775) (-2009.602) (-1986.262) [-1993.708] * (-2003.083) (-1986.253) [-1988.359] (-1996.741) -- 0:02:54
461400 -- (-1992.293) (-1999.714) [-1984.180] (-1987.034) * (-1995.615) [-1982.677] (-1984.868) (-1992.134) -- 0:02:53
461500 -- (-1992.469) (-1995.913) [-1985.852] (-1984.630) * [-1990.353] (-1983.383) (-1986.591) (-1991.928) -- 0:02:53
461600 -- (-1996.842) (-1988.889) (-1994.042) [-1981.502] * (-1995.426) [-1986.175] (-1991.670) (-1998.503) -- 0:02:53
461700 -- (-1992.186) (-1986.771) (-1995.068) [-1980.537] * (-1995.871) (-1988.867) (-1997.930) [-1987.555] -- 0:02:53
461800 -- (-1987.505) (-1986.915) (-1988.950) [-1980.347] * (-1998.655) (-1982.121) (-2000.797) [-1990.196] -- 0:02:53
461900 -- (-1984.267) (-1986.283) (-1993.952) [-1985.002] * (-2005.592) [-1981.772] (-1991.874) (-1994.611) -- 0:02:53
462000 -- (-1991.313) (-1982.410) [-1990.815] (-1984.764) * (-2000.812) [-1984.221] (-1989.628) (-2000.113) -- 0:02:53
Average standard deviation of split frequencies: 0.002623
462100 -- (-1990.694) [-1982.640] (-1988.256) (-1986.169) * (-2006.700) [-1988.499] (-1988.959) (-1999.555) -- 0:02:53
462200 -- (-1986.776) [-1984.436] (-1987.595) (-1984.801) * (-2009.221) [-1978.610] (-1997.315) (-2003.463) -- 0:02:53
462300 -- [-1990.795] (-1993.751) (-1989.918) (-1988.816) * (-2006.826) [-1982.473] (-1995.446) (-2002.692) -- 0:02:53
462400 -- (-1989.549) (-1998.326) [-1987.719] (-1984.533) * (-2014.370) [-1986.777] (-1991.751) (-1997.694) -- 0:02:53
462500 -- [-1991.457] (-1999.013) (-1987.994) (-1995.684) * (-2005.814) [-1984.277] (-1994.293) (-1992.447) -- 0:02:53
462600 -- [-1994.433] (-1993.159) (-1986.558) (-1991.877) * (-1995.301) (-1985.782) (-1993.051) [-1993.492] -- 0:02:53
462700 -- (-1997.209) (-1992.593) [-1986.892] (-2002.699) * (-1992.301) [-1984.264] (-1990.890) (-1994.478) -- 0:02:53
462800 -- (-2003.129) (-1998.880) [-1986.841] (-2001.388) * (-1991.580) (-1990.416) [-1993.867] (-1997.063) -- 0:02:52
462900 -- (-1998.417) (-1996.282) [-1979.964] (-2000.419) * (-1991.212) [-1985.835] (-1998.461) (-1993.744) -- 0:02:52
463000 -- (-2005.466) (-1998.904) [-1981.897] (-2001.334) * [-1994.004] (-1982.189) (-1996.110) (-1997.153) -- 0:02:52
Average standard deviation of split frequencies: 0.002413
463100 -- (-2012.524) (-1999.143) [-1978.954] (-2006.982) * (-1991.843) [-1979.991] (-1986.039) (-1991.153) -- 0:02:52
463200 -- (-2005.424) (-2003.228) [-1986.569] (-1993.339) * [-1994.585] (-1982.193) (-1989.357) (-1998.508) -- 0:02:52
463300 -- (-2003.130) (-1994.248) [-1985.988] (-1992.969) * (-1988.234) [-1983.298] (-1990.367) (-2000.144) -- 0:02:52
463400 -- (-1996.796) (-1997.439) [-1983.193] (-1995.070) * (-1989.502) [-1979.080] (-1995.702) (-1994.300) -- 0:02:52
463500 -- (-1995.268) (-1995.203) [-1981.724] (-1995.029) * [-1988.767] (-1982.883) (-1995.324) (-1992.897) -- 0:02:52
463600 -- (-1988.883) (-1991.588) [-1985.921] (-1987.986) * [-1990.830] (-1988.377) (-1993.970) (-2001.072) -- 0:02:52
463700 -- (-1990.935) (-1990.073) [-1986.223] (-1987.382) * (-1992.172) [-1979.891] (-1985.671) (-2002.342) -- 0:02:53
463800 -- (-1994.919) (-1986.182) (-1987.539) [-1986.211] * (-1990.045) [-1980.842] (-1992.571) (-1996.880) -- 0:02:53
463900 -- (-2002.473) (-1987.078) (-1987.605) [-1986.660] * [-1989.496] (-1981.077) (-1994.205) (-1991.136) -- 0:02:53
464000 -- (-1993.882) (-1987.760) [-1986.473] (-1986.293) * (-1985.102) [-1980.282] (-1994.712) (-1990.555) -- 0:02:53
Average standard deviation of split frequencies: 0.002467
464100 -- (-1999.186) (-1990.745) (-1987.206) [-1986.225] * (-1989.027) [-1978.624] (-1993.525) (-1990.749) -- 0:02:53
464200 -- (-1994.372) (-1986.472) (-1982.317) [-1986.686] * (-1989.439) [-1978.253] (-1991.097) (-1991.149) -- 0:02:53
464300 -- (-1994.273) [-1985.388] (-1990.576) (-1983.535) * (-1995.107) [-1985.712] (-1988.776) (-1995.575) -- 0:02:53
464400 -- (-2002.182) (-1993.153) (-1989.994) [-1984.120] * (-1998.361) [-1981.373] (-1993.372) (-1995.555) -- 0:02:52
464500 -- (-2004.529) (-1989.569) [-1984.386] (-1991.196) * (-1992.570) [-1978.861] (-1995.796) (-2000.629) -- 0:02:52
464600 -- (-2001.858) (-1998.038) [-1988.313] (-1992.669) * [-1998.152] (-1989.936) (-1993.870) (-2006.972) -- 0:02:52
464700 -- (-1998.569) (-1994.462) (-1987.961) [-1989.550] * (-1991.343) [-1990.736] (-1994.711) (-1999.446) -- 0:02:52
464800 -- (-1997.031) (-1988.026) (-1991.989) [-1986.121] * (-2000.577) (-1987.576) (-2001.794) [-1993.301] -- 0:02:52
464900 -- (-2000.311) [-1988.526] (-1995.479) (-1991.428) * (-1993.595) (-1989.746) (-1994.341) [-1987.114] -- 0:02:52
465000 -- (-2006.484) [-1985.463] (-2001.584) (-1983.051) * (-1990.698) (-1991.402) (-1986.169) [-1987.345] -- 0:02:52
Average standard deviation of split frequencies: 0.002635
465100 -- (-1996.490) [-1984.249] (-1999.210) (-1982.255) * (-2000.181) [-1986.251] (-1985.650) (-1992.461) -- 0:02:52
465200 -- (-1994.008) (-1984.397) (-1997.534) [-1979.088] * [-1998.404] (-1992.401) (-1986.743) (-1987.719) -- 0:02:52
465300 -- (-1991.970) (-1981.966) (-1986.853) [-1984.906] * (-1989.890) (-1987.151) [-1990.073] (-1987.236) -- 0:02:52
465400 -- (-1985.928) (-1992.018) [-1984.109] (-1986.601) * (-1986.380) [-1985.953] (-1995.878) (-1993.010) -- 0:02:52
465500 -- [-1980.386] (-1991.709) (-1988.456) (-1993.005) * [-1987.631] (-1983.838) (-1991.286) (-1992.703) -- 0:02:52
465600 -- [-1984.058] (-1986.884) (-1988.114) (-1995.579) * (-1999.417) [-1983.484] (-1983.367) (-1994.054) -- 0:02:52
465700 -- (-1991.632) [-1989.226] (-1990.049) (-1994.721) * [-1992.399] (-1988.577) (-1984.566) (-1996.943) -- 0:02:52
465800 -- (-1991.918) (-1990.261) [-1987.650] (-1986.575) * (-1994.750) (-1982.562) [-1986.204] (-1999.799) -- 0:02:52
465900 -- (-1994.722) [-1997.112] (-1997.749) (-1992.027) * (-1995.262) (-1984.770) [-1985.945] (-1996.507) -- 0:02:51
466000 -- [-1989.279] (-1998.408) (-1983.691) (-1992.557) * (-2003.486) (-1987.327) [-1989.146] (-1994.221) -- 0:02:51
Average standard deviation of split frequencies: 0.002832
466100 -- (-1997.042) (-1993.303) [-1985.196] (-1995.674) * (-1998.459) (-1996.328) [-1986.279] (-1989.661) -- 0:02:51
466200 -- (-1993.471) (-1990.089) [-1990.439] (-1995.112) * [-1989.480] (-1987.454) (-1984.532) (-1988.731) -- 0:02:51
466300 -- (-1987.810) (-1988.382) (-1987.799) [-1985.205] * (-2001.899) (-1986.725) [-1984.499] (-1992.525) -- 0:02:51
466400 -- (-1993.931) (-1988.324) [-1980.988] (-1982.819) * (-1997.489) [-1986.991] (-1990.387) (-1989.576) -- 0:02:51
466500 -- (-1997.039) (-1992.286) [-1978.533] (-1986.441) * (-1991.210) [-1991.101] (-1986.777) (-1989.485) -- 0:02:51
466600 -- (-2002.394) (-2001.182) [-1979.983] (-1983.828) * (-1994.398) [-1986.126] (-1990.152) (-2000.926) -- 0:02:51
466700 -- (-1992.485) (-1996.354) [-1981.010] (-1989.726) * (-1995.030) [-1986.895] (-1988.329) (-1996.606) -- 0:02:52
466800 -- (-1991.666) (-2002.735) [-1977.358] (-1989.427) * (-2000.391) [-1987.243] (-1985.566) (-1996.228) -- 0:02:52
466900 -- (-1990.999) (-2003.736) [-1977.375] (-1990.835) * (-1998.493) (-1997.294) [-1985.443] (-2008.359) -- 0:02:52
467000 -- (-1992.038) (-1996.495) [-1979.953] (-1993.200) * (-1999.047) (-1990.982) [-1987.380] (-2008.282) -- 0:02:52
Average standard deviation of split frequencies: 0.002969
467100 -- (-1995.132) (-1992.974) [-1983.645] (-1992.526) * (-2007.995) [-1993.190] (-1989.698) (-2002.268) -- 0:02:52
467200 -- (-1996.598) (-1988.368) [-1985.482] (-1993.855) * (-2004.844) [-1991.775] (-1999.647) (-2002.752) -- 0:02:52
467300 -- (-1993.578) (-1991.295) [-1983.979] (-1995.290) * [-2000.021] (-1987.385) (-1996.871) (-1997.724) -- 0:02:52
467400 -- [-1994.871] (-1992.258) (-1984.416) (-1996.334) * (-1993.578) [-1982.106] (-1999.821) (-2006.101) -- 0:02:52
467500 -- (-2000.934) [-1990.491] (-1986.383) (-1997.438) * [-1986.802] (-1981.048) (-2006.137) (-2013.676) -- 0:02:51
467600 -- (-1997.670) (-1990.769) [-1989.489] (-1987.100) * (-1996.443) [-1977.825] (-2007.396) (-2009.611) -- 0:02:51
467700 -- (-1992.767) (-1999.821) (-1989.520) [-1991.541] * (-1990.351) [-1981.482] (-1998.779) (-2001.576) -- 0:02:51
467800 -- (-1992.654) (-1997.286) [-1986.291] (-1994.276) * [-1991.044] (-1982.925) (-1997.766) (-2007.608) -- 0:02:51
467900 -- (-1994.502) (-1995.473) [-1986.551] (-2002.025) * [-1988.803] (-1982.555) (-1990.762) (-2024.637) -- 0:02:51
468000 -- (-1994.913) (-1988.673) [-1990.281] (-2000.560) * (-1996.672) [-1988.031] (-1992.942) (-2021.877) -- 0:02:51
Average standard deviation of split frequencies: 0.002848
468100 -- (-1992.634) [-1986.224] (-1987.937) (-1993.819) * (-1997.454) (-1988.506) [-1987.257] (-2015.352) -- 0:02:51
468200 -- (-1994.986) [-1984.891] (-1991.607) (-1994.260) * (-1994.241) (-1998.738) [-1990.237] (-2018.415) -- 0:02:51
468300 -- (-1992.149) [-1992.105] (-1991.444) (-1991.867) * [-1988.141] (-1994.859) (-1991.682) (-2011.252) -- 0:02:51
468400 -- (-1993.835) (-1994.783) [-1991.880] (-2001.503) * [-1990.282] (-1995.292) (-1989.741) (-2015.346) -- 0:02:51
468500 -- (-1996.910) [-1999.312] (-2000.433) (-1996.305) * [-1991.323] (-1999.111) (-1992.297) (-1997.360) -- 0:02:51
468600 -- (-1994.341) (-2001.123) (-1999.997) [-1990.691] * (-1989.786) (-2000.060) [-1990.326] (-1995.347) -- 0:02:51
468700 -- (-1991.412) (-1996.493) (-2001.909) [-1988.670] * (-1997.252) (-2008.987) (-1990.162) [-1990.588] -- 0:02:51
468800 -- (-1998.554) (-1992.034) (-2010.620) [-1989.521] * (-1992.765) (-2001.681) [-1983.508] (-1994.068) -- 0:02:51
468900 -- (-1996.954) (-1999.986) (-2004.771) [-1987.994] * (-1989.011) (-1998.851) [-1984.954] (-1999.399) -- 0:02:51
469000 -- (-1996.008) (-1992.382) (-2008.770) [-1983.643] * (-1989.293) (-1999.327) [-1985.829] (-1996.434) -- 0:02:50
Average standard deviation of split frequencies: 0.003014
469100 -- (-1997.040) (-1991.719) (-1998.467) [-1985.488] * (-2003.022) (-2000.334) [-1986.548] (-1992.293) -- 0:02:50
469200 -- (-2000.741) (-1990.916) (-2004.904) [-1981.297] * (-1996.368) (-1994.458) [-1989.059] (-1997.746) -- 0:02:50
469300 -- (-1992.721) (-1992.886) (-1990.261) [-1980.942] * (-1995.984) [-1993.078] (-1987.895) (-1991.967) -- 0:02:50
469400 -- (-1988.811) (-1995.100) (-1995.424) [-1984.754] * (-1998.821) (-1994.997) (-1988.991) [-1986.919] -- 0:02:50
469500 -- (-1985.451) (-1997.918) (-1995.954) [-1984.581] * (-2001.968) (-1997.073) [-1992.931] (-1984.942) -- 0:02:50
469600 -- (-1984.646) (-2001.231) (-1999.005) [-1986.659] * [-1986.555] (-1997.005) (-1989.720) (-1987.676) -- 0:02:50
469700 -- (-1985.794) (-1996.500) (-1990.632) [-1987.529] * (-1989.306) (-1990.928) [-1991.168] (-1993.862) -- 0:02:50
469800 -- (-1987.806) (-1990.700) [-1991.183] (-1988.627) * [-1988.340] (-1987.143) (-2001.457) (-1996.472) -- 0:02:51
469900 -- (-1985.637) (-1995.405) [-1988.390] (-1982.779) * (-1987.143) [-1985.242] (-1996.098) (-1992.371) -- 0:02:51
470000 -- (-1987.462) (-1988.319) (-1994.833) [-1986.857] * (-1991.978) [-1984.743] (-1994.244) (-1990.960) -- 0:02:51
Average standard deviation of split frequencies: 0.002779
470100 -- (-1982.192) (-1991.222) [-1978.387] (-1982.418) * (-1996.640) (-1991.279) (-1993.205) [-1990.165] -- 0:02:51
470200 -- (-1984.562) (-1997.495) (-1981.687) [-1979.284] * (-1996.686) [-1991.380] (-1998.299) (-1984.135) -- 0:02:51
470300 -- (-1987.769) (-1990.861) [-1982.498] (-1977.918) * (-1993.694) (-1991.365) (-1995.261) [-1986.127] -- 0:02:51
470400 -- [-1994.952] (-1988.693) (-1982.599) (-1977.049) * (-1996.182) (-1986.173) (-2006.690) [-1986.057] -- 0:02:51
470500 -- (-1996.538) (-1986.024) (-1981.894) [-1983.780] * (-1991.390) (-1987.397) [-1992.148] (-2002.406) -- 0:02:51
470600 -- (-1994.635) (-1984.534) [-1983.908] (-1987.546) * [-1989.382] (-1990.164) (-1998.232) (-2002.499) -- 0:02:50
470700 -- (-1993.596) (-1984.828) [-1982.304] (-1986.966) * [-1989.322] (-1982.001) (-1994.984) (-2000.752) -- 0:02:50
470800 -- (-1994.641) (-1987.866) [-1982.748] (-1988.096) * (-1993.357) [-1982.540] (-2002.517) (-2003.511) -- 0:02:50
470900 -- (-2002.715) [-1987.975] (-1985.527) (-1985.305) * (-1992.848) [-1981.678] (-2001.321) (-1993.906) -- 0:02:50
471000 -- (-1999.251) (-1988.753) (-1990.999) [-1985.706] * (-1998.026) [-1980.285] (-1989.638) (-2002.700) -- 0:02:50
Average standard deviation of split frequencies: 0.002630
471100 -- (-1992.237) (-1993.533) [-1985.155] (-1982.295) * (-1992.282) [-1988.464] (-1993.585) (-1996.782) -- 0:02:50
471200 -- (-1992.451) (-1990.551) (-1983.524) [-1983.808] * (-1990.662) [-1991.271] (-1989.822) (-1997.471) -- 0:02:50
471300 -- (-1989.866) (-1993.017) [-1982.849] (-1984.418) * (-1992.595) [-1987.459] (-1993.013) (-1992.601) -- 0:02:50
471400 -- (-1991.009) (-2005.405) (-1991.564) [-1984.783] * (-2004.340) [-1985.021] (-1990.267) (-1992.912) -- 0:02:50
471500 -- (-1988.780) (-1994.364) (-1988.932) [-1983.229] * (-1998.130) [-1984.541] (-1993.695) (-1999.778) -- 0:02:50
471600 -- (-1987.661) (-1992.370) (-1989.174) [-1984.310] * (-2003.726) (-1988.409) [-1987.212] (-1998.743) -- 0:02:50
471700 -- [-1987.566] (-1990.490) (-1994.375) (-1982.492) * (-1994.788) (-1990.037) [-1987.800] (-1996.274) -- 0:02:50
471800 -- (-1983.979) (-1988.931) (-1990.992) [-1985.379] * (-1999.857) (-1990.083) (-1989.580) [-1994.831] -- 0:02:50
471900 -- (-1985.457) (-1992.138) (-1982.943) [-1977.918] * (-1993.264) [-1982.951] (-1999.711) (-1993.338) -- 0:02:50
472000 -- (-1986.692) (-1993.282) [-1978.148] (-1984.904) * (-1999.777) [-1981.249] (-1999.050) (-1993.503) -- 0:02:50
Average standard deviation of split frequencies: 0.002625
472100 -- (-1987.234) (-1996.322) [-1977.931] (-1986.170) * (-2000.412) [-1985.016] (-1998.645) (-1989.995) -- 0:02:49
472200 -- (-1992.700) (-2004.312) (-1977.929) [-1981.582] * (-1992.533) [-1982.292] (-1993.648) (-1989.727) -- 0:02:49
472300 -- (-1985.937) (-2000.309) (-1978.894) [-1979.263] * (-1992.953) [-1986.478] (-1986.845) (-1988.246) -- 0:02:49
472400 -- (-1994.175) (-1997.686) [-1977.792] (-1983.678) * (-1995.015) (-1985.559) (-1991.136) [-1987.684] -- 0:02:49
472500 -- (-1989.821) (-1998.294) (-1983.916) [-1979.691] * (-1999.395) (-1989.677) [-1982.632] (-1988.795) -- 0:02:49
472600 -- (-1990.564) (-1993.237) [-1985.706] (-1988.008) * (-1997.453) (-1989.431) [-1984.114] (-1992.145) -- 0:02:49
472700 -- [-1991.741] (-1999.225) (-1983.815) (-1985.822) * (-1998.896) (-1985.119) [-1983.678] (-1994.400) -- 0:02:49
472800 -- (-1992.451) (-1990.073) [-1981.761] (-1982.256) * (-1995.327) [-1978.982] (-1986.092) (-1994.056) -- 0:02:50
472900 -- (-1999.512) (-1993.995) (-1982.739) [-1980.779] * (-1999.101) [-1981.874] (-1988.658) (-1998.674) -- 0:02:50
473000 -- (-1994.328) (-1992.651) (-1981.277) [-1984.023] * (-1993.212) [-1984.152] (-1988.008) (-1999.512) -- 0:02:50
Average standard deviation of split frequencies: 0.002732
473100 -- (-1992.427) (-1993.938) [-1985.220] (-1990.099) * (-1991.116) [-1981.924] (-1991.737) (-1993.184) -- 0:02:50
473200 -- (-1993.413) [-1990.492] (-1991.276) (-1991.502) * (-1994.313) [-1982.402] (-1991.014) (-1995.231) -- 0:02:50
473300 -- (-1991.649) (-1990.379) (-1986.777) [-1991.625] * (-1995.585) [-1982.558] (-1995.771) (-2001.123) -- 0:02:50
473400 -- (-1988.836) (-1988.821) [-1987.894] (-1994.611) * (-1995.347) [-1982.365] (-1993.498) (-1995.064) -- 0:02:50
473500 -- (-1993.733) (-1991.546) [-1982.634] (-1999.641) * (-1992.807) [-1990.294] (-1995.948) (-1993.771) -- 0:02:50
473600 -- (-1995.566) (-1989.023) [-1982.480] (-2000.988) * [-1986.927] (-1989.303) (-1990.368) (-1996.381) -- 0:02:50
473700 -- (-1986.854) (-1989.386) [-1983.178] (-1998.984) * [-1985.475] (-1986.381) (-1990.250) (-1996.282) -- 0:02:49
473800 -- [-1984.045] (-1987.979) (-1986.824) (-1995.708) * (-1984.365) [-1982.449] (-2001.774) (-1993.514) -- 0:02:49
473900 -- (-1991.482) [-1989.618] (-1999.652) (-1995.754) * (-1985.592) [-1985.529] (-2003.994) (-1987.388) -- 0:02:49
474000 -- (-1988.829) [-1990.338] (-1996.127) (-1985.735) * (-1990.549) (-1988.924) (-1996.460) [-1989.914] -- 0:02:49
Average standard deviation of split frequencies: 0.002727
474100 -- (-1996.764) [-1984.963] (-1991.672) (-1987.098) * (-1991.903) (-1989.956) (-1992.641) [-1990.723] -- 0:02:49
474200 -- (-1993.879) (-1986.256) (-1992.376) [-1987.554] * (-1997.302) [-1993.351] (-1998.836) (-1987.210) -- 0:02:49
474300 -- (-1996.712) (-1990.116) [-1986.122] (-1996.087) * (-1993.542) (-1993.386) (-2005.032) [-1989.822] -- 0:02:49
474400 -- (-1994.846) (-1990.994) [-1980.919] (-1998.638) * (-1993.663) (-1987.740) [-2007.317] (-1993.077) -- 0:02:49
474500 -- (-1992.168) (-1993.086) [-1980.625] (-1995.612) * (-2001.815) [-1984.103] (-2005.626) (-1988.558) -- 0:02:49
474600 -- [-1990.476] (-1986.994) (-1977.031) (-1989.643) * (-2004.704) (-1987.926) (-2000.731) [-1986.724] -- 0:02:49
474700 -- (-1984.715) (-1987.725) [-1982.598] (-1997.288) * (-1998.076) (-1997.997) [-2001.232] (-1984.507) -- 0:02:49
474800 -- (-1988.611) [-1985.525] (-1982.716) (-2001.251) * [-1988.086] (-1999.916) (-1997.741) (-1986.438) -- 0:02:49
474900 -- (-1991.856) (-1992.247) [-1986.624] (-1997.246) * (-1996.370) [-1984.550] (-2005.609) (-1988.993) -- 0:02:49
475000 -- (-1993.282) (-1994.011) (-1990.262) [-1986.640] * (-1999.241) (-1985.068) (-2004.749) [-1991.726] -- 0:02:49
Average standard deviation of split frequencies: 0.002664
475100 -- (-2002.074) (-1984.037) (-1990.348) [-1996.954] * (-1992.673) [-1990.242] (-1995.677) (-1993.209) -- 0:02:49
475200 -- (-2003.066) [-1985.823] (-1990.468) (-1996.142) * (-1993.925) (-1991.898) (-1997.708) [-1990.336] -- 0:02:48
475300 -- (-1996.486) (-1988.881) [-1980.664] (-1993.991) * (-1993.005) (-1990.578) (-1992.287) [-1989.495] -- 0:02:48
475400 -- (-1996.194) (-1991.526) [-1983.723] (-1993.520) * (-1998.638) (-1983.716) [-1989.991] (-1991.978) -- 0:02:48
475500 -- (-1994.231) [-1991.099] (-1982.230) (-1988.325) * (-2000.759) (-1983.172) [-1992.112] (-1992.722) -- 0:02:48
475600 -- (-1992.558) (-1997.364) [-1985.587] (-1986.993) * (-1992.017) [-1981.391] (-1987.555) (-1992.063) -- 0:02:48
475700 -- (-1995.342) [-1987.877] (-1994.623) (-1987.417) * (-1994.032) [-1978.469] (-1992.021) (-1996.785) -- 0:02:48
475800 -- (-1993.184) [-1988.348] (-1994.708) (-1986.737) * (-2000.698) [-1986.755] (-1986.204) (-2000.344) -- 0:02:48
475900 -- (-1991.860) [-1985.162] (-1990.225) (-1984.034) * (-2004.811) [-1985.102] (-1986.699) (-1994.728) -- 0:02:49
476000 -- (-1995.211) (-1981.976) [-1990.272] (-1986.731) * (-1997.759) [-1983.980] (-1990.573) (-2000.730) -- 0:02:49
Average standard deviation of split frequencies: 0.002772
476100 -- (-1999.551) (-1986.141) [-1986.444] (-1984.886) * (-1999.697) [-1984.130] (-1991.534) (-2005.762) -- 0:02:49
476200 -- (-1998.459) (-1992.957) [-1980.445] (-1978.198) * (-1993.953) [-1980.148] (-1992.794) (-2004.674) -- 0:02:49
476300 -- (-1999.221) [-1991.690] (-1976.346) (-1979.218) * (-1997.598) [-1987.403] (-1988.242) (-1997.826) -- 0:02:49
476400 -- (-1996.542) (-1992.971) (-1979.103) [-1978.280] * (-2000.048) [-1987.696] (-1988.073) (-1999.253) -- 0:02:49
476500 -- (-1998.568) (-1991.149) (-1985.733) [-1979.826] * (-1998.713) [-1982.486] (-1989.527) (-1992.110) -- 0:02:49
476600 -- (-2002.616) (-1987.845) (-1984.649) [-1984.551] * (-1990.863) [-1979.536] (-1999.184) (-1996.230) -- 0:02:49
476700 -- (-2003.480) [-1980.286] (-1991.036) (-1984.766) * (-1985.144) [-1978.185] (-1989.215) (-2000.358) -- 0:02:49
476800 -- (-1997.994) [-1981.848] (-1992.075) (-1986.692) * (-1988.503) (-1978.746) [-1989.673] (-1997.329) -- 0:02:48
476900 -- (-2004.440) (-1985.502) (-1991.159) [-1987.447] * (-1992.701) [-1975.527] (-1994.896) (-1997.596) -- 0:02:48
477000 -- (-2008.591) (-1986.044) [-1979.897] (-1995.685) * (-1989.959) [-1980.322] (-2003.015) (-2002.660) -- 0:02:48
Average standard deviation of split frequencies: 0.002710
477100 -- (-2005.210) [-1979.065] (-1988.855) (-1984.592) * [-1988.436] (-1981.864) (-1995.576) (-1989.973) -- 0:02:48
477200 -- (-1996.143) (-1980.001) [-1979.999] (-1981.845) * (-1989.204) [-1981.692] (-1999.349) (-1990.202) -- 0:02:48
477300 -- (-2005.324) (-1979.380) (-1982.900) [-1983.094] * (-1991.292) [-1981.397] (-2006.018) (-1997.841) -- 0:02:48
477400 -- (-2001.436) [-1981.462] (-1985.210) (-1987.197) * (-1989.912) [-1979.169] (-1997.880) (-1995.100) -- 0:02:48
477500 -- (-2007.180) [-1980.610] (-1983.479) (-1981.252) * (-1991.146) [-1983.868] (-1999.147) (-1992.656) -- 0:02:48
477600 -- (-1999.100) [-1984.952] (-1988.531) (-1985.666) * [-1989.585] (-1981.382) (-1991.456) (-1991.127) -- 0:02:48
477700 -- (-1988.059) (-1984.903) (-1987.926) [-1986.801] * [-1987.853] (-1986.683) (-1992.876) (-1988.797) -- 0:02:48
477800 -- (-1990.400) (-1985.358) (-1993.634) [-1988.825] * (-1989.980) (-1987.592) [-1988.490] (-1993.079) -- 0:02:48
477900 -- (-1994.068) [-1981.638] (-1982.574) (-1985.620) * (-1993.440) (-1990.887) [-1991.029] (-1990.132) -- 0:02:48
478000 -- (-1995.268) (-1984.507) [-1982.295] (-1987.673) * [-1989.309] (-1992.119) (-1997.557) (-1983.716) -- 0:02:48
Average standard deviation of split frequencies: 0.002732
478100 -- (-1990.670) (-1986.767) (-1985.817) [-1984.616] * (-1994.309) (-1997.074) (-1997.724) [-1988.545] -- 0:02:48
478200 -- (-1986.577) (-1990.078) [-1982.682] (-1990.297) * [-1987.012] (-1997.160) (-1997.800) (-1993.419) -- 0:02:48
478300 -- (-1988.123) [-1986.805] (-1993.216) (-1991.588) * (-1988.573) [-1993.562] (-1991.978) (-1993.754) -- 0:02:47
478400 -- [-1985.314] (-1989.619) (-1989.298) (-1993.888) * [-1987.484] (-1989.295) (-1998.660) (-1990.917) -- 0:02:47
478500 -- (-1986.480) [-1987.639] (-1991.583) (-1994.580) * (-1994.132) (-1987.772) (-2007.583) [-1984.800] -- 0:02:47
478600 -- (-1992.860) [-1987.320] (-1990.706) (-1984.059) * (-2007.494) (-1982.344) (-2003.607) [-1989.561] -- 0:02:47
478700 -- (-1986.898) (-1997.321) (-1987.796) [-1983.594] * (-1994.685) [-1984.883] (-2000.666) (-1990.461) -- 0:02:47
478800 -- (-1993.129) (-1996.016) [-1988.060] (-1985.415) * (-1990.166) [-1990.372] (-1998.743) (-1997.232) -- 0:02:47
478900 -- (-2000.803) (-1983.102) [-1981.065] (-1985.137) * (-1989.988) [-1985.878] (-1996.950) (-1991.011) -- 0:02:47
479000 -- (-1992.709) [-1978.026] (-1989.410) (-1988.274) * (-1989.237) [-1985.494] (-1991.013) (-1994.751) -- 0:02:48
Average standard deviation of split frequencies: 0.002698
479100 -- (-1997.312) (-1980.394) [-1984.616] (-1998.489) * (-1995.186) [-1981.691] (-1990.570) (-1992.909) -- 0:02:48
479200 -- (-2000.707) [-1980.366] (-1989.165) (-2000.654) * (-2009.648) [-1985.558] (-1996.620) (-1990.301) -- 0:02:48
479300 -- (-1993.822) [-1981.983] (-1996.046) (-1993.718) * (-2004.159) (-1984.615) (-2005.738) [-1987.440] -- 0:02:48
479400 -- (-1994.512) [-1984.980] (-1987.600) (-1993.201) * (-2003.103) [-1981.541] (-1993.549) (-1988.079) -- 0:02:48
479500 -- (-1993.171) (-1983.988) (-1990.229) [-1988.501] * (-2006.784) (-1980.740) (-1988.898) [-1986.637] -- 0:02:48
479600 -- (-1990.271) (-1987.084) [-1984.041] (-1983.068) * (-2005.227) [-1988.063] (-1987.294) (-1990.655) -- 0:02:48
479700 -- (-1989.453) (-1989.768) [-1981.894] (-1987.379) * (-2005.458) (-1990.197) [-1986.028] (-1996.146) -- 0:02:48
479800 -- (-1994.347) [-1984.804] (-1982.982) (-1986.205) * (-1999.111) (-1987.386) [-1983.797] (-1996.246) -- 0:02:48
479900 -- (-1998.245) (-1986.503) [-1979.059] (-1980.500) * (-2000.596) (-1987.885) [-1982.034] (-1996.363) -- 0:02:47
480000 -- (-2004.713) (-1984.026) (-1985.124) [-1982.607] * (-2000.128) (-1982.394) [-1986.946] (-1992.555) -- 0:02:47
Average standard deviation of split frequencies: 0.002609
480100 -- (-1997.974) [-1981.931] (-1989.880) (-1990.718) * (-1997.660) (-1981.135) [-1988.628] (-1993.800) -- 0:02:47
480200 -- (-1992.139) (-1979.961) (-1989.992) [-1981.522] * (-1992.698) [-1982.052] (-1993.067) (-1992.455) -- 0:02:47
480300 -- (-1992.636) (-1992.182) (-1991.968) [-1986.916] * (-1987.525) [-1979.071] (-1993.891) (-1991.792) -- 0:02:47
480400 -- (-1995.902) (-1989.852) (-1994.442) [-1990.765] * (-1998.072) [-1980.367] (-1989.558) (-1988.548) -- 0:02:47
480500 -- (-1989.198) [-1989.858] (-1992.526) (-1994.085) * (-2003.772) [-1977.618] (-1991.006) (-1985.257) -- 0:02:47
480600 -- (-1992.779) [-1983.511] (-1993.629) (-1988.334) * (-2000.333) (-1979.419) (-1993.767) [-1988.482] -- 0:02:47
480700 -- (-1998.377) (-1985.395) (-1991.087) [-1983.644] * (-1992.149) [-1982.357] (-1992.162) (-1990.702) -- 0:02:47
480800 -- (-1998.509) (-1986.827) (-1998.278) [-1986.207] * (-1998.389) [-1989.694] (-1996.516) (-1986.614) -- 0:02:47
480900 -- (-1994.946) [-1987.002] (-1999.518) (-1986.357) * [-1989.483] (-1990.718) (-1994.943) (-1987.829) -- 0:02:47
481000 -- (-1992.108) (-1992.536) (-1994.413) [-1988.131] * (-1987.279) [-1982.610] (-1996.171) (-1999.357) -- 0:02:47
Average standard deviation of split frequencies: 0.002603
481100 -- (-1991.131) [-1989.181] (-1989.410) (-1990.850) * (-1994.868) [-1983.442] (-2002.133) (-1992.174) -- 0:02:47
481200 -- (-2000.200) (-1991.936) (-1990.616) [-1990.856] * (-1997.326) [-1979.265] (-1992.688) (-1985.091) -- 0:02:47
481300 -- (-2005.984) (-1988.050) (-1989.603) [-1983.357] * (-2002.910) [-1979.452] (-2000.736) (-1984.097) -- 0:02:47
481400 -- (-2000.511) (-1987.803) (-1994.167) [-1983.521] * (-1995.290) [-1982.412] (-1993.980) (-1987.091) -- 0:02:46
481500 -- (-2006.271) (-1987.037) (-1988.172) [-1982.543] * (-1988.482) [-1985.867] (-1990.024) (-1988.936) -- 0:02:46
481600 -- (-1998.029) (-1991.765) (-1990.925) [-1985.336] * (-1986.227) (-1990.534) [-1984.456] (-1995.848) -- 0:02:46
481700 -- (-1997.260) [-1989.522] (-1989.806) (-1984.237) * [-1984.363] (-1986.646) (-1987.276) (-1988.655) -- 0:02:46
481800 -- (-1995.509) (-1993.747) (-1993.552) [-1982.693] * (-1984.996) (-1990.848) [-1982.687] (-1995.206) -- 0:02:46
481900 -- (-1995.033) (-1996.237) (-1992.071) [-1981.356] * (-1988.947) [-1985.399] (-1985.685) (-1988.728) -- 0:02:46
482000 -- (-1991.537) (-1992.089) (-1986.474) [-1983.558] * (-1990.603) [-1987.796] (-1984.030) (-1986.462) -- 0:02:46
Average standard deviation of split frequencies: 0.002514
482100 -- (-1995.505) (-2003.300) (-1987.701) [-1982.594] * [-1989.372] (-1989.140) (-1991.661) (-1991.785) -- 0:02:47
482200 -- (-1994.677) (-2001.062) (-1985.182) [-1985.411] * [-1988.276] (-1989.417) (-1992.232) (-1992.356) -- 0:02:47
482300 -- (-1996.647) (-2000.553) (-1990.270) [-1983.155] * (-1986.565) [-1982.888] (-1987.956) (-1987.536) -- 0:02:47
482400 -- (-1995.261) (-2006.286) (-1990.678) [-1986.116] * (-1989.103) [-1978.307] (-1990.668) (-1995.813) -- 0:02:47
482500 -- (-1992.632) (-1997.841) (-1989.372) [-1979.782] * (-1992.113) [-1980.982] (-1995.482) (-1994.326) -- 0:02:47
482600 -- (-1992.270) (-1990.355) (-1993.920) [-1980.926] * (-1996.920) [-1984.062] (-1996.011) (-1994.005) -- 0:02:47
482700 -- [-1991.093] (-1991.055) (-1987.546) (-1989.874) * (-1999.418) (-1983.843) [-1991.545] (-1993.526) -- 0:02:47
482800 -- (-1993.800) [-1986.253] (-1987.010) (-1989.999) * (-1997.137) [-1984.688] (-1991.121) (-1985.289) -- 0:02:47
482900 -- (-1990.935) (-1996.490) (-1991.304) [-1993.824] * (-1988.486) [-1987.795] (-1990.565) (-1987.899) -- 0:02:47
483000 -- (-1995.908) (-1984.117) [-1989.282] (-1992.977) * (-1990.406) [-1984.044] (-1995.239) (-1993.540) -- 0:02:46
Average standard deviation of split frequencies: 0.002620
483100 -- (-1994.296) [-1982.313] (-1988.126) (-1991.525) * (-1992.650) [-1984.373] (-1991.010) (-2000.049) -- 0:02:46
483200 -- (-1991.741) [-1982.286] (-1985.609) (-1990.813) * [-1985.266] (-1986.609) (-1997.558) (-1996.594) -- 0:02:46
483300 -- [-1991.270] (-1993.970) (-1983.573) (-1986.495) * [-1991.531] (-1989.901) (-1995.385) (-1994.237) -- 0:02:46
483400 -- (-1997.481) (-1990.183) [-1983.278] (-1986.628) * (-1996.934) (-1983.727) [-1993.101] (-1999.472) -- 0:02:46
483500 -- (-2002.336) (-1987.465) [-1980.364] (-1985.940) * (-1992.873) [-1985.772] (-1993.439) (-1995.631) -- 0:02:46
483600 -- (-2018.053) (-1988.058) (-1980.029) [-1985.281] * (-1990.692) [-1983.851] (-1996.212) (-2001.708) -- 0:02:46
483700 -- (-2002.919) (-1990.862) (-1982.673) [-1985.575] * (-1983.554) [-1986.672] (-1998.674) (-1992.600) -- 0:02:46
483800 -- (-1997.262) (-1990.719) (-1985.378) [-1982.313] * (-1983.317) [-1983.252] (-2002.436) (-1989.360) -- 0:02:46
483900 -- (-1995.613) (-1999.961) (-1985.487) [-1983.666] * (-1986.893) (-1988.068) (-2007.586) [-1992.218] -- 0:02:46
484000 -- (-1989.794) (-2000.684) (-1988.382) [-1981.337] * (-1987.904) [-1985.667] (-1994.335) (-2000.183) -- 0:02:46
Average standard deviation of split frequencies: 0.002671
484100 -- (-1995.077) (-2000.072) [-1986.208] (-1982.795) * (-1990.557) (-1988.878) (-2001.538) [-1980.780] -- 0:02:46
484200 -- (-1994.053) (-1990.862) [-1987.915] (-1988.231) * (-1990.304) [-1992.551] (-1993.060) (-1980.195) -- 0:02:46
484300 -- [-1985.442] (-1985.088) (-1992.137) (-1983.703) * (-1990.795) (-1989.712) (-1997.844) [-1979.997] -- 0:02:46
484400 -- (-1988.862) (-1987.177) (-2003.171) [-1991.526] * (-1995.058) (-1984.010) (-1997.694) [-1982.363] -- 0:02:46
484500 -- (-1990.012) (-1987.054) (-2004.511) [-1988.070] * (-1992.348) [-1985.890] (-2000.969) (-1984.394) -- 0:02:45
484600 -- (-1987.662) [-1984.451] (-2006.516) (-1987.088) * (-1990.897) [-1984.242] (-1999.410) (-1981.720) -- 0:02:45
484700 -- (-1988.573) (-1992.480) (-1999.502) [-1982.512] * (-1999.831) [-1986.292] (-1993.980) (-1986.082) -- 0:02:45
484800 -- (-1987.111) (-1991.905) (-1996.279) [-1978.768] * (-2002.633) (-1985.320) (-1996.648) [-1989.814] -- 0:02:45
484900 -- [-1984.119] (-1987.899) (-1993.199) (-1977.845) * (-2003.960) (-1992.081) (-2002.653) [-1987.149] -- 0:02:45
485000 -- (-1985.750) [-1982.560] (-1986.735) (-1984.954) * (-2004.301) (-1986.790) (-1993.090) [-1990.291] -- 0:02:45
Average standard deviation of split frequencies: 0.002804
485100 -- (-1988.813) [-1985.707] (-1989.550) (-1989.254) * (-1997.870) [-1985.946] (-1989.419) (-2003.893) -- 0:02:46
485200 -- (-1991.401) (-1984.104) (-1982.354) [-1983.295] * (-1996.868) (-1982.821) [-1993.817] (-2014.703) -- 0:02:46
485300 -- (-1995.717) (-1992.097) (-1985.287) [-1987.119] * (-2000.683) [-1984.451] (-1987.826) (-2005.772) -- 0:02:46
485400 -- (-1998.572) [-1989.061] (-1983.995) (-1990.957) * (-1993.428) [-1986.064] (-1993.549) (-2003.431) -- 0:02:46
485500 -- (-2003.267) (-1994.783) [-1979.852] (-1988.637) * (-1992.418) [-1990.397] (-2005.896) (-2001.941) -- 0:02:46
485600 -- (-1992.808) (-2010.750) (-1979.864) [-1988.316] * (-1992.458) [-1987.686] (-1997.876) (-1996.641) -- 0:02:46
485700 -- (-1995.846) (-1997.604) [-1985.075] (-1991.504) * (-1997.677) [-1993.130] (-1990.764) (-1990.391) -- 0:02:46
485800 -- (-1994.829) (-1998.955) [-1984.055] (-1990.987) * (-1995.333) (-1987.553) (-1999.826) [-1989.675] -- 0:02:46
485900 -- (-1997.473) (-1993.205) [-1985.286] (-1993.072) * (-1989.312) [-1986.728] (-1995.390) (-1991.998) -- 0:02:46
486000 -- (-2002.647) (-1994.798) [-1984.391] (-1989.740) * (-1990.096) [-1984.255] (-1992.780) (-1993.960) -- 0:02:46
Average standard deviation of split frequencies: 0.002798
486100 -- (-2003.494) (-1991.425) [-1983.473] (-1991.702) * (-1996.049) [-1985.370] (-1991.876) (-1991.568) -- 0:02:45
486200 -- (-2003.351) (-1992.268) [-1987.465] (-1993.950) * (-1998.286) [-1983.289] (-1992.773) (-1993.716) -- 0:02:45
486300 -- (-2005.288) (-1996.003) [-1984.333] (-1991.773) * [-1990.940] (-1984.572) (-1993.544) (-1997.147) -- 0:02:45
486400 -- (-2000.544) (-1989.952) (-1989.652) [-1984.087] * (-1989.954) [-1982.871] (-1992.476) (-1995.308) -- 0:02:45
486500 -- (-1999.771) (-1989.582) [-1988.260] (-1984.644) * (-1995.532) [-1983.418] (-1994.317) (-1992.034) -- 0:02:45
486600 -- (-2006.546) (-1991.662) [-1985.415] (-1988.990) * (-2000.552) (-1982.393) [-1992.835] (-1988.092) -- 0:02:45
486700 -- (-2006.758) (-1993.716) [-1983.032] (-1988.604) * (-1993.951) [-1987.524] (-1997.387) (-1988.718) -- 0:02:45
486800 -- [-1995.047] (-1994.468) (-1986.241) (-1985.073) * [-1991.927] (-1984.473) (-2001.188) (-1998.341) -- 0:02:45
486900 -- (-2004.104) (-2001.190) (-1989.125) [-1980.880] * [-1992.036] (-1981.874) (-2004.464) (-2001.195) -- 0:02:45
487000 -- (-2006.263) (-1992.590) (-1986.707) [-1985.170] * (-1985.094) [-1983.874] (-1993.193) (-2008.794) -- 0:02:45
Average standard deviation of split frequencies: 0.003013
487100 -- (-1998.844) (-1988.970) [-1983.689] (-1991.068) * [-1990.247] (-1982.699) (-1996.080) (-2002.827) -- 0:02:45
487200 -- (-2000.049) (-1989.415) (-1984.842) [-1988.733] * (-2003.893) [-1986.112] (-1995.917) (-2007.405) -- 0:02:45
487300 -- (-1998.085) [-1981.468] (-1989.444) (-1981.810) * (-1994.579) [-1989.912] (-1992.608) (-2008.052) -- 0:02:45
487400 -- [-1994.303] (-1982.757) (-1987.587) (-1982.355) * (-1995.516) [-1982.166] (-1998.467) (-2001.841) -- 0:02:45
487500 -- (-1989.533) [-1983.334] (-1989.900) (-1981.395) * (-1989.741) [-1983.051] (-2003.500) (-2005.959) -- 0:02:45
487600 -- (-1990.019) [-1983.075] (-1994.032) (-1988.389) * (-1987.454) [-1989.785] (-1991.789) (-2001.475) -- 0:02:44
487700 -- (-1995.881) [-1980.989] (-1994.743) (-1989.892) * (-1993.705) [-1983.319] (-1988.205) (-1999.053) -- 0:02:44
487800 -- (-1989.050) [-1981.184] (-1994.694) (-1989.409) * (-1995.292) (-1983.908) [-1991.064] (-1997.811) -- 0:02:44
487900 -- (-1992.505) [-1982.191] (-2000.502) (-1992.837) * (-2005.794) [-1982.004] (-1988.800) (-2000.871) -- 0:02:44
488000 -- (-1991.856) [-1981.030] (-2004.898) (-1990.774) * (-2009.420) [-1983.294] (-1989.819) (-2005.208) -- 0:02:44
Average standard deviation of split frequencies: 0.002870
488100 -- (-1995.294) [-1984.625] (-1993.810) (-1991.590) * (-1999.096) (-1982.655) [-1990.228] (-1990.801) -- 0:02:45
488200 -- (-1995.264) [-1981.941] (-1992.394) (-1994.095) * (-1999.345) [-1987.220] (-1988.764) (-1991.462) -- 0:02:45
488300 -- (-1991.194) (-1987.701) (-1990.144) [-1986.786] * (-2000.791) [-1989.512] (-1989.002) (-1990.387) -- 0:02:45
488400 -- (-1993.023) [-1982.235] (-1987.698) (-1988.583) * (-1995.182) (-2004.433) (-1992.722) [-1986.249] -- 0:02:45
488500 -- (-1992.669) (-1981.959) [-1990.600] (-1990.272) * (-1992.303) (-1999.525) [-1989.417] (-1984.738) -- 0:02:45
488600 -- [-1990.274] (-1982.264) (-2001.939) (-1989.617) * [-1996.572] (-2001.308) (-1988.120) (-1980.860) -- 0:02:45
488700 -- [-1993.414] (-1985.699) (-2009.255) (-1987.842) * (-2004.104) (-1993.616) (-1989.874) [-1983.287] -- 0:02:45
488800 -- [-1988.196] (-1987.773) (-1995.443) (-1992.715) * (-1995.951) (-1991.998) (-1987.217) [-1983.630] -- 0:02:45
488900 -- (-1990.700) [-1988.353] (-1993.433) (-1986.990) * (-1994.914) (-2007.535) [-1985.789] (-1984.798) -- 0:02:45
489000 -- (-2005.214) [-1984.788] (-1983.182) (-1998.583) * (-1986.489) (-2009.745) (-1980.761) [-1981.412] -- 0:02:45
Average standard deviation of split frequencies: 0.002973
489100 -- (-1999.089) (-1987.333) [-1978.687] (-1991.427) * (-1988.541) (-1998.723) (-1990.783) [-1980.886] -- 0:02:45
489200 -- (-2003.851) (-1999.288) [-1977.420] (-1985.951) * [-1989.751] (-2001.168) (-1990.709) (-1985.325) -- 0:02:44
489300 -- (-1995.743) (-1991.369) [-1976.799] (-1987.278) * (-1990.022) (-2003.453) (-1987.571) [-1990.539] -- 0:02:44
489400 -- (-1997.721) (-1981.688) [-1980.841] (-1990.288) * (-1991.169) (-2003.590) (-1989.319) [-1987.742] -- 0:02:44
489500 -- (-1997.016) (-1982.590) [-1979.625] (-1996.047) * (-1989.171) (-2009.289) (-1990.204) [-1989.986] -- 0:02:44
489600 -- (-1991.276) (-1995.405) [-1981.872] (-1992.781) * [-1990.707] (-2004.127) (-1989.804) (-1982.581) -- 0:02:44
489700 -- (-1994.363) (-1984.479) [-1987.874] (-1997.578) * (-1991.324) (-2009.376) (-1995.296) [-1983.895] -- 0:02:44
489800 -- (-1993.340) [-1982.785] (-1995.052) (-1989.216) * (-1996.465) (-2007.566) [-1986.471] (-1987.011) -- 0:02:44
489900 -- (-1994.562) (-1980.833) [-1986.383] (-1989.596) * (-1992.885) (-1994.576) (-1986.202) [-1984.207] -- 0:02:44
490000 -- (-1989.935) (-1987.055) [-1984.971] (-1992.535) * (-1992.093) (-1988.407) (-1986.742) [-1984.906] -- 0:02:44
Average standard deviation of split frequencies: 0.003188
490100 -- (-1990.550) (-1986.925) [-1984.361] (-1991.754) * (-1991.738) (-1990.900) [-1989.777] (-1983.553) -- 0:02:44
490200 -- (-1990.763) [-1986.057] (-1993.099) (-1994.345) * (-1992.934) (-1994.498) (-1992.293) [-1983.894] -- 0:02:44
490300 -- (-1998.934) [-1980.253] (-2005.043) (-1996.514) * [-1991.319] (-1983.671) (-1992.142) (-1995.641) -- 0:02:44
490400 -- (-1994.622) [-1984.455] (-1999.678) (-1994.956) * (-1992.654) [-1985.210] (-1993.269) (-1992.987) -- 0:02:44
490500 -- (-2000.346) [-1979.801] (-1998.120) (-1986.358) * (-1992.631) [-1982.790] (-1986.777) (-1998.681) -- 0:02:44
490600 -- (-2002.888) [-1983.664] (-1993.219) (-1985.584) * (-1996.394) (-1982.744) [-1986.897] (-1997.292) -- 0:02:44
490700 -- (-2006.716) [-1983.258] (-1992.451) (-1983.762) * (-1987.691) (-1983.253) [-1987.725] (-1996.645) -- 0:02:43
490800 -- (-2012.274) (-1983.018) (-1985.978) [-1986.941] * (-1987.389) [-1982.026] (-1999.331) (-1995.956) -- 0:02:43
490900 -- (-2000.395) [-1986.933] (-1984.513) (-1987.944) * [-1984.524] (-1984.094) (-1997.202) (-1988.563) -- 0:02:43
491000 -- (-1993.844) (-1990.310) [-1984.739] (-1984.031) * (-1989.144) [-1985.830] (-2004.016) (-1994.749) -- 0:02:43
Average standard deviation of split frequencies: 0.003016
491100 -- (-1991.735) (-1994.913) [-1989.334] (-1990.054) * (-1985.713) [-1982.738] (-2003.110) (-1990.025) -- 0:02:43
491200 -- (-2000.887) (-1988.389) [-1987.755] (-1981.708) * [-1986.939] (-1984.343) (-2002.308) (-1989.566) -- 0:02:44
491300 -- (-2003.551) (-1990.111) [-1987.594] (-1983.694) * (-1989.917) (-1991.622) (-1995.913) [-1985.521] -- 0:02:44
491400 -- (-2010.228) (-1981.236) [-1980.159] (-1980.046) * (-1986.913) (-1988.640) (-1991.466) [-1984.749] -- 0:02:44
491500 -- (-1992.469) (-1982.995) [-1979.264] (-1980.334) * (-1991.216) (-1990.678) (-1986.674) [-1986.196] -- 0:02:44
491600 -- (-1993.747) (-1987.595) [-1980.558] (-1988.315) * (-1991.316) [-1985.966] (-1994.651) (-1992.993) -- 0:02:44
491700 -- (-2005.328) (-1984.950) (-1979.527) [-1987.243] * (-1993.305) [-1988.567] (-2000.333) (-1988.387) -- 0:02:44
491800 -- (-1999.905) (-1990.225) [-1979.823] (-1985.718) * (-1994.315) (-1984.778) [-1989.642] (-1989.042) -- 0:02:44
491900 -- (-1998.042) (-1989.033) [-1980.929] (-1983.936) * (-1994.060) (-2001.468) (-1992.444) [-1992.861] -- 0:02:44
492000 -- (-1998.504) [-1988.314] (-1982.114) (-1978.311) * (-1986.051) (-1986.543) (-1992.484) [-1992.914] -- 0:02:44
Average standard deviation of split frequencies: 0.002956
492100 -- (-2006.852) [-1985.164] (-1989.367) (-1981.851) * [-1987.264] (-1987.771) (-1992.522) (-1985.933) -- 0:02:44
492200 -- (-2010.065) [-1988.237] (-1985.319) (-1982.488) * (-1991.892) [-1986.763] (-1992.216) (-1985.685) -- 0:02:44
492300 -- (-2025.893) (-1987.292) (-1986.833) [-1983.950] * (-1996.252) [-1984.707] (-1987.390) (-1994.057) -- 0:02:43
492400 -- (-2013.822) (-1988.121) (-1988.704) [-1988.997] * (-1997.889) (-1987.303) (-1997.240) [-1983.273] -- 0:02:43
492500 -- (-2000.223) (-1982.209) (-1984.244) [-1979.809] * (-2003.329) [-1980.842] (-1989.799) (-1987.728) -- 0:02:43
492600 -- (-2003.842) (-1990.182) [-1980.926] (-1982.870) * (-2004.964) (-1983.413) [-1987.540] (-1987.397) -- 0:02:43
492700 -- (-1993.567) (-1993.855) [-1987.720] (-1981.798) * (-1999.484) (-1983.088) (-1991.578) [-1980.304] -- 0:02:43
492800 -- (-1993.757) [-1989.196] (-1988.155) (-1986.230) * (-1991.984) (-1985.724) (-1994.213) [-1980.958] -- 0:02:43
492900 -- (-1992.554) (-1993.070) (-1992.493) [-1984.819] * (-1994.199) [-1990.000] (-1996.765) (-1985.285) -- 0:02:43
493000 -- (-1997.234) [-1993.833] (-2002.453) (-1985.600) * (-1992.865) (-1991.555) (-1994.705) [-1988.352] -- 0:02:43
Average standard deviation of split frequencies: 0.002867
493100 -- (-1990.105) (-1993.030) (-1999.381) [-1985.645] * (-1992.454) [-1991.261] (-1999.350) (-1989.354) -- 0:02:43
493200 -- (-1986.836) (-1993.690) (-2000.877) [-1984.549] * (-1996.101) (-1995.083) (-1990.458) [-1989.372] -- 0:02:43
493300 -- (-1992.162) (-1990.862) (-1994.828) [-1983.002] * (-1994.876) (-1987.738) [-1992.362] (-1988.921) -- 0:02:43
493400 -- (-1992.899) (-1991.481) (-1990.096) [-1982.372] * (-1990.735) (-1987.639) (-1991.204) [-1986.192] -- 0:02:43
493500 -- (-1998.446) (-1991.863) (-1991.407) [-1980.727] * (-1995.240) (-1988.254) (-1988.683) [-1985.550] -- 0:02:43
493600 -- (-2005.964) (-1995.643) (-1986.102) [-1981.106] * (-1992.680) [-1993.788] (-1994.432) (-1988.022) -- 0:02:43
493700 -- (-2005.086) (-1997.331) [-1983.486] (-1982.003) * (-1996.345) (-1990.380) [-1988.729] (-1989.241) -- 0:02:43
493800 -- (-2006.472) (-2003.621) [-1979.992] (-1984.190) * (-1994.344) [-1988.893] (-1988.974) (-1994.744) -- 0:02:42
493900 -- (-2002.562) (-1998.512) (-1979.623) [-1980.153] * (-1987.447) [-1986.920] (-1991.808) (-1990.549) -- 0:02:42
494000 -- (-2000.188) [-1988.048] (-1984.475) (-1985.727) * (-1989.044) [-1991.113] (-2000.526) (-1980.427) -- 0:02:42
Average standard deviation of split frequencies: 0.002998
494100 -- (-1997.190) (-1990.884) [-1981.597] (-1987.732) * (-1987.177) [-1986.367] (-2001.447) (-1988.547) -- 0:02:42
494200 -- (-2004.376) [-1986.936] (-1982.303) (-1993.492) * (-1992.731) (-1990.676) [-1990.909] (-1990.989) -- 0:02:43
494300 -- (-1991.716) [-1987.613] (-1983.455) (-1994.123) * [-1988.596] (-1991.555) (-1992.183) (-1991.005) -- 0:02:43
494400 -- (-2006.141) (-1997.399) (-1979.992) [-1984.584] * [-1990.047] (-1999.197) (-1996.248) (-1988.709) -- 0:02:43
494500 -- (-2001.396) (-1992.016) [-1980.824] (-1991.831) * [-1991.674] (-1995.364) (-1994.806) (-1993.742) -- 0:02:43
494600 -- (-2004.643) (-1992.197) [-1980.624] (-1989.065) * [-1990.227] (-1998.385) (-1991.344) (-1986.439) -- 0:02:43
494700 -- (-2001.510) (-1988.496) [-1979.355] (-1992.688) * (-1988.201) (-2008.895) (-1993.630) [-1987.186] -- 0:02:43
494800 -- (-2002.672) (-1998.242) [-1986.578] (-1987.111) * (-1990.044) (-2005.807) (-1999.868) [-1982.845] -- 0:02:43
494900 -- (-2004.657) [-1997.544] (-1986.619) (-1991.041) * [-1998.379] (-2002.273) (-1995.818) (-1985.698) -- 0:02:43
495000 -- (-1997.240) (-1998.677) [-1984.429] (-1997.217) * (-1993.872) (-2000.563) [-2001.394] (-1992.547) -- 0:02:43
Average standard deviation of split frequencies: 0.003101
495100 -- (-2004.025) (-1989.493) [-1980.546] (-1998.801) * [-1994.920] (-1996.387) (-1998.204) (-1998.455) -- 0:02:43
495200 -- (-1996.202) (-1993.414) [-1986.740] (-1994.597) * (-2000.294) [-1992.773] (-1991.840) (-2013.486) -- 0:02:43
495300 -- (-1992.141) (-1991.974) [-1984.559] (-1988.239) * (-1997.135) [-1989.666] (-1987.276) (-2008.058) -- 0:02:43
495400 -- (-1993.469) (-1999.892) [-1981.828] (-1989.398) * (-2002.017) [-1984.983] (-1990.073) (-1995.817) -- 0:02:42
495500 -- (-2000.777) (-1998.039) (-1986.762) [-1987.032] * (-1992.538) [-1990.048] (-1989.086) (-1995.485) -- 0:02:42
495600 -- (-1998.637) (-2003.601) (-1987.439) [-1985.273] * [-1992.306] (-1988.037) (-1992.205) (-1996.738) -- 0:02:42
495700 -- (-1995.873) (-1999.062) (-1989.926) [-1985.289] * [-1989.436] (-1987.430) (-1991.581) (-2003.347) -- 0:02:42
495800 -- (-1988.785) (-2013.660) [-1988.834] (-1984.886) * (-1986.331) [-1985.912] (-1994.555) (-1995.640) -- 0:02:42
495900 -- (-1990.343) (-2009.393) [-1983.327] (-1981.848) * [-1985.898] (-1999.238) (-1990.202) (-2001.358) -- 0:02:42
496000 -- (-1992.724) (-2007.507) [-1985.651] (-1981.128) * [-1991.061] (-1994.029) (-1990.444) (-2001.466) -- 0:02:42
Average standard deviation of split frequencies: 0.003095
496100 -- (-1991.565) (-2010.556) [-1985.484] (-1982.582) * [-1989.997] (-1989.969) (-1991.354) (-2001.704) -- 0:02:42
496200 -- (-1996.775) (-1999.576) [-1980.582] (-1981.269) * (-1991.509) [-1982.670] (-1990.194) (-2001.674) -- 0:02:42
496300 -- (-1994.326) (-2009.388) (-1985.039) [-1980.521] * (-1992.429) [-1982.445] (-1998.144) (-2003.772) -- 0:02:42
496400 -- (-1996.455) (-2003.558) (-1985.600) [-1986.857] * (-1996.123) [-1984.727] (-2009.075) (-2003.619) -- 0:02:42
496500 -- (-1994.335) (-2018.954) [-1984.664] (-1981.816) * (-1990.915) [-1978.649] (-2004.102) (-1998.973) -- 0:02:42
496600 -- [-1982.840] (-2008.109) (-1988.509) (-1984.763) * (-1999.622) [-1985.822] (-1996.903) (-1989.132) -- 0:02:42
496700 -- [-1986.431] (-1999.320) (-1988.506) (-1993.435) * [-1997.265] (-1985.277) (-1997.631) (-1995.953) -- 0:02:42
496800 -- (-1990.726) (-2003.447) (-1993.598) [-1992.988] * (-2001.281) [-1990.394] (-1998.563) (-1996.465) -- 0:02:42
496900 -- (-1990.047) (-1987.744) [-1987.310] (-1991.638) * (-1995.624) [-1988.605] (-1997.830) (-1999.092) -- 0:02:41
497000 -- [-1988.326] (-1992.328) (-1991.659) (-1991.966) * [-1988.372] (-1992.262) (-1999.484) (-2002.150) -- 0:02:41
Average standard deviation of split frequencies: 0.003251
497100 -- (-1989.659) (-1990.748) [-1984.960] (-1987.970) * (-1985.406) [-1986.942] (-2001.763) (-1997.951) -- 0:02:41
497200 -- (-1995.199) (-2002.022) [-1982.319] (-1990.179) * [-1983.902] (-1986.645) (-1988.370) (-1989.540) -- 0:02:41
497300 -- (-1988.851) (-1997.182) [-1983.806] (-1990.610) * [-1988.913] (-1984.983) (-1988.656) (-1989.321) -- 0:02:42
497400 -- (-1992.937) (-2003.358) [-1980.303] (-1991.515) * (-1996.712) (-1983.018) [-1988.962] (-1987.338) -- 0:02:42
497500 -- (-1993.469) (-2000.012) (-1987.313) [-1984.964] * (-1993.993) (-1995.073) [-1987.875] (-1990.049) -- 0:02:42
497600 -- (-1991.899) (-2009.549) (-1983.790) [-1983.680] * (-1995.116) [-1991.495] (-1986.691) (-1992.435) -- 0:02:42
497700 -- (-1990.605) (-1999.964) [-1981.489] (-1981.087) * (-1997.961) (-2016.790) [-1985.347] (-1993.173) -- 0:02:42
497800 -- (-1993.448) (-2003.118) (-1989.596) [-1978.971] * (-1996.378) (-2011.845) [-1989.299] (-1989.928) -- 0:02:42
497900 -- (-1993.591) (-1997.799) (-1996.356) [-1978.566] * (-1999.489) (-1994.455) [-1986.149] (-1993.596) -- 0:02:42
498000 -- (-1997.236) (-2003.493) (-2000.591) [-1980.508] * (-2001.487) (-1990.544) [-1986.294] (-1990.195) -- 0:02:42
Average standard deviation of split frequencies: 0.003136
498100 -- (-1994.004) (-1998.333) (-1988.471) [-1981.792] * (-2000.372) [-1991.634] (-1984.885) (-1986.384) -- 0:02:42
498200 -- (-1989.103) (-1992.727) (-1990.803) [-1983.686] * (-2001.652) (-1986.669) (-1992.012) [-1988.833] -- 0:02:42
498300 -- (-1987.355) (-1997.110) (-1986.401) [-1987.223] * (-2010.025) (-1991.115) (-1992.362) [-1991.191] -- 0:02:42
498400 -- (-1997.259) (-1996.295) [-1979.910] (-1986.886) * (-2012.597) [-1991.441] (-1993.599) (-1992.897) -- 0:02:42
498500 -- (-1997.735) (-1990.863) [-1977.335] (-1983.592) * (-2001.572) (-1983.609) (-1995.053) [-1989.625] -- 0:02:41
498600 -- (-1996.077) (-1993.378) [-1985.397] (-1986.881) * (-2008.203) (-1985.127) [-1990.991] (-1994.948) -- 0:02:41
498700 -- (-1988.822) (-1997.961) [-1984.634] (-1985.396) * (-2010.456) [-1982.487] (-1993.078) (-2003.152) -- 0:02:41
498800 -- (-1991.445) (-1992.057) (-1984.258) [-1981.660] * (-2001.564) [-1983.559] (-1999.626) (-1997.157) -- 0:02:41
498900 -- (-1993.306) (-1992.400) (-1987.112) [-1980.297] * (-1991.098) (-1979.795) [-1984.493] (-1996.775) -- 0:02:41
499000 -- (-1991.595) (-1991.709) (-1988.787) [-1989.929] * (-1995.954) [-1983.427] (-1993.718) (-2002.744) -- 0:02:41
Average standard deviation of split frequencies: 0.003480
499100 -- (-1984.574) (-1991.420) [-1987.523] (-1991.537) * (-1991.927) [-1982.710] (-1995.747) (-1997.149) -- 0:02:41
499200 -- [-1986.092] (-1993.520) (-1987.851) (-1989.159) * (-1991.137) [-1987.073] (-1994.244) (-1993.831) -- 0:02:41
499300 -- (-1984.967) (-1998.325) (-1981.431) [-1988.197] * [-1989.757] (-1991.092) (-2001.540) (-1993.202) -- 0:02:41
499400 -- (-1985.679) (-1991.823) [-1979.867] (-1993.430) * (-1999.370) [-1987.422] (-1996.055) (-1993.501) -- 0:02:41
499500 -- (-1986.852) (-1996.344) [-1979.763] (-1997.718) * (-1999.106) [-1984.902] (-1997.395) (-1989.673) -- 0:02:41
499600 -- (-1989.883) (-1998.795) [-1980.179] (-1998.558) * (-1994.591) [-1987.417] (-2000.725) (-1993.904) -- 0:02:41
499700 -- (-1992.796) (-1995.374) [-1982.555] (-1997.185) * (-1988.925) [-1985.073] (-2000.774) (-1998.967) -- 0:02:41
499800 -- (-1986.851) (-1996.268) [-1986.174] (-1991.921) * [-1983.276] (-1996.124) (-2003.462) (-1996.439) -- 0:02:41
499900 -- (-1988.965) (-1993.435) [-1981.603] (-2007.406) * [-1982.538] (-2000.337) (-1993.026) (-1996.675) -- 0:02:41
500000 -- [-1986.045] (-1994.247) (-1986.060) (-2012.157) * [-1987.335] (-1992.825) (-1995.938) (-1998.015) -- 0:02:41
Average standard deviation of split frequencies: 0.003474
500100 -- (-1988.356) (-1995.595) [-1978.370] (-2006.832) * [-1984.789] (-1991.010) (-2000.246) (-2006.520) -- 0:02:40
500200 -- (-1996.101) (-1996.330) [-1978.480] (-2004.624) * [-1988.583] (-1981.749) (-1998.593) (-2001.610) -- 0:02:40
500300 -- (-1994.117) (-1992.379) [-1977.130] (-2001.652) * [-1981.876] (-1983.856) (-1997.712) (-2000.242) -- 0:02:41
500400 -- (-1993.660) (-2000.550) [-1979.446] (-1996.140) * (-1982.418) (-1987.598) (-1995.292) [-2000.636] -- 0:02:41
500500 -- (-1993.158) (-1995.724) [-1982.729] (-1999.473) * [-1985.400] (-1991.894) (-1999.782) (-1994.979) -- 0:02:41
500600 -- (-1991.138) (-1998.485) [-1980.779] (-1998.250) * (-1986.652) [-1986.237] (-1993.114) (-1992.245) -- 0:02:41
500700 -- (-1988.334) (-1997.657) (-1983.935) [-1989.642] * (-1987.065) [-1983.884] (-1989.753) (-1991.090) -- 0:02:41
500800 -- (-1996.334) (-1995.243) [-1983.314] (-1988.472) * [-1988.845] (-1982.829) (-1992.676) (-1986.965) -- 0:02:41
500900 -- (-1995.869) (-2001.041) (-1980.968) [-1986.140] * (-1990.287) [-1984.453] (-1992.416) (-1993.058) -- 0:02:41
501000 -- (-1994.089) (-1992.633) [-1983.240] (-1985.836) * (-1993.810) (-1989.491) (-1997.905) [-1987.188] -- 0:02:41
Average standard deviation of split frequencies: 0.003278
501100 -- (-1997.815) (-1988.436) (-1984.754) [-1984.169] * (-1997.917) [-1988.667] (-2000.921) (-1984.666) -- 0:02:41
501200 -- (-2004.914) (-1987.670) [-1985.382] (-1984.696) * (-1993.839) (-2000.012) [-1998.346] (-1984.596) -- 0:02:41
501300 -- (-2004.633) [-1988.441] (-1985.176) (-1989.472) * (-1992.958) (-2009.244) (-1998.868) [-1985.350] -- 0:02:41
501400 -- (-1998.842) (-1991.808) (-1989.036) [-1985.532] * (-1988.567) (-2000.975) (-1997.802) [-1985.867] -- 0:02:41
501500 -- (-1992.368) (-1999.826) (-1992.183) [-1984.593] * (-1990.647) [-1981.620] (-2001.698) (-1985.346) -- 0:02:41
501600 -- (-1997.316) (-1994.549) [-1986.284] (-1989.315) * (-1990.821) (-1983.496) (-2003.563) [-1986.168] -- 0:02:40
501700 -- (-1995.815) (-1998.769) [-1986.784] (-1994.791) * (-1985.392) [-1983.899] (-1993.204) (-1990.831) -- 0:02:40
501800 -- (-2000.520) (-2002.587) [-1981.107] (-1997.654) * (-1995.582) [-1985.264] (-2001.985) (-1992.215) -- 0:02:40
501900 -- (-1998.390) (-2005.543) [-1982.876] (-1986.923) * (-1995.200) [-1985.585] (-1997.310) (-1997.249) -- 0:02:40
502000 -- (-1996.578) (-2007.273) [-1989.722] (-1992.041) * (-1993.926) [-1985.511] (-1995.702) (-1998.164) -- 0:02:40
Average standard deviation of split frequencies: 0.003326
502100 -- (-2000.038) (-1995.030) [-1983.659] (-1988.170) * [-1984.658] (-1986.934) (-1990.229) (-1995.929) -- 0:02:40
502200 -- (-1998.427) (-1990.815) [-1982.320] (-1987.932) * [-1979.491] (-1986.441) (-1992.826) (-1996.787) -- 0:02:40
502300 -- (-1999.639) [-1991.274] (-1987.497) (-1989.937) * (-1993.431) [-1989.024] (-1987.098) (-2002.254) -- 0:02:40
502400 -- (-1998.983) [-1988.472] (-1994.093) (-1986.155) * (-1985.710) (-2000.284) [-1989.772] (-2000.929) -- 0:02:40
502500 -- (-2000.559) (-1985.856) (-2002.571) [-1983.695] * (-1987.668) (-2004.194) [-1988.395] (-2002.284) -- 0:02:40
502600 -- (-2001.490) (-1994.412) (-1994.629) [-1982.587] * [-1992.531] (-2004.833) (-1994.485) (-2007.129) -- 0:02:40
502700 -- (-2001.256) (-1987.807) (-1996.416) [-1984.561] * [-1981.763] (-1996.850) (-1988.001) (-2012.263) -- 0:02:40
502800 -- (-1995.858) [-1985.860] (-1985.750) (-1986.083) * (-1980.040) (-1995.967) [-1986.962] (-2006.326) -- 0:02:40
502900 -- [-1991.366] (-1993.773) (-1990.509) (-1991.675) * (-1983.614) (-1994.374) [-1987.232] (-2007.202) -- 0:02:40
503000 -- (-1992.627) (-2001.840) (-1992.447) [-1982.356] * (-1983.825) (-1999.998) [-1985.517] (-1996.735) -- 0:02:40
Average standard deviation of split frequencies: 0.003373
503100 -- (-1991.790) (-1995.950) (-1991.296) [-1983.420] * [-1982.608] (-1992.748) (-1987.968) (-1994.990) -- 0:02:40
503200 -- (-1990.778) (-1993.577) (-1979.959) [-1982.671] * (-1985.301) [-1993.046] (-1994.483) (-2001.412) -- 0:02:39
503300 -- (-1997.242) (-1991.076) [-1978.894] (-1983.247) * [-1983.148] (-1993.054) (-1986.366) (-2004.342) -- 0:02:39
503400 -- (-2001.326) (-1990.318) [-1986.310] (-1986.571) * [-1981.872] (-1985.948) (-1987.076) (-1997.059) -- 0:02:40
503500 -- (-1987.046) (-1992.490) [-1983.748] (-1991.655) * (-1985.526) [-1982.491] (-1986.003) (-2000.806) -- 0:02:40
503600 -- (-1986.873) (-1993.794) [-1987.078] (-1991.092) * (-1980.978) [-1979.164] (-1993.260) (-2002.067) -- 0:02:40
503700 -- [-1988.334] (-1993.511) (-1987.071) (-1991.814) * (-1986.534) [-1983.126] (-1997.221) (-2009.868) -- 0:02:40
503800 -- (-1987.803) (-1989.537) [-1982.284] (-1996.591) * (-1988.104) (-1994.701) [-1993.805] (-2002.787) -- 0:02:40
503900 -- (-1989.116) (-1995.951) [-1982.446] (-1997.551) * [-1982.636] (-1990.785) (-1996.144) (-2010.438) -- 0:02:40
504000 -- [-1987.354] (-1990.175) (-1988.582) (-1993.766) * [-1980.824] (-1992.729) (-1993.508) (-1988.703) -- 0:02:40
Average standard deviation of split frequencies: 0.003420
504100 -- [-1985.044] (-1992.309) (-1991.998) (-1997.315) * (-1979.876) [-1989.852] (-2010.710) (-1987.848) -- 0:02:40
504200 -- [-1985.024] (-1989.432) (-1995.369) (-1997.057) * (-1985.176) [-1989.043] (-2000.400) (-1993.827) -- 0:02:40
504300 -- [-1984.639] (-1988.559) (-1995.562) (-1990.270) * (-1987.596) [-1994.049] (-2000.821) (-1993.590) -- 0:02:40
504400 -- (-1988.517) (-1987.936) [-1984.873] (-1985.331) * [-1983.649] (-1992.903) (-1993.827) (-1995.970) -- 0:02:40
504500 -- (-1992.187) (-1990.588) (-1988.325) [-1986.682] * (-1984.207) (-1999.321) [-1985.750] (-1993.444) -- 0:02:40
504600 -- (-1996.044) (-1991.660) [-1981.676] (-1988.923) * [-1980.922] (-1992.035) (-1988.898) (-1984.099) -- 0:02:40
504700 -- (-1995.483) (-1994.455) [-1979.363] (-1991.781) * (-1988.229) (-1992.246) (-1993.485) [-1985.942] -- 0:02:39
504800 -- [-1992.289] (-1993.494) (-1990.249) (-1989.744) * [-1989.659] (-1987.269) (-1992.828) (-1990.462) -- 0:02:39
504900 -- (-2006.287) (-1990.103) [-1983.961] (-1990.936) * (-1986.797) [-1985.844] (-1984.843) (-1990.691) -- 0:02:39
505000 -- (-2010.926) (-1987.450) [-1984.607] (-1996.693) * [-1992.881] (-1982.511) (-1987.680) (-1993.394) -- 0:02:39
Average standard deviation of split frequencies: 0.003519
505100 -- (-2006.200) (-1994.381) [-1986.565] (-1991.722) * (-2004.125) [-1982.425] (-1991.503) (-1997.240) -- 0:02:39
505200 -- (-1994.265) (-1997.995) [-1983.442] (-1988.843) * (-1994.765) [-1983.785] (-1993.067) (-2004.549) -- 0:02:39
505300 -- (-1994.312) (-1997.181) [-1983.235] (-1983.043) * (-1986.949) [-1982.469] (-1985.611) (-2008.519) -- 0:02:39
505400 -- (-1992.716) (-2002.398) [-1982.492] (-1984.031) * (-1998.597) [-1980.323] (-1988.094) (-2008.608) -- 0:02:39
505500 -- (-1991.602) (-1990.374) (-1983.403) [-1983.078] * (-1994.831) [-1985.363] (-1994.717) (-2003.683) -- 0:02:39
505600 -- (-1990.062) (-1991.818) [-1981.636] (-1986.205) * (-1991.565) (-1988.439) [-1986.402] (-2000.802) -- 0:02:39
505700 -- (-2002.387) (-1996.134) [-1983.697] (-1990.782) * (-1991.225) [-1988.775] (-1987.576) (-2000.526) -- 0:02:39
505800 -- (-2006.482) (-1997.780) [-1987.843] (-1986.419) * (-1989.626) (-1987.363) [-1987.738] (-1999.962) -- 0:02:39
505900 -- (-2005.622) (-1994.312) (-1990.512) [-1986.828] * (-1995.873) [-1988.592] (-1991.364) (-1993.480) -- 0:02:39
506000 -- (-1994.663) (-1997.056) (-1992.950) [-1990.027] * (-1993.421) [-1982.433] (-1992.146) (-1994.184) -- 0:02:39
Average standard deviation of split frequencies: 0.003726
506100 -- (-1996.139) (-1999.525) (-1996.933) [-1985.871] * (-1988.751) [-1979.760] (-1997.035) (-2001.486) -- 0:02:39
506200 -- (-1991.935) (-1998.838) [-1989.046] (-1986.815) * (-1987.705) [-1977.055] (-1995.890) (-1994.607) -- 0:02:39
506300 -- (-1993.477) (-1997.940) (-1984.797) [-1989.733] * (-1990.661) [-1984.196] (-1993.566) (-2003.507) -- 0:02:38
506400 -- (-1987.532) (-1987.931) [-1985.506] (-1993.843) * (-1997.427) (-1984.453) [-1990.583] (-2005.575) -- 0:02:38
506500 -- (-1986.539) (-1992.979) [-1980.057] (-1988.358) * [-1989.405] (-1985.554) (-1987.261) (-2005.190) -- 0:02:39
506600 -- (-1984.525) (-1991.371) [-1988.724] (-1989.983) * (-1994.574) [-1988.712] (-1988.269) (-1999.351) -- 0:02:39
506700 -- [-1981.699] (-1994.034) (-1984.460) (-1988.008) * (-1997.032) (-1993.512) [-1988.865] (-1991.299) -- 0:02:39
506800 -- (-1993.063) (-1996.187) (-1985.195) [-1984.103] * [-1986.584] (-1992.621) (-1991.525) (-1989.057) -- 0:02:39
506900 -- (-1995.505) (-1990.347) (-1986.068) [-1982.496] * [-1985.687] (-1987.442) (-1989.926) (-1993.224) -- 0:02:39
507000 -- (-1994.767) (-1985.225) [-1982.346] (-1984.426) * (-1985.964) (-1989.447) [-1985.202] (-1992.421) -- 0:02:39
Average standard deviation of split frequencies: 0.003558
507100 -- (-1994.746) (-1995.919) (-1981.040) [-1989.635] * [-1983.097] (-1988.759) (-1986.771) (-1989.406) -- 0:02:39
507200 -- (-2002.998) (-1985.881) [-1979.205] (-1987.426) * [-1982.253] (-1994.722) (-1996.412) (-1985.632) -- 0:02:39
507300 -- (-2007.440) (-1989.902) [-1983.586] (-1994.355) * (-1984.627) (-1995.586) (-1989.481) [-1990.063] -- 0:02:39
507400 -- (-2010.508) (-1997.856) (-1990.499) [-1993.499] * [-1981.767] (-1981.021) (-1991.706) (-1994.884) -- 0:02:39
507500 -- (-2016.834) (-1992.474) [-1990.573] (-1982.947) * (-1983.344) (-1978.749) (-1984.937) [-1986.669] -- 0:02:39
507600 -- (-2004.976) (-1985.922) (-1983.372) [-1983.761] * (-1984.753) (-1982.981) (-1990.934) [-1985.950] -- 0:02:39
507700 -- (-2001.074) (-1985.640) [-1980.736] (-1988.325) * (-1982.958) [-1979.240] (-1985.869) (-1986.671) -- 0:02:39
507800 -- (-2004.391) (-1985.490) [-1978.670] (-1994.235) * [-1981.091] (-1992.523) (-1991.331) (-1990.361) -- 0:02:38
507900 -- (-2004.047) [-1987.657] (-1989.615) (-1990.643) * [-1980.278] (-1991.705) (-1990.863) (-1989.351) -- 0:02:38
508000 -- (-2006.656) (-1995.836) (-1989.078) [-1992.395] * [-1978.770] (-1995.069) (-1999.018) (-1989.350) -- 0:02:38
Average standard deviation of split frequencies: 0.003446
508100 -- (-1997.447) (-1993.044) [-1983.163] (-1991.135) * (-1982.923) (-1991.541) (-1990.247) [-1988.823] -- 0:02:38
508200 -- (-2002.471) [-1987.761] (-1990.224) (-1994.677) * [-1984.927] (-1991.767) (-1986.510) (-1987.982) -- 0:02:38
508300 -- (-1998.396) (-1993.085) (-1985.944) [-1987.106] * [-1981.310] (-1992.056) (-1986.187) (-1988.979) -- 0:02:38
508400 -- (-2002.182) [-1990.945] (-1984.118) (-1993.940) * (-1980.475) (-1995.660) [-1987.690] (-1990.566) -- 0:02:38
508500 -- (-2002.956) (-1992.564) (-1986.984) [-1988.388] * [-1979.350] (-1999.692) (-1985.328) (-1986.071) -- 0:02:38
508600 -- (-1999.801) (-1993.207) (-1995.711) [-1988.009] * [-1984.029] (-1997.224) (-1985.049) (-1991.576) -- 0:02:38
508700 -- (-1995.853) (-1992.259) [-1986.772] (-1994.766) * (-1983.120) (-2002.941) (-1988.726) [-1990.310] -- 0:02:38
508800 -- [-1992.128] (-1993.385) (-1990.206) (-1993.463) * [-1982.405] (-1995.841) (-1988.127) (-1991.972) -- 0:02:38
508900 -- [-1984.647] (-1994.646) (-1987.039) (-1991.564) * (-1987.124) [-1988.865] (-1992.796) (-1994.176) -- 0:02:38
509000 -- (-1984.959) (-1992.012) [-1987.532] (-1990.771) * (-1985.851) [-1987.878] (-1994.034) (-1990.589) -- 0:02:38
Average standard deviation of split frequencies: 0.003386
509100 -- [-1983.623] (-1995.707) (-1994.374) (-1992.045) * (-1988.450) (-1994.267) [-1988.975] (-1991.235) -- 0:02:38
509200 -- (-1982.021) (-1993.542) (-1992.891) [-1987.413] * (-1987.271) (-1990.912) [-1987.758] (-1993.866) -- 0:02:38
509300 -- (-1986.923) (-1991.902) [-1983.791] (-1994.209) * [-1993.938] (-1992.135) (-1993.974) (-1998.659) -- 0:02:38
509400 -- (-1987.726) [-1994.891] (-1986.776) (-1992.539) * (-1987.572) (-1997.726) (-1989.013) [-1992.338] -- 0:02:37
509500 -- (-1986.851) (-1988.700) [-1983.385] (-1997.641) * (-1987.309) (-1996.382) [-1986.969] (-1986.044) -- 0:02:38
509600 -- [-1991.294] (-1988.989) (-1984.942) (-1997.112) * [-1989.689] (-1996.957) (-1988.620) (-1988.117) -- 0:02:38
509700 -- [-1983.814] (-1990.838) (-1984.046) (-2003.037) * [-1986.920] (-1992.919) (-1987.407) (-1991.317) -- 0:02:38
509800 -- (-1982.298) (-1990.570) [-1989.359] (-1994.779) * (-1988.481) [-1989.389] (-1987.075) (-1994.052) -- 0:02:38
509900 -- (-1981.196) (-1997.099) [-1976.792] (-2001.199) * [-1990.907] (-1992.874) (-1990.560) (-1994.972) -- 0:02:38
510000 -- (-1982.942) (-2003.457) [-1979.958] (-1999.713) * (-1994.506) [-1990.929] (-1991.628) (-1986.301) -- 0:02:38
Average standard deviation of split frequencies: 0.003591
510100 -- [-1983.217] (-2004.426) (-1982.358) (-1986.282) * (-1992.423) (-1991.676) (-1996.444) [-1990.979] -- 0:02:38
510200 -- (-1988.610) (-2004.998) [-1980.401] (-1989.843) * [-1981.347] (-1998.980) (-1995.198) (-1992.289) -- 0:02:38
510300 -- (-1995.846) (-2006.052) [-1982.828] (-1992.981) * [-1981.713] (-2002.575) (-1994.432) (-1999.354) -- 0:02:38
510400 -- (-1987.615) (-2000.142) [-1982.738] (-1991.283) * (-1985.466) [-1995.596] (-1999.312) (-1998.737) -- 0:02:38
510500 -- (-1991.061) (-1997.127) [-1979.797] (-1987.449) * (-1992.096) (-1993.478) (-1996.927) [-1995.025] -- 0:02:38
510600 -- (-1993.579) (-2007.650) (-1985.272) [-1986.187] * [-1989.813] (-1993.848) (-1993.404) (-2001.862) -- 0:02:38
510700 -- (-1987.454) (-2007.016) [-1989.052] (-1992.856) * [-1980.510] (-1988.872) (-1993.829) (-2003.917) -- 0:02:38
510800 -- (-1983.245) (-1999.250) [-1980.658] (-1994.684) * (-1985.253) (-1989.905) [-1992.652] (-1994.070) -- 0:02:38
510900 -- [-1984.226] (-2009.120) (-1979.941) (-1993.292) * [-1990.090] (-1989.763) (-1986.947) (-1996.479) -- 0:02:37
511000 -- [-1981.167] (-2010.960) (-1980.026) (-1995.591) * [-1985.421] (-1993.631) (-1989.814) (-1992.935) -- 0:02:37
Average standard deviation of split frequencies: 0.003583
511100 -- (-1981.545) (-2003.699) [-1987.549] (-1993.652) * (-1985.297) (-1998.247) (-1991.512) [-1992.136] -- 0:02:37
511200 -- (-1986.056) (-1995.511) [-1988.715] (-1995.318) * [-1985.925] (-1995.462) (-1990.296) (-1996.109) -- 0:02:37
511300 -- [-1984.057] (-1988.872) (-1984.874) (-1994.887) * [-1985.208] (-1996.242) (-1991.676) (-1997.971) -- 0:02:37
511400 -- (-1983.098) (-1990.415) [-1980.066] (-1999.327) * [-1984.346] (-2007.159) (-1991.715) (-1995.077) -- 0:02:37
511500 -- (-1985.782) (-1989.059) [-1977.119] (-1994.620) * [-1984.745] (-1999.736) (-1999.071) (-1998.589) -- 0:02:37
511600 -- [-1981.298] (-1988.382) (-1978.167) (-1990.704) * [-1983.497] (-2001.401) (-1997.402) (-1995.029) -- 0:02:37
511700 -- [-1982.577] (-1992.047) (-1980.853) (-1993.139) * [-1985.563] (-2003.109) (-1995.792) (-1990.682) -- 0:02:37
511800 -- [-1979.516] (-1993.241) (-1984.214) (-1988.753) * [-1989.614] (-1992.680) (-1997.342) (-1986.620) -- 0:02:37
511900 -- [-1977.095] (-1994.605) (-1989.860) (-1991.403) * [-1982.424] (-1994.225) (-1993.176) (-1993.135) -- 0:02:37
512000 -- [-1976.312] (-1990.365) (-1983.908) (-1994.041) * (-1984.321) (-1995.599) (-2000.989) [-1993.071] -- 0:02:37
Average standard deviation of split frequencies: 0.003603
512100 -- [-1979.956] (-1997.058) (-1981.942) (-1991.295) * [-1982.980] (-1989.952) (-2013.603) (-1993.849) -- 0:02:37
512200 -- [-1984.964] (-1995.485) (-1982.427) (-1995.279) * [-1982.208] (-1992.750) (-2007.163) (-1990.090) -- 0:02:37
512300 -- (-1984.463) (-1995.473) [-1982.241] (-2000.394) * [-1986.794] (-1999.934) (-1997.547) (-1987.799) -- 0:02:37
512400 -- [-1978.629] (-2003.659) (-1987.712) (-2001.708) * [-1981.706] (-2001.632) (-1991.487) (-1988.694) -- 0:02:37
512500 -- [-1981.143] (-1994.061) (-1984.798) (-1997.043) * (-1984.929) (-2004.362) (-1995.948) [-1983.916] -- 0:02:36
512600 -- [-1976.476] (-1990.957) (-1992.259) (-1997.722) * [-1982.406] (-2001.650) (-1999.746) (-1985.176) -- 0:02:37
512700 -- [-1978.503] (-1994.584) (-2000.184) (-1999.571) * [-1982.487] (-1992.331) (-2001.351) (-1993.003) -- 0:02:37
512800 -- [-1982.459] (-1993.011) (-2002.112) (-1998.205) * [-1981.508] (-1994.491) (-2004.682) (-1989.387) -- 0:02:37
512900 -- (-1989.498) (-2003.370) (-1992.281) [-1993.132] * [-1983.926] (-1999.894) (-2020.035) (-1988.768) -- 0:02:37
513000 -- [-1983.567] (-1999.169) (-2003.725) (-1996.826) * [-1986.852] (-1997.950) (-2007.360) (-2004.674) -- 0:02:37
Average standard deviation of split frequencies: 0.003438
513100 -- [-1980.109] (-1994.837) (-2012.733) (-2003.201) * [-1988.147] (-1992.874) (-2001.889) (-1996.467) -- 0:02:37
513200 -- [-1981.692] (-1997.408) (-2004.252) (-2002.626) * (-1988.064) [-1991.971] (-1998.738) (-1994.171) -- 0:02:37
513300 -- [-1988.106] (-1994.104) (-1996.437) (-2002.745) * [-1986.930] (-1989.828) (-1992.734) (-1982.397) -- 0:02:37
513400 -- (-1983.860) [-1992.245] (-1985.737) (-2009.777) * (-1984.056) [-1989.172] (-1986.933) (-1986.695) -- 0:02:37
513500 -- [-1981.909] (-1992.795) (-1991.793) (-2007.596) * (-1985.652) (-1993.736) [-1987.403] (-1986.726) -- 0:02:37
513600 -- [-1981.802] (-1995.936) (-1987.409) (-2007.471) * (-1992.324) (-1995.044) (-1989.059) [-1988.955] -- 0:02:37
513700 -- (-1986.680) (-1996.383) [-1986.557] (-2009.102) * [-1983.543] (-2013.024) (-1984.366) (-1994.160) -- 0:02:37
513800 -- (-1987.730) (-1990.099) [-1987.718] (-1999.896) * [-1982.956] (-2002.245) (-1987.745) (-1991.692) -- 0:02:37
513900 -- (-1982.879) [-1988.485] (-1994.792) (-2002.584) * [-1984.901] (-2004.539) (-1986.591) (-1987.203) -- 0:02:37
514000 -- [-1987.497] (-1993.887) (-1996.253) (-1990.446) * (-1989.431) (-2002.501) [-1986.618] (-1990.171) -- 0:02:36
Average standard deviation of split frequencies: 0.003432
514100 -- (-1988.279) [-1990.378] (-1991.803) (-1995.695) * (-1994.150) (-1999.702) [-1988.397] (-1994.279) -- 0:02:36
514200 -- [-1982.178] (-1985.022) (-1995.608) (-1999.154) * (-1998.750) (-1996.158) [-1988.117] (-1995.525) -- 0:02:36
514300 -- [-1982.195] (-1984.936) (-1992.878) (-2010.575) * (-1993.934) (-1992.948) (-1989.371) [-1995.534] -- 0:02:36
514400 -- [-1984.338] (-1986.327) (-1996.490) (-2001.021) * (-1985.644) (-1993.906) [-1984.574] (-1999.976) -- 0:02:36
514500 -- [-1982.464] (-1986.828) (-1995.077) (-1993.929) * (-1987.204) [-1991.702] (-1985.463) (-1998.781) -- 0:02:36
514600 -- [-1982.938] (-1985.515) (-1989.212) (-1997.225) * (-1984.704) (-1989.130) [-1992.721] (-1997.219) -- 0:02:36
514700 -- [-1984.581] (-1992.690) (-1988.571) (-1996.385) * [-1990.486] (-1988.136) (-1996.925) (-1996.253) -- 0:02:36
514800 -- (-1990.175) (-2003.379) [-1986.827] (-1992.340) * (-1999.377) (-1991.468) [-1996.829] (-1996.787) -- 0:02:36
514900 -- (-1988.867) (-2006.415) (-1988.346) [-1993.411] * (-1990.561) [-1990.898] (-1992.409) (-1995.787) -- 0:02:36
515000 -- [-1988.005] (-2000.161) (-1985.861) (-1999.755) * (-1997.907) (-1987.984) [-1991.276] (-1994.860) -- 0:02:36
Average standard deviation of split frequencies: 0.003555
515100 -- [-1980.454] (-1991.821) (-1995.550) (-2000.690) * (-1992.283) (-1987.131) (-1995.049) [-1991.446] -- 0:02:36
515200 -- [-1980.810] (-1991.784) (-1991.741) (-2000.785) * [-1992.201] (-1991.272) (-2003.202) (-1994.603) -- 0:02:36
515300 -- (-1983.485) [-1985.486] (-1990.197) (-1999.772) * (-1992.761) [-1986.004] (-1991.242) (-1991.678) -- 0:02:36
515400 -- (-1986.588) (-1989.994) [-1986.090] (-2005.665) * (-1992.130) [-1991.931] (-1994.093) (-2000.796) -- 0:02:36
515500 -- [-1984.717] (-1990.601) (-1989.789) (-1995.673) * (-2012.144) [-1989.226] (-1990.380) (-2014.823) -- 0:02:36
515600 -- [-1990.862] (-1992.196) (-1993.207) (-1990.469) * (-1997.899) (-1989.090) [-1991.689] (-1992.217) -- 0:02:36
515700 -- [-1982.939] (-1995.835) (-1993.368) (-1983.061) * (-2002.671) (-1987.250) [-1990.515] (-1986.631) -- 0:02:36
515800 -- [-1982.268] (-1995.760) (-1984.422) (-1991.314) * [-1992.372] (-1985.889) (-1988.607) (-1985.546) -- 0:02:36
515900 -- (-1983.694) (-1997.040) [-1990.248] (-1991.764) * (-1989.959) (-1996.123) (-1992.724) [-1985.221] -- 0:02:36
516000 -- [-1985.946] (-1995.409) (-1990.355) (-1991.830) * [-1984.321] (-1990.053) (-1985.622) (-1990.718) -- 0:02:36
Average standard deviation of split frequencies: 0.003392
516100 -- [-1995.570] (-2001.299) (-1991.053) (-1989.721) * (-1988.917) (-1988.363) [-1986.569] (-1992.040) -- 0:02:36
516200 -- [-1986.724] (-1999.228) (-1991.496) (-1993.417) * (-1992.371) [-1987.571] (-1988.944) (-2003.571) -- 0:02:36
516300 -- (-1990.930) (-2007.863) [-1988.358] (-1998.729) * [-1988.364] (-1989.273) (-1989.726) (-1998.623) -- 0:02:36
516400 -- [-1988.777] (-2009.793) (-1983.937) (-1997.579) * [-1993.773] (-2004.419) (-1988.385) (-1997.865) -- 0:02:36
516500 -- [-1985.986] (-1995.692) (-1982.335) (-1992.215) * (-1999.206) (-1998.022) [-1989.493] (-1989.062) -- 0:02:36
516600 -- [-1982.731] (-1990.154) (-1989.083) (-1993.956) * (-1997.886) (-1992.601) (-1991.662) [-1988.432] -- 0:02:36
516700 -- (-1982.808) (-1988.935) [-1988.156] (-1986.638) * (-1991.955) (-1992.282) (-2001.087) [-1985.047] -- 0:02:36
516800 -- [-1979.616] (-1993.326) (-1989.095) (-1989.355) * (-1996.877) (-1993.078) (-1995.761) [-1986.373] -- 0:02:36
516900 -- [-1983.270] (-1997.358) (-1996.397) (-1991.018) * (-1996.414) (-1995.946) (-1999.849) [-1980.288] -- 0:02:36
517000 -- [-1982.467] (-1992.203) (-1991.664) (-1993.244) * (-1989.233) (-2000.386) (-1997.141) [-1984.528] -- 0:02:36
Average standard deviation of split frequencies: 0.003255
517100 -- (-1980.653) (-1993.315) (-1996.702) [-1993.710] * (-1990.631) (-1996.870) (-1997.455) [-1982.700] -- 0:02:35
517200 -- [-1987.068] (-2008.935) (-1994.601) (-2004.517) * [-1988.893] (-1994.554) (-2004.039) (-1989.870) -- 0:02:35
517300 -- [-1984.445] (-2009.295) (-1995.082) (-1995.094) * (-1995.582) (-1988.950) (-1993.249) [-1983.025] -- 0:02:35
517400 -- [-1982.622] (-1998.769) (-1995.564) (-1998.661) * (-1990.793) (-1992.034) (-1992.900) [-1981.879] -- 0:02:35
517500 -- [-1981.564] (-1995.043) (-2002.767) (-2000.208) * (-1995.434) (-1997.172) (-1993.403) [-1985.618] -- 0:02:35
517600 -- (-1984.309) (-1989.962) (-2015.488) [-1995.820] * (-1994.884) (-1992.071) (-1995.641) [-1983.880] -- 0:02:35
517700 -- [-1988.337] (-2001.556) (-1997.507) (-1994.814) * (-1992.415) (-1994.228) (-1992.675) [-1987.204] -- 0:02:35
517800 -- [-1981.679] (-1994.569) (-1999.129) (-2006.507) * (-1982.725) (-2000.309) (-1997.626) [-1987.464] -- 0:02:35
517900 -- [-1981.872] (-1992.699) (-2006.083) (-1998.598) * [-1982.158] (-2000.872) (-1991.412) (-1983.072) -- 0:02:35
518000 -- (-1991.920) [-1996.761] (-1998.877) (-1992.191) * (-1992.078) (-2003.489) (-1990.844) [-1980.835] -- 0:02:35
Average standard deviation of split frequencies: 0.003327
518100 -- (-1989.424) (-1994.594) (-2000.209) [-1992.291] * (-1988.649) (-2005.613) (-1986.815) [-1982.029] -- 0:02:35
518200 -- [-1987.647] (-1990.831) (-1994.878) (-1995.822) * (-1987.306) (-2001.281) (-1994.582) [-1983.363] -- 0:02:35
518300 -- [-1980.932] (-1990.551) (-1990.634) (-2003.281) * [-1987.520] (-2000.491) (-1999.611) (-1984.575) -- 0:02:35
518400 -- [-1980.857] (-1991.691) (-1989.888) (-1998.523) * (-1992.329) (-1995.772) (-1997.973) [-1984.326] -- 0:02:35
518500 -- (-1986.987) [-1992.019] (-1988.794) (-1990.748) * (-1989.514) (-2002.094) [-1989.631] (-1990.182) -- 0:02:35
518600 -- [-1980.575] (-1993.170) (-1986.477) (-1987.669) * [-1991.083] (-1996.610) (-1986.877) (-1985.054) -- 0:02:35
518700 -- (-1992.102) (-1995.580) (-1988.875) [-1987.290] * (-1986.534) (-2004.614) (-1990.689) [-1984.216] -- 0:02:35
518800 -- (-1989.268) (-1990.824) [-1984.362] (-1988.883) * (-1992.115) (-1996.617) [-1985.987] (-1987.416) -- 0:02:35
518900 -- [-1984.879] (-2013.590) (-1984.216) (-2001.094) * (-1984.737) (-1989.420) (-1985.870) [-1985.178] -- 0:02:35
519000 -- [-1981.768] (-1994.886) (-1989.064) (-2004.170) * [-1980.081] (-1994.464) (-1997.979) (-1983.774) -- 0:02:35
Average standard deviation of split frequencies: 0.003243
519100 -- [-1981.459] (-1994.905) (-1997.848) (-1996.618) * (-1980.111) (-1992.945) (-1997.607) [-1982.842] -- 0:02:35
519200 -- [-1983.323] (-1997.925) (-1995.029) (-2000.040) * (-1983.603) (-1988.520) (-1990.385) [-1980.378] -- 0:02:35
519300 -- (-1985.010) (-1994.162) [-1995.304] (-1993.510) * [-1984.311] (-1990.194) (-1991.743) (-1983.508) -- 0:02:35
519400 -- [-1988.172] (-2009.929) (-1991.515) (-1996.104) * (-1994.475) (-1994.966) (-1992.930) [-1987.085] -- 0:02:35
519500 -- [-1983.168] (-2015.297) (-1989.038) (-1993.059) * [-1989.524] (-1996.569) (-1993.509) (-1985.102) -- 0:02:35
519600 -- [-1987.643] (-2020.827) (-1993.937) (-1994.548) * [-1985.455] (-1999.496) (-1992.916) (-1986.260) -- 0:02:35
519700 -- [-1988.638] (-2012.803) (-1993.546) (-1991.279) * (-1988.643) (-2019.694) (-1993.856) [-1984.769] -- 0:02:35
519800 -- [-1982.302] (-2006.975) (-1988.835) (-1992.062) * (-1986.329) (-2003.575) [-1986.216] (-1988.535) -- 0:02:35
519900 -- (-1986.780) (-1998.829) [-1989.397] (-1991.829) * (-1987.091) (-1997.280) (-1993.763) [-1990.212] -- 0:02:35
520000 -- (-1990.215) (-2004.801) [-1991.775] (-1985.631) * [-1986.208] (-2005.225) (-1994.465) (-1986.979) -- 0:02:35
Average standard deviation of split frequencies: 0.003289
520100 -- (-1993.382) (-2014.443) (-1998.047) [-1983.848] * (-1985.149) (-2003.762) (-1992.929) [-1988.464] -- 0:02:35
520200 -- (-1981.661) (-1996.493) (-1987.667) [-1980.619] * [-1988.986] (-1996.234) (-1997.111) (-1980.790) -- 0:02:34
520300 -- [-1983.971] (-1994.573) (-1993.901) (-1994.448) * (-1986.357) (-1994.093) (-1999.043) [-1982.362] -- 0:02:34
520400 -- (-1983.321) (-1995.462) [-1990.453] (-1994.489) * [-1983.465] (-1993.205) (-2003.960) (-1981.154) -- 0:02:34
520500 -- [-1983.824] (-1992.302) (-1994.735) (-1991.465) * [-1983.624] (-1990.424) (-2008.346) (-1985.387) -- 0:02:34
520600 -- [-1982.176] (-2000.448) (-1995.920) (-1990.653) * [-1986.735] (-1990.589) (-2012.442) (-1986.154) -- 0:02:34
520700 -- [-1983.204] (-2006.064) (-1989.985) (-1993.322) * (-1989.493) [-1990.686] (-2011.614) (-1986.511) -- 0:02:34
520800 -- [-1980.707] (-2005.007) (-1992.031) (-1993.146) * (-1995.881) (-1992.572) (-2006.453) [-1984.171] -- 0:02:34
520900 -- [-1983.052] (-2005.346) (-1980.595) (-2000.633) * (-1997.971) (-1992.731) (-1999.776) [-1985.354] -- 0:02:34
521000 -- [-1983.329] (-2005.120) (-1982.712) (-1997.325) * (-1994.439) (-1990.593) (-2000.771) [-1984.433] -- 0:02:34
Average standard deviation of split frequencies: 0.003385
521100 -- (-1983.479) (-2008.355) [-1976.379] (-1996.832) * (-1989.789) (-1987.469) (-1994.779) [-1980.419] -- 0:02:34
521200 -- (-1981.867) (-2001.252) [-1978.685] (-2006.062) * (-1993.282) [-1987.789] (-1998.133) (-1982.506) -- 0:02:34
521300 -- [-1978.709] (-2002.331) (-1987.685) (-1998.934) * (-1988.732) (-1988.304) (-1995.816) [-1982.034] -- 0:02:34
521400 -- [-1987.392] (-1996.320) (-1989.835) (-2000.808) * (-1988.105) (-1987.157) (-1990.551) [-1978.956] -- 0:02:34
521500 -- [-1985.013] (-1992.853) (-1983.181) (-1993.819) * (-1993.356) (-1987.108) (-1997.315) [-1979.120] -- 0:02:34
521600 -- [-1983.029] (-1987.890) (-1981.813) (-1989.407) * (-1993.025) (-1994.516) (-1996.530) [-1978.721] -- 0:02:34
521700 -- (-1979.330) [-1991.776] (-1979.643) (-1986.627) * (-1993.049) (-1997.142) (-2003.702) [-1980.204] -- 0:02:34
521800 -- (-1977.889) (-1992.988) [-1981.467] (-1986.542) * [-1984.847] (-1992.727) (-1992.460) (-1984.344) -- 0:02:34
521900 -- (-1981.747) (-1995.721) [-1981.495] (-1983.745) * [-1985.286] (-1998.209) (-1993.691) (-1994.079) -- 0:02:34
522000 -- [-1981.246] (-1991.507) (-1982.351) (-1986.505) * (-1987.795) (-1989.774) (-1997.527) [-1983.446] -- 0:02:34
Average standard deviation of split frequencies: 0.003457
522100 -- (-1987.865) (-1992.287) (-1982.159) [-1988.116] * [-1982.343] (-1997.777) (-1993.642) (-1983.963) -- 0:02:34
522200 -- [-1988.275] (-1996.517) (-1985.081) (-1985.911) * [-1985.146] (-1996.408) (-1995.323) (-1979.412) -- 0:02:34
522300 -- [-1984.551] (-1995.356) (-1990.621) (-1990.639) * [-1979.248] (-1993.579) (-1989.749) (-1981.356) -- 0:02:34
522400 -- (-1987.283) (-1997.338) [-1988.829] (-1994.574) * [-1977.911] (-1995.342) (-1989.421) (-1984.969) -- 0:02:34
522500 -- [-1978.759] (-1994.534) (-1982.127) (-1997.171) * [-1978.631] (-2000.275) (-1992.970) (-1991.066) -- 0:02:34
522600 -- [-1984.105] (-1993.599) (-1982.975) (-1997.877) * [-1980.246] (-1992.735) (-1994.462) (-1991.237) -- 0:02:34
522700 -- [-1982.090] (-1994.608) (-1986.154) (-1996.344) * (-1983.752) (-1997.189) (-1996.357) [-1981.036] -- 0:02:34
522800 -- [-1979.225] (-2000.838) (-1987.719) (-1998.656) * (-1989.785) (-1990.154) (-1996.084) [-1985.310] -- 0:02:34
522900 -- (-1979.851) (-2010.002) (-1986.908) [-1988.243] * (-1988.968) (-1993.053) [-1994.724] (-1982.990) -- 0:02:34
523000 -- [-1984.822] (-2013.412) (-1988.328) (-1987.680) * (-1992.570) [-1986.034] (-1999.114) (-1983.458) -- 0:02:34
Average standard deviation of split frequencies: 0.003398
523100 -- (-1987.662) (-2014.138) [-1984.432] (-1987.475) * (-1989.060) (-1989.555) (-2010.051) [-1983.215] -- 0:02:34
523200 -- [-1988.092] (-2001.501) (-1985.289) (-1988.992) * (-1988.672) [-1988.485] (-1996.926) (-1984.857) -- 0:02:34
523300 -- (-1991.639) (-2001.295) (-1987.907) [-1987.828] * [-1984.309] (-1992.856) (-1996.036) (-1983.903) -- 0:02:33
523400 -- (-1985.544) (-1995.103) (-1987.391) [-1985.926] * [-1981.685] (-1990.028) (-1994.779) (-1987.822) -- 0:02:33
523500 -- (-1986.802) (-1996.030) (-1987.450) [-1985.118] * (-1983.470) (-1993.079) [-1996.511] (-1989.329) -- 0:02:33
523600 -- (-1988.048) (-1999.821) (-1991.596) [-1984.250] * (-1986.491) (-1996.522) (-1995.997) [-1984.807] -- 0:02:33
523700 -- (-1984.935) (-2003.620) (-1992.485) [-1983.663] * (-1984.574) [-1993.177] (-1993.475) (-1991.543) -- 0:02:33
523800 -- (-1987.271) (-1994.642) (-1994.715) [-1982.292] * [-1984.948] (-1991.800) (-1994.034) (-1989.245) -- 0:02:33
523900 -- [-1991.080] (-2009.571) (-1995.458) (-1981.620) * [-1989.439] (-1990.727) (-2001.354) (-1990.506) -- 0:02:33
524000 -- [-1984.846] (-2000.512) (-1996.211) (-1988.209) * (-1994.236) (-1992.159) (-2002.780) [-1985.027] -- 0:02:33
Average standard deviation of split frequencies: 0.003366
524100 -- [-1981.511] (-2006.981) (-1992.421) (-1985.334) * (-1987.144) (-1995.664) (-2005.095) [-1983.252] -- 0:02:33
524200 -- (-1983.426) (-2014.829) (-2001.649) [-1978.582] * [-1980.081] (-1987.917) (-1993.510) (-1986.529) -- 0:02:33
524300 -- (-1981.428) (-2004.724) (-1996.588) [-1979.307] * [-1980.588] (-1997.452) (-2003.451) (-1981.951) -- 0:02:33
524400 -- (-1988.137) (-2001.070) (-2006.358) [-1982.910] * (-1980.357) (-1990.392) (-2000.662) [-1988.532] -- 0:02:33
524500 -- (-1981.737) (-1998.624) (-1997.425) [-1978.909] * [-1978.306] (-1996.708) (-1994.435) (-1986.922) -- 0:02:33
524600 -- (-1984.342) (-1992.327) (-1999.866) [-1979.022] * [-1979.467] (-1999.529) (-1994.164) (-1985.413) -- 0:02:33
524700 -- [-1979.691] (-1989.935) (-2004.960) (-1988.062) * [-1982.509] (-2013.004) (-1987.104) (-1986.595) -- 0:02:33
524800 -- (-1980.274) [-1983.779] (-2003.450) (-1991.499) * [-1982.902] (-2002.865) (-1989.912) (-1981.850) -- 0:02:33
524900 -- [-1985.696] (-1987.680) (-2004.636) (-1989.447) * (-1981.794) (-2015.362) (-1991.238) [-1987.776] -- 0:02:33
525000 -- [-1989.044] (-1990.251) (-1994.610) (-1993.460) * (-1982.214) (-2004.371) (-1990.635) [-1990.840] -- 0:02:33
Average standard deviation of split frequencies: 0.003462
525100 -- (-1991.807) (-1994.230) [-1989.839] (-1988.099) * (-1983.178) (-2022.217) [-1991.242] (-1986.069) -- 0:02:33
525200 -- (-1987.761) (-1990.055) [-1986.969] (-1986.726) * (-1982.785) (-2017.031) (-1993.924) [-1988.151] -- 0:02:33
525300 -- (-1984.871) (-1996.199) (-1990.274) [-1983.956] * [-1980.761] (-2007.839) (-1999.508) (-1991.165) -- 0:02:33
525400 -- [-1982.547] (-1990.007) (-1994.427) (-1988.712) * [-1980.331] (-2008.285) (-1989.586) (-1987.482) -- 0:02:33
525500 -- [-1987.418] (-1991.305) (-2001.839) (-1989.224) * (-1982.819) (-1999.392) [-1990.005] (-1995.740) -- 0:02:33
525600 -- (-1991.788) (-1991.182) (-2002.885) [-1988.520] * [-1979.398] (-1997.193) (-1989.284) (-1990.900) -- 0:02:33
525700 -- (-1992.369) [-1990.641] (-1998.710) (-1985.084) * [-1982.912] (-1987.434) (-1986.698) (-1992.367) -- 0:02:33
525800 -- (-1992.042) (-1987.852) [-1989.983] (-1987.846) * [-1981.189] (-1993.160) (-1991.842) (-1989.415) -- 0:02:33
525900 -- [-1983.750] (-1985.036) (-1995.645) (-1990.239) * [-1984.413] (-1992.567) (-1995.757) (-1996.638) -- 0:02:33
526000 -- (-1996.667) (-1990.905) (-1993.951) [-1988.080] * [-1987.391] (-1991.023) (-1991.361) (-1998.388) -- 0:02:33
Average standard deviation of split frequencies: 0.003226
526100 -- (-1995.706) (-1994.993) (-1985.583) [-1990.708] * [-1980.431] (-1987.688) (-1990.563) (-1990.433) -- 0:02:33
526200 -- (-1999.419) (-1997.287) [-1990.922] (-1996.785) * [-1983.042] (-1994.903) (-1992.964) (-1998.830) -- 0:02:33
526300 -- (-1998.945) [-1995.116] (-1997.872) (-2000.651) * (-1986.842) [-1986.332] (-1992.848) (-2004.309) -- 0:02:33
526400 -- (-1996.977) (-1999.813) [-1990.586] (-1997.089) * (-1995.762) (-1991.246) (-1991.209) [-1999.609] -- 0:02:32
526500 -- (-1999.073) [-1991.830] (-1997.049) (-1992.365) * (-2007.956) (-1990.684) [-1990.690] (-1997.429) -- 0:02:32
526600 -- (-1995.935) [-1986.954] (-2000.742) (-1990.382) * (-1989.829) [-1984.179] (-1989.632) (-1991.540) -- 0:02:32
526700 -- (-1991.689) (-1987.179) (-1993.434) [-1984.956] * [-1986.897] (-1982.745) (-1989.369) (-2004.047) -- 0:02:32
526800 -- (-1993.455) (-1992.162) (-1990.376) [-1986.698] * (-1989.463) [-1986.143] (-1987.182) (-1990.256) -- 0:02:32
526900 -- (-1992.250) (-1995.090) (-1989.254) [-1980.288] * [-1982.826] (-1985.818) (-1995.962) (-1988.487) -- 0:02:32
527000 -- (-1990.765) (-2004.051) (-1981.628) [-1982.867] * [-1981.788] (-1991.828) (-1993.262) (-1990.397) -- 0:02:32
Average standard deviation of split frequencies: 0.003219
527100 -- [-1989.838] (-2001.738) (-1991.569) (-1992.715) * [-1988.240] (-1996.439) (-1999.321) (-2000.405) -- 0:02:32
527200 -- (-1993.707) (-2001.743) (-1993.390) [-1985.488] * [-1987.153] (-2001.454) (-1996.390) (-1993.468) -- 0:02:32
527300 -- (-1987.715) (-2000.582) (-2001.821) [-1976.647] * [-1987.867] (-2002.193) (-1995.518) (-1988.892) -- 0:02:32
527400 -- (-1994.834) (-1998.819) (-1996.972) [-1979.796] * [-1983.352] (-2006.351) (-1997.772) (-1991.864) -- 0:02:32
527500 -- (-1995.583) (-2008.181) (-1995.114) [-1983.370] * [-1981.981] (-2000.192) (-2000.937) (-1992.177) -- 0:02:32
527600 -- (-1988.073) (-2004.099) (-1992.323) [-1982.636] * (-1981.172) (-1991.645) [-1992.262] (-1996.527) -- 0:02:32
527700 -- (-1985.099) (-2004.950) (-1987.061) [-1984.011] * (-1988.577) (-1996.480) [-1988.120] (-1993.796) -- 0:02:32
527800 -- (-1987.446) (-1989.354) (-1989.080) [-1984.307] * [-1981.642] (-2001.487) (-1999.555) (-1991.478) -- 0:02:32
527900 -- [-1978.716] (-1987.978) (-1985.814) (-1984.829) * [-1978.809] (-1994.804) (-1999.643) (-1998.631) -- 0:02:32
528000 -- (-1983.592) (-1986.772) (-1982.190) [-1981.233] * [-1980.723] (-2000.196) (-2015.618) (-1997.171) -- 0:02:32
Average standard deviation of split frequencies: 0.003213
528100 -- (-1985.994) (-1987.592) [-1990.710] (-1985.562) * [-1979.498] (-1993.117) (-1993.334) (-1990.146) -- 0:02:32
528200 -- (-1991.531) (-1987.663) (-1990.914) [-1980.931] * [-1981.090] (-1991.386) (-2000.656) (-1993.630) -- 0:02:32
528300 -- (-1997.157) (-1991.946) (-1991.581) [-1982.644] * [-1982.580] (-1996.914) (-1992.622) (-1993.015) -- 0:02:32
528400 -- (-1995.462) [-1985.341] (-1983.292) (-1980.649) * [-1983.523] (-1994.957) (-1996.118) (-1988.965) -- 0:02:32
528500 -- (-1996.880) (-1986.106) (-1982.057) [-1980.470] * (-1992.034) (-1997.651) (-1999.555) [-1984.237] -- 0:02:32
528600 -- (-1992.150) (-1991.509) (-1987.147) [-1979.846] * [-1991.763] (-1996.548) (-1988.852) (-1987.187) -- 0:02:32
528700 -- (-1995.788) (-1986.535) (-1988.845) [-1979.601] * (-2001.965) (-1987.768) [-1987.437] (-1995.802) -- 0:02:32
528800 -- (-1981.959) (-1995.306) [-1983.595] (-1984.638) * (-1996.138) (-1991.820) (-1984.948) [-1990.088] -- 0:02:32
528900 -- (-1988.203) (-2000.578) (-1986.411) [-1980.009] * (-1989.809) (-1988.910) (-1989.016) [-1986.013] -- 0:02:32
529000 -- (-1983.378) (-2005.803) (-1990.719) [-1980.626] * [-1990.679] (-1991.183) (-1997.695) (-1988.480) -- 0:02:32
Average standard deviation of split frequencies: 0.003156
529100 -- [-1986.863] (-1998.996) (-1990.885) (-1982.213) * (-1989.143) (-1990.341) (-1992.828) [-1984.123] -- 0:02:32
529200 -- [-1981.100] (-1997.245) (-1992.404) (-1981.909) * (-1987.967) (-1991.855) (-1996.043) [-1984.702] -- 0:02:32
529300 -- (-1981.651) (-1995.985) [-1983.090] (-1980.515) * [-1985.154] (-1993.118) (-1987.830) (-1992.564) -- 0:02:32
529400 -- (-1983.646) (-1998.040) (-1982.755) [-1979.162] * (-1982.385) (-1997.293) [-1984.166] (-1987.038) -- 0:02:32
529500 -- (-1986.029) (-1998.236) [-1979.959] (-1983.899) * [-1985.596] (-1994.645) (-1984.735) (-1993.933) -- 0:02:31
529600 -- [-1985.655] (-1988.708) (-1982.640) (-1987.667) * (-1987.133) (-1988.828) (-1985.464) [-1988.898] -- 0:02:31
529700 -- [-1988.988] (-1989.576) (-1984.866) (-1988.431) * (-1989.526) (-1990.670) [-1983.146] (-1985.659) -- 0:02:31
529800 -- (-1990.644) (-1991.385) [-1991.520] (-1989.063) * (-1989.851) [-1987.238] (-1989.165) (-1988.229) -- 0:02:31
529900 -- (-1986.488) (-1990.545) [-1980.104] (-1992.576) * (-1988.694) (-1986.519) [-1987.645] (-1991.038) -- 0:02:31
530000 -- (-1986.176) (-1994.270) [-1985.185] (-1987.573) * (-1985.656) [-1988.479] (-1990.023) (-1991.156) -- 0:02:31
Average standard deviation of split frequencies: 0.003303
530100 -- (-1988.416) [-1989.997] (-1989.292) (-1992.180) * [-1985.403] (-1994.177) (-1990.022) (-1989.585) -- 0:02:31
530200 -- (-1985.562) (-1987.966) [-1984.864] (-1983.677) * (-1990.376) (-1993.708) (-1995.096) [-1989.281] -- 0:02:31
530300 -- (-1994.427) (-1992.972) (-1989.204) [-1984.562] * (-1990.673) [-1991.104] (-1996.157) (-1993.390) -- 0:02:31
530400 -- (-1990.772) (-1991.957) (-2006.982) [-1987.250] * (-1991.574) (-1992.329) (-2005.249) [-1987.253] -- 0:02:31
530500 -- (-1992.965) [-1988.370] (-1995.912) (-1991.964) * (-1991.754) (-1996.243) (-2002.226) [-1987.832] -- 0:02:31
530600 -- [-1979.802] (-1984.936) (-2000.122) (-1989.447) * (-1989.415) (-1987.359) (-1994.961) [-1990.209] -- 0:02:31
530700 -- (-1983.737) (-1988.674) (-1989.325) [-1980.087] * (-1997.802) [-1983.819] (-1989.910) (-1993.267) -- 0:02:31
530800 -- (-1980.397) (-1989.798) (-1993.020) [-1978.794] * (-1988.659) [-1988.044] (-1988.679) (-1996.164) -- 0:02:31
530900 -- (-1983.298) (-1991.969) [-1985.327] (-1984.423) * (-1986.339) (-1988.837) [-1985.479] (-1998.203) -- 0:02:31
531000 -- (-1985.645) (-1995.522) (-1983.089) [-1982.259] * (-1987.424) (-1987.462) (-1989.879) [-1987.958] -- 0:02:31
Average standard deviation of split frequencies: 0.003195
531100 -- (-1991.805) (-1998.688) [-1985.153] (-1993.350) * (-1989.791) (-1992.488) (-1988.121) [-1985.070] -- 0:02:31
531200 -- (-1992.077) (-1992.394) [-1985.039] (-1998.826) * [-1985.974] (-1984.694) (-1988.621) (-1986.643) -- 0:02:31
531300 -- [-1988.202] (-1993.384) (-1986.656) (-1999.322) * (-1989.174) (-1996.215) (-1990.270) [-1988.586] -- 0:02:31
531400 -- (-1988.638) (-1995.990) [-1985.956] (-2000.112) * (-1996.282) [-1988.691] (-1989.603) (-1991.418) -- 0:02:31
531500 -- (-1995.029) (-1990.002) [-1987.413] (-1982.958) * (-1986.875) [-1984.268] (-1991.289) (-1989.883) -- 0:02:31
531600 -- (-2000.725) [-1987.124] (-1991.154) (-1984.847) * (-1982.477) (-1989.010) (-1995.607) [-1988.792] -- 0:02:31
531700 -- (-2004.406) (-1995.771) (-1987.486) [-1981.494] * (-1987.292) (-1981.677) (-2000.148) [-1988.241] -- 0:02:31
531800 -- (-1994.193) [-1994.867] (-1993.716) (-1983.527) * (-1987.470) [-1983.279] (-1998.187) (-1996.086) -- 0:02:31
531900 -- (-1990.940) (-1991.456) (-1996.119) [-1979.492] * (-1988.399) (-1996.262) (-1991.577) [-1991.656] -- 0:02:31
532000 -- (-1983.258) (-1993.622) (-1987.167) [-1977.657] * [-1994.945] (-1996.657) (-1987.388) (-1997.309) -- 0:02:31
Average standard deviation of split frequencies: 0.003214
532100 -- (-1983.701) (-1993.874) (-1991.226) [-1983.353] * [-1985.984] (-1995.217) (-1985.145) (-2000.794) -- 0:02:31
532200 -- (-1981.827) (-1997.263) (-1987.158) [-1979.175] * [-1983.653] (-2001.959) (-1987.984) (-1996.334) -- 0:02:31
532300 -- [-1982.814] (-1994.276) (-1995.779) (-1981.448) * (-1985.893) (-2001.089) [-1988.043] (-1993.420) -- 0:02:31
532400 -- (-1982.889) (-1990.665) (-1998.334) [-1986.475] * (-1987.807) [-1992.676] (-1985.104) (-2007.936) -- 0:02:31
532500 -- [-1978.467] (-1993.002) (-1991.964) (-1987.387) * [-1985.332] (-1997.212) (-1997.342) (-2007.546) -- 0:02:31
532600 -- [-1983.756] (-1993.028) (-1988.161) (-1990.452) * [-1984.369] (-1995.369) (-2004.228) (-2009.903) -- 0:02:30
532700 -- (-1985.036) (-1987.974) (-1983.173) [-1982.296] * [-1986.763] (-1990.803) (-2002.612) (-2016.751) -- 0:02:30
532800 -- (-1987.120) (-1990.328) (-1983.090) [-1981.738] * [-1990.241] (-1986.220) (-1999.619) (-2014.412) -- 0:02:30
532900 -- [-1987.961] (-1994.248) (-2000.120) (-1983.046) * [-1986.975] (-1995.482) (-1990.888) (-2001.377) -- 0:02:30
533000 -- (-1985.247) (-1995.913) [-1994.802] (-1990.911) * (-1992.302) (-1994.778) [-1985.944] (-2006.824) -- 0:02:30
Average standard deviation of split frequencies: 0.003158
533100 -- [-1985.627] (-1989.990) (-1990.173) (-1981.877) * (-1999.861) (-1991.181) [-1985.896] (-2000.465) -- 0:02:30
533200 -- (-1986.920) (-1988.297) [-1983.932] (-1992.355) * (-1993.611) (-1993.394) [-1987.364] (-1993.716) -- 0:02:30
533300 -- [-1981.409] (-1993.508) (-1983.835) (-1984.052) * (-1986.280) (-1993.551) [-1985.228] (-1995.726) -- 0:02:30
533400 -- [-1982.417] (-1990.640) (-1981.189) (-1991.543) * (-1985.268) [-1989.866] (-1988.798) (-1999.994) -- 0:02:30
533500 -- [-1984.232] (-1988.485) (-1980.587) (-1991.829) * [-1983.394] (-1989.797) (-1992.005) (-1995.721) -- 0:02:30
533600 -- (-1982.649) (-1991.036) (-1985.372) [-1993.149] * (-1984.939) (-1990.035) [-1990.346] (-1996.700) -- 0:02:30
533700 -- [-1981.323] (-1991.194) (-1987.892) (-1992.802) * (-1982.806) [-1989.485] (-1988.765) (-2001.413) -- 0:02:30
533800 -- [-1982.949] (-1991.765) (-1990.279) (-1990.211) * [-1984.225] (-1989.071) (-1983.157) (-2005.655) -- 0:02:30
533900 -- (-1985.042) (-1987.433) [-1987.291] (-1989.608) * (-1988.374) (-1994.227) [-1980.155] (-2004.582) -- 0:02:31
534000 -- [-1985.511] (-1989.588) (-1991.174) (-1988.665) * (-1986.207) (-1998.172) [-1976.733] (-2002.121) -- 0:02:30
Average standard deviation of split frequencies: 0.003127
534100 -- (-1984.868) (-1998.149) (-1995.065) [-1981.594] * (-1989.258) (-1999.406) [-1980.605] (-2011.085) -- 0:02:30
534200 -- (-1981.297) (-2000.360) (-2003.042) [-1981.194] * (-1992.664) (-2000.069) [-1987.846] (-2004.142) -- 0:02:30
534300 -- [-1979.302] (-1997.353) (-1997.451) (-1982.875) * (-2000.468) (-1995.040) [-1984.743] (-2001.319) -- 0:02:30
534400 -- [-1981.064] (-2001.215) (-1991.546) (-1987.628) * (-1990.838) (-1992.146) [-1980.800] (-1993.274) -- 0:02:30
534500 -- [-1989.156] (-2009.077) (-1987.329) (-1990.515) * (-1997.567) (-1996.022) [-1981.217] (-1997.771) -- 0:02:30
534600 -- (-1981.331) (-2000.703) (-1982.883) [-1984.131] * (-1993.009) (-1997.209) [-1982.697] (-1997.832) -- 0:02:30
534700 -- (-1992.287) [-1986.690] (-1979.395) (-1988.833) * (-1993.570) [-1994.821] (-1985.418) (-2000.713) -- 0:02:30
534800 -- (-1985.692) [-1983.331] (-1991.594) (-1985.214) * (-2000.876) (-1990.437) [-1990.566] (-1996.783) -- 0:02:30
534900 -- (-1987.299) [-1983.727] (-1995.134) (-1984.546) * (-1988.008) (-1987.212) [-1987.630] (-1996.869) -- 0:02:30
535000 -- (-1987.623) [-1990.132] (-2008.979) (-1989.934) * (-1988.485) [-1989.214] (-1991.126) (-1993.792) -- 0:02:30
Average standard deviation of split frequencies: 0.003171
535100 -- [-1982.531] (-1987.753) (-1998.429) (-1989.517) * (-1988.716) (-1991.554) [-1984.517] (-1996.309) -- 0:02:30
535200 -- (-1980.984) [-1984.250] (-1992.297) (-1995.111) * [-1996.523] (-1994.721) (-1985.203) (-1992.584) -- 0:02:30
535300 -- (-1984.602) (-1992.976) (-1991.741) [-1984.867] * (-1995.295) (-2000.741) [-1988.833] (-1994.403) -- 0:02:30
535400 -- (-1987.151) (-1988.984) (-2007.201) [-1984.471] * (-1994.376) [-1996.003] (-1988.024) (-1997.111) -- 0:02:30
535500 -- (-1985.741) (-1998.446) (-1994.422) [-1985.349] * [-1991.439] (-1995.890) (-1988.857) (-1992.288) -- 0:02:30
535600 -- [-1978.031] (-1993.570) (-2003.984) (-1985.762) * (-1987.335) (-2003.279) [-1984.789] (-1994.859) -- 0:02:30
535700 -- [-1980.027] (-2000.213) (-1997.673) (-1982.516) * [-1989.940] (-2002.575) (-1986.200) (-1993.222) -- 0:02:29
535800 -- [-1980.072] (-1997.373) (-1989.238) (-1984.182) * [-1990.993] (-1991.449) (-1991.002) (-1986.736) -- 0:02:29
535900 -- [-1977.538] (-1992.772) (-1986.188) (-1990.836) * (-1992.772) (-1993.661) (-1992.377) [-1986.834] -- 0:02:29
536000 -- [-1980.930] (-1994.757) (-1983.326) (-1993.776) * (-1982.909) [-1987.157] (-1994.350) (-1999.233) -- 0:02:29
Average standard deviation of split frequencies: 0.003266
536100 -- (-1987.596) (-1992.799) [-1982.808] (-1994.659) * [-1986.347] (-1994.091) (-1988.181) (-2009.045) -- 0:02:29
536200 -- [-1984.480] (-1989.857) (-1985.963) (-1990.277) * [-1986.412] (-1998.558) (-1984.509) (-2006.105) -- 0:02:29
536300 -- (-1992.652) (-1984.824) [-1984.304] (-1991.356) * (-1986.408) (-1997.122) [-1982.150] (-2008.180) -- 0:02:29
536400 -- [-1992.455] (-1985.103) (-1985.823) (-1990.530) * (-1989.151) (-1998.993) [-1987.167] (-2005.735) -- 0:02:29
536500 -- (-1991.931) (-1987.259) [-1982.646] (-1998.222) * [-1983.427] (-1997.954) (-1994.608) (-2005.071) -- 0:02:29
536600 -- (-1987.028) (-1993.272) [-1985.064] (-1996.988) * [-1986.164] (-2004.316) (-1986.050) (-1998.175) -- 0:02:29
536700 -- [-1984.337] (-1993.700) (-1983.881) (-2003.732) * [-1988.654] (-2010.656) (-1985.411) (-1999.430) -- 0:02:29
536800 -- (-1982.599) (-1992.876) [-1980.948] (-2008.070) * (-1983.194) (-2002.629) [-1984.901] (-2001.013) -- 0:02:29
536900 -- (-1977.740) [-1986.343] (-1994.032) (-1998.371) * [-1988.369] (-1997.884) (-1991.798) (-1994.515) -- 0:02:29
537000 -- [-1983.986] (-1987.805) (-1988.885) (-1997.226) * [-1985.742] (-2003.738) (-1990.074) (-2007.154) -- 0:02:30
Average standard deviation of split frequencies: 0.003360
537100 -- (-1982.671) [-1986.517] (-1991.101) (-1991.947) * [-1985.189] (-1994.469) (-1987.183) (-2009.240) -- 0:02:29
537200 -- [-1981.262] (-1984.241) (-1989.796) (-1998.515) * [-1980.126] (-1997.937) (-1998.328) (-2001.702) -- 0:02:29
537300 -- [-1984.285] (-1986.236) (-1987.283) (-1996.313) * (-1980.366) (-1992.374) (-2005.496) [-1989.359] -- 0:02:29
537400 -- [-1988.445] (-1984.947) (-1988.405) (-2005.122) * [-1982.294] (-1996.752) (-1995.095) (-1997.930) -- 0:02:29
537500 -- (-1987.555) [-1987.598] (-1990.533) (-1995.695) * [-1984.974] (-2001.398) (-1994.057) (-1997.414) -- 0:02:29
537600 -- (-1983.252) [-1983.757] (-1993.718) (-1996.413) * (-1984.526) [-1984.532] (-1982.911) (-1995.880) -- 0:02:29
537700 -- [-1981.132] (-1987.960) (-1998.953) (-1998.326) * (-1987.017) (-1988.322) [-1986.352] (-1997.692) -- 0:02:29
537800 -- [-1980.973] (-1985.771) (-1997.049) (-1992.573) * [-1978.068] (-1991.245) (-1987.110) (-1995.097) -- 0:02:29
537900 -- [-1985.703] (-1996.669) (-1996.404) (-1998.771) * (-1989.225) (-1996.899) [-1981.425] (-1995.965) -- 0:02:29
538000 -- (-1984.840) (-1990.584) [-1995.378] (-1996.235) * [-1989.028] (-1993.428) (-1977.447) (-1994.089) -- 0:02:29
Average standard deviation of split frequencies: 0.003479
538100 -- (-1985.265) [-1991.920] (-2003.703) (-1994.818) * (-1988.125) (-1993.495) [-1980.067] (-1996.166) -- 0:02:29
538200 -- (-1985.855) (-1991.158) (-2010.430) [-1984.924] * (-1980.426) (-1992.918) [-1983.432] (-1996.115) -- 0:02:29
538300 -- (-1987.942) (-1991.986) (-1992.900) [-1987.730] * (-1988.085) (-1996.189) [-1983.112] (-2003.353) -- 0:02:29
538400 -- [-1981.499] (-1999.915) (-1993.603) (-1989.838) * [-1981.127] (-1997.384) (-1985.120) (-1995.967) -- 0:02:29
538500 -- [-1982.017] (-1997.067) (-1998.889) (-1989.444) * [-1979.032] (-1992.823) (-1992.042) (-1988.816) -- 0:02:29
538600 -- (-1981.620) (-1999.981) (-1998.576) [-1985.500] * (-1982.229) (-1992.653) [-1986.724] (-1992.193) -- 0:02:29
538700 -- [-1983.265] (-2005.131) (-1995.625) (-1992.070) * [-1989.152] (-1988.912) (-1988.969) (-1992.760) -- 0:02:28
538800 -- (-1982.179) (-1998.931) (-2001.811) [-1996.103] * [-1983.996] (-1990.533) (-1995.372) (-1996.220) -- 0:02:28
538900 -- [-1987.618] (-1988.400) (-1996.858) (-1990.384) * (-1985.776) [-1987.841] (-1990.888) (-1994.203) -- 0:02:28
539000 -- (-1994.052) (-1993.475) (-1999.159) [-1986.146] * [-1985.151] (-1993.516) (-1996.811) (-1992.032) -- 0:02:28
Average standard deviation of split frequencies: 0.003322
539100 -- [-1986.091] (-1997.945) (-1999.639) (-1987.993) * (-1990.888) (-1985.100) (-1999.154) [-1988.068] -- 0:02:28
539200 -- [-1987.063] (-2001.201) (-2003.136) (-1992.393) * (-1992.039) (-1991.595) [-1994.265] (-1987.562) -- 0:02:28
539300 -- (-1988.303) (-1998.812) [-1996.174] (-1994.842) * [-1982.340] (-1995.691) (-1990.729) (-1996.694) -- 0:02:28
539400 -- (-1987.917) (-1993.299) [-1988.387] (-1999.059) * [-1983.250] (-1994.199) (-1994.274) (-1991.188) -- 0:02:28
539500 -- [-1987.230] (-1991.798) (-1990.985) (-1996.411) * [-1983.839] (-1994.819) (-1995.474) (-1991.202) -- 0:02:28
539600 -- (-1990.481) [-1992.809] (-1989.537) (-2007.918) * [-1988.674] (-1995.759) (-1998.629) (-1986.828) -- 0:02:28
539700 -- (-1993.838) (-1991.135) [-1987.316] (-2007.840) * [-1980.756] (-1996.721) (-1993.264) (-1991.253) -- 0:02:28
539800 -- (-1990.506) (-1998.483) [-1991.646] (-2010.617) * [-1980.522] (-1990.250) (-2004.396) (-1990.891) -- 0:02:28
539900 -- (-1991.198) (-2002.562) [-1984.984] (-1995.630) * [-1987.341] (-1990.269) (-1996.080) (-1989.607) -- 0:02:28
540000 -- [-1985.260] (-1996.255) (-1988.507) (-1989.061) * [-1985.657] (-1994.266) (-2000.032) (-1990.459) -- 0:02:28
Average standard deviation of split frequencies: 0.003341
540100 -- (-1999.982) (-2001.763) [-1985.056] (-1990.267) * [-1987.917] (-1992.944) (-2002.309) (-1991.349) -- 0:02:29
540200 -- (-1982.440) (-1998.872) [-1986.082] (-1989.294) * [-1980.218] (-1995.642) (-2004.844) (-1991.700) -- 0:02:28
540300 -- [-1982.872] (-2003.482) (-1986.080) (-1988.243) * [-1980.135] (-2000.498) (-2015.045) (-1999.870) -- 0:02:28
540400 -- [-1988.574] (-2004.858) (-1991.548) (-1994.502) * [-1982.259] (-1994.626) (-2003.699) (-1991.472) -- 0:02:28
540500 -- (-1983.280) (-1997.441) (-2000.117) [-1985.468] * [-1976.515] (-1985.082) (-2001.319) (-1993.946) -- 0:02:28
540600 -- [-1980.474] (-2001.062) (-1998.305) (-1987.651) * [-1978.921] (-1981.241) (-1993.916) (-1994.885) -- 0:02:28
540700 -- [-1983.389] (-1989.584) (-1995.139) (-1991.119) * (-1981.090) [-1979.621] (-1987.554) (-1987.304) -- 0:02:28
540800 -- (-1995.138) [-1992.345] (-1999.721) (-1993.356) * (-1985.692) [-1983.694] (-1991.641) (-1987.945) -- 0:02:28
540900 -- (-1994.864) (-1996.385) (-2014.676) [-1986.878] * (-1981.544) [-1980.930] (-1992.844) (-1993.699) -- 0:02:28
541000 -- (-1987.598) (-2007.156) [-1992.448] (-1985.938) * [-1982.781] (-1987.700) (-1985.060) (-1992.797) -- 0:02:28
Average standard deviation of split frequencies: 0.003235
541100 -- (-1984.679) (-2000.777) (-1992.042) [-1980.259] * (-1985.131) [-1984.561] (-1982.046) (-1997.040) -- 0:02:28
541200 -- (-1980.211) (-2001.862) (-1992.975) [-1981.506] * (-1999.759) [-1982.099] (-1983.391) (-1995.064) -- 0:02:28
541300 -- [-1981.686] (-1999.498) (-1988.036) (-1983.665) * [-1985.664] (-1984.274) (-1984.727) (-1991.329) -- 0:02:28
541400 -- (-1983.164) (-2000.712) (-1995.223) [-1983.641] * (-1984.657) (-1984.361) [-1983.856] (-1993.439) -- 0:02:28
541500 -- (-1982.270) (-1994.430) (-1998.542) [-1979.695] * (-1982.254) [-1982.506] (-1986.960) (-1991.431) -- 0:02:28
541600 -- (-1982.242) (-1988.333) (-1997.800) [-1979.489] * (-1984.028) [-1980.622] (-1984.219) (-1989.873) -- 0:02:28
541700 -- [-1978.752] (-1985.484) (-2004.830) (-1980.720) * (-1991.215) [-1980.214] (-1984.965) (-1986.440) -- 0:02:28
541800 -- (-1986.373) (-1993.868) (-2001.556) [-1979.814] * (-1988.651) [-1985.086] (-1987.119) (-1988.690) -- 0:02:27
541900 -- [-1990.595] (-1995.691) (-2006.591) (-1986.058) * [-1987.069] (-1982.723) (-1992.065) (-1996.393) -- 0:02:27
542000 -- (-1987.354) (-1997.995) (-1998.281) [-1983.065] * (-1992.928) [-1979.562] (-1988.169) (-2001.836) -- 0:02:27
Average standard deviation of split frequencies: 0.003180
542100 -- (-1988.499) (-2000.944) (-1993.932) [-1978.044] * (-1980.125) (-1985.046) [-1985.592] (-1996.342) -- 0:02:27
542200 -- (-1988.347) (-1998.355) (-1996.193) [-1984.978] * (-1983.539) (-1994.015) [-1993.948] (-1991.769) -- 0:02:27
542300 -- [-1986.258] (-2000.585) (-2000.445) (-1988.264) * (-1993.297) [-1985.923] (-1981.001) (-1993.831) -- 0:02:27
542400 -- (-1988.274) [-1991.690] (-2007.462) (-1992.598) * [-1984.884] (-1981.303) (-1982.418) (-1989.144) -- 0:02:27
542500 -- [-1982.912] (-1986.291) (-2000.993) (-1982.766) * [-1983.900] (-1985.350) (-1983.282) (-2000.058) -- 0:02:27
542600 -- (-1982.826) [-1989.002] (-1998.423) (-1987.249) * (-1984.924) (-1984.176) [-1983.293] (-1994.593) -- 0:02:27
542700 -- (-1992.627) (-1989.204) (-1988.947) [-1983.668] * (-1984.219) [-1983.986] (-1989.160) (-2003.194) -- 0:02:27
542800 -- [-1980.719] (-1992.303) (-1991.805) (-1986.884) * [-1984.885] (-1992.529) (-1987.930) (-2009.270) -- 0:02:27
542900 -- (-1985.496) (-1989.345) (-1999.668) [-1985.684] * (-1990.045) (-1985.848) [-1981.850] (-2006.510) -- 0:02:27
543000 -- (-1989.983) (-1993.813) (-1996.164) [-1981.782] * (-1993.604) (-1992.222) [-1982.444] (-2011.145) -- 0:02:27
Average standard deviation of split frequencies: 0.003099
543100 -- [-1991.573] (-1998.039) (-1990.990) (-1982.782) * (-1998.257) (-1986.076) (-1983.485) [-2001.899] -- 0:02:28
543200 -- (-1988.325) (-1992.660) (-1997.336) [-1981.128] * (-1996.798) [-1983.259] (-1984.761) (-1995.448) -- 0:02:28
543300 -- (-1988.555) (-1994.950) (-1998.023) [-1981.835] * (-1991.932) (-1985.661) [-1985.111] (-1994.120) -- 0:02:27
543400 -- (-1985.782) (-1992.559) (-1994.512) [-1984.762] * (-1989.650) [-1983.140] (-1985.189) (-2000.273) -- 0:02:27
543500 -- (-1984.748) (-1994.892) (-1986.616) [-1985.529] * (-1994.946) [-1982.114] (-1988.916) (-2001.129) -- 0:02:27
543600 -- (-1989.450) (-1995.050) (-1990.223) [-1991.001] * (-1990.935) [-1983.228] (-1989.164) (-1997.513) -- 0:02:27
543700 -- (-1988.978) (-2005.259) (-1996.427) [-1986.323] * (-1989.713) [-1983.034] (-1982.228) (-1995.442) -- 0:02:27
543800 -- [-1985.039] (-1991.112) (-1998.503) (-1987.181) * (-1990.714) (-1988.946) [-1981.907] (-1995.105) -- 0:02:27
543900 -- (-1983.901) (-1998.262) (-1996.097) [-1987.743] * (-1999.441) [-1987.173] (-1987.673) (-1996.788) -- 0:02:27
544000 -- [-1989.120] (-2003.558) (-1992.105) (-1993.152) * (-2000.389) (-1983.220) (-1988.035) [-1989.072] -- 0:02:27
Average standard deviation of split frequencies: 0.002896
544100 -- [-1985.441] (-1994.760) (-1994.443) (-1987.176) * (-2003.457) (-1984.898) [-1985.897] (-1988.995) -- 0:02:27
544200 -- (-1992.277) (-1991.089) (-1995.498) [-1984.194] * (-2008.264) [-1983.319] (-1982.272) (-1992.157) -- 0:02:27
544300 -- (-1999.297) (-1988.432) (-2005.529) [-1983.575] * (-2003.111) [-1992.058] (-1987.133) (-1994.497) -- 0:02:27
544400 -- (-2008.058) [-1986.563] (-1998.905) (-1988.108) * (-2003.180) [-1984.208] (-1987.860) (-1986.863) -- 0:02:27
544500 -- (-2004.411) [-1988.030] (-2009.556) (-1996.197) * (-1995.501) (-1980.041) [-1981.492] (-1997.424) -- 0:02:27
544600 -- (-1998.910) (-1985.507) (-2003.172) [-1980.770] * (-1995.441) [-1984.682] (-1988.855) (-1998.063) -- 0:02:27
544700 -- (-1995.535) [-1985.598] (-1990.831) (-1985.475) * (-1998.589) [-1981.252] (-1990.736) (-1997.866) -- 0:02:27
544800 -- (-1991.753) [-1988.989] (-1995.347) (-1982.851) * (-1995.546) [-1981.508] (-1987.499) (-1999.287) -- 0:02:27
544900 -- (-2001.306) (-2000.466) (-1997.317) [-1983.291] * (-1994.954) (-1983.120) [-1986.549] (-2001.047) -- 0:02:26
545000 -- (-1987.954) (-1998.887) (-1996.210) [-1984.262] * (-1990.503) [-1979.821] (-1993.301) (-2000.413) -- 0:02:26
Average standard deviation of split frequencies: 0.002940
545100 -- [-1987.940] (-1997.473) (-1991.317) (-1985.439) * (-1986.694) [-1980.486] (-2006.813) (-1992.546) -- 0:02:26
545200 -- (-1986.108) (-1999.857) (-1996.438) [-1986.620] * (-1987.695) [-1981.271] (-2005.690) (-1991.129) -- 0:02:26
545300 -- [-1985.809] (-1996.591) (-1993.481) (-1982.836) * (-1983.017) [-1980.741] (-2000.346) (-1997.987) -- 0:02:26
545400 -- (-1987.280) [-1989.366] (-1996.349) (-1985.786) * (-1991.178) [-1980.845] (-2008.650) (-1992.961) -- 0:02:26
545500 -- (-1983.746) [-1989.182] (-1999.205) (-1983.654) * (-1985.783) [-1982.748] (-1999.015) (-1997.930) -- 0:02:26
545600 -- (-1988.296) (-1987.622) (-1998.319) [-1980.111] * [-1983.446] (-1995.291) (-1991.942) (-2001.168) -- 0:02:26
545700 -- [-1983.409] (-1990.785) (-1993.655) (-1983.441) * [-1979.427] (-1994.453) (-1985.011) (-2002.969) -- 0:02:26
545800 -- (-1992.951) (-1986.107) (-1999.037) [-1985.416] * (-1981.887) (-1994.582) [-1991.048] (-1995.185) -- 0:02:26
545900 -- (-1991.005) [-1987.500] (-2002.896) (-1985.655) * [-1982.749] (-1993.406) (-1990.986) (-1996.379) -- 0:02:26
546000 -- (-1995.725) (-1986.772) (-1993.973) [-1982.752] * [-1985.191] (-1993.777) (-1998.401) (-2001.649) -- 0:02:26
Average standard deviation of split frequencies: 0.003009
546100 -- (-1984.740) [-1986.540] (-1991.549) (-1985.991) * [-1984.186] (-1991.957) (-1992.718) (-1992.065) -- 0:02:27
546200 -- (-1984.862) (-1995.440) (-1999.415) [-1984.243] * [-1983.763] (-1985.040) (-2001.270) (-1992.763) -- 0:02:27
546300 -- (-1990.897) (-2002.813) (-1999.571) [-1983.309] * (-1983.781) [-1986.118] (-1999.652) (-1987.956) -- 0:02:26
546400 -- (-1991.481) (-1996.445) (-1999.879) [-1982.071] * [-1982.175] (-1985.742) (-2001.346) (-1997.303) -- 0:02:26
546500 -- (-2003.068) (-1994.342) [-1997.908] (-1977.831) * [-1981.676] (-1988.815) (-2001.350) (-1988.706) -- 0:02:26
546600 -- (-2005.236) (-1998.687) (-1998.229) [-1982.696] * [-1985.316] (-1998.814) (-2003.868) (-1988.555) -- 0:02:26
546700 -- [-1989.031] (-1992.730) (-1999.327) (-1983.542) * (-1990.088) (-1995.388) (-2001.665) [-1982.410] -- 0:02:26
546800 -- (-1993.770) (-1995.505) (-2009.563) [-1980.733] * (-1980.098) (-1985.932) (-2006.021) [-1982.837] -- 0:02:26
546900 -- (-2002.135) (-1991.830) (-1997.492) [-1976.860] * [-1982.805] (-1977.583) (-1998.972) (-1994.130) -- 0:02:26
547000 -- (-1993.674) (-1996.469) (-1988.820) [-1976.214] * [-1980.248] (-1983.296) (-1994.163) (-1995.931) -- 0:02:26
Average standard deviation of split frequencies: 0.003151
547100 -- (-1988.518) (-1990.283) (-2000.355) [-1978.890] * (-1983.128) [-1981.772] (-1996.373) (-1995.385) -- 0:02:26
547200 -- (-1991.050) (-1988.208) (-2005.005) [-1986.944] * (-1986.119) [-1984.004] (-1995.183) (-1997.786) -- 0:02:26
547300 -- (-1988.503) (-1989.207) (-1996.417) [-1985.982] * (-1988.013) [-1979.248] (-1986.472) (-1998.994) -- 0:02:26
547400 -- (-1987.651) (-1987.572) (-1994.825) [-1982.598] * (-1992.505) [-1980.271] (-1984.969) (-1997.628) -- 0:02:26
547500 -- (-1992.526) (-1999.560) (-1994.331) [-1980.537] * (-1991.351) (-1987.717) [-1982.606] (-1999.101) -- 0:02:26
547600 -- (-1989.800) (-1999.301) (-1992.895) [-1980.218] * (-1987.181) (-1988.776) (-1985.515) [-1985.199] -- 0:02:26
547700 -- (-1989.361) (-1992.561) (-1995.671) [-1981.110] * (-1990.720) [-1988.946] (-1982.769) (-1986.633) -- 0:02:26
547800 -- (-1989.144) (-2006.519) [-1985.178] (-1981.984) * (-1996.075) (-1993.599) [-1982.431] (-1990.116) -- 0:02:26
547900 -- (-1991.992) (-2000.476) [-1987.474] (-1986.450) * (-1987.011) (-1993.498) [-1987.840] (-1988.553) -- 0:02:26
548000 -- (-1985.226) (-1989.024) (-1993.737) [-1987.979] * (-1994.817) (-1992.105) [-1986.097] (-1994.244) -- 0:02:25
Average standard deviation of split frequencies: 0.003170
548100 -- (-1995.015) (-1990.337) (-1987.450) [-1986.620] * (-1997.874) [-1983.034] (-1988.782) (-1990.366) -- 0:02:25
548200 -- (-1986.505) (-1994.929) (-1987.320) [-1983.777] * (-1992.339) [-1979.657] (-1986.341) (-1997.130) -- 0:02:25
548300 -- (-1984.759) (-2006.071) [-1988.465] (-1986.532) * (-1993.930) [-1981.143] (-1989.592) (-1992.221) -- 0:02:25
548400 -- (-1989.705) (-1993.078) [-1989.996] (-1989.450) * (-2004.210) (-1987.471) [-1986.428] (-1986.496) -- 0:02:25
548500 -- [-1989.930] (-1995.890) (-1990.160) (-1985.900) * (-1995.354) (-1984.957) [-1985.271] (-1999.629) -- 0:02:25
548600 -- (-1986.007) (-2000.542) (-1991.148) [-1984.142] * (-1997.638) [-1983.414] (-1990.911) (-1993.314) -- 0:02:25
548700 -- [-1986.622] (-2001.444) (-1995.620) (-1984.290) * (-1991.664) [-1986.131] (-1988.074) (-2001.765) -- 0:02:25
548800 -- (-1987.766) (-2005.868) [-1988.952] (-1983.293) * (-1996.234) (-1990.281) [-1987.405] (-2006.067) -- 0:02:25
548900 -- (-1992.750) (-2003.678) [-1987.467] (-1993.744) * [-1987.711] (-1986.628) (-1992.487) (-1996.685) -- 0:02:25
549000 -- (-1996.300) [-1999.311] (-1997.669) (-1994.661) * [-1990.100] (-1983.207) (-1998.662) (-1994.735) -- 0:02:25
Average standard deviation of split frequencies: 0.003213
549100 -- [-1982.259] (-1989.241) (-2000.227) (-1986.280) * (-1991.172) [-1982.458] (-1995.511) (-1998.076) -- 0:02:26
549200 -- [-1977.646] (-1997.890) (-1995.479) (-1985.277) * (-1991.593) [-1981.680] (-1991.077) (-1992.450) -- 0:02:26
549300 -- [-1982.932] (-1988.159) (-1995.382) (-1988.593) * (-1993.523) [-1987.169] (-1989.733) (-1993.252) -- 0:02:26
549400 -- [-1982.447] (-1994.374) (-1990.323) (-1989.090) * (-1988.176) [-1981.152] (-1993.366) (-1997.420) -- 0:02:25
549500 -- (-1980.739) (-1998.476) [-1989.701] (-1985.849) * (-1986.037) [-1981.792] (-1989.288) (-1993.844) -- 0:02:25
549600 -- (-1982.223) (-2010.146) [-1987.813] (-1987.912) * (-1987.467) [-1980.957] (-1988.027) (-1993.490) -- 0:02:25
549700 -- (-1980.783) (-2002.155) (-1988.807) [-1987.878] * (-1995.648) [-1982.523] (-1996.374) (-1987.397) -- 0:02:25
549800 -- [-1981.692] (-2000.799) (-1988.345) (-1991.757) * (-1989.902) (-1983.006) (-1987.265) [-1984.996] -- 0:02:25
549900 -- [-1979.539] (-2002.359) (-1986.221) (-1988.283) * (-1989.873) (-1989.325) (-1986.692) [-1985.904] -- 0:02:25
550000 -- (-1989.811) (-2013.273) [-1991.007] (-1991.636) * (-1986.270) [-1987.949] (-1989.178) (-1989.666) -- 0:02:25
Average standard deviation of split frequencies: 0.003207
550100 -- (-1989.282) (-2004.999) [-1987.018] (-1988.355) * [-1982.149] (-1982.135) (-1995.250) (-1987.642) -- 0:02:25
550200 -- (-1993.529) (-1998.962) (-1990.477) [-1985.828] * (-1982.890) [-1984.014] (-1988.225) (-1991.137) -- 0:02:25
550300 -- (-1992.062) (-1990.986) [-1986.572] (-1987.270) * (-1993.125) [-1981.707] (-2002.035) (-1992.703) -- 0:02:25
550400 -- [-1989.626] (-1989.907) (-1985.854) (-1999.843) * (-1985.596) [-1986.340] (-1997.680) (-1994.611) -- 0:02:25
550500 -- (-1992.904) [-1991.805] (-1995.316) (-1995.813) * [-1983.985] (-1987.101) (-1992.371) (-1991.858) -- 0:02:25
550600 -- (-1992.156) [-1987.198] (-1984.402) (-1997.805) * (-1984.727) [-1981.045] (-2000.723) (-1997.900) -- 0:02:25
550700 -- (-1988.437) (-1993.685) (-1988.364) [-1991.146] * (-1986.487) [-1987.210] (-1999.064) (-1997.034) -- 0:02:25
550800 -- (-1986.942) (-1996.992) (-1996.421) [-1985.718] * [-1984.576] (-1988.619) (-1991.535) (-1991.454) -- 0:02:25
550900 -- [-1985.168] (-2006.931) (-1999.842) (-1995.569) * [-1978.422] (-1989.356) (-1997.946) (-1984.584) -- 0:02:25
551000 -- (-1985.023) (-1996.125) (-1992.308) [-1992.929] * [-1977.247] (-1986.508) (-2000.080) (-1986.531) -- 0:02:25
Average standard deviation of split frequencies: 0.003103
551100 -- [-1985.551] (-1996.409) (-1991.047) (-1991.635) * (-1981.474) [-1982.910] (-2002.336) (-1985.518) -- 0:02:24
551200 -- [-1983.824] (-1993.743) (-1991.899) (-1989.518) * (-1985.293) (-1979.345) (-2001.650) [-1989.268] -- 0:02:24
551300 -- (-1988.995) (-1985.913) (-1992.604) [-1988.102] * (-1986.445) [-1982.953] (-2007.935) (-1994.761) -- 0:02:24
551400 -- (-1990.201) (-1989.949) (-2002.527) [-1983.806] * [-1989.508] (-1983.385) (-1998.050) (-2001.456) -- 0:02:24
551500 -- [-1985.210] (-1993.476) (-1997.306) (-1985.633) * (-1989.541) [-1980.165] (-2005.109) (-1999.277) -- 0:02:24
551600 -- [-1982.525] (-1991.812) (-1992.308) (-1988.903) * [-1983.718] (-1982.756) (-1995.719) (-1995.390) -- 0:02:24
551700 -- [-1988.055] (-1992.289) (-1999.471) (-1987.495) * [-1986.235] (-1980.356) (-1995.370) (-2003.779) -- 0:02:24
551800 -- [-1983.823] (-1992.332) (-1993.691) (-1992.333) * [-1980.832] (-1981.988) (-1999.892) (-2003.254) -- 0:02:24
551900 -- (-1983.019) [-1988.048] (-1992.810) (-1988.839) * (-1982.002) [-1980.287] (-2000.549) (-2003.232) -- 0:02:24
552000 -- [-1985.295] (-1986.531) (-2000.844) (-1982.423) * [-1982.859] (-1983.259) (-1990.213) (-1996.034) -- 0:02:24
Average standard deviation of split frequencies: 0.002927
552100 -- (-1985.952) (-1987.810) (-2000.875) [-1986.303] * (-1981.827) [-1984.979] (-1996.372) (-1991.974) -- 0:02:24
552200 -- (-1992.867) [-1989.202] (-1996.606) (-1994.817) * (-1984.380) [-1983.092] (-1997.714) (-1990.676) -- 0:02:25
552300 -- (-1997.554) (-1998.059) [-1992.490] (-1991.354) * [-1979.681] (-1988.598) (-1999.347) (-1997.906) -- 0:02:25
552400 -- [-1996.671] (-1994.026) (-1990.968) (-1988.351) * [-1982.041] (-1988.828) (-1999.098) (-2005.094) -- 0:02:25
552500 -- (-1994.870) (-1999.123) [-1989.506] (-1990.868) * (-1981.459) [-1982.480] (-1995.495) (-1997.378) -- 0:02:24
552600 -- (-1997.039) (-1994.536) (-1992.524) [-1979.919] * [-1983.103] (-1981.879) (-1987.661) (-1997.106) -- 0:02:24
552700 -- (-2000.553) (-1992.585) (-1992.814) [-1983.478] * (-1984.608) (-1983.036) [-1990.818] (-2004.357) -- 0:02:24
552800 -- (-2000.310) (-1996.735) (-1993.277) [-1981.035] * (-1980.423) [-1985.925] (-1988.809) (-2006.870) -- 0:02:24
552900 -- (-1996.224) [-1989.811] (-1990.802) (-1983.697) * (-1984.844) [-1979.789] (-1987.686) (-1997.531) -- 0:02:24
553000 -- (-2001.179) (-1990.262) [-1989.948] (-1983.289) * [-1984.382] (-1984.907) (-1990.213) (-1996.424) -- 0:02:24
Average standard deviation of split frequencies: 0.003092
553100 -- [-1993.588] (-1992.288) (-1989.354) (-1984.929) * [-1981.606] (-1985.428) (-1992.946) (-1991.777) -- 0:02:24
553200 -- (-1999.141) (-1992.357) (-1990.403) [-1979.509] * (-1978.481) [-1986.324] (-1993.723) (-1992.115) -- 0:02:24
553300 -- (-1994.328) (-1992.808) (-1994.036) [-1980.100] * [-1981.331] (-1998.188) (-1991.275) (-1992.793) -- 0:02:24
553400 -- (-1993.368) (-1992.720) (-1996.025) [-1979.085] * (-1983.227) (-1993.331) [-1992.670] (-1993.266) -- 0:02:24
553500 -- (-1994.723) (-1988.090) (-2001.186) [-1982.600] * [-1984.415] (-1984.797) (-1986.528) (-1996.866) -- 0:02:24
553600 -- (-1996.580) (-1990.246) (-1999.950) [-1979.599] * [-1982.513] (-1990.340) (-1992.637) (-1996.770) -- 0:02:24
553700 -- (-1993.886) (-2002.234) (-2004.060) [-1980.192] * [-1977.847] (-1988.311) (-1987.352) (-1999.509) -- 0:02:24
553800 -- (-1989.398) [-1992.883] (-1992.928) (-1983.138) * (-1982.087) [-1985.574] (-1990.183) (-1991.829) -- 0:02:24
553900 -- (-1997.843) (-2001.148) (-1991.356) [-1986.103] * (-1980.980) [-1982.565] (-1989.923) (-1996.650) -- 0:02:24
554000 -- (-1996.580) (-1999.258) [-1996.697] (-1989.493) * [-1978.830] (-1982.747) (-1992.826) (-2000.694) -- 0:02:24
Average standard deviation of split frequencies: 0.003135
554100 -- (-2000.491) [-1989.482] (-1995.544) (-1988.794) * (-1981.051) [-1981.431] (-1991.513) (-1996.270) -- 0:02:24
554200 -- (-2005.630) (-1991.048) (-1995.298) [-1986.323] * [-1983.610] (-1982.238) (-1991.204) (-1998.296) -- 0:02:23
554300 -- (-2003.673) (-1985.074) (-1995.299) [-1980.198] * (-1985.227) [-1982.941] (-1994.993) (-1999.765) -- 0:02:23
554400 -- (-1997.276) (-1989.832) (-1997.609) [-1983.984] * [-1983.695] (-1981.449) (-1996.003) (-1998.101) -- 0:02:23
554500 -- (-1989.553) (-1990.368) (-2004.747) [-1981.765] * (-1985.740) [-1981.584] (-1990.699) (-2001.596) -- 0:02:23
554600 -- (-1985.750) (-1993.496) (-2002.731) [-1981.024] * (-1991.631) [-1985.745] (-1988.003) (-1999.393) -- 0:02:23
554700 -- [-1987.406] (-2000.603) (-1997.267) (-1981.456) * (-1995.353) [-1988.877] (-1988.788) (-2000.025) -- 0:02:23
554800 -- [-1984.952] (-1996.763) (-1991.528) (-1984.828) * (-1989.952) (-1991.883) [-1990.696] (-2005.804) -- 0:02:23
554900 -- (-1987.462) (-1996.765) (-1988.635) [-1982.471] * (-1995.166) (-1993.841) [-1990.382] (-2015.270) -- 0:02:23
555000 -- (-1985.352) (-2006.411) (-1985.599) [-1980.426] * (-1988.279) [-1989.772] (-1994.258) (-2012.142) -- 0:02:23
Average standard deviation of split frequencies: 0.003202
555100 -- [-1983.648] (-1987.970) (-1988.129) (-1984.374) * [-1982.367] (-1991.586) (-1990.733) (-2006.903) -- 0:02:23
555200 -- (-1986.993) (-1989.670) (-1985.946) [-1980.191] * (-1985.127) [-1981.332] (-1994.144) (-1992.825) -- 0:02:23
555300 -- [-1985.708] (-1986.431) (-1994.157) (-1982.843) * (-1988.647) [-1983.403] (-1993.288) (-1999.799) -- 0:02:24
555400 -- (-1987.350) (-1989.662) (-1997.469) [-1980.480] * [-1983.087] (-1977.605) (-1989.213) (-2005.147) -- 0:02:24
555500 -- (-1990.960) (-1993.360) (-2001.516) [-1982.543] * [-1981.510] (-1977.648) (-1991.845) (-1997.834) -- 0:02:24
555600 -- (-1990.846) (-1993.254) (-1999.529) [-1979.185] * (-1982.935) [-1979.375] (-1991.113) (-1997.251) -- 0:02:23
555700 -- (-1995.378) (-1989.641) (-2002.585) [-1978.516] * (-1984.311) [-1984.336] (-1985.749) (-2003.085) -- 0:02:23
555800 -- (-1995.883) [-1989.695] (-1995.196) (-1983.034) * [-1982.466] (-1985.029) (-1987.804) (-2005.084) -- 0:02:23
555900 -- (-1994.905) (-1994.541) (-1993.203) [-1989.387] * [-1983.500] (-1992.124) (-1985.791) (-2006.131) -- 0:02:23
556000 -- (-1998.423) (-1998.388) (-1987.368) [-1982.320] * [-1987.332] (-1985.645) (-1990.423) (-2011.555) -- 0:02:23
Average standard deviation of split frequencies: 0.002955
556100 -- (-1993.992) (-2008.258) [-1986.875] (-1983.234) * (-1991.091) [-1985.177] (-1992.036) (-2002.077) -- 0:02:23
556200 -- (-1995.363) (-2001.594) (-1995.352) [-1984.439] * (-1999.903) [-1984.372] (-1986.697) (-2005.607) -- 0:02:23
556300 -- [-1988.226] (-2003.894) (-1997.917) (-1991.626) * (-1994.939) (-1981.338) (-1996.092) [-1992.423] -- 0:02:23
556400 -- (-1991.144) (-1995.931) (-1998.127) [-1991.109] * (-1994.381) [-1977.594] (-1998.083) (-1991.682) -- 0:02:23
556500 -- [-1983.766] (-1993.423) (-2002.669) (-1984.612) * (-2000.907) [-1981.842] (-2006.587) (-1987.639) -- 0:02:23
556600 -- (-1987.885) (-1993.488) (-1992.545) [-1980.214] * (-2002.011) [-1980.655] (-1989.184) (-1994.862) -- 0:02:23
556700 -- (-1980.871) (-1991.769) (-1999.519) [-1981.685] * (-1990.465) [-1980.723] (-1992.296) (-1993.408) -- 0:02:23
556800 -- (-1982.862) (-1999.815) (-1992.215) [-1982.496] * (-1993.493) [-1978.643] (-1996.753) (-1995.526) -- 0:02:23
556900 -- (-1982.053) (-2001.102) (-1998.211) [-1984.824] * (-1991.153) (-1981.610) [-1996.024] (-1994.189) -- 0:02:23
557000 -- [-1984.641] (-1994.421) (-1998.720) (-1988.637) * [-1990.716] (-1987.607) (-1997.523) (-1989.384) -- 0:02:23
Average standard deviation of split frequencies: 0.002925
557100 -- [-1986.832] (-1989.532) (-1989.418) (-1983.932) * [-1984.748] (-1997.088) (-1997.429) (-1997.537) -- 0:02:23
557200 -- [-1984.612] (-1991.012) (-1995.129) (-1980.093) * (-1989.196) (-1998.766) [-1986.472] (-1998.600) -- 0:02:23
557300 -- (-1992.179) (-2000.108) (-1995.152) [-1980.984] * [-1983.636] (-1997.946) (-1989.904) (-1998.786) -- 0:02:22
557400 -- [-1982.831] (-1993.403) (-2001.176) (-1983.127) * [-1982.194] (-1992.773) (-1994.782) (-1991.340) -- 0:02:22
557500 -- (-1993.378) (-1995.271) (-1999.863) [-1982.877] * (-1981.011) (-1990.983) (-1993.684) [-1986.472] -- 0:02:22
557600 -- (-2003.549) (-1989.196) (-1996.514) [-1978.353] * [-1982.066] (-2000.265) (-1991.261) (-1988.742) -- 0:02:22
557700 -- (-1990.042) (-1990.890) (-2001.441) [-1979.586] * [-1981.954] (-1996.978) (-1989.595) (-1991.720) -- 0:02:22
557800 -- [-1984.674] (-1987.280) (-1998.813) (-1980.481) * [-1982.983] (-1993.273) (-1992.040) (-2001.839) -- 0:02:22
557900 -- (-1984.856) (-1992.343) [-1989.854] (-1985.319) * [-1981.077] (-1986.564) (-1992.835) (-2009.183) -- 0:02:22
558000 -- (-1992.328) (-1993.131) (-1990.185) [-1985.676] * (-1984.990) [-1985.418] (-1995.553) (-1996.774) -- 0:02:22
Average standard deviation of split frequencies: 0.003016
558100 -- (-1993.736) (-2007.097) (-1990.014) [-1985.800] * (-1985.609) [-1987.233] (-1997.903) (-1997.264) -- 0:02:22
558200 -- (-1992.037) (-1996.449) (-1992.716) [-1983.802] * (-1986.657) [-1985.117] (-1994.117) (-1988.211) -- 0:02:22
558300 -- (-1994.559) (-1995.949) (-1994.289) [-1980.385] * [-1988.184] (-1991.699) (-1993.353) (-1983.149) -- 0:02:23
558400 -- (-2007.980) (-1999.546) (-1986.699) [-1980.168] * (-1989.498) (-2001.519) (-1993.533) [-1983.135] -- 0:02:23
558500 -- (-2005.319) (-1991.469) [-1988.978] (-1980.483) * (-1989.513) (-2010.539) (-1995.109) [-1988.760] -- 0:02:23
558600 -- (-2007.453) (-2001.814) [-1990.194] (-1982.019) * (-1994.083) [-2005.461] (-1991.354) (-1989.489) -- 0:02:23
558700 -- (-1999.956) (-2001.367) (-1994.414) [-1979.946] * (-1989.268) (-1998.591) (-1997.563) [-1991.342] -- 0:02:22
558800 -- (-2007.370) (-1993.765) [-1994.565] (-1981.890) * (-1987.219) (-2003.010) (-2002.135) [-1987.876] -- 0:02:22
558900 -- (-2005.728) (-1998.760) (-1992.381) [-1983.066] * [-1991.835] (-1992.954) (-2007.135) (-1992.925) -- 0:02:22
559000 -- (-2002.354) (-1996.655) (-1994.913) [-1977.402] * (-1987.490) (-1988.499) (-1994.017) [-1988.290] -- 0:02:22
Average standard deviation of split frequencies: 0.003035
559100 -- (-1997.296) (-1999.881) (-1995.594) [-1977.823] * (-1987.937) [-1989.580] (-1994.049) (-1999.806) -- 0:02:22
559200 -- (-1997.257) (-2002.487) (-1997.199) [-1979.386] * (-1991.700) (-1993.623) [-1995.829] (-1994.389) -- 0:02:22
559300 -- (-1990.529) [-1994.943] (-1992.261) (-1984.056) * (-1996.306) (-1995.571) [-1988.868] (-1994.410) -- 0:02:22
559400 -- (-1990.124) (-1997.109) (-1989.878) [-1987.393] * (-1988.456) [-1991.612] (-1992.850) (-1996.806) -- 0:02:22
559500 -- (-1993.907) (-1994.320) (-1997.886) [-1990.228] * [-1988.412] (-1995.884) (-1996.816) (-1994.186) -- 0:02:22
559600 -- (-1993.184) [-1988.757] (-1995.853) (-1988.985) * (-1985.739) (-1993.558) [-1992.845] (-1989.830) -- 0:02:22
559700 -- (-1998.228) (-1984.624) (-1996.350) [-1985.672] * [-1986.604] (-1984.363) (-1998.242) (-1995.542) -- 0:02:22
559800 -- (-1992.447) (-1986.265) (-1993.890) [-1992.743] * (-1994.067) [-1986.153] (-2002.921) (-1996.035) -- 0:02:22
559900 -- (-2000.778) [-1988.628] (-1995.182) (-1984.068) * (-2003.319) [-1980.363] (-1999.692) (-1995.130) -- 0:02:22
560000 -- (-2007.412) [-1984.440] (-1998.406) (-1980.775) * (-1992.973) [-1981.492] (-1998.210) (-1996.216) -- 0:02:22
Average standard deviation of split frequencies: 0.002789
560100 -- (-1998.910) (-1988.846) (-2006.368) [-1981.842] * (-1992.098) [-1980.038] (-1993.968) (-1996.882) -- 0:02:22
560200 -- (-1990.524) (-1988.260) (-2008.287) [-1984.534] * (-1997.020) [-1983.897] (-1990.490) (-1994.659) -- 0:02:22
560300 -- (-1992.264) (-1992.197) (-2005.585) [-1981.274] * (-2001.407) (-1990.959) (-2000.523) [-1990.553] -- 0:02:22
560400 -- [-1985.130] (-1989.755) (-1997.580) (-1979.004) * (-2001.518) [-1987.102] (-1997.260) (-1991.001) -- 0:02:21
560500 -- [-1986.656] (-1996.005) (-2004.115) (-1980.462) * (-2010.828) (-1983.383) (-1997.242) [-1989.426] -- 0:02:21
560600 -- [-1986.456] (-1999.331) (-2005.798) (-1983.270) * (-1997.264) [-1978.161] (-1987.694) (-1990.978) -- 0:02:21
560700 -- (-1990.577) (-2001.477) [-2000.589] (-1982.953) * (-1993.782) [-1978.784] (-1991.512) (-1988.724) -- 0:02:21
560800 -- (-1987.501) (-1994.185) (-2007.530) [-1977.212] * (-1993.362) [-1984.685] (-1993.205) (-1985.093) -- 0:02:21
560900 -- (-1989.582) (-1995.757) (-1996.196) [-1982.157] * (-1991.752) [-1983.359] (-1990.212) (-1985.630) -- 0:02:21
561000 -- (-1991.742) (-2007.342) (-1994.285) [-1982.509] * (-1985.133) [-1983.826] (-1992.108) (-1993.768) -- 0:02:21
Average standard deviation of split frequencies: 0.002880
561100 -- [-1989.616] (-1992.582) (-1995.870) (-1984.422) * (-1985.269) (-1984.587) [-1989.114] (-1994.453) -- 0:02:21
561200 -- (-1996.208) (-1993.851) (-1999.269) [-1982.523] * [-1982.803] (-1985.943) (-1992.167) (-1990.463) -- 0:02:21
561300 -- (-1990.899) (-1996.900) (-1993.790) [-1982.381] * [-1988.279] (-1982.288) (-1994.888) (-1990.325) -- 0:02:22
561400 -- (-1997.882) (-1991.531) [-1983.800] (-1986.347) * (-1990.784) (-1989.487) (-1994.441) [-1991.399] -- 0:02:22
561500 -- (-1993.367) [-1988.193] (-1992.969) (-1986.146) * (-1995.614) [-1985.657] (-1993.918) (-1999.475) -- 0:02:22
561600 -- (-2004.332) (-1993.802) (-1987.320) [-1984.814] * [-1985.452] (-1990.634) (-1991.442) (-1991.742) -- 0:02:22
561700 -- (-1998.423) (-1990.735) (-1991.155) [-1987.645] * (-1990.166) [-1987.787] (-1993.487) (-1995.981) -- 0:02:22
561800 -- (-1992.895) (-1990.599) (-1992.635) [-1987.971] * (-1984.472) [-1990.576] (-1995.049) (-1993.522) -- 0:02:21
561900 -- [-1986.089] (-1990.102) (-1990.448) (-1995.546) * (-1987.643) (-1989.916) [-1987.501] (-2001.954) -- 0:02:21
562000 -- [-1991.619] (-1994.116) (-1987.774) (-1998.276) * (-1986.584) [-1984.516] (-1993.381) (-1997.528) -- 0:02:21
Average standard deviation of split frequencies: 0.002827
562100 -- (-1988.995) (-1994.830) [-1985.816] (-1992.269) * (-1987.205) [-1985.940] (-1989.134) (-1999.051) -- 0:02:21
562200 -- (-1987.355) (-1995.208) [-1984.536] (-1994.542) * (-1989.549) (-1984.155) [-1990.448] (-1997.201) -- 0:02:21
562300 -- [-1985.497] (-2005.957) (-1986.031) (-1997.846) * (-1987.494) [-1981.706] (-1990.302) (-1996.748) -- 0:02:21
562400 -- [-1984.303] (-1999.659) (-1983.976) (-1999.348) * (-1990.494) [-1984.130] (-1993.002) (-1994.718) -- 0:02:21
562500 -- [-1988.942] (-1997.355) (-1987.325) (-2000.789) * [-1986.496] (-1987.583) (-1995.729) (-1988.469) -- 0:02:21
562600 -- [-1990.148] (-1996.088) (-1986.720) (-1994.089) * (-1986.357) (-1992.878) (-1994.655) [-1991.889] -- 0:02:21
562700 -- (-1990.512) [-1991.539] (-1991.195) (-1991.831) * (-1988.815) (-1998.101) [-1993.554] (-1999.644) -- 0:02:21
562800 -- [-1980.316] (-1995.693) (-1989.746) (-1994.376) * [-1988.310] (-1999.368) (-1992.938) (-2000.979) -- 0:02:21
562900 -- [-1979.554] (-1998.311) (-1991.141) (-1994.416) * [-1988.585] (-1993.587) (-1995.643) (-1991.622) -- 0:02:21
563000 -- (-1986.458) (-1999.065) [-1990.317] (-1999.265) * [-1989.507] (-1988.235) (-2004.317) (-2006.543) -- 0:02:21
Average standard deviation of split frequencies: 0.002822
563100 -- (-1987.675) [-1992.713] (-1994.444) (-1994.910) * (-1984.342) [-1983.302] (-2002.654) (-1999.939) -- 0:02:21
563200 -- (-1985.200) (-1989.571) (-1996.506) [-1987.060] * (-1986.795) [-1985.135] (-1995.838) (-1998.604) -- 0:02:21
563300 -- (-1993.848) (-1988.672) (-1992.679) [-1989.900] * (-1982.731) [-1988.293] (-1993.741) (-2012.733) -- 0:02:21
563400 -- (-1993.742) [-1982.388] (-1991.958) (-1986.875) * (-1985.574) [-1987.174] (-1996.107) (-1997.380) -- 0:02:21
563500 -- (-1994.900) (-1987.984) [-1986.105] (-1987.649) * (-1991.624) (-1986.502) [-1994.106] (-2002.282) -- 0:02:20
563600 -- (-1992.463) (-1988.214) (-1986.359) [-1984.337] * (-1987.074) [-1984.516] (-1994.448) (-1992.948) -- 0:02:20
563700 -- (-1988.895) (-1982.729) (-1987.980) [-1986.360] * [-1997.411] (-1980.624) (-1997.898) (-1989.041) -- 0:02:20
563800 -- (-1986.099) (-1992.123) (-1986.352) [-1984.616] * (-1992.970) [-1982.010] (-1993.473) (-1992.735) -- 0:02:20
563900 -- [-1985.888] (-1991.889) (-1993.832) (-1988.134) * (-1987.944) [-1983.529] (-1990.959) (-1989.941) -- 0:02:20
564000 -- (-1985.137) (-1994.361) (-1990.231) [-1985.512] * (-1993.281) [-1981.199] (-1989.193) (-1992.593) -- 0:02:20
Average standard deviation of split frequencies: 0.002865
564100 -- (-1983.373) (-1987.773) (-1991.426) [-1984.832] * (-1990.546) [-1982.728] (-1989.403) (-1992.044) -- 0:02:20
564200 -- [-1981.801] (-1995.732) (-1990.723) (-1982.977) * (-1997.118) [-1984.418] (-1986.355) (-1993.451) -- 0:02:20
564300 -- (-1979.422) (-1995.512) (-1987.607) [-1984.827] * (-1997.936) [-1985.304] (-1987.763) (-1997.387) -- 0:02:20
564400 -- (-1980.990) (-1988.562) (-1993.892) [-1985.366] * [-1997.876] (-1990.548) (-1995.542) (-1997.903) -- 0:02:21
564500 -- (-1989.125) [-1990.908] (-1988.301) (-1985.433) * (-1997.480) (-1988.811) (-1990.023) [-1990.011] -- 0:02:21
564600 -- (-1991.279) (-1988.310) [-1984.395] (-1987.820) * (-1992.467) [-1985.803] (-1987.298) (-1988.764) -- 0:02:21
564700 -- (-1989.879) [-1985.253] (-1989.900) (-1989.676) * (-1998.625) [-1985.861] (-1996.907) (-1995.924) -- 0:02:21
564800 -- (-1992.115) [-1985.395] (-1990.549) (-1988.085) * (-1999.257) [-1986.098] (-1996.858) (-1995.567) -- 0:02:21
564900 -- (-1987.657) [-1985.310] (-1990.175) (-1995.339) * (-1996.424) [-1988.550] (-2002.441) (-1999.473) -- 0:02:20
565000 -- (-1992.642) (-1985.244) [-1992.203] (-1994.223) * (-2000.171) [-1984.401] (-1991.406) (-1993.687) -- 0:02:20
Average standard deviation of split frequencies: 0.002717
565100 -- (-1998.302) [-1986.544] (-1986.442) (-1995.596) * (-1995.410) [-1988.132] (-1994.208) (-1996.840) -- 0:02:20
565200 -- (-1996.386) (-1988.249) [-1990.097] (-1995.620) * (-1984.279) (-1992.873) (-1998.034) [-1995.362] -- 0:02:20
565300 -- (-1994.342) [-1990.775] (-1993.595) (-2004.883) * (-1988.022) (-1988.255) [-1993.561] (-2013.914) -- 0:02:20
565400 -- (-1993.487) (-1991.540) [-1988.875] (-2001.746) * [-1990.364] (-1993.763) (-1994.945) (-1992.391) -- 0:02:20
565500 -- (-1988.876) (-1996.705) [-1987.703] (-1996.978) * [-1986.596] (-1987.784) (-2007.631) (-1990.217) -- 0:02:20
565600 -- (-1987.727) (-2000.679) [-1986.617] (-1991.999) * [-1992.443] (-1989.586) (-1998.187) (-1990.471) -- 0:02:20
565700 -- (-1984.029) [-1988.546] (-2003.776) (-1993.239) * (-2000.719) [-1990.448] (-1997.217) (-1989.727) -- 0:02:20
565800 -- [-1979.535] (-1989.608) (-1995.009) (-1993.631) * (-1996.370) [-1985.967] (-1991.520) (-1986.667) -- 0:02:20
565900 -- [-1980.205] (-1986.209) (-1991.244) (-1996.292) * (-1995.476) [-1984.832] (-1995.550) (-1993.587) -- 0:02:20
566000 -- [-1980.532] (-1989.043) (-1990.129) (-1993.641) * (-2002.537) [-1984.355] (-2006.327) (-1990.971) -- 0:02:20
Average standard deviation of split frequencies: 0.002855
566100 -- [-1983.899] (-1993.184) (-1990.352) (-1994.570) * (-2004.462) [-1982.213] (-1992.152) (-1993.054) -- 0:02:20
566200 -- (-1982.090) [-1990.530] (-1991.741) (-1995.559) * (-2000.766) [-1982.973] (-1986.583) (-1989.786) -- 0:02:20
566300 -- [-1983.632] (-1990.505) (-1988.448) (-2000.410) * (-1994.234) [-1986.099] (-1990.796) (-1996.958) -- 0:02:20
566400 -- [-1984.333] (-1988.681) (-1987.206) (-2006.580) * (-2004.101) (-1990.660) [-1989.954] (-1999.754) -- 0:02:20
566500 -- (-1987.725) (-1992.134) [-1986.227] (-2005.886) * (-2004.283) [-1988.418] (-1992.094) (-2009.317) -- 0:02:20
566600 -- (-1992.502) (-1987.689) [-1993.908] (-1994.826) * (-1997.724) [-1985.058] (-1999.873) (-1992.930) -- 0:02:19
566700 -- [-1991.760] (-1989.519) (-1993.165) (-1997.939) * (-1995.563) [-1990.777] (-1996.305) (-1988.187) -- 0:02:19
566800 -- (-1988.509) (-1991.549) [-1997.298] (-2000.726) * (-2001.030) (-1991.957) (-2002.417) [-1987.259] -- 0:02:19
566900 -- [-1986.478] (-1992.534) (-2000.479) (-1991.868) * [-1993.362] (-1991.592) (-1998.390) (-1984.412) -- 0:02:19
567000 -- (-1990.258) (-1996.146) (-2000.515) [-1987.580] * (-1997.050) (-1989.623) (-1997.211) [-1986.788] -- 0:02:19
Average standard deviation of split frequencies: 0.002802
567100 -- [-1987.168] (-1997.247) (-2003.029) (-1991.476) * [-1989.175] (-1989.685) (-1992.248) (-1984.627) -- 0:02:19
567200 -- [-1989.750] (-1993.230) (-2001.026) (-1987.141) * (-1993.237) (-1997.520) [-1988.919] (-1986.670) -- 0:02:19
567300 -- (-1989.846) (-1996.022) (-2002.345) [-1986.005] * (-1997.971) (-1997.306) (-1991.321) [-1990.532] -- 0:02:19
567400 -- (-1989.992) (-1997.300) (-2000.870) [-1982.322] * [-1989.708] (-1998.068) (-1992.837) (-1990.803) -- 0:02:20
567500 -- (-1986.070) (-1993.308) (-2002.128) [-1985.512] * [-1983.989] (-1993.991) (-1996.170) (-1990.733) -- 0:02:20
567600 -- (-1990.911) (-1991.858) (-1995.494) [-1979.498] * (-1983.146) [-1987.463] (-1991.410) (-1993.852) -- 0:02:20
567700 -- (-1993.270) (-1992.079) (-1996.004) [-1979.647] * (-1984.683) [-1985.176] (-1992.806) (-1998.831) -- 0:02:20
567800 -- (-1998.866) (-1994.266) (-2000.045) [-1980.325] * (-1990.734) [-1984.115] (-2000.990) (-1997.523) -- 0:02:20
567900 -- (-2000.792) (-1996.135) (-1993.538) [-1989.368] * (-1990.137) [-1988.953] (-2001.160) (-2003.200) -- 0:02:20
568000 -- (-2003.045) (-2002.511) [-1989.333] (-1994.542) * (-1988.563) [-1986.209] (-2004.723) (-1993.903) -- 0:02:19
Average standard deviation of split frequencies: 0.002489
568100 -- (-2004.297) (-1995.486) (-1992.314) [-1992.404] * (-1989.977) [-1985.008] (-2001.479) (-1993.854) -- 0:02:19
568200 -- (-2011.672) [-1997.942] (-1991.028) (-1994.896) * [-1988.920] (-1982.528) (-1999.915) (-2004.875) -- 0:02:19
568300 -- (-1997.773) [-1990.832] (-1986.587) (-1993.726) * (-1992.557) [-1983.447] (-1991.283) (-2004.115) -- 0:02:19
568400 -- (-1993.762) (-1989.445) [-1986.399] (-1990.299) * (-1985.935) (-1981.089) [-1989.577] (-2002.907) -- 0:02:19
568500 -- (-1996.183) (-1993.121) [-1984.621] (-1991.840) * [-1981.747] (-1986.584) (-1992.624) (-2002.589) -- 0:02:19
568600 -- [-1993.427] (-1998.713) (-1986.006) (-1986.597) * [-1979.331] (-1990.984) (-1991.661) (-2000.361) -- 0:02:19
568700 -- [-1993.537] (-1992.732) (-1986.521) (-1983.596) * [-1980.477] (-1986.698) (-1997.963) (-2000.302) -- 0:02:19
568800 -- (-1995.654) (-1993.806) (-1991.924) [-1983.192] * [-1976.826] (-1989.349) (-1993.123) (-2010.431) -- 0:02:19
568900 -- (-1998.228) (-1998.554) (-1988.759) [-1981.632] * [-1985.815] (-1989.830) (-1993.350) (-2000.209) -- 0:02:19
569000 -- (-1994.889) (-1990.599) (-1985.529) [-1980.445] * [-1984.516] (-1992.744) (-2000.832) (-1992.084) -- 0:02:19
Average standard deviation of split frequencies: 0.002414
569100 -- (-1998.098) (-1998.300) [-1985.937] (-1986.374) * [-1984.308] (-1981.966) (-1995.996) (-1993.017) -- 0:02:19
569200 -- [-1995.490] (-1999.483) (-1986.229) (-1989.455) * (-1982.997) [-1983.558] (-2000.701) (-1995.100) -- 0:02:19
569300 -- (-1991.956) (-2003.374) (-1989.985) [-1985.092] * (-1991.655) [-1982.886] (-2003.460) (-2002.446) -- 0:02:19
569400 -- (-1989.419) (-1995.111) (-1984.924) [-1984.000] * (-1985.867) (-1985.763) [-1995.944] (-2000.466) -- 0:02:19
569500 -- (-2003.146) (-1995.009) (-1987.674) [-1983.462] * (-1985.695) [-1981.181] (-1993.033) (-1991.887) -- 0:02:19
569600 -- (-1993.989) (-1993.320) (-1997.901) [-1982.833] * (-1989.805) [-1979.984] (-2001.057) (-1989.370) -- 0:02:19
569700 -- (-1991.616) (-1999.890) (-1994.648) [-1981.155] * (-1993.848) [-1981.299] (-1998.428) (-1995.662) -- 0:02:18
569800 -- (-1998.341) (-1994.346) (-1992.785) [-1982.337] * (-1984.305) [-1984.720] (-1997.953) (-1993.292) -- 0:02:18
569900 -- (-1994.572) (-1992.362) [-1989.791] (-1984.859) * (-1987.128) [-1991.124] (-1989.002) (-1989.764) -- 0:02:18
570000 -- [-1992.899] (-2000.690) (-1988.131) (-1980.124) * (-1982.905) [-1983.005] (-1994.072) (-1992.542) -- 0:02:18
Average standard deviation of split frequencies: 0.002528
570100 -- (-2000.740) (-1991.016) [-1992.070] (-1986.996) * (-1982.453) [-1983.541] (-1999.718) (-1989.762) -- 0:02:18
570200 -- (-1994.352) (-1995.400) (-1991.113) [-1991.151] * [-1981.974] (-1986.245) (-2004.141) (-1996.556) -- 0:02:18
570300 -- (-1992.402) (-1997.574) (-1991.160) [-1985.633] * (-1978.954) [-1988.193] (-2002.316) (-1995.712) -- 0:02:18
570400 -- [-1991.207] (-1996.515) (-1989.519) (-1987.371) * [-1982.946] (-1991.247) (-1999.122) (-1994.380) -- 0:02:18
570500 -- (-1989.390) [-1988.298] (-1990.274) (-1987.289) * (-1988.542) [-1995.218] (-1997.656) (-1993.316) -- 0:02:19
570600 -- [-1986.410] (-1992.483) (-1993.766) (-1990.857) * [-1984.934] (-1996.511) (-1993.920) (-1997.308) -- 0:02:19
570700 -- [-1988.003] (-1991.132) (-1987.799) (-1987.511) * [-1983.867] (-1994.497) (-1993.703) (-1990.781) -- 0:02:19
570800 -- (-1987.579) (-1996.644) [-1988.096] (-1986.387) * (-1993.607) (-1994.898) (-1996.158) [-1988.144] -- 0:02:19
570900 -- (-1988.465) [-1987.601] (-1988.459) (-1987.556) * (-1988.614) (-1992.205) [-1993.359] (-1987.003) -- 0:02:19
571000 -- (-1991.480) [-1985.898] (-1989.518) (-1994.010) * (-1989.608) (-2003.807) [-1991.291] (-1992.519) -- 0:02:18
Average standard deviation of split frequencies: 0.002452
571100 -- (-1987.281) [-1987.043] (-1997.030) (-1993.463) * [-1987.042] (-1996.651) (-1993.559) (-2003.649) -- 0:02:18
571200 -- (-1992.117) [-1988.064] (-1997.191) (-1991.880) * (-1985.890) (-1984.821) [-1992.479] (-2003.133) -- 0:02:18
571300 -- (-1995.221) (-1988.526) (-1988.962) [-1984.394] * (-1982.623) (-1991.621) [-1985.954] (-2004.313) -- 0:02:18
571400 -- (-1997.522) (-1993.864) (-1989.386) [-1982.669] * (-1983.818) (-1989.626) [-1985.826] (-2007.922) -- 0:02:18
571500 -- (-1995.161) (-1998.791) (-1988.354) [-1986.075] * [-1985.101] (-1989.561) (-1987.537) (-2005.415) -- 0:02:18
571600 -- (-1994.531) (-2003.586) (-1991.435) [-1985.729] * (-1991.677) [-1982.112] (-2001.282) (-1998.345) -- 0:02:18
571700 -- (-1994.096) (-2008.532) (-1985.601) [-1985.425] * (-1990.371) [-1979.538] (-2003.566) (-2001.089) -- 0:02:18
571800 -- (-1988.504) (-1992.519) [-1988.968] (-1988.554) * [-1992.304] (-1982.278) (-2001.700) (-2002.616) -- 0:02:18
571900 -- (-1992.189) (-1991.067) [-1981.766] (-1984.946) * (-2002.044) (-1995.231) (-2000.729) [-2005.200] -- 0:02:18
572000 -- (-1990.473) (-1991.634) (-1982.660) [-1984.935] * (-1989.104) [-1984.923] (-1998.084) (-2006.113) -- 0:02:18
Average standard deviation of split frequencies: 0.002401
572100 -- (-1993.864) (-1991.580) (-1990.760) [-1984.077] * (-1985.808) (-1991.036) [-1994.805] (-2014.213) -- 0:02:18
572200 -- [-1992.268] (-1991.735) (-1989.785) (-1989.308) * [-1980.920] (-1987.042) (-1994.304) (-2014.768) -- 0:02:18
572300 -- (-1994.413) (-1996.748) [-1982.950] (-1984.574) * [-1979.809] (-1988.414) (-1998.812) (-2006.762) -- 0:02:18
572400 -- (-2007.940) [-1995.107] (-1987.379) (-1981.130) * (-1982.522) [-1980.555] (-2002.691) (-2004.101) -- 0:02:18
572500 -- (-2003.075) (-1988.127) (-1984.693) [-1984.438] * (-1979.719) [-1983.319] (-2005.704) (-2003.854) -- 0:02:18
572600 -- (-2000.525) (-1992.413) (-1989.742) [-1981.758] * (-1980.552) [-1985.031] (-1997.794) (-2012.530) -- 0:02:18
572700 -- (-1996.443) (-1999.868) (-1997.488) [-1985.328] * (-1979.940) [-1978.235] (-2004.378) (-2008.674) -- 0:02:18
572800 -- [-1989.695] (-2002.909) (-1995.044) (-1987.981) * [-1986.063] (-1982.995) (-2002.791) (-2008.478) -- 0:02:17
572900 -- [-1987.812] (-1996.099) (-1997.186) (-1986.534) * [-1988.366] (-1984.876) (-2004.064) (-2011.761) -- 0:02:17
573000 -- (-1992.354) (-1987.554) (-1992.863) [-1989.384] * (-1986.425) [-1984.846] (-1998.845) (-2002.628) -- 0:02:17
Average standard deviation of split frequencies: 0.002491
573100 -- (-1998.051) (-1985.345) (-1995.164) [-1983.313] * (-1983.691) [-1986.544] (-1995.012) (-2005.287) -- 0:02:17
573200 -- (-1993.298) (-1987.345) [-1991.228] (-1987.334) * [-1987.476] (-1992.675) (-1996.072) (-2001.404) -- 0:02:17
573300 -- (-1993.732) (-1986.207) (-1995.963) [-1982.106] * [-1982.563] (-1987.838) (-1994.201) (-2007.284) -- 0:02:17
573400 -- (-2000.450) (-1990.981) (-1995.144) [-1984.902] * [-1984.805] (-1991.796) (-1997.800) (-2004.738) -- 0:02:17
573500 -- (-1996.232) [-1985.557] (-2007.557) (-1987.271) * [-1992.416] (-1990.034) (-1997.588) (-2002.178) -- 0:02:18
573600 -- (-1997.745) (-1984.823) (-2010.345) [-1983.375] * (-1990.735) (-1987.276) [-1989.760] (-1993.702) -- 0:02:18
573700 -- (-1993.758) [-1987.578] (-1997.095) (-1987.571) * (-1989.453) (-1985.946) [-1983.069] (-2004.359) -- 0:02:18
573800 -- (-1991.259) [-1991.742] (-2006.013) (-1990.074) * (-1992.340) (-1989.375) [-1987.276] (-1992.708) -- 0:02:18
573900 -- [-1990.020] (-1994.721) (-2006.822) (-1983.687) * (-1983.979) (-1993.984) [-1990.420] (-1995.942) -- 0:02:18
574000 -- (-1992.316) (-1991.022) (-1997.819) [-1986.174] * [-1986.510] (-2002.838) (-1989.754) (-1997.004) -- 0:02:18
Average standard deviation of split frequencies: 0.002581
574100 -- [-1992.339] (-1987.815) (-1994.072) (-1988.228) * (-1985.619) [-1991.260] (-1989.808) (-1995.663) -- 0:02:17
574200 -- (-1995.760) [-1982.089] (-1994.733) (-1983.056) * [-1984.333] (-1993.998) (-1991.664) (-2007.815) -- 0:02:17
574300 -- (-1991.255) (-1984.637) (-1994.844) [-1985.120] * [-1981.392] (-1991.615) (-1989.991) (-2001.266) -- 0:02:17
574400 -- (-1984.800) (-1998.245) (-1991.719) [-1987.226] * (-1984.662) (-2009.102) (-1990.766) [-1998.704] -- 0:02:17
574500 -- (-1993.316) (-1995.254) (-1991.525) [-1984.887] * (-1985.250) (-2006.176) [-1984.627] (-2004.079) -- 0:02:17
574600 -- [-1988.388] (-1989.991) (-1991.811) (-1987.888) * (-1983.231) (-2008.632) [-1978.813] (-1999.964) -- 0:02:17
574700 -- (-1987.752) (-1996.480) (-1995.380) [-1988.163] * [-1981.619] (-1998.267) (-1978.156) (-2000.440) -- 0:02:17
574800 -- [-1983.728] (-1996.692) (-1993.789) (-1994.469) * [-1980.139] (-1999.385) (-1982.649) (-2001.806) -- 0:02:17
574900 -- [-1989.549] (-1992.469) (-1997.444) (-1992.974) * (-1985.989) (-1995.113) [-1980.933] (-1998.129) -- 0:02:17
575000 -- (-1992.522) (-1985.323) [-1992.802] (-1998.114) * (-1987.896) (-1993.304) [-1983.832] (-2016.981) -- 0:02:17
Average standard deviation of split frequencies: 0.002576
575100 -- (-2001.956) [-1990.550] (-1986.809) (-1993.062) * (-1990.394) (-1996.116) [-1984.734] (-1999.423) -- 0:02:17
575200 -- (-2003.698) [-1988.572] (-1988.347) (-1990.780) * (-1989.531) (-1992.020) [-1981.545] (-1998.576) -- 0:02:17
575300 -- (-2000.309) [-1989.481] (-1992.030) (-1990.599) * [-1986.449] (-1997.690) (-1985.744) (-1989.011) -- 0:02:17
575400 -- (-2003.088) [-1986.982] (-1990.350) (-1984.263) * [-1985.349] (-1993.294) (-1992.026) (-1996.279) -- 0:02:17
575500 -- (-2008.566) [-1986.737] (-1994.889) (-1985.741) * [-1984.516] (-1988.359) (-1994.120) (-1997.144) -- 0:02:17
575600 -- (-2006.862) (-1989.593) (-1991.952) [-1984.065] * [-1990.245] (-1997.536) (-1993.918) (-1995.638) -- 0:02:17
575700 -- (-1999.571) [-1988.098] (-2000.423) (-1981.294) * (-1990.889) [-1997.803] (-1990.269) (-1995.876) -- 0:02:17
575800 -- (-1990.829) (-1992.965) (-1995.925) [-1980.009] * [-1982.146] (-1997.935) (-1986.759) (-2006.007) -- 0:02:17
575900 -- (-1995.827) (-1990.116) (-1993.212) [-1980.837] * (-1990.020) (-1996.526) [-1984.590] (-2013.971) -- 0:02:16
576000 -- (-1993.519) (-1987.710) (-1995.799) [-1988.812] * (-1991.707) (-1991.751) [-1984.419] (-1999.306) -- 0:02:16
Average standard deviation of split frequencies: 0.002618
576100 -- [-1992.493] (-1992.903) (-1988.581) (-1987.718) * (-1986.463) (-1999.772) [-1982.457] (-1997.888) -- 0:02:16
576200 -- (-1989.444) (-1990.813) [-1985.839] (-1990.292) * [-1983.370] (-2003.944) (-1984.942) (-1997.053) -- 0:02:16
576300 -- (-1996.143) (-1987.844) (-1989.609) [-1984.792] * [-1982.556] (-1999.590) (-1992.218) (-1997.763) -- 0:02:16
576400 -- [-1990.774] (-1995.435) (-1994.167) (-1990.328) * (-1986.218) (-2001.532) (-1990.917) [-1993.289] -- 0:02:16
576500 -- [-1988.379] (-1988.663) (-1994.136) (-1989.296) * [-1984.276] (-1997.179) (-2002.998) (-1993.759) -- 0:02:16
576600 -- (-1992.712) (-1989.435) (-1997.683) [-1986.090] * (-1993.458) [-1993.213] (-1995.826) (-1993.428) -- 0:02:17
576700 -- (-1995.406) (-1985.369) (-1992.475) [-1993.104] * (-1989.191) [-1990.993] (-1996.193) (-1990.819) -- 0:02:17
576800 -- (-1993.228) (-1986.553) (-1992.454) [-1985.082] * (-1986.649) [-1992.136] (-1992.901) (-1996.816) -- 0:02:17
576900 -- (-1987.825) [-1989.550] (-1996.753) (-1988.461) * [-1986.515] (-1997.559) (-1991.779) (-1994.744) -- 0:02:17
577000 -- (-1996.504) (-1997.226) (-1992.566) [-1991.256] * [-1978.183] (-2001.450) (-2002.931) (-1991.417) -- 0:02:17
Average standard deviation of split frequencies: 0.002613
577100 -- (-1992.334) (-2004.485) (-1996.161) [-1988.285] * [-1984.208] (-1988.674) (-1995.605) (-1984.666) -- 0:02:17
577200 -- (-1999.296) (-2010.248) (-1991.275) [-1983.119] * [-1986.697] (-1994.699) (-1992.160) (-1989.233) -- 0:02:16
577300 -- (-1996.597) (-2001.137) (-1990.116) [-1987.067] * [-1986.078] (-1989.854) (-1993.013) (-1989.902) -- 0:02:16
577400 -- (-1996.370) (-1995.725) (-1986.472) [-1990.004] * [-1983.475] (-1988.052) (-1993.807) (-1997.589) -- 0:02:16
577500 -- (-2007.942) (-1993.127) [-1986.802] (-1984.990) * [-1984.189] (-1991.887) (-1990.894) (-1998.858) -- 0:02:16
577600 -- [-1995.619] (-1996.185) (-1989.111) (-1985.024) * (-1988.696) (-1993.592) [-1990.438] (-1996.960) -- 0:02:16
577700 -- (-2004.471) (-2001.819) [-1986.408] (-1990.449) * (-1991.802) [-1989.538] (-1997.129) (-1992.051) -- 0:02:16
577800 -- (-1994.553) (-1996.150) (-1989.315) [-1989.636] * (-1992.179) [-1983.642] (-2000.574) (-1992.558) -- 0:02:16
577900 -- (-1995.597) (-1991.438) (-1995.666) [-1983.342] * (-1991.846) (-1990.841) (-1997.360) [-1987.406] -- 0:02:16
578000 -- (-1996.431) (-1990.800) [-1993.027] (-1988.982) * [-1986.335] (-1988.127) (-1992.201) (-1993.231) -- 0:02:16
Average standard deviation of split frequencies: 0.002889
578100 -- (-2010.563) (-1990.060) [-1990.984] (-1994.227) * [-1994.720] (-1985.833) (-1995.134) (-1992.060) -- 0:02:16
578200 -- (-2010.235) (-1993.318) [-1986.684] (-1992.302) * (-1991.667) (-1986.370) (-1992.538) [-1987.544] -- 0:02:16
578300 -- (-2002.724) (-2004.388) [-1988.994] (-1988.574) * (-1988.963) (-1984.200) (-1988.782) [-1988.845] -- 0:02:16
578400 -- (-2000.459) (-1990.539) (-1994.376) [-1984.059] * (-1995.361) (-2000.067) (-1988.610) [-1985.012] -- 0:02:16
578500 -- (-1996.402) (-1984.954) (-1994.375) [-1990.416] * (-1987.527) (-1998.956) (-1985.852) [-1984.899] -- 0:02:16
578600 -- (-1999.421) (-1987.160) (-1997.642) [-1992.528] * (-1986.592) (-2000.067) [-1986.906] (-1986.475) -- 0:02:16
578700 -- (-2002.701) [-1987.813] (-1997.805) (-1985.745) * [-1981.067] (-2006.631) (-1984.926) (-1992.529) -- 0:02:16
578800 -- (-2001.674) [-1988.489] (-2002.779) (-1992.908) * [-1979.735] (-1999.329) (-1983.093) (-1990.706) -- 0:02:16
578900 -- (-1997.052) (-1987.505) (-2007.898) [-1992.139] * (-1983.210) (-1998.475) [-1984.738] (-2006.874) -- 0:02:16
579000 -- (-1999.087) [-1989.196] (-2005.213) (-1992.682) * (-1980.084) (-1992.098) [-1981.429] (-2008.273) -- 0:02:15
Average standard deviation of split frequencies: 0.002744
579100 -- (-1995.032) [-1988.363] (-2010.653) (-1988.248) * (-1981.817) (-1998.588) [-1985.140] (-1995.294) -- 0:02:15
579200 -- (-2005.483) [-1981.267] (-2013.677) (-1988.421) * (-1983.170) (-1992.414) [-1984.933] (-1986.229) -- 0:02:15
579300 -- (-2009.880) [-1983.217] (-2003.101) (-1987.238) * (-1990.159) (-1997.819) [-1988.364] (-1993.621) -- 0:02:15
579400 -- (-2001.407) [-1984.443] (-2004.402) (-1994.609) * (-1987.263) (-2002.874) (-1987.236) [-1988.062] -- 0:02:15
579500 -- (-1998.919) [-1984.732] (-1991.000) (-2000.828) * (-1989.259) [-1985.597] (-1986.840) (-1989.116) -- 0:02:15
579600 -- (-1999.720) [-1980.942] (-1996.710) (-1997.766) * (-1984.660) (-1991.726) [-1984.604] (-1990.466) -- 0:02:16
579700 -- (-2003.485) [-1977.256] (-1994.071) (-1997.790) * [-1977.671] (-1999.581) (-1991.018) (-1991.954) -- 0:02:16
579800 -- (-1996.226) (-1982.258) (-1992.055) [-1999.640] * [-1980.188] (-1985.577) (-1998.832) (-1994.659) -- 0:02:16
579900 -- (-2000.697) [-1979.906] (-1994.020) (-1992.346) * (-1982.722) [-1982.454] (-1985.925) (-1988.113) -- 0:02:16
580000 -- (-2015.687) [-1979.159] (-1991.757) (-1992.375) * (-1988.322) (-1986.317) [-1986.517] (-1994.375) -- 0:02:16
Average standard deviation of split frequencies: 0.002670
580100 -- (-2005.048) [-1981.724] (-1989.627) (-1992.251) * [-1988.100] (-1990.670) (-1996.855) (-1989.958) -- 0:02:16
580200 -- (-2003.201) [-1981.819] (-1989.279) (-1989.167) * (-1988.076) [-1986.765] (-1995.011) (-1983.879) -- 0:02:16
580300 -- [-1992.370] (-1985.084) (-1989.072) (-1988.301) * (-1991.401) (-1990.350) (-1986.253) [-1985.609] -- 0:02:15
580400 -- (-1991.057) (-1989.247) (-1990.261) [-1986.026] * [-1991.470] (-1995.481) (-1990.549) (-1987.224) -- 0:02:15
580500 -- (-1991.796) [-1981.737] (-1991.845) (-1986.118) * [-1992.248] (-1993.354) (-1985.654) (-1992.379) -- 0:02:15
580600 -- (-1997.561) (-1986.927) (-1994.583) [-1988.555] * (-1988.648) (-1988.445) [-1981.188] (-1989.495) -- 0:02:15
580700 -- (-1999.734) [-1983.320] (-1994.011) (-1993.466) * (-1983.978) (-1990.472) [-1981.964] (-1988.465) -- 0:02:15
580800 -- [-1987.961] (-1984.615) (-1992.584) (-2000.782) * [-1983.143] (-1999.904) (-1985.388) (-1988.700) -- 0:02:15
580900 -- (-1997.075) [-1983.106] (-1989.438) (-1999.173) * [-1982.187] (-1995.266) (-1991.809) (-1994.690) -- 0:02:15
581000 -- (-1992.873) [-1983.605] (-1987.273) (-1999.575) * [-1982.530] (-1995.372) (-1987.736) (-1991.426) -- 0:02:15
Average standard deviation of split frequencies: 0.002735
581100 -- (-1993.423) (-1982.788) [-1986.228] (-2000.451) * [-1981.238] (-2004.476) (-1983.310) (-1991.762) -- 0:02:15
581200 -- (-1994.145) (-1980.172) [-1989.565] (-1996.621) * (-1979.881) (-1999.397) [-1983.862] (-2001.170) -- 0:02:15
581300 -- (-1996.319) (-1985.576) [-1989.987] (-1994.873) * (-1979.118) (-2008.956) [-1979.624] (-2007.716) -- 0:02:15
581400 -- (-1995.485) (-1987.177) (-1988.592) [-1988.090] * (-1983.598) (-2001.000) [-1980.494] (-1993.183) -- 0:02:15
581500 -- (-1997.053) [-1986.107] (-2008.429) (-1992.407) * (-1983.025) (-2002.904) [-1981.341] (-1991.779) -- 0:02:15
581600 -- [-1993.353] (-1985.765) (-2015.236) (-2001.803) * (-1985.785) (-1996.141) [-1981.911] (-1993.115) -- 0:02:15
581700 -- (-1997.523) [-1984.311] (-1987.337) (-2003.764) * [-1978.959] (-1995.173) (-1986.908) (-1988.583) -- 0:02:15
581800 -- (-1994.817) [-1983.170] (-1989.259) (-2002.640) * [-1980.610] (-1999.546) (-1987.273) (-1992.109) -- 0:02:15
581900 -- (-1991.191) [-1978.044] (-1993.398) (-2000.436) * (-1978.815) (-1998.063) [-1986.585] (-1987.302) -- 0:02:15
582000 -- (-1997.978) [-1981.731] (-1993.835) (-1994.609) * (-1983.663) (-1995.610) [-1987.631] (-1990.811) -- 0:02:15
Average standard deviation of split frequencies: 0.002684
582100 -- (-1996.314) (-1983.307) [-1995.529] (-1995.879) * (-1982.772) (-1996.683) [-1985.713] (-1997.395) -- 0:02:14
582200 -- (-1998.182) [-1983.614] (-1996.107) (-1992.162) * [-1979.762] (-1999.206) (-1989.715) (-2000.596) -- 0:02:14
582300 -- (-2000.352) [-1982.842] (-1992.219) (-1996.189) * (-1978.076) (-1991.554) [-1985.620] (-1996.904) -- 0:02:14
582400 -- (-2004.069) [-1983.310] (-1990.626) (-1999.652) * (-1985.828) (-1993.860) [-1983.374] (-2004.343) -- 0:02:14
582500 -- (-1998.348) [-1978.701] (-1992.412) (-1995.686) * [-1981.867] (-2000.059) (-1989.891) (-1993.874) -- 0:02:14
582600 -- (-1992.258) [-1975.892] (-1993.196) (-1997.707) * [-1978.292] (-1999.264) (-1987.310) (-1991.121) -- 0:02:15
582700 -- (-1991.414) [-1976.824] (-1990.014) (-2003.187) * (-1978.655) (-1998.636) [-1987.757] (-1994.734) -- 0:02:15
582800 -- (-1992.197) [-1979.393] (-1991.777) (-1996.056) * [-1984.390] (-1985.430) (-1988.433) (-1995.915) -- 0:02:15
582900 -- (-1988.000) [-1984.111] (-1994.413) (-1996.369) * [-1980.832] (-1990.009) (-1987.898) (-1994.979) -- 0:02:15
583000 -- (-1994.981) [-1985.864] (-1991.259) (-1999.790) * [-1981.283] (-1990.108) (-1989.150) (-1996.177) -- 0:02:15
Average standard deviation of split frequencies: 0.002679
583100 -- (-1999.289) [-1983.407] (-1991.895) (-1997.869) * [-1982.900] (-1991.601) (-1989.377) (-1996.372) -- 0:02:15
583200 -- (-1992.049) (-1983.032) [-1990.372] (-2000.039) * (-1987.022) (-2001.820) [-1987.028] (-1998.120) -- 0:02:15
583300 -- (-1995.040) [-1988.894] (-1988.659) (-1988.369) * (-1986.533) (-2014.702) [-1987.754] (-2001.605) -- 0:02:15
583400 -- (-1992.555) [-1986.254] (-1985.234) (-1990.990) * (-1987.816) (-1997.564) [-1978.100] (-1994.730) -- 0:02:14
583500 -- (-1991.756) [-1983.565] (-1991.105) (-1996.184) * (-1993.514) (-2000.402) [-1982.873] (-1992.651) -- 0:02:14
583600 -- (-1996.388) [-1980.194] (-1990.903) (-2000.241) * [-1989.671] (-1999.354) (-1988.158) (-1994.117) -- 0:02:14
583700 -- (-1992.419) (-1975.876) [-1991.710] (-1992.670) * (-1987.398) (-2000.592) [-1988.106] (-1995.195) -- 0:02:14
583800 -- (-1996.491) [-1979.357] (-1995.956) (-1993.501) * (-1990.671) (-1998.214) (-1989.977) [-1996.841] -- 0:02:14
583900 -- (-1991.157) [-1981.855] (-1998.460) (-2006.737) * (-1994.093) (-1999.584) [-1987.602] (-1993.940) -- 0:02:14
584000 -- (-1995.620) [-1981.550] (-1997.908) (-1999.892) * [-1985.790] (-1991.048) (-1990.194) (-1995.040) -- 0:02:14
Average standard deviation of split frequencies: 0.002721
584100 -- (-1994.478) [-1982.165] (-1998.015) (-1989.699) * (-1982.384) (-1992.235) [-1984.812] (-2008.089) -- 0:02:14
584200 -- (-1995.995) [-1981.209] (-1995.256) (-1997.350) * [-1985.239] (-1989.360) (-1992.253) (-1992.598) -- 0:02:14
584300 -- (-1992.458) [-1981.868] (-1996.487) (-1997.857) * (-1992.027) [-1993.388] (-1984.815) (-1989.915) -- 0:02:14
584400 -- (-2000.081) [-1985.100] (-2008.151) (-1999.867) * (-1991.781) (-1987.873) [-1984.234] (-1995.925) -- 0:02:14
584500 -- (-1996.140) (-1981.811) (-2005.978) [-1996.745] * (-1992.794) [-1983.928] (-1982.338) (-1994.411) -- 0:02:14
584600 -- [-1992.594] (-1981.134) (-1994.624) (-2000.048) * (-1992.071) [-1986.168] (-1987.377) (-1992.403) -- 0:02:14
584700 -- (-2004.112) [-1980.299] (-1996.445) (-1999.316) * (-1996.468) (-1988.203) [-1990.370] (-1993.589) -- 0:02:14
584800 -- (-2005.238) [-1984.009] (-2002.138) (-1999.372) * (-1994.810) (-1988.213) [-1984.961] (-1989.402) -- 0:02:14
584900 -- (-2004.795) (-1990.125) (-1999.854) [-2001.694] * (-2000.539) (-1990.331) [-1988.284] (-1998.816) -- 0:02:14
585000 -- (-2004.708) [-1989.710] (-1988.128) (-1997.465) * (-1998.353) [-1987.841] (-1989.084) (-2002.849) -- 0:02:14
Average standard deviation of split frequencies: 0.002624
585100 -- (-2008.297) (-1998.287) (-1993.199) [-1988.506] * (-1994.581) [-1988.840] (-1982.779) (-2001.255) -- 0:02:14
585200 -- (-2011.181) (-1989.392) (-1994.631) [-1990.486] * (-1992.122) (-1996.636) [-1981.575] (-2002.211) -- 0:02:13
585300 -- (-2009.539) (-1987.681) (-2000.137) [-1991.651] * (-1986.852) (-1997.568) [-1985.084] (-2015.687) -- 0:02:13
585400 -- (-2003.390) [-1985.703] (-2002.211) (-1988.404) * (-1983.957) [-1989.305] (-2000.077) (-2008.476) -- 0:02:13
585500 -- (-1996.226) (-1988.970) [-1995.407] (-1993.190) * [-1982.618] (-1992.651) (-1995.855) (-2007.339) -- 0:02:13
585600 -- (-1995.379) [-1986.047] (-1998.359) (-1991.349) * (-1986.164) (-1992.303) [-1985.995] (-2001.097) -- 0:02:13
585700 -- (-1993.891) (-1988.024) [-1996.838] (-1988.834) * (-1986.638) [-1986.752] (-2000.276) (-1999.627) -- 0:02:14
585800 -- (-1998.034) [-1989.943] (-1997.030) (-1987.367) * [-1988.558] (-1986.738) (-1998.835) (-2007.028) -- 0:02:14
585900 -- (-1994.507) [-1986.750] (-2002.258) (-1995.424) * [-1982.588] (-1985.497) (-1990.250) (-2006.016) -- 0:02:14
586000 -- (-1993.995) [-1984.290] (-2007.626) (-1998.188) * [-1984.613] (-1991.137) (-1992.316) (-2012.059) -- 0:02:14
Average standard deviation of split frequencies: 0.002620
586100 -- (-1990.385) [-1981.265] (-2009.802) (-1999.302) * [-1986.238] (-1993.144) (-1984.793) (-1999.225) -- 0:02:14
586200 -- [-1992.271] (-1989.616) (-2007.230) (-2001.852) * (-1984.327) (-2004.393) [-1983.898] (-2004.011) -- 0:02:14
586300 -- [-1993.284] (-1989.799) (-2007.734) (-1994.292) * [-1986.295] (-1992.537) (-1987.089) (-1999.719) -- 0:02:14
586400 -- (-1992.660) [-1983.924] (-2006.506) (-1987.032) * [-1983.038] (-1993.065) (-1990.764) (-2004.280) -- 0:02:14
586500 -- (-1994.506) [-1982.627] (-2013.988) (-1988.503) * [-1985.251] (-1989.362) (-1991.961) (-2010.672) -- 0:02:13
586600 -- (-1991.941) (-1986.992) (-2003.170) [-1990.676] * [-1987.120] (-1993.763) (-1990.672) (-2006.637) -- 0:02:13
586700 -- (-1993.762) [-1981.884] (-2000.687) (-1988.486) * (-1984.795) (-1995.677) [-1988.030] (-2008.152) -- 0:02:13
586800 -- (-2003.793) [-1980.785] (-2004.566) (-1993.600) * [-1983.685] (-2001.491) (-1989.040) (-2005.237) -- 0:02:13
586900 -- (-1994.222) [-1983.612] (-2018.649) (-1995.419) * (-1985.699) [-1994.251] (-1988.253) (-1995.108) -- 0:02:13
587000 -- (-1990.639) (-1980.290) (-2006.113) [-1985.414] * [-1983.239] (-1999.086) (-1991.893) (-1993.314) -- 0:02:13
Average standard deviation of split frequencies: 0.002661
587100 -- (-1988.131) [-1980.573] (-2006.358) (-1986.223) * (-1989.679) (-1996.724) [-1985.488] (-1995.101) -- 0:02:13
587200 -- (-1989.510) [-1985.019] (-2001.677) (-1997.149) * (-1992.621) (-1994.676) [-1983.043] (-2001.063) -- 0:02:13
587300 -- (-1991.314) [-1986.228] (-2005.377) (-1992.527) * (-1987.075) (-1995.072) [-1984.984] (-2006.055) -- 0:02:13
587400 -- (-1998.458) (-1992.118) (-1996.989) [-1992.582] * (-1991.232) (-1995.863) [-1983.910] (-2016.010) -- 0:02:13
587500 -- (-2013.245) [-1984.561] (-2001.982) (-1989.668) * [-1987.309] (-2003.247) (-1986.604) (-2002.209) -- 0:02:13
587600 -- (-2008.413) (-1985.068) (-2001.819) [-1999.182] * (-1988.561) (-2015.362) [-1985.522] (-1997.061) -- 0:02:13
587700 -- (-2003.873) [-1988.535] (-1997.932) (-1994.646) * (-1991.158) (-2007.809) [-1982.034] (-2000.659) -- 0:02:13
587800 -- (-1992.975) [-1983.874] (-1995.967) (-1996.455) * (-1992.914) (-2007.301) [-1985.108] (-1995.539) -- 0:02:13
587900 -- (-1999.278) [-1986.340] (-1994.336) (-1998.433) * (-1993.105) (-1999.003) (-1987.442) [-1992.513] -- 0:02:13
588000 -- (-2000.318) (-1983.972) [-1992.484] (-1999.079) * (-1994.396) [-1998.371] (-2003.126) (-1998.612) -- 0:02:13
Average standard deviation of split frequencies: 0.002656
588100 -- (-1995.623) [-1983.190] (-1991.153) (-2004.717) * [-1995.889] (-1991.682) (-1994.297) (-2001.936) -- 0:02:13
588200 -- (-1991.920) [-1986.212] (-1993.029) (-2002.366) * [-1999.222] (-1993.139) (-1999.416) (-2005.681) -- 0:02:13
588300 -- (-1990.781) [-1983.062] (-1997.914) (-1999.858) * (-1998.844) (-1992.411) [-1992.698] (-1996.740) -- 0:02:12
588400 -- [-1988.779] (-1986.048) (-2006.669) (-1995.611) * [-1995.950] (-1994.663) (-1998.234) (-2005.117) -- 0:02:12
588500 -- [-1988.436] (-1992.377) (-2006.199) (-1990.408) * [-1989.749] (-1995.406) (-1990.921) (-2000.211) -- 0:02:12
588600 -- (-1990.582) [-1991.664] (-2008.359) (-1993.144) * (-1990.446) (-1992.174) [-1987.161] (-1997.866) -- 0:02:12
588700 -- (-1989.653) (-1993.467) (-2005.110) [-1992.530] * (-1993.437) (-1995.811) [-1986.307] (-2000.317) -- 0:02:13
588800 -- [-1988.667] (-1990.290) (-2009.474) (-1988.045) * (-1991.602) (-1992.572) [-1985.578] (-1996.554) -- 0:02:13
588900 -- [-1987.701] (-1995.490) (-1999.630) (-1986.190) * (-1990.173) (-2001.002) [-1984.290] (-1994.902) -- 0:02:13
589000 -- [-1988.022] (-1990.560) (-2000.358) (-1993.319) * (-1992.058) (-1995.496) (-1981.634) [-1984.414] -- 0:02:13
Average standard deviation of split frequencies: 0.002515
589100 -- (-1991.307) [-1983.913] (-2002.389) (-1996.284) * (-2003.049) (-1995.143) [-1982.457] (-1991.797) -- 0:02:13
589200 -- [-1988.261] (-1987.015) (-2005.451) (-1994.176) * (-2001.938) (-1989.237) (-1986.243) [-1989.951] -- 0:02:13
589300 -- (-1987.050) [-1988.575] (-2012.881) (-1996.229) * (-2005.300) (-1998.934) [-1983.858] (-1986.313) -- 0:02:13
589400 -- [-1989.631] (-2000.864) (-2013.928) (-2003.346) * (-2001.856) (-1997.984) (-1996.458) [-1985.591] -- 0:02:13
589500 -- [-1987.473] (-1996.338) (-2009.326) (-2000.075) * (-1987.651) (-1998.478) (-1988.328) [-1985.367] -- 0:02:13
589600 -- (-1999.868) (-1992.403) (-2011.719) [-1993.451] * (-1990.541) (-2000.450) (-1997.729) [-1987.736] -- 0:02:12
589700 -- (-1998.238) (-1982.326) (-2010.796) [-1994.312] * (-1993.428) (-1993.671) (-1990.438) [-1991.114] -- 0:02:12
589800 -- (-1994.328) [-1983.815] (-2011.699) (-1999.783) * (-2001.289) [-1996.771] (-1990.942) (-1989.951) -- 0:02:12
589900 -- (-1992.406) [-1982.908] (-2013.845) (-2001.554) * (-1993.836) (-2000.426) (-1996.655) [-1988.009] -- 0:02:12
590000 -- [-1993.048] (-1980.206) (-2001.178) (-1998.052) * (-1994.185) (-2001.501) (-2000.010) [-1985.074] -- 0:02:12
Average standard deviation of split frequencies: 0.002511
590100 -- (-1990.220) [-1980.080] (-2007.634) (-1994.038) * (-1998.832) (-1995.497) (-1998.380) [-1986.338] -- 0:02:12
590200 -- [-1987.272] (-1978.725) (-1998.324) (-1998.179) * (-1994.129) [-1987.866] (-1993.823) (-1986.545) -- 0:02:12
590300 -- (-1996.598) [-1977.272] (-2004.327) (-1997.001) * (-2002.559) (-1998.051) (-1989.346) [-1988.902] -- 0:02:12
590400 -- (-2009.130) [-1986.659] (-1997.874) (-1991.804) * (-1995.857) (-1990.899) (-1984.137) [-1986.783] -- 0:02:12
590500 -- (-2007.455) [-1986.431] (-2000.970) (-1985.167) * (-1998.359) (-1990.327) (-1987.115) [-1987.535] -- 0:02:12
590600 -- (-2009.355) (-1979.764) [-1990.295] (-1985.997) * (-2000.497) (-1986.246) [-1987.833] (-1991.304) -- 0:02:12
590700 -- (-2007.973) [-1981.739] (-1990.865) (-1993.251) * (-2000.630) (-1983.925) (-2000.836) [-1989.846] -- 0:02:12
590800 -- (-2010.022) [-1991.225] (-1991.466) (-1993.370) * (-1996.605) [-1984.346] (-1992.249) (-1989.500) -- 0:02:12
590900 -- (-2011.850) [-1978.938] (-2000.922) (-1997.459) * (-1992.612) [-1986.660] (-1995.043) (-1990.381) -- 0:02:12
591000 -- (-2004.372) [-1984.229] (-1996.028) (-1998.982) * (-1991.705) [-1985.599] (-1999.528) (-2001.871) -- 0:02:12
Average standard deviation of split frequencies: 0.002506
591100 -- (-2000.909) [-1981.798] (-1998.192) (-1992.574) * [-1988.901] (-1989.961) (-1987.671) (-2001.182) -- 0:02:12
591200 -- (-2010.459) (-1990.814) [-1991.317] (-1991.158) * [-1985.420] (-1993.513) (-1985.981) (-2008.660) -- 0:02:12
591300 -- (-1997.448) [-1984.776] (-1996.250) (-1998.160) * (-1992.354) [-1989.845] (-1988.736) (-1999.945) -- 0:02:12
591400 -- (-2004.431) [-1985.786] (-1996.622) (-1998.927) * (-1983.714) (-1991.310) [-1983.244] (-2004.435) -- 0:02:11
591500 -- (-1994.721) [-1986.978] (-1991.887) (-1990.119) * (-1987.915) (-1996.876) [-1986.513] (-1999.931) -- 0:02:11
591600 -- (-1990.673) [-1983.138] (-1995.634) (-1996.304) * (-1989.277) (-1996.591) [-1984.767] (-2007.801) -- 0:02:11
591700 -- (-1995.057) [-1986.050] (-1993.775) (-1994.105) * (-1991.062) (-1990.374) [-1980.667] (-2007.738) -- 0:02:11
591800 -- (-1996.748) [-1988.923] (-1993.658) (-2005.771) * (-1989.520) (-1990.036) [-1982.017] (-2017.603) -- 0:02:12
591900 -- (-1992.672) [-1981.490] (-1987.088) (-2003.474) * (-1989.834) (-1989.534) [-1979.900] (-2005.838) -- 0:02:12
592000 -- (-1989.858) [-1979.551] (-1988.294) (-2010.841) * [-1982.769] (-1988.704) (-1978.317) (-1998.725) -- 0:02:12
Average standard deviation of split frequencies: 0.002525
592100 -- [-1986.186] (-1982.325) (-1991.032) (-2007.438) * (-1983.291) (-1990.879) [-1976.634] (-1999.616) -- 0:02:12
592200 -- (-1994.425) (-1984.804) [-1991.715] (-2002.143) * [-1984.789] (-1992.064) (-1980.304) (-2004.345) -- 0:02:12
592300 -- (-1992.374) [-1981.383] (-1995.846) (-2000.831) * (-1989.864) (-1998.001) [-1980.959] (-1996.880) -- 0:02:12
592400 -- (-1992.630) [-1978.877] (-1995.397) (-2002.642) * (-1989.546) (-1995.234) [-1980.783] (-1999.603) -- 0:02:12
592500 -- (-2000.818) [-1977.074] (-1996.519) (-1993.177) * (-1990.505) (-1997.284) [-1984.621] (-1996.501) -- 0:02:12
592600 -- (-2000.078) [-1982.180] (-1989.578) (-1994.293) * (-1988.309) (-1993.623) (-1987.565) [-1989.393] -- 0:02:11
592700 -- (-1991.708) [-1984.081] (-1988.766) (-1993.204) * (-1989.250) (-1991.534) [-1984.595] (-1997.239) -- 0:02:11
592800 -- [-1987.654] (-1984.094) (-1991.564) (-1994.896) * [-1985.977] (-1991.400) (-1988.819) (-1990.915) -- 0:02:11
592900 -- (-1991.275) [-1982.057] (-1994.540) (-1998.302) * (-1998.931) (-1993.350) (-1994.023) [-1988.801] -- 0:02:11
593000 -- (-1992.887) [-1981.345] (-2003.496) (-1995.546) * (-2003.999) (-2000.196) (-1991.746) [-1993.561] -- 0:02:11
Average standard deviation of split frequencies: 0.002475
593100 -- (-1993.706) [-1979.633] (-2000.295) (-1999.195) * (-1999.135) (-2002.306) [-1990.317] (-1990.925) -- 0:02:11
593200 -- (-1988.176) [-1977.808] (-2003.023) (-2006.445) * (-1995.921) (-2000.940) [-1986.013] (-1991.252) -- 0:02:11
593300 -- (-1990.962) [-1977.479] (-1990.886) (-1998.739) * (-1995.754) (-1992.824) (-1988.210) [-1984.939] -- 0:02:11
593400 -- (-1993.740) [-1980.124] (-1994.645) (-1995.240) * (-1991.098) (-2003.783) (-1986.604) [-1982.988] -- 0:02:11
593500 -- (-1999.906) [-1980.218] (-1997.583) (-1992.674) * (-1991.100) (-2001.803) [-1984.427] (-1983.254) -- 0:02:11
593600 -- (-2003.617) (-1980.042) (-1996.574) [-1988.227] * (-1997.015) (-2001.701) [-1979.771] (-1985.576) -- 0:02:11
593700 -- (-1996.091) [-1983.222] (-2002.540) (-1986.267) * (-1996.965) (-2005.187) [-1980.379] (-1999.071) -- 0:02:11
593800 -- (-1992.145) (-1982.608) (-2002.470) [-1990.365] * [-1995.594] (-1996.652) (-1984.178) (-1995.090) -- 0:02:11
593900 -- (-1994.329) [-1984.887] (-2002.421) (-1989.219) * (-1993.201) (-2008.864) (-1985.939) [-1997.242] -- 0:02:11
594000 -- (-1994.416) [-1986.543] (-2005.707) (-1991.048) * [-1995.005] (-2001.276) (-1983.613) (-2000.506) -- 0:02:11
Average standard deviation of split frequencies: 0.002471
594100 -- (-1987.790) (-1991.096) (-1999.524) [-1988.814] * (-2006.382) (-2001.305) (-1983.466) [-1987.335] -- 0:02:11
594200 -- [-1993.204] (-1992.548) (-1989.368) (-1992.389) * (-2008.998) (-2003.221) (-1988.729) [-1989.033] -- 0:02:11
594300 -- (-1987.200) [-1993.102] (-1991.562) (-1995.791) * (-1998.030) (-1999.206) (-1985.753) [-1985.145] -- 0:02:11
594400 -- [-1986.276] (-1989.259) (-1990.276) (-1992.691) * (-1998.370) (-1993.355) (-1991.542) [-1991.706] -- 0:02:11
594500 -- [-1985.239] (-1994.788) (-1991.989) (-1993.017) * (-2000.025) (-1992.280) [-1993.310] (-1991.621) -- 0:02:10
594600 -- (-1989.960) (-1989.857) (-1993.486) [-1993.724] * (-1995.760) [-1990.505] (-1988.728) (-1998.835) -- 0:02:10
594700 -- (-1991.909) (-1992.962) [-1991.009] (-1995.634) * (-1999.481) [-1987.258] (-1989.593) (-2005.989) -- 0:02:10
594800 -- (-1985.820) [-1985.117] (-1990.559) (-1994.203) * (-2001.150) [-1982.394] (-1987.573) (-2004.659) -- 0:02:11
594900 -- (-2002.635) [-1982.526] (-1997.785) (-1991.408) * (-2012.958) [-1987.999] (-1986.612) (-2005.942) -- 0:02:11
595000 -- (-1998.603) [-1982.494] (-1995.843) (-1990.598) * (-2006.910) (-1991.152) [-1983.041] (-2004.522) -- 0:02:11
Average standard deviation of split frequencies: 0.002602
595100 -- [-1985.052] (-1987.355) (-1990.503) (-1985.424) * (-2001.879) (-1995.071) [-1981.245] (-1998.870) -- 0:02:11
595200 -- [-1985.330] (-1987.116) (-1994.929) (-1989.550) * (-1998.617) (-2000.424) [-1979.764] (-1995.900) -- 0:02:11
595300 -- [-1983.657] (-1985.740) (-1992.166) (-1989.578) * (-2000.530) (-2004.443) [-1982.991] (-1994.083) -- 0:02:11
595400 -- (-1993.384) [-1985.784] (-1997.522) (-1987.417) * (-1999.426) (-1988.667) [-1981.213] (-1993.465) -- 0:02:11
595500 -- (-1998.996) [-1983.516] (-1993.458) (-1989.313) * (-1993.316) (-1985.997) [-1977.489] (-1995.006) -- 0:02:11
595600 -- (-1992.251) [-1984.861] (-1991.290) (-1987.944) * (-1998.517) (-1986.749) [-1980.633] (-2004.941) -- 0:02:11
595700 -- (-1998.624) [-1991.184] (-1996.586) (-1999.604) * (-1999.957) (-1990.808) [-1980.206] (-1992.054) -- 0:02:10
595800 -- (-1996.077) [-1986.372] (-1988.151) (-1998.454) * (-1994.228) (-1987.402) [-1987.032] (-1994.982) -- 0:02:10
595900 -- [-1988.720] (-1997.275) (-1992.884) (-1994.426) * (-1996.520) (-1988.677) (-1991.063) [-1985.808] -- 0:02:10
596000 -- [-1985.642] (-1997.427) (-1986.096) (-1990.863) * (-2002.564) [-1987.265] (-2002.948) (-1986.653) -- 0:02:10
Average standard deviation of split frequencies: 0.002711
596100 -- (-1987.762) (-1989.789) (-1991.101) [-1990.481] * (-2003.884) (-1990.279) (-2006.678) [-1988.270] -- 0:02:10
596200 -- [-1990.200] (-1994.645) (-1997.862) (-1987.055) * (-2008.141) (-1987.003) [-1992.967] (-1990.149) -- 0:02:10
596300 -- [-1989.557] (-1999.856) (-2005.666) (-1989.238) * [-1996.864] (-1990.260) (-1992.061) (-1990.836) -- 0:02:10
596400 -- [-1994.300] (-1999.517) (-1988.779) (-1993.031) * (-1997.640) [-1996.500] (-1984.997) (-1991.371) -- 0:02:10
596500 -- [-1989.940] (-1987.298) (-1989.698) (-1995.279) * (-1996.529) (-1992.693) [-1980.810] (-1994.991) -- 0:02:10
596600 -- (-1989.704) (-1988.371) (-1992.397) [-1987.308] * (-1990.743) (-1994.359) [-1981.043] (-1991.620) -- 0:02:10
596700 -- (-1991.014) (-1987.118) [-1991.617] (-1994.712) * (-1991.035) (-1998.695) [-1979.964] (-1992.855) -- 0:02:10
596800 -- (-1991.330) [-1985.267] (-1991.618) (-1999.912) * (-1993.906) (-2001.765) [-1979.863] (-1992.042) -- 0:02:10
596900 -- (-1999.751) [-1981.291] (-1987.634) (-2006.560) * (-1998.196) (-2001.650) [-1978.440] (-1997.175) -- 0:02:10
597000 -- (-2003.312) [-1983.991] (-1984.416) (-1997.159) * (-1994.120) (-2008.434) [-1982.955] (-1994.717) -- 0:02:10
Average standard deviation of split frequencies: 0.002661
597100 -- (-2014.239) (-1986.014) [-1982.670] (-1997.293) * [-1993.470] (-1995.435) (-1987.320) (-1993.441) -- 0:02:10
597200 -- (-2006.123) (-1984.763) [-1982.364] (-1997.583) * (-1992.155) (-1990.756) (-1991.309) [-1990.266] -- 0:02:10
597300 -- (-1999.119) [-1983.205] (-1993.595) (-1994.600) * (-1993.077) (-1988.542) [-1989.266] (-1989.580) -- 0:02:10
597400 -- (-2005.772) (-1989.520) (-1983.466) [-1991.719] * (-1997.540) [-1986.916] (-1993.694) (-1991.649) -- 0:02:10
597500 -- (-1994.473) [-1985.545] (-1988.729) (-1993.648) * (-2000.562) [-1984.584] (-1987.732) (-1985.402) -- 0:02:10
597600 -- (-1998.525) (-1983.935) [-1983.334] (-1992.289) * (-1999.469) [-1985.305] (-1991.066) (-1993.383) -- 0:02:09
597700 -- (-1995.467) [-1988.792] (-1981.107) (-1994.021) * (-1997.983) [-1987.703] (-1994.819) (-1989.741) -- 0:02:09
597800 -- (-1998.095) (-1991.701) [-1984.365] (-2011.001) * (-2002.075) [-1989.045] (-1992.628) (-1996.345) -- 0:02:09
597900 -- (-2000.749) (-1985.298) [-1981.293] (-2007.730) * (-1997.774) [-1984.417] (-1991.488) (-1993.042) -- 0:02:10
598000 -- (-2008.969) [-1981.248] (-1979.872) (-2000.572) * (-1997.243) (-1996.251) (-2002.678) [-1985.155] -- 0:02:10
Average standard deviation of split frequencies: 0.002725
598100 -- (-1998.593) (-1985.589) [-1981.811] (-1986.589) * [-1991.304] (-1996.321) (-1996.223) (-1991.709) -- 0:02:10
598200 -- (-1996.055) (-1984.534) [-1984.280] (-1987.922) * (-1989.831) (-1992.696) (-1994.196) [-1992.228] -- 0:02:10
598300 -- (-1999.661) (-1983.308) [-1982.060] (-1990.670) * (-1987.016) [-1985.409] (-1997.445) (-1993.072) -- 0:02:10
598400 -- (-1996.706) (-1987.257) (-1982.264) [-1987.841] * (-1990.081) [-1984.121] (-2001.471) (-2001.402) -- 0:02:10
598500 -- (-1998.731) (-1979.839) [-1982.836] (-1987.103) * (-1994.893) (-1981.717) (-1991.096) [-1992.389] -- 0:02:10
598600 -- (-1994.423) [-1982.582] (-1988.196) (-1990.418) * (-1994.001) (-1990.595) [-1989.385] (-1989.521) -- 0:02:10
598700 -- (-1987.458) (-1987.434) [-1981.761] (-1989.525) * (-1994.398) (-1997.829) [-1986.534] (-1991.745) -- 0:02:10
598800 -- (-1993.326) (-1996.991) [-1976.322] (-1986.489) * (-1993.841) (-1990.658) [-1983.018] (-1992.649) -- 0:02:09
598900 -- (-1997.348) (-1986.022) (-1985.005) [-1988.728] * [-1987.233] (-1998.817) (-1985.022) (-1987.303) -- 0:02:09
599000 -- (-1989.270) (-1989.127) (-1987.609) [-1989.589] * (-1990.484) (-2004.321) (-1990.150) [-1988.443] -- 0:02:09
Average standard deviation of split frequencies: 0.002855
599100 -- (-1998.544) (-1988.313) (-1991.857) [-1991.662] * (-1990.899) (-2000.608) (-1991.900) [-1985.211] -- 0:02:09
599200 -- (-1994.523) (-1989.780) [-1991.692] (-1995.234) * (-1990.450) (-1994.410) (-1985.449) [-1986.765] -- 0:02:09
599300 -- (-1991.560) (-1992.010) [-1988.722] (-1989.640) * (-1989.529) (-1999.123) (-1982.326) [-1988.440] -- 0:02:09
599400 -- (-1985.925) (-1988.688) (-1980.560) [-1988.554] * (-1991.783) (-1997.304) [-1980.157] (-1989.985) -- 0:02:09
599500 -- (-1984.004) (-1982.504) [-1982.691] (-1988.245) * (-1991.330) (-1997.968) [-1987.538] (-1996.963) -- 0:02:09
599600 -- (-2004.337) (-1985.361) [-1981.289] (-1987.229) * (-1991.764) (-1997.600) [-1983.939] (-1993.805) -- 0:02:09
599700 -- (-2002.459) (-1996.329) [-1977.439] (-1989.604) * (-1989.072) (-2000.531) [-1981.789] (-1998.665) -- 0:02:09
599800 -- (-1993.999) [-1981.118] (-1981.089) (-1992.815) * (-1993.316) (-2002.094) [-1981.053] (-1999.304) -- 0:02:09
599900 -- (-2002.065) (-1982.084) [-1980.961] (-1991.267) * (-1986.968) (-2000.300) [-1981.358] (-1995.847) -- 0:02:09
600000 -- (-1994.816) (-1984.744) [-1982.969] (-1992.250) * [-1983.633] (-2001.505) (-1984.714) (-1993.930) -- 0:02:09
Average standard deviation of split frequencies: 0.002738
600100 -- (-1995.676) (-1986.019) [-1982.514] (-1996.195) * (-1981.195) (-1998.557) [-1981.240] (-1995.159) -- 0:02:09
600200 -- (-1994.730) (-1984.895) [-1980.653] (-1997.679) * [-1986.912] (-2004.117) (-1985.355) (-2000.575) -- 0:02:09
600300 -- (-1999.497) (-1987.793) [-1983.222] (-1994.170) * (-1989.520) (-2003.532) [-1984.856] (-1997.757) -- 0:02:09
600400 -- (-1995.189) (-1981.527) [-1979.099] (-1987.130) * [-1983.193] (-1995.291) (-1999.536) (-1996.277) -- 0:02:09
600500 -- (-1997.179) (-1983.388) [-1982.910] (-1988.023) * [-1987.615] (-1994.532) (-1996.741) (-2003.836) -- 0:02:09
600600 -- (-1995.694) (-1985.533) [-1982.749] (-1983.867) * [-1982.744] (-1994.545) (-1996.654) (-1996.649) -- 0:02:09
600700 -- (-2000.149) (-1986.216) [-1978.426] (-1983.710) * [-1988.393] (-1997.441) (-1992.137) (-1994.080) -- 0:02:08
600800 -- (-1996.463) [-1993.496] (-1979.496) (-1994.563) * (-1989.157) (-1994.817) [-1986.943] (-2000.383) -- 0:02:08
600900 -- (-2003.335) (-1994.054) [-1980.164] (-1998.183) * (-1992.063) (-1999.709) [-1986.666] (-2002.185) -- 0:02:09
601000 -- (-2001.735) (-1994.345) [-1982.426] (-1994.336) * (-1993.230) (-2011.126) [-1982.265] (-2005.921) -- 0:02:09
Average standard deviation of split frequencies: 0.002778
601100 -- (-1997.392) (-1996.342) [-1982.300] (-1993.821) * (-2001.274) (-2008.609) [-1983.691] (-1999.513) -- 0:02:09
601200 -- (-1998.739) (-1992.870) [-1979.231] (-1990.639) * (-2000.944) (-2002.636) [-1979.828] (-1998.831) -- 0:02:09
601300 -- (-1997.686) (-1994.385) (-1978.739) [-1985.588] * (-2000.991) (-1991.913) [-1987.605] (-1992.073) -- 0:02:09
601400 -- (-1996.555) (-1986.484) [-1983.007] (-1990.637) * (-2005.979) (-1990.749) (-1988.408) [-1982.814] -- 0:02:09
601500 -- (-1988.886) (-1996.535) [-1983.474] (-1999.447) * (-2002.935) (-1993.502) (-1984.485) [-1984.021] -- 0:02:09
601600 -- (-1995.279) (-1986.987) [-1977.710] (-1993.723) * (-1988.211) [-1987.564] (-1989.299) (-1986.360) -- 0:02:09
601700 -- (-1990.004) [-1985.034] (-1978.192) (-2003.890) * (-1999.578) [-1985.025] (-1986.401) (-1986.210) -- 0:02:09
601800 -- (-1991.569) [-1981.586] (-1985.476) (-2007.374) * (-1992.573) (-1990.245) [-1988.618] (-1998.055) -- 0:02:09
601900 -- (-1988.121) [-1980.892] (-1983.369) (-2007.029) * (-1983.862) (-1990.577) [-1986.831] (-1998.232) -- 0:02:08
602000 -- (-1993.174) [-1979.493] (-1987.278) (-1997.689) * (-1986.734) (-1990.777) [-1989.079] (-1992.203) -- 0:02:08
Average standard deviation of split frequencies: 0.002953
602100 -- (-1993.931) (-1983.846) [-1982.757] (-1999.900) * (-1982.280) (-1993.583) (-1999.291) [-1987.576] -- 0:02:08
602200 -- (-1990.007) [-1979.943] (-1982.935) (-2000.877) * [-1986.285] (-1993.981) (-1987.285) (-1985.706) -- 0:02:08
602300 -- (-1992.528) [-1980.494] (-1983.928) (-1999.361) * (-1986.245) (-1995.498) (-1994.902) [-1992.185] -- 0:02:08
602400 -- (-1990.325) (-1982.333) [-1977.801] (-2001.327) * [-1985.346] (-1991.881) (-1991.200) (-1997.778) -- 0:02:08
602500 -- (-1989.942) (-1982.283) [-1984.455] (-2004.394) * [-1980.662] (-1992.950) (-1990.935) (-1995.900) -- 0:02:08
602600 -- (-1990.646) [-1979.352] (-1984.468) (-2004.142) * (-1989.412) [-1988.304] (-2002.764) (-1999.341) -- 0:02:08
602700 -- (-1990.268) (-1982.545) [-1979.952] (-1997.279) * [-1985.951] (-1988.852) (-1984.748) (-2006.417) -- 0:02:08
602800 -- (-1996.096) (-1988.170) [-1980.909] (-1998.043) * (-1983.751) (-1994.166) [-1981.152] (-2007.653) -- 0:02:08
602900 -- (-1999.407) [-1979.428] (-1983.614) (-1995.722) * (-1992.049) (-2000.669) [-1977.506] (-2010.402) -- 0:02:08
603000 -- (-1993.875) (-1986.740) [-1979.475] (-1993.752) * (-1996.516) (-1994.950) [-1977.180] (-2002.002) -- 0:02:08
Average standard deviation of split frequencies: 0.002970
603100 -- (-1995.015) (-2000.213) [-1978.841] (-1993.355) * (-1996.508) (-1994.314) [-1978.440] (-1996.746) -- 0:02:08
603200 -- (-1994.044) (-1987.846) [-1981.870] (-1993.124) * (-1996.035) (-1997.977) [-1981.111] (-1999.844) -- 0:02:08
603300 -- (-1991.929) (-1992.664) [-1981.154] (-2007.268) * (-1988.699) [-2000.586] (-1982.871) (-1995.013) -- 0:02:08
603400 -- (-1990.395) (-1987.270) [-1986.955] (-2000.981) * (-1981.781) (-1997.277) [-1981.031] (-1997.997) -- 0:02:08
603500 -- (-1994.207) [-1988.340] (-1986.888) (-2004.658) * (-1982.122) (-1999.137) (-1981.303) [-1993.253] -- 0:02:08
603600 -- (-1992.770) [-1985.184] (-1988.287) (-2001.617) * [-1985.607] (-1999.776) (-1983.311) (-1999.778) -- 0:02:08
603700 -- (-1995.848) [-1988.076] (-1988.291) (-2006.606) * [-1988.305] (-2009.472) (-1990.829) (-1994.914) -- 0:02:08
603800 -- (-1995.160) [-1987.315] (-1985.922) (-1996.325) * [-1990.129] (-2000.065) (-1989.602) (-2000.133) -- 0:02:07
603900 -- (-1993.975) (-1990.501) [-1985.223] (-1989.049) * [-1984.171] (-1995.664) (-1992.210) (-1985.407) -- 0:02:08
604000 -- (-1993.764) (-1986.367) (-1985.219) [-1989.528] * (-1982.656) (-1996.318) [-1978.680] (-1989.813) -- 0:02:08
Average standard deviation of split frequencies: 0.003077
604100 -- (-1997.127) (-1985.946) (-1981.166) [-1987.780] * (-1988.124) (-1993.645) [-1980.753] (-1992.868) -- 0:02:08
604200 -- (-1996.469) (-1982.805) [-1981.248] (-1988.228) * (-1991.748) (-1992.003) (-1983.592) [-1986.853] -- 0:02:08
604300 -- (-1995.627) (-1983.674) [-1979.619] (-1990.358) * (-1993.135) (-2001.474) [-1989.903] (-1988.028) -- 0:02:08
604400 -- (-1995.358) (-1989.457) [-1978.349] (-1996.415) * (-1992.556) (-2002.117) [-1983.232] (-1988.046) -- 0:02:08
604500 -- (-1994.045) (-1992.819) [-1984.422] (-1996.631) * (-1989.761) (-1996.327) [-1984.740] (-1995.329) -- 0:02:08
604600 -- (-1989.593) [-1985.901] (-1985.832) (-2004.737) * (-1997.168) (-2002.445) [-1984.362] (-1990.108) -- 0:02:08
604700 -- (-1991.235) (-1989.477) [-1982.186] (-1998.914) * (-2004.609) (-2002.600) [-1980.242] (-1985.245) -- 0:02:08
604800 -- (-1989.958) (-1992.325) [-1979.603] (-1989.781) * (-1996.448) (-2000.929) (-1978.527) [-1988.021] -- 0:02:08
604900 -- (-1999.053) (-1988.978) [-1981.574] (-1992.602) * (-1992.261) (-1998.785) [-1985.718] (-1984.624) -- 0:02:08
605000 -- (-2009.259) (-1990.191) [-1979.514] (-1989.026) * (-1992.791) (-2006.481) (-1980.400) [-1984.246] -- 0:02:07
Average standard deviation of split frequencies: 0.003138
605100 -- (-1997.697) (-1991.614) [-1979.708] (-1991.513) * (-1999.233) (-2000.324) (-1983.054) [-1983.124] -- 0:02:07
605200 -- (-1994.634) (-1991.576) [-1979.226] (-2012.842) * (-2000.145) (-1992.161) [-1983.639] (-1985.845) -- 0:02:07
605300 -- (-1992.160) (-1986.630) [-1980.830] (-2009.699) * (-1991.910) (-1991.030) [-1981.280] (-1984.291) -- 0:02:07
605400 -- (-1992.079) (-1977.813) [-1979.587] (-1998.060) * (-1999.886) (-1994.583) [-1985.118] (-1989.447) -- 0:02:07
605500 -- (-1989.143) (-1986.161) [-1986.984] (-1995.185) * (-1995.554) (-1995.209) [-1983.742] (-1990.942) -- 0:02:07
605600 -- (-1993.596) (-1985.861) [-1989.521] (-2001.071) * (-1997.037) (-1993.963) [-1980.537] (-1985.596) -- 0:02:07
605700 -- (-1995.466) [-1987.212] (-1987.387) (-1995.002) * (-1998.635) (-1993.079) [-1988.700] (-1986.714) -- 0:02:07
605800 -- (-1989.564) (-1986.858) [-1984.276] (-1993.536) * (-1995.939) (-2000.633) (-1984.657) [-1986.733] -- 0:02:07
605900 -- (-1989.608) (-1988.729) [-1985.612] (-1990.602) * (-1991.615) (-1993.058) [-1984.302] (-1984.676) -- 0:02:07
606000 -- (-1988.936) (-1988.553) [-1984.487] (-1993.207) * (-1995.306) (-2001.613) [-1985.853] (-1985.770) -- 0:02:07
Average standard deviation of split frequencies: 0.003089
606100 -- (-1994.244) [-1982.513] (-1985.412) (-1991.118) * (-1994.116) (-1992.325) (-1982.056) [-1987.636] -- 0:02:07
606200 -- (-1992.514) [-1980.133] (-2000.506) (-1991.911) * (-1998.711) (-1996.579) [-1982.312] (-1985.783) -- 0:02:07
606300 -- (-2004.389) [-1985.131] (-1995.808) (-1993.226) * [-1992.956] (-1995.860) (-1996.145) (-1986.707) -- 0:02:07
606400 -- (-1994.788) (-1990.952) [-1988.272] (-1994.974) * (-1991.380) (-1990.818) [-1987.418] (-1988.128) -- 0:02:07
606500 -- (-1991.288) [-1983.603] (-1985.979) (-1993.688) * (-1991.259) [-1986.306] (-1991.854) (-1990.961) -- 0:02:07
606600 -- (-1998.524) (-1984.642) [-1980.266] (-2003.392) * (-1993.489) [-1986.411] (-1991.511) (-1994.077) -- 0:02:07
606700 -- (-1992.437) [-1985.468] (-1982.453) (-2002.064) * (-1990.897) (-1983.506) [-1997.952] (-1993.399) -- 0:02:07
606800 -- (-1993.915) (-1984.446) [-1980.790] (-1997.266) * (-1991.528) [-1985.709] (-1997.423) (-1993.968) -- 0:02:07
606900 -- [-1996.016] (-1990.434) (-1981.166) (-1995.958) * (-1989.115) [-1986.550] (-1990.599) (-1993.520) -- 0:02:06
607000 -- (-1993.556) [-1982.291] (-1987.474) (-1995.821) * (-1991.912) [-1984.826] (-1988.930) (-1988.747) -- 0:02:07
Average standard deviation of split frequencies: 0.003105
607100 -- (-1994.216) (-1985.148) [-1984.223] (-1995.892) * (-1991.327) (-1992.725) [-1986.109] (-1993.911) -- 0:02:07
607200 -- (-1988.352) (-1990.057) [-1987.313] (-1996.797) * (-1988.082) (-1997.173) (-1992.663) [-1994.243] -- 0:02:07
607300 -- (-1993.438) [-1986.133] (-1986.329) (-1999.043) * [-1983.524] (-1988.715) (-1989.994) (-1990.076) -- 0:02:07
607400 -- (-2003.004) (-1983.976) [-1982.027] (-1992.419) * (-1990.531) (-1980.219) (-1990.946) [-1987.860] -- 0:02:07
607500 -- (-1994.807) (-1990.450) (-1985.772) [-1994.875] * (-1990.482) [-1984.136] (-1992.304) (-1986.195) -- 0:02:07
607600 -- (-2005.309) (-1988.616) [-1983.314] (-1995.107) * (-1994.941) (-1988.779) (-1991.944) [-1997.279] -- 0:02:07
607700 -- (-1996.311) (-1984.656) [-1990.212] (-2000.817) * [-1987.990] (-1996.487) (-2002.657) (-1990.505) -- 0:02:07
607800 -- (-1999.106) (-1986.490) (-1987.408) [-1995.081] * [-1985.288] (-1991.750) (-1993.143) (-1988.764) -- 0:02:07
607900 -- (-1995.910) [-1982.957] (-1986.687) (-1993.415) * [-1985.631] (-1985.933) (-1991.227) (-1999.500) -- 0:02:07
608000 -- (-1996.407) [-1980.236] (-1993.876) (-2001.387) * [-1986.973] (-1989.625) (-1989.419) (-2001.487) -- 0:02:07
Average standard deviation of split frequencies: 0.003123
608100 -- (-1996.829) (-1987.403) [-1982.271] (-1996.094) * (-1992.339) [-1988.767] (-1988.618) (-2001.046) -- 0:02:06
608200 -- (-1997.811) [-2000.610] (-1981.760) (-1990.157) * (-1996.990) [-1990.031] (-1994.149) (-1992.219) -- 0:02:06
608300 -- (-2000.709) (-1989.357) [-1985.359] (-1986.183) * (-1992.686) (-1982.500) (-1988.715) [-1990.119] -- 0:02:06
608400 -- (-1999.167) (-1986.926) [-1982.247] (-1991.496) * (-1991.426) [-1978.864] (-1986.737) (-1994.584) -- 0:02:06
608500 -- (-2000.174) (-1984.927) [-1981.675] (-1997.484) * (-1996.269) (-1985.093) [-1985.490] (-1999.993) -- 0:02:06
608600 -- (-1998.533) [-1981.536] (-1983.844) (-1992.694) * (-1994.408) [-1979.469] (-1986.532) (-1993.900) -- 0:02:06
608700 -- (-1993.427) [-1984.897] (-1985.901) (-2000.979) * (-2005.388) [-1981.391] (-1984.317) (-1989.894) -- 0:02:06
608800 -- (-1993.868) [-1980.818] (-1991.729) (-2007.931) * (-2007.352) (-1982.678) (-1985.155) [-1987.890] -- 0:02:06
608900 -- (-1987.619) [-1981.150] (-1995.578) (-1996.494) * (-2001.906) [-1977.301] (-1982.016) (-1985.726) -- 0:02:06
609000 -- (-1989.049) [-1981.548] (-1983.920) (-2000.902) * (-2003.666) [-1978.641] (-1993.591) (-1988.522) -- 0:02:06
Average standard deviation of split frequencies: 0.003095
609100 -- [-1991.079] (-1985.159) (-1988.187) (-2000.900) * (-2007.275) [-1982.265] (-1993.289) (-1988.149) -- 0:02:06
609200 -- (-1993.549) [-1989.017] (-1991.286) (-2000.838) * (-2001.673) (-1986.407) (-1997.294) [-1987.052] -- 0:02:06
609300 -- (-1996.182) [-1983.275] (-1991.617) (-2001.310) * (-1998.024) [-1982.121] (-1999.430) (-1992.555) -- 0:02:06
609400 -- (-1994.723) [-1983.788] (-1986.152) (-1995.580) * (-2001.465) [-1985.522] (-2003.847) (-1989.874) -- 0:02:06
609500 -- (-1994.143) [-1981.877] (-1986.638) (-1998.455) * (-2001.377) [-1984.478] (-1995.611) (-1992.902) -- 0:02:06
609600 -- (-1994.121) (-1992.747) [-1985.749] (-1992.350) * [-1997.184] (-1990.424) (-1988.373) (-1985.516) -- 0:02:06
609700 -- (-1996.556) (-1989.973) [-1986.996] (-1986.170) * (-1992.021) (-1992.448) (-1992.371) [-1987.366] -- 0:02:06
609800 -- (-2000.460) (-1984.957) (-1990.159) [-1985.909] * (-1994.945) (-1987.471) (-1984.049) [-1987.343] -- 0:02:06
609900 -- (-1996.447) [-1985.905] (-1982.392) (-1986.805) * (-2004.914) (-1989.207) [-1989.713] (-1991.818) -- 0:02:06
610000 -- (-1994.098) (-1983.007) (-1990.414) [-1988.487] * (-1999.100) (-1989.598) (-1986.155) [-1988.828] -- 0:02:06
Average standard deviation of split frequencies: 0.003091
610100 -- (-1991.823) (-1984.350) (-1991.046) [-1987.024] * (-2001.582) (-1981.718) [-1984.871] (-1995.378) -- 0:02:06
610200 -- (-1986.186) [-1983.501] (-1995.953) (-1995.577) * (-2002.298) [-1982.562] (-1988.450) (-1991.559) -- 0:02:06
610300 -- [-1987.783] (-1988.715) (-2004.969) (-1997.658) * (-2000.877) [-1981.527] (-1983.374) (-1995.368) -- 0:02:06
610400 -- [-1986.041] (-1988.223) (-1995.524) (-1990.772) * (-1996.099) (-2000.035) [-1983.506] (-1993.847) -- 0:02:06
610500 -- (-1989.141) [-1982.470] (-2000.226) (-1989.029) * (-1998.902) (-1992.962) [-1984.963] (-1999.493) -- 0:02:06
610600 -- (-1992.416) [-1980.258] (-1996.486) (-2000.296) * (-1995.777) [-1984.093] (-1982.748) (-2001.063) -- 0:02:06
610700 -- (-1993.552) [-1981.391] (-1997.819) (-1997.289) * (-1993.380) (-1986.692) (-1985.954) [-1995.053] -- 0:02:06
610800 -- (-1994.600) [-1980.927] (-1995.382) (-1996.556) * (-1992.524) [-1980.452] (-1989.443) (-1997.021) -- 0:02:06
610900 -- (-1986.872) [-1980.660] (-2001.624) (-1992.770) * (-1988.017) [-1978.755] (-1988.923) (-1996.379) -- 0:02:06
611000 -- (-1989.943) [-1986.399] (-1999.232) (-1996.466) * (-1987.669) [-1980.287] (-1987.987) (-1991.461) -- 0:02:06
Average standard deviation of split frequencies: 0.002997
611100 -- (-1994.822) [-1991.384] (-2002.327) (-1993.717) * (-1986.514) [-1982.512] (-1983.145) (-2002.429) -- 0:02:06
611200 -- (-1986.020) [-1985.098] (-1998.798) (-1992.602) * (-1999.254) [-1979.748] (-1986.001) (-1996.398) -- 0:02:05
611300 -- [-1991.923] (-1985.094) (-1984.941) (-1997.344) * (-1995.698) [-1979.568] (-1984.561) (-1996.935) -- 0:02:05
611400 -- (-1991.104) (-1986.956) [-1986.247] (-1996.968) * (-1991.370) [-1981.796] (-1980.172) (-1995.925) -- 0:02:05
611500 -- (-1992.683) (-1984.193) [-1984.126] (-1999.162) * (-1985.773) [-1987.565] (-1987.983) (-1995.628) -- 0:02:05
611600 -- (-1990.659) [-1989.379] (-1981.667) (-1989.909) * [-1986.384] (-1987.922) (-1982.845) (-1992.569) -- 0:02:05
611700 -- (-1998.572) [-1988.452] (-1983.094) (-1992.154) * (-1984.697) (-1989.250) [-1982.830] (-1993.163) -- 0:02:05
611800 -- (-1994.678) (-1982.176) [-1984.904] (-1990.653) * (-1989.931) (-1996.181) [-1978.763] (-1989.808) -- 0:02:05
611900 -- [-1988.719] (-1985.677) (-1984.461) (-1990.179) * (-1990.795) (-1992.498) [-1983.844] (-1990.232) -- 0:02:05
612000 -- (-2004.078) (-1985.295) [-1980.583] (-1992.540) * (-1991.687) (-1994.869) [-1981.380] (-1992.860) -- 0:02:05
Average standard deviation of split frequencies: 0.002882
612100 -- (-2011.614) (-1986.025) [-1981.910] (-2003.667) * (-1991.117) (-1997.341) [-1982.651] (-1991.618) -- 0:02:05
612200 -- (-1990.860) (-1987.607) [-1979.192] (-2011.453) * (-2002.719) (-2003.114) [-1990.131] (-1993.043) -- 0:02:05
612300 -- (-1993.077) (-1983.480) [-1983.014] (-1999.135) * (-2006.580) (-1997.173) (-1995.537) [-1991.226] -- 0:02:05
612400 -- (-1991.817) (-1989.002) [-1988.533] (-1999.346) * (-2004.287) (-1993.968) [-1990.972] (-1987.139) -- 0:02:05
612500 -- (-1992.859) (-1996.367) [-1987.730] (-1997.915) * (-2007.883) (-1999.753) [-1985.609] (-2000.830) -- 0:02:05
612600 -- (-1990.633) (-1987.970) [-1982.314] (-1997.849) * (-1993.200) (-2007.170) [-1985.272] (-1992.058) -- 0:02:05
612700 -- (-1991.091) (-1989.522) [-1981.438] (-1994.453) * (-1994.559) (-2009.754) [-1982.733] (-1992.871) -- 0:02:05
612800 -- (-1999.014) [-1983.756] (-1995.199) (-1999.999) * (-1994.953) (-2002.820) (-1985.757) [-1993.980] -- 0:02:05
612900 -- (-2001.328) [-1986.953] (-1990.222) (-1998.224) * (-1992.033) (-1998.925) [-1987.942] (-1991.411) -- 0:02:05
613000 -- (-1997.859) (-1994.566) [-1985.479] (-1990.782) * (-1996.345) (-1991.605) [-1981.292] (-1992.372) -- 0:02:05
Average standard deviation of split frequencies: 0.003119
613100 -- (-1987.316) (-1998.104) [-1984.935] (-1987.497) * (-1991.530) (-1993.782) [-1982.314] (-1996.128) -- 0:02:05
613200 -- [-1987.788] (-1998.628) (-1987.617) (-1989.857) * (-1986.590) (-1997.850) [-1980.472] (-1998.585) -- 0:02:05
613300 -- (-1988.109) (-1999.635) (-1986.298) [-1987.043] * (-1991.557) (-1990.556) [-1982.620] (-1998.339) -- 0:02:05
613400 -- (-1993.743) (-1988.198) [-1987.408] (-1988.246) * (-2001.233) (-1995.180) [-1980.453] (-2001.114) -- 0:02:05
613500 -- (-1993.314) (-1994.878) (-1991.565) [-1990.507] * (-1993.004) (-1990.128) [-1983.034] (-1987.839) -- 0:02:05
613600 -- (-1989.336) [-1992.018] (-1988.609) (-1998.404) * (-1988.479) [-1988.762] (-1988.166) (-1988.210) -- 0:02:05
613700 -- [-1993.364] (-1995.075) (-1980.249) (-1996.338) * (-1996.422) (-1993.110) (-1995.127) [-1987.008] -- 0:02:05
613800 -- (-1995.887) (-1986.703) [-1979.377] (-2000.642) * [-1989.188] (-1999.073) (-1990.380) (-1987.736) -- 0:02:05
613900 -- (-1998.829) (-1992.706) [-1980.945] (-1991.534) * (-1989.254) (-1992.817) [-1988.686] (-1990.862) -- 0:02:05
614000 -- (-1988.902) (-1992.103) [-1980.235] (-1993.003) * (-1988.201) [-1990.430] (-1984.560) (-1985.476) -- 0:02:05
Average standard deviation of split frequencies: 0.003334
614100 -- (-1996.473) (-1987.112) [-1979.763] (-1998.854) * (-1994.218) (-1994.396) [-1983.698] (-1997.634) -- 0:02:05
614200 -- (-2004.130) (-1989.042) (-1985.938) [-1993.073] * (-1995.249) (-1985.859) [-1981.243] (-1995.784) -- 0:02:04
614300 -- (-1991.143) [-1992.225] (-1989.407) (-2000.113) * (-1998.120) [-1986.531] (-1987.681) (-1993.071) -- 0:02:04
614400 -- (-1990.975) [-1986.004] (-1990.025) (-2000.440) * [-1992.506] (-1990.673) (-1992.710) (-1998.795) -- 0:02:04
614500 -- [-1989.874] (-1986.111) (-1993.418) (-1990.005) * [-1998.203] (-1996.576) (-1998.792) (-1993.279) -- 0:02:04
614600 -- (-1994.051) [-1985.486] (-1994.679) (-1988.034) * [-1992.221] (-1994.143) (-1996.729) (-1987.849) -- 0:02:04
614700 -- (-1994.980) [-1981.789] (-2000.301) (-1988.383) * (-1986.554) (-1989.068) [-1991.631] (-1990.295) -- 0:02:04
614800 -- [-1997.615] (-1983.756) (-2003.646) (-1988.756) * (-1989.276) [-1985.697] (-1994.493) (-1991.364) -- 0:02:04
614900 -- (-1994.105) [-1982.564] (-2002.210) (-1992.735) * (-1985.120) (-1985.423) (-1991.188) [-1985.554] -- 0:02:04
615000 -- (-1991.256) (-1987.954) (-2008.011) [-1988.363] * (-1989.477) (-1984.568) [-1985.381] (-1992.102) -- 0:02:04
Average standard deviation of split frequencies: 0.003284
615100 -- (-1999.140) [-1991.136] (-1997.411) (-1985.441) * (-1990.591) [-1984.122] (-1987.660) (-1997.320) -- 0:02:04
615200 -- (-2004.836) [-1983.680] (-1994.077) (-1992.448) * (-1989.089) [-1990.855] (-1986.656) (-1994.295) -- 0:02:04
615300 -- (-1991.844) [-1984.173] (-2002.063) (-2002.229) * [-1987.626] (-1986.789) (-1992.540) (-1988.083) -- 0:02:04
615400 -- [-1986.734] (-1985.327) (-1996.782) (-1989.889) * (-1988.929) [-1983.284] (-2001.728) (-1995.776) -- 0:02:04
615500 -- (-1985.626) [-1983.791] (-1998.232) (-1987.208) * (-1989.119) [-1982.893] (-1991.656) (-1997.807) -- 0:02:04
615600 -- (-1988.916) [-1979.680] (-1990.598) (-1992.393) * (-1986.658) [-1986.091] (-1993.008) (-1989.598) -- 0:02:04
615700 -- (-1990.403) [-1981.923] (-1990.877) (-1995.172) * (-1989.083) [-1982.203] (-1991.062) (-1993.493) -- 0:02:04
615800 -- (-1990.570) [-1984.357] (-1990.270) (-1986.173) * (-2006.966) [-1983.403] (-1987.954) (-1996.409) -- 0:02:04
615900 -- (-1991.125) [-1980.007] (-1984.867) (-1988.028) * (-2000.092) (-1993.509) (-1996.756) [-1999.067] -- 0:02:04
616000 -- (-1991.125) (-1978.631) [-1991.838] (-1997.084) * [-1985.912] (-1991.363) (-1995.003) (-1995.149) -- 0:02:04
Average standard deviation of split frequencies: 0.003301
616100 -- (-1986.409) [-1987.069] (-1990.618) (-1996.548) * [-1986.756] (-1991.030) (-1993.486) (-1994.489) -- 0:02:04
616200 -- (-1986.027) [-1986.382] (-1991.760) (-1985.509) * (-1995.563) (-1991.542) [-1987.071] (-2001.423) -- 0:02:04
616300 -- (-1991.762) (-1984.323) (-1991.904) [-1988.811] * (-1990.865) (-1996.708) [-1986.288] (-1998.075) -- 0:02:04
616400 -- (-1992.432) (-1987.704) [-1981.453] (-1989.156) * [-1989.625] (-1994.449) (-1992.730) (-1997.805) -- 0:02:04
616500 -- (-1991.135) [-1984.755] (-1985.937) (-1996.463) * [-1988.677] (-1996.004) (-1990.931) (-1995.951) -- 0:02:04
616600 -- (-1995.926) [-1985.107] (-1986.601) (-1993.586) * (-1993.809) (-1994.917) [-1982.106] (-1995.941) -- 0:02:04
616700 -- (-1992.110) (-1989.166) [-1987.987] (-1996.033) * (-1993.635) (-1994.591) [-1984.815] (-1989.610) -- 0:02:04
616800 -- (-1998.671) (-1985.594) [-1989.295] (-1991.400) * (-1990.245) (-1990.946) [-1980.859] (-1989.482) -- 0:02:04
616900 -- (-1998.643) [-1980.599] (-1991.152) (-1989.235) * [-1991.469] (-1993.870) (-1992.934) (-1992.603) -- 0:02:04
617000 -- (-2000.751) [-1983.659] (-1992.703) (-1996.123) * [-1987.349] (-1994.172) (-1986.812) (-1992.707) -- 0:02:04
Average standard deviation of split frequencies: 0.003317
617100 -- (-1992.163) [-1983.060] (-1987.820) (-2005.445) * [-1985.358] (-1995.871) (-1992.778) (-1994.971) -- 0:02:04
617200 -- (-1995.676) (-1987.531) [-1990.349] (-2005.366) * [-1982.464] (-1993.756) (-1986.954) (-1997.290) -- 0:02:04
617300 -- (-1994.345) [-1984.971] (-1992.521) (-1999.310) * [-1985.610] (-1995.201) (-1979.364) (-2006.778) -- 0:02:03
617400 -- (-1986.924) [-1983.784] (-1997.174) (-2009.039) * (-1979.537) (-1989.200) [-1984.430] (-2007.467) -- 0:02:03
617500 -- (-1988.720) (-1978.508) [-1992.727] (-1997.494) * (-1986.408) [-1983.136] (-1986.614) (-2008.710) -- 0:02:03
617600 -- [-1982.767] (-1978.253) (-2000.217) (-1994.911) * [-1988.629] (-1983.007) (-1989.880) (-2007.202) -- 0:02:03
617700 -- (-1985.256) [-1981.874] (-2007.325) (-1997.872) * (-1990.494) (-1994.494) (-1986.181) [-1994.479] -- 0:02:03
617800 -- (-1989.609) (-1982.388) (-2017.243) [-1993.623] * (-1991.630) (-1997.661) [-1983.053] (-1992.231) -- 0:02:03
617900 -- (-1992.677) [-1986.913] (-2004.065) (-2000.519) * (-1994.700) (-1995.026) [-1980.846] (-1992.590) -- 0:02:03
618000 -- (-1990.176) [-1989.846] (-1998.820) (-1996.661) * (-1984.746) (-1992.469) [-1981.475] (-1993.593) -- 0:02:03
Average standard deviation of split frequencies: 0.003312
618100 -- (-1995.489) [-1980.899] (-2001.493) (-2002.282) * (-1984.209) [-1986.171] (-1982.168) (-1997.078) -- 0:02:03
618200 -- (-1993.457) [-1987.833] (-1995.458) (-1995.838) * (-1989.353) [-1987.846] (-1986.725) (-1989.461) -- 0:02:03
618300 -- (-1989.648) [-1980.058] (-1999.626) (-2003.400) * (-1994.524) [-1988.375] (-1990.922) (-1993.071) -- 0:02:03
618400 -- (-1995.659) [-1986.239] (-1991.066) (-1999.742) * [-1991.166] (-1994.935) (-1997.916) (-2010.253) -- 0:02:03
618500 -- (-1995.279) [-1981.439] (-1991.560) (-1998.338) * (-1987.910) [-1990.875] (-1991.839) (-2002.846) -- 0:02:03
618600 -- (-1993.600) [-1984.185] (-1990.602) (-1993.057) * [-1990.952] (-1983.817) (-1989.415) (-1995.234) -- 0:02:03
618700 -- [-1989.880] (-1988.900) (-2001.924) (-1988.178) * (-1989.825) [-1986.423] (-1992.161) (-1992.968) -- 0:02:03
618800 -- (-1990.542) [-1985.804] (-2000.645) (-1991.934) * (-1992.167) [-1984.937] (-1988.243) (-2000.677) -- 0:02:03
618900 -- [-1992.506] (-1991.445) (-2002.145) (-2010.731) * (-1994.203) [-1987.891] (-1991.782) (-1994.407) -- 0:02:03
619000 -- [-1990.662] (-1990.672) (-1994.927) (-2004.727) * (-1989.887) (-2000.802) (-1991.301) [-1995.244] -- 0:02:03
Average standard deviation of split frequencies: 0.003350
619100 -- [-1986.970] (-1987.811) (-1991.788) (-2004.084) * (-1985.959) (-2003.144) [-1986.426] (-2006.068) -- 0:02:03
619200 -- (-1997.535) (-1985.183) [-1986.258] (-2001.951) * [-1984.782] (-2002.877) (-1981.802) (-2008.245) -- 0:02:03
619300 -- (-1996.679) [-1978.774] (-1986.270) (-2000.866) * (-1982.674) (-2000.606) [-1979.989] (-2001.515) -- 0:02:03
619400 -- (-1989.000) [-1981.280] (-1990.355) (-2002.101) * (-1982.291) (-2004.362) [-1987.037] (-2007.405) -- 0:02:03
619500 -- (-1986.292) [-1978.712] (-1990.646) (-1997.812) * (-1987.223) (-1996.687) [-1989.059] (-1999.216) -- 0:02:03
619600 -- (-1990.869) [-1979.237] (-1991.618) (-1995.804) * [-1984.935] (-1994.757) (-1983.757) (-2003.623) -- 0:02:03
619700 -- (-1988.999) [-1982.024] (-1986.148) (-2004.779) * [-1980.947] (-1995.444) (-1987.395) (-1994.287) -- 0:02:03
619800 -- (-1997.917) (-1986.250) [-1979.040] (-2004.621) * [-1984.271] (-1996.434) (-1982.842) (-1994.451) -- 0:02:03
619900 -- (-2002.658) (-1989.823) [-1981.935] (-2011.264) * [-1985.524] (-1999.312) (-1979.563) (-2001.138) -- 0:02:03
620000 -- (-1997.441) (-1988.747) [-1987.851] (-2008.592) * (-1985.980) (-1998.786) [-1978.518] (-1999.860) -- 0:02:03
Average standard deviation of split frequencies: 0.003214
620100 -- (-1996.917) (-1989.445) [-1983.128] (-1999.541) * [-1985.850] (-1995.940) (-1987.119) (-1999.816) -- 0:02:03
620200 -- (-1997.272) (-1988.552) [-1988.499] (-1991.204) * (-1991.470) (-1996.826) [-1980.857] (-2000.551) -- 0:02:03
620300 -- (-2005.799) [-1990.308] (-1988.658) (-1995.563) * [-1992.893] (-1994.520) (-1980.128) (-2009.035) -- 0:02:03
620400 -- (-2004.529) (-1989.633) (-1988.698) [-1993.358] * (-1990.668) (-1999.888) [-1981.680] (-2013.615) -- 0:02:02
620500 -- (-1997.294) [-1985.286] (-1990.938) (-1988.622) * [-1989.265] (-1997.126) (-1987.423) (-2001.315) -- 0:02:02
620600 -- [-1993.573] (-1987.965) (-1992.230) (-1992.756) * (-1989.996) (-1994.075) [-1982.492] (-2007.115) -- 0:02:02
620700 -- (-1990.317) [-1983.806] (-1985.176) (-2000.552) * [-1987.961] (-1994.688) (-1994.279) (-2007.865) -- 0:02:02
620800 -- [-1996.538] (-1988.805) (-1989.491) (-1994.327) * (-1985.656) (-1994.741) [-1987.089] (-2004.552) -- 0:02:02
620900 -- (-1995.592) (-1987.774) (-2000.946) [-1992.642] * [-1984.044] (-1994.815) (-1985.324) (-2006.030) -- 0:02:02
621000 -- (-1993.174) [-1981.780] (-1997.363) (-1990.738) * (-1983.823) [-1991.520] (-1989.958) (-2010.652) -- 0:02:02
Average standard deviation of split frequencies: 0.003166
621100 -- (-1993.084) (-1986.896) (-2002.900) [-1988.986] * (-1991.286) (-1996.731) [-1984.217] (-2011.096) -- 0:02:02
621200 -- (-1993.615) (-1983.447) (-2010.171) [-1986.827] * [-1985.301] (-1988.357) (-1985.840) (-2003.235) -- 0:02:02
621300 -- [-1994.747] (-1985.362) (-2004.997) (-1992.667) * (-1984.980) (-1997.729) (-1991.014) [-1995.685] -- 0:02:02
621400 -- [-1988.683] (-1986.380) (-2004.350) (-1998.566) * [-1989.133] (-2002.029) (-1988.079) (-1994.708) -- 0:02:02
621500 -- [-1989.360] (-1992.121) (-1999.322) (-1999.703) * [-1987.121] (-2015.776) (-1983.002) (-2000.443) -- 0:02:02
621600 -- [-1996.140] (-1990.263) (-2003.078) (-2005.513) * (-1990.011) (-2014.872) [-1986.837] (-2007.607) -- 0:02:02
621700 -- (-1989.014) [-1988.689] (-1998.545) (-2006.229) * (-1992.543) (-1999.586) [-1986.274] (-1997.783) -- 0:02:02
621800 -- [-1987.500] (-1985.328) (-1992.125) (-2015.129) * (-1984.294) (-1988.760) [-1981.495] (-1998.280) -- 0:02:02
621900 -- [-1988.640] (-1998.246) (-1991.930) (-2008.882) * (-1982.369) (-1995.177) [-1989.312] (-1994.601) -- 0:02:02
622000 -- (-1990.858) [-1993.144] (-1999.851) (-2002.732) * (-1982.161) [-1987.508] (-1980.205) (-1998.896) -- 0:02:02
Average standard deviation of split frequencies: 0.003161
622100 -- [-1991.415] (-1995.246) (-2002.957) (-2001.787) * (-1980.736) (-1989.973) [-1980.426] (-1998.512) -- 0:02:02
622200 -- [-1986.831] (-1991.940) (-1995.932) (-1998.856) * (-1991.936) (-1999.470) [-1980.989] (-1992.577) -- 0:02:02
622300 -- [-1989.206] (-1983.617) (-1996.225) (-2003.808) * (-1986.589) (-1993.928) [-1982.482] (-1992.045) -- 0:02:02
622400 -- (-1988.473) (-1983.798) [-1984.422] (-2008.648) * [-1983.082] (-1988.667) (-1983.528) (-1994.149) -- 0:02:02
622500 -- (-1995.912) (-1983.478) [-1982.302] (-1997.317) * (-1985.459) [-1988.635] (-1992.598) (-1989.860) -- 0:02:02
622600 -- (-1995.743) (-1985.358) [-1986.795] (-1998.911) * [-1983.605] (-1988.768) (-1989.277) (-1999.462) -- 0:02:02
622700 -- (-1995.468) (-1985.252) [-1986.057] (-1997.186) * [-1979.581] (-1989.169) (-1990.819) (-1999.535) -- 0:02:02
622800 -- (-2003.332) [-1979.474] (-1985.532) (-1997.185) * (-1984.443) (-1994.577) (-1992.997) [-1994.787] -- 0:02:02
622900 -- (-1993.073) (-1977.303) [-1984.197] (-2002.288) * (-1986.462) (-1995.639) [-1993.767] (-2000.383) -- 0:02:02
623000 -- (-2002.933) (-1980.210) [-1979.828] (-1999.054) * (-1992.056) (-1985.923) [-1991.815] (-1997.177) -- 0:02:02
Average standard deviation of split frequencies: 0.003091
623100 -- (-1994.046) [-1981.100] (-1980.294) (-1998.262) * (-1987.807) [-1985.493] (-1990.977) (-1996.333) -- 0:02:02
623200 -- (-1987.146) [-1985.242] (-1983.447) (-1994.681) * (-1986.316) (-1983.507) [-1986.990] (-2005.275) -- 0:02:02
623300 -- (-1993.553) [-1983.724] (-1981.733) (-1997.984) * (-1991.157) [-1990.727] (-1993.481) (-1992.337) -- 0:02:02
623400 -- (-1994.118) [-1980.884] (-1983.343) (-1996.351) * [-1982.692] (-1985.715) (-1998.271) (-1995.316) -- 0:02:02
623500 -- (-1994.925) (-1983.257) [-1983.362] (-1993.485) * [-1984.708] (-1997.039) (-1988.696) (-1997.654) -- 0:02:01
623600 -- (-1999.240) (-1986.002) [-1984.370] (-1998.289) * [-1979.615] (-1992.955) (-1987.445) (-1998.859) -- 0:02:01
623700 -- (-1999.084) [-1983.694] (-1981.743) (-1989.081) * (-1987.562) [-1991.512] (-1993.808) (-1992.882) -- 0:02:01
623800 -- (-1993.934) (-1982.902) [-1981.764] (-1991.178) * [-1984.174] (-1989.408) (-1987.123) (-1997.834) -- 0:02:01
623900 -- [-1993.283] (-1981.101) (-1980.604) (-1992.588) * (-1983.662) (-1993.006) [-1982.778] (-1995.339) -- 0:02:01
624000 -- (-1991.619) (-1985.820) [-1983.954] (-1993.814) * [-1988.011] (-1996.065) (-1984.498) (-1991.815) -- 0:02:01
Average standard deviation of split frequencies: 0.003172
624100 -- (-1990.163) (-1999.438) [-1982.677] (-1998.029) * (-1988.969) (-1995.202) [-1992.951] (-1991.490) -- 0:02:01
624200 -- (-1999.635) (-1991.386) [-1983.279] (-1989.689) * (-1994.794) (-1993.005) (-1998.965) [-1986.326] -- 0:02:01
624300 -- (-2009.941) (-1982.045) [-1983.636] (-2001.020) * (-1997.140) (-1988.290) [-1986.611] (-1993.258) -- 0:02:01
624400 -- (-1997.192) [-1983.333] (-1983.541) (-1991.941) * (-2000.850) [-1988.061] (-1997.758) (-1990.477) -- 0:02:01
624500 -- (-2013.948) [-1993.357] (-1990.604) (-1991.051) * [-1982.397] (-1984.216) (-2003.076) (-1995.501) -- 0:02:01
624600 -- (-2011.378) (-1998.924) (-1992.951) [-1997.788] * [-1981.910] (-1983.224) (-2012.516) (-1990.796) -- 0:02:01
624700 -- (-2011.574) [-1994.121] (-1988.397) (-1992.359) * [-1981.170] (-1986.413) (-1995.900) (-1992.117) -- 0:02:01
624800 -- (-2012.798) (-1983.376) [-1986.650] (-1988.581) * (-1982.519) [-1987.978] (-1999.317) (-1993.813) -- 0:02:01
624900 -- (-2005.573) (-1982.420) [-1981.027] (-1996.161) * (-1984.129) [-1986.043] (-1996.233) (-1992.361) -- 0:02:01
625000 -- (-1999.846) [-1981.636] (-1982.170) (-1992.063) * (-1981.878) [-1987.290] (-1994.616) (-1991.686) -- 0:02:01
Average standard deviation of split frequencies: 0.003038
625100 -- (-2006.915) (-1988.262) [-1979.591] (-1987.029) * [-1978.999] (-1987.891) (-1995.062) (-1992.494) -- 0:02:01
625200 -- (-2019.638) (-1985.669) [-1982.607] (-1986.713) * [-1980.738] (-1988.793) (-1995.044) (-1996.397) -- 0:02:01
625300 -- (-2016.088) [-1985.494] (-1991.555) (-1991.200) * (-1986.669) (-1996.442) [-1981.450] (-1989.501) -- 0:02:01
625400 -- (-2008.366) (-1982.776) (-1994.755) [-1984.836] * (-1991.093) (-1996.039) [-1979.879] (-1988.266) -- 0:02:01
625500 -- (-2008.712) (-1982.158) [-1994.475] (-1991.736) * (-1985.038) (-1989.134) [-1980.418] (-1991.430) -- 0:02:01
625600 -- (-2005.659) [-1983.606] (-1991.281) (-1991.887) * (-1985.824) (-1999.077) [-1980.581] (-1992.962) -- 0:02:01
625700 -- (-2005.912) (-1986.093) (-1992.420) [-1988.112] * [-1986.543] (-2001.810) (-1989.800) (-1998.508) -- 0:02:01
625800 -- (-2009.280) [-1983.865] (-1991.183) (-1990.349) * [-1993.394] (-1993.212) (-1993.758) (-1998.378) -- 0:02:01
625900 -- (-1994.539) [-1984.172] (-2001.798) (-1996.611) * (-1993.768) (-1992.671) [-1992.726] (-1994.320) -- 0:02:01
626000 -- (-1992.132) [-1985.592] (-1997.065) (-1996.284) * [-1987.246] (-1991.588) (-1990.771) (-1994.921) -- 0:02:01
Average standard deviation of split frequencies: 0.003012
626100 -- [-1991.587] (-1990.856) (-2004.529) (-2000.459) * [-1983.650] (-1989.973) (-1991.004) (-1993.818) -- 0:02:01
626200 -- (-1992.182) (-1982.169) (-1995.041) [-1996.375] * (-1990.162) [-1991.293] (-2009.849) (-1991.939) -- 0:02:01
626300 -- (-1992.746) [-1981.811] (-2002.813) (-1991.299) * [-1990.167] (-1994.764) (-1996.015) (-1992.344) -- 0:02:01
626400 -- (-1992.028) [-1981.325] (-2003.520) (-1989.596) * [-1987.339] (-1998.534) (-2000.843) (-1996.432) -- 0:02:01
626500 -- (-1993.903) [-1978.054] (-2003.153) (-1993.675) * [-1987.333] (-1999.839) (-1991.265) (-1991.898) -- 0:02:01
626600 -- (-1990.099) [-1981.910] (-1997.461) (-2006.569) * [-1988.245] (-1991.279) (-1995.305) (-1997.351) -- 0:02:00
626700 -- [-1997.447] (-1984.670) (-2005.199) (-2009.945) * [-1988.565] (-1990.900) (-1996.216) (-1993.319) -- 0:02:00
626800 -- (-1997.382) (-1983.191) [-1992.867] (-1992.678) * [-1986.995] (-1993.397) (-1992.857) (-1992.005) -- 0:02:00
626900 -- [-1995.213] (-1980.591) (-1989.284) (-1991.169) * (-1992.994) (-1992.448) [-1986.298] (-1993.666) -- 0:02:00
627000 -- (-1998.155) [-1981.779] (-1994.108) (-1994.679) * (-1994.153) (-1992.054) [-1984.449] (-1999.087) -- 0:02:00
Average standard deviation of split frequencies: 0.002963
627100 -- (-2002.444) [-1979.862] (-1995.178) (-1991.976) * (-2001.422) (-1996.153) [-1989.721] (-2000.401) -- 0:02:00
627200 -- (-2004.172) [-1981.618] (-1999.009) (-1985.640) * (-1998.556) (-1993.716) [-1988.508] (-2002.651) -- 0:02:00
627300 -- (-2003.496) [-1985.359] (-2000.279) (-1986.962) * (-2005.317) (-1995.517) [-1987.673] (-2004.059) -- 0:02:00
627400 -- (-2012.767) (-1987.961) (-1999.797) [-1985.267] * (-2006.013) (-1995.026) [-1983.889] (-1999.093) -- 0:02:00
627500 -- (-2014.213) [-1989.240] (-1992.538) (-1990.153) * (-2003.688) (-1993.344) [-1982.372] (-1989.018) -- 0:02:00
627600 -- (-2011.294) (-1987.719) (-1999.019) [-1990.062] * (-2006.944) (-1989.288) [-1983.597] (-1986.711) -- 0:02:00
627700 -- (-2007.370) (-1983.472) [-1990.678] (-1988.086) * (-2007.908) (-1986.243) [-1984.830] (-1986.284) -- 0:02:00
627800 -- (-2002.361) (-1987.788) [-1985.323] (-1990.052) * (-2005.783) (-1989.248) (-1985.673) [-1985.242] -- 0:02:00
627900 -- (-1999.058) (-1989.824) [-1985.930] (-1988.492) * (-2001.019) (-2004.204) [-1980.689] (-1986.843) -- 0:02:00
628000 -- (-2000.335) (-1989.498) (-1986.419) [-1993.357] * (-1996.448) (-1999.503) [-1985.844] (-1992.599) -- 0:02:00
Average standard deviation of split frequencies: 0.002938
628100 -- (-1990.475) (-1989.655) [-1983.470] (-1994.493) * (-1998.231) [-1987.938] (-1991.984) (-2002.066) -- 0:02:00
628200 -- [-1991.391] (-1987.302) (-1989.890) (-1991.039) * (-1992.328) (-1994.235) [-1982.391] (-1998.177) -- 0:02:00
628300 -- (-1997.206) (-1986.321) [-1986.996] (-1991.517) * [-1988.978] (-1992.716) (-1981.756) (-1995.421) -- 0:02:00
628400 -- (-1994.726) (-1987.446) (-2003.202) [-1985.251] * [-1993.847] (-1990.891) (-1984.023) (-1987.411) -- 0:02:00
628500 -- [-1994.259] (-1991.046) (-1992.670) (-1985.062) * (-1990.965) (-2002.326) [-1985.753] (-1992.338) -- 0:02:00
628600 -- (-2009.492) [-1986.178] (-1990.616) (-1986.000) * [-1981.979] (-1989.367) (-1983.016) (-2001.314) -- 0:02:00
628700 -- (-1994.946) [-1980.644] (-1998.154) (-1990.025) * (-1982.293) (-1987.579) [-1984.671] (-2007.897) -- 0:02:00
628800 -- (-1997.183) (-1981.634) (-1995.630) [-1990.898] * [-1982.474] (-1990.270) (-1983.814) (-1994.128) -- 0:02:00
628900 -- (-1992.007) [-1981.656] (-1991.760) (-1988.555) * (-1983.525) (-1990.146) [-1984.793] (-1990.889) -- 0:02:00
629000 -- (-1994.879) [-1983.471] (-2002.698) (-1992.173) * (-1990.960) (-1988.890) [-1981.128] (-1989.684) -- 0:02:00
Average standard deviation of split frequencies: 0.002804
629100 -- (-1986.889) (-1992.619) [-1997.074] (-1995.776) * [-1986.920] (-1995.085) (-1983.496) (-1990.132) -- 0:02:00
629200 -- (-1994.567) [-1986.334] (-1997.056) (-1997.845) * (-1996.435) (-1995.187) (-1986.251) [-1991.483] -- 0:02:00
629300 -- (-1989.225) [-1985.341] (-1996.944) (-1998.443) * (-2007.489) (-1990.762) [-1984.375] (-1995.058) -- 0:02:00
629400 -- [-1987.321] (-1986.362) (-2000.422) (-2002.864) * (-2001.560) (-1992.610) [-1986.791] (-2000.893) -- 0:02:00
629500 -- [-1990.346] (-1985.836) (-1996.692) (-2003.147) * (-2007.122) (-2000.549) [-1985.529] (-1994.241) -- 0:02:00
629600 -- (-1997.186) [-1986.235] (-1993.962) (-1998.628) * (-2007.376) (-1998.164) (-1986.713) [-1995.817] -- 0:02:00
629700 -- [-1993.208] (-1989.950) (-1994.855) (-2002.837) * (-2002.720) (-1997.971) [-1987.121] (-1989.917) -- 0:01:59
629800 -- (-1992.294) [-1986.257] (-1997.099) (-1999.164) * (-2002.650) (-1996.091) (-1992.483) [-1991.673] -- 0:01:59
629900 -- (-1985.128) [-1985.386] (-1989.417) (-1993.680) * (-2009.333) (-1997.991) [-1991.293] (-1990.875) -- 0:01:59
630000 -- (-1995.934) [-1986.793] (-1995.920) (-2000.467) * (-2010.129) [-1988.360] (-1997.750) (-1987.854) -- 0:01:59
Average standard deviation of split frequencies: 0.002821
630100 -- [-1985.267] (-1988.863) (-1995.982) (-1998.256) * (-2004.627) (-1989.927) (-2009.338) [-1993.415] -- 0:01:59
630200 -- (-1985.200) [-1987.852] (-1992.117) (-1995.979) * (-2001.056) [-1986.686] (-1997.699) (-1992.575) -- 0:01:59
630300 -- (-1984.744) [-1991.079] (-1991.958) (-1998.873) * (-1997.220) (-1994.740) [-1988.987] (-1990.093) -- 0:01:59
630400 -- (-1993.844) [-1980.111] (-1988.918) (-1991.904) * (-1991.477) [-1991.048] (-1983.704) (-1991.448) -- 0:01:59
630500 -- (-1995.611) [-1978.706] (-1992.415) (-1994.386) * (-1989.636) (-2003.707) (-1984.444) [-1986.261] -- 0:01:59
630600 -- (-1987.454) [-1980.453] (-1989.249) (-1995.806) * (-1986.953) (-1996.379) [-1981.796] (-1991.736) -- 0:01:59
630700 -- (-1991.326) [-1986.749] (-1985.023) (-1999.999) * (-1986.796) [-1991.248] (-1986.205) (-1990.220) -- 0:01:59
630800 -- (-1989.225) [-1991.110] (-1987.315) (-2004.770) * [-1983.636] (-1996.059) (-1992.350) (-1986.582) -- 0:01:59
630900 -- (-1985.584) (-1995.933) [-1979.818] (-2000.040) * [-1985.873] (-2003.454) (-1990.051) (-1997.925) -- 0:01:59
631000 -- (-1987.911) (-1993.148) [-1980.488] (-1997.749) * [-1984.413] (-2001.306) (-1992.279) (-1993.571) -- 0:01:59
Average standard deviation of split frequencies: 0.002838
631100 -- (-1989.151) (-1991.846) [-1984.911] (-2006.304) * (-1991.989) (-1996.789) (-1985.014) [-1986.253] -- 0:01:59
631200 -- (-1989.869) [-1990.755] (-1990.023) (-1999.701) * (-1993.116) (-1998.600) (-1986.074) [-1985.087] -- 0:01:59
631300 -- (-1989.801) (-1989.308) (-1990.460) [-1987.808] * (-1991.858) (-2003.295) (-1991.669) [-1990.494] -- 0:01:59
631400 -- (-1991.302) [-1987.755] (-1987.009) (-1991.466) * [-1992.399] (-2004.009) (-1997.057) (-1990.628) -- 0:01:59
631500 -- (-1989.526) (-1984.583) (-1983.978) [-1985.847] * (-1998.380) (-1997.790) (-1998.610) [-1998.648] -- 0:01:59
631600 -- (-1993.805) [-1986.801] (-1983.680) (-1987.889) * [-1991.382] (-1997.406) (-1997.451) (-1987.023) -- 0:01:59
631700 -- (-1994.479) [-1984.941] (-1982.879) (-1996.768) * (-1988.486) [-1992.102] (-2006.907) (-1993.626) -- 0:01:59
631800 -- (-1988.919) [-1991.772] (-1985.579) (-1989.724) * (-1989.835) [-1987.519] (-1986.082) (-1996.835) -- 0:01:59
631900 -- (-1998.480) [-1985.256] (-1983.504) (-1983.622) * (-1993.745) (-1986.862) [-1984.664] (-1995.730) -- 0:01:59
632000 -- (-2001.102) [-1986.043] (-1982.371) (-1987.683) * (-1995.336) [-1986.490] (-1993.045) (-1995.941) -- 0:01:59
Average standard deviation of split frequencies: 0.002919
632100 -- (-2001.782) [-1981.580] (-1986.881) (-1992.499) * (-1987.606) (-1987.187) [-1989.095] (-1993.464) -- 0:01:59
632200 -- (-1995.064) [-1989.846] (-1982.749) (-2002.989) * [-1984.656] (-1996.371) (-1990.284) (-1997.133) -- 0:01:59
632300 -- (-1995.451) (-1984.360) [-1984.812] (-1999.240) * (-1990.906) (-1990.893) [-1981.594] (-1993.503) -- 0:01:59
632400 -- (-1997.298) (-1986.927) [-1984.291] (-1998.166) * (-1990.764) [-1988.090] (-1987.838) (-1994.964) -- 0:01:59
632500 -- (-1991.185) [-1982.069] (-1986.300) (-1996.049) * (-1998.061) (-1987.388) [-1986.819] (-1993.797) -- 0:01:59
632600 -- (-1997.614) [-1984.347] (-1987.804) (-2007.939) * (-1997.889) (-1992.039) (-1989.847) [-1993.047] -- 0:01:59
632700 -- (-1998.089) (-1982.599) [-1990.689] (-2005.072) * (-1992.274) [-1992.252] (-1990.783) (-2000.619) -- 0:01:59
632800 -- (-1997.801) [-1986.766] (-1998.632) (-1993.942) * (-1986.468) [-1989.553] (-1996.252) (-1998.236) -- 0:01:58
632900 -- (-2001.991) (-1989.313) [-1993.609] (-1992.842) * [-1983.541] (-1986.951) (-1994.258) (-1993.738) -- 0:01:58
633000 -- (-2002.940) [-1984.029] (-1990.716) (-1996.434) * [-1983.916] (-1986.768) (-1989.911) (-1993.116) -- 0:01:58
Average standard deviation of split frequencies: 0.002957
633100 -- (-1994.879) [-1983.347] (-1990.207) (-1991.546) * [-1982.645] (-1987.634) (-1987.917) (-1990.959) -- 0:01:58
633200 -- (-2000.289) [-1984.657] (-1987.462) (-1990.665) * [-1981.494] (-2000.751) (-1987.574) (-1996.766) -- 0:01:58
633300 -- (-1991.872) [-1983.954] (-1992.683) (-1989.865) * [-1983.439] (-1985.673) (-1990.120) (-1997.362) -- 0:01:58
633400 -- [-1990.104] (-1983.793) (-1989.192) (-1995.017) * [-1986.371] (-1983.295) (-1989.248) (-1986.708) -- 0:01:58
633500 -- (-1993.200) [-1989.422] (-1989.488) (-1999.496) * (-1985.865) (-1984.988) (-1992.103) [-1991.263] -- 0:01:58
633600 -- (-1989.608) (-1993.142) [-1978.806] (-1996.690) * [-1980.260] (-1986.079) (-1994.663) (-1991.987) -- 0:01:58
633700 -- (-1995.233) (-1991.871) (-1979.088) [-1993.454] * [-1982.793] (-1992.865) (-1983.625) (-1998.942) -- 0:01:58
633800 -- (-1998.738) (-1985.922) [-1980.911] (-2001.122) * [-1987.381] (-1999.503) (-1977.070) (-2002.116) -- 0:01:58
633900 -- (-1997.908) (-1995.205) (-1991.600) [-1989.817] * (-1991.909) (-1999.953) [-1978.994] (-1992.945) -- 0:01:58
634000 -- (-2002.322) (-1994.725) (-1996.482) [-1988.158] * (-1984.381) (-1997.366) [-1978.392] (-1997.000) -- 0:01:58
Average standard deviation of split frequencies: 0.002995
634100 -- (-1994.642) [-1994.226] (-2002.466) (-1995.542) * (-1982.935) [-1989.300] (-1981.727) (-2013.947) -- 0:01:58
634200 -- [-1996.572] (-1997.502) (-2000.164) (-1996.213) * (-1982.277) (-1989.244) [-1986.336] (-1997.854) -- 0:01:58
634300 -- (-1996.688) (-2002.436) [-1996.333] (-1992.182) * [-1983.036] (-1997.074) (-1985.229) (-2005.192) -- 0:01:58
634400 -- [-1988.568] (-1995.449) (-1994.424) (-1999.927) * [-1977.994] (-1988.754) (-1987.020) (-1990.096) -- 0:01:58
634500 -- [-1985.121] (-1997.048) (-2012.295) (-1994.716) * [-1980.714] (-1991.122) (-1988.236) (-1987.156) -- 0:01:58
634600 -- [-1984.447] (-1992.503) (-2006.662) (-1999.312) * [-1979.942] (-1989.138) (-1986.065) (-1989.774) -- 0:01:58
634700 -- (-1993.561) [-1990.088] (-1999.405) (-1992.747) * [-1980.825] (-1992.479) (-1990.440) (-1987.915) -- 0:01:58
634800 -- (-1991.560) [-1990.516] (-2006.827) (-2005.296) * (-1981.220) (-1999.527) (-1998.082) [-1991.573] -- 0:01:58
634900 -- (-1994.015) [-1989.189] (-2003.743) (-2006.687) * (-1978.849) (-1996.815) (-2009.971) [-1987.810] -- 0:01:58
635000 -- (-2000.825) [-1991.422] (-2004.462) (-1999.184) * (-1987.853) (-1989.063) (-1988.764) [-1986.722] -- 0:01:58
Average standard deviation of split frequencies: 0.002820
635100 -- (-1995.014) [-1988.014] (-1998.792) (-1999.297) * (-1989.907) (-1993.470) [-1987.953] (-1985.419) -- 0:01:58
635200 -- (-1999.617) [-1985.483] (-1998.070) (-1991.345) * (-1982.687) (-1999.006) (-1989.055) [-1984.272] -- 0:01:58
635300 -- (-2000.696) (-1985.958) (-1995.921) [-1995.147] * (-1982.557) (-1997.644) [-1983.183] (-1992.680) -- 0:01:58
635400 -- (-1994.772) [-1987.954] (-2002.874) (-2006.375) * (-1984.358) (-1995.344) [-1984.401] (-1997.256) -- 0:01:58
635500 -- (-1995.258) [-1987.332] (-1999.758) (-2006.406) * [-1987.545] (-1992.888) (-1986.219) (-2006.033) -- 0:01:58
635600 -- (-1991.034) [-1987.699] (-2003.858) (-2004.197) * (-1987.231) (-1994.960) [-1987.398] (-2001.918) -- 0:01:58
635700 -- (-1989.370) [-1983.333] (-1990.300) (-2003.658) * (-1986.317) (-1991.728) [-1985.748] (-1998.530) -- 0:01:58
635800 -- (-1991.595) [-1985.205] (-1994.286) (-1995.432) * [-1992.500] (-1991.256) (-1978.637) (-2007.165) -- 0:01:58
635900 -- (-1989.547) [-1984.981] (-2000.816) (-2002.876) * [-1984.052] (-1993.538) (-1979.731) (-2005.989) -- 0:01:57
636000 -- [-1986.480] (-1993.459) (-1996.834) (-2000.681) * (-1988.198) [-1992.621] (-1980.511) (-1995.605) -- 0:01:57
Average standard deviation of split frequencies: 0.002795
636100 -- (-1988.190) (-1991.048) [-1989.259] (-1992.050) * (-1998.302) (-1991.365) [-1983.103] (-2000.504) -- 0:01:57
636200 -- [-1988.200] (-1993.558) (-1983.327) (-1996.592) * (-1992.886) (-1994.926) [-1983.543] (-1995.529) -- 0:01:57
636300 -- [-1989.321] (-1999.061) (-1984.561) (-1997.341) * (-1988.866) (-1995.749) [-1986.808] (-1997.428) -- 0:01:57
636400 -- (-1987.602) (-1999.951) [-1987.688] (-1993.820) * [-1984.771] (-1997.159) (-1992.253) (-1990.406) -- 0:01:57
636500 -- (-1993.383) (-2005.575) [-1988.242] (-1987.078) * [-1977.451] (-1995.298) (-1996.435) (-1989.069) -- 0:01:57
636600 -- (-1988.817) (-1992.605) [-1991.791] (-1985.342) * (-1978.232) (-1988.097) [-1984.440] (-1988.424) -- 0:01:57
636700 -- (-1994.594) (-1987.965) (-1986.018) [-1987.932] * [-1978.564] (-1993.742) (-1992.759) (-1984.838) -- 0:01:57
636800 -- (-1993.423) (-1994.952) (-1989.722) [-1986.141] * [-1981.554] (-2000.741) (-1988.108) (-1988.384) -- 0:01:57
636900 -- (-1995.604) (-1995.855) (-1991.641) [-1991.408] * [-1981.795] (-1998.819) (-1987.244) (-1988.898) -- 0:01:57
637000 -- [-1990.587] (-1992.458) (-1986.838) (-1997.450) * [-1982.470] (-1990.646) (-1991.070) (-1991.533) -- 0:01:57
Average standard deviation of split frequencies: 0.002790
637100 -- [-1989.063] (-1994.894) (-1989.169) (-1999.622) * [-1985.342] (-1989.457) (-1993.062) (-1997.215) -- 0:01:57
637200 -- (-1984.321) (-2001.118) [-1983.474] (-1997.751) * [-1982.642] (-1990.428) (-1992.165) (-1998.708) -- 0:01:57
637300 -- [-1986.853] (-2004.275) (-1984.897) (-1989.339) * (-1988.921) [-1989.734] (-1991.668) (-1993.532) -- 0:01:57
637400 -- [-1988.327] (-1993.085) (-1993.759) (-1993.670) * (-1991.437) [-1996.532] (-1999.079) (-1992.818) -- 0:01:57
637500 -- (-2004.041) (-1994.175) [-1990.279] (-1989.653) * (-1984.565) (-2002.100) [-1990.737] (-1989.061) -- 0:01:57
637600 -- (-2000.846) (-1998.123) (-1993.609) [-1988.989] * [-1983.573] (-1998.910) (-1997.081) (-1992.342) -- 0:01:57
637700 -- (-1998.446) (-1990.570) (-1990.575) [-1987.901] * [-1979.691] (-2000.193) (-1985.366) (-1992.059) -- 0:01:57
637800 -- (-1995.822) (-1995.172) (-1993.612) [-1989.824] * [-1981.904] (-2009.981) (-1985.438) (-1994.501) -- 0:01:57
637900 -- (-1997.140) (-2000.539) (-1988.049) [-1986.869] * (-1990.899) (-1995.931) [-1983.475] (-1992.996) -- 0:01:57
638000 -- (-2004.932) (-1995.064) [-1991.233] (-1992.767) * [-1990.290] (-1989.514) (-1989.892) (-1985.548) -- 0:01:57
Average standard deviation of split frequencies: 0.002681
638100 -- (-2003.189) (-1991.470) (-1987.212) [-1986.929] * [-1985.139] (-1992.625) (-1990.200) (-1991.982) -- 0:01:57
638200 -- (-2007.700) (-1988.856) (-1992.049) [-1991.095] * [-1982.468] (-1991.238) (-1993.199) (-1993.849) -- 0:01:57
638300 -- (-1998.777) (-1991.627) (-1992.087) [-1987.294] * [-1981.645] (-1997.426) (-1984.337) (-2000.528) -- 0:01:57
638400 -- (-2000.624) [-1985.563] (-2002.941) (-1988.374) * [-1982.899] (-2007.683) (-1982.440) (-1997.240) -- 0:01:57
638500 -- (-1998.680) [-1986.056] (-1991.408) (-1986.749) * (-1981.966) (-1999.911) [-1985.022] (-2003.275) -- 0:01:57
638600 -- (-1990.560) [-1985.792] (-1993.425) (-1994.239) * (-1984.247) (-1996.607) [-1985.607] (-2005.722) -- 0:01:57
638700 -- (-1992.409) (-1989.450) [-1991.386] (-1988.879) * (-1992.184) (-1992.645) [-1982.399] (-2010.894) -- 0:01:57
638800 -- (-2000.339) (-1988.513) [-1986.421] (-1992.681) * (-1987.781) (-1990.898) [-1986.113] (-1990.734) -- 0:01:57
638900 -- (-2000.194) (-1983.990) [-1981.081] (-1986.659) * [-1985.037] (-1989.547) (-1988.400) (-1991.289) -- 0:01:56
639000 -- (-1998.647) [-1987.012] (-1981.558) (-1986.428) * (-1985.835) (-1989.147) [-1982.572] (-1998.256) -- 0:01:56
Average standard deviation of split frequencies: 0.002550
639100 -- (-1999.640) (-1994.043) [-1977.164] (-1987.560) * [-1982.700] (-1993.263) (-1985.634) (-1999.373) -- 0:01:56
639200 -- (-1998.988) (-1993.322) [-1978.256] (-1986.143) * [-1983.324] (-1988.968) (-1987.748) (-1997.940) -- 0:01:56
639300 -- (-1998.799) (-1994.452) [-1977.397] (-2003.041) * (-1990.109) (-1990.081) [-1979.196] (-1991.303) -- 0:01:56
639400 -- (-1997.848) (-1994.414) [-1976.577] (-1994.871) * (-1994.882) (-1993.493) [-1980.852] (-1987.231) -- 0:01:56
639500 -- (-1995.185) (-1999.286) [-1981.409] (-1993.155) * (-1988.621) (-1996.826) [-1984.182] (-1998.187) -- 0:01:56
639600 -- (-1990.201) (-2002.805) [-1979.740] (-1999.593) * (-1995.079) (-1999.001) [-1984.015] (-1999.832) -- 0:01:56
639700 -- (-1990.180) (-1999.410) [-1985.539] (-1990.854) * (-1992.338) (-1996.845) [-1981.133] (-1991.983) -- 0:01:56
639800 -- (-1995.550) (-2004.227) (-1985.128) [-1984.274] * (-1989.242) (-2001.460) [-1981.786] (-1988.451) -- 0:01:56
639900 -- (-1998.252) (-1996.401) [-1984.199] (-1991.514) * (-1987.005) (-2006.459) (-1982.449) [-1986.350] -- 0:01:56
640000 -- (-1994.912) (-1999.512) [-1982.874] (-1989.876) * (-1982.486) (-2000.762) [-1984.476] (-1994.225) -- 0:01:56
Average standard deviation of split frequencies: 0.002462
640100 -- (-1999.608) (-2002.108) (-1983.973) [-1992.955] * [-1979.007] (-1999.449) (-1988.677) (-2000.413) -- 0:01:56
640200 -- (-1993.434) (-2001.928) [-1983.936] (-1991.422) * [-1978.725] (-1991.675) (-1981.429) (-1995.054) -- 0:01:56
640300 -- (-1995.749) (-1995.314) [-1980.099] (-1996.456) * [-1983.113] (-1988.128) (-1985.514) (-1995.414) -- 0:01:56
640400 -- (-1989.711) (-2002.607) [-1980.626] (-1997.792) * (-1983.351) (-1991.931) [-1988.894] (-2001.033) -- 0:01:56
640500 -- (-1992.736) (-1998.233) [-1985.505] (-2001.269) * (-1989.778) [-1992.915] (-1985.123) (-1993.229) -- 0:01:56
640600 -- (-1990.978) (-1996.594) [-1981.910] (-1994.527) * (-1990.945) (-1993.335) (-1987.277) [-1989.305] -- 0:01:56
640700 -- (-1993.938) (-2004.802) [-1978.966] (-1991.892) * [-1984.947] (-1989.966) (-1983.174) (-1985.014) -- 0:01:56
640800 -- (-1993.461) (-1991.183) [-1982.629] (-1991.668) * [-1981.125] (-1994.631) (-1988.487) (-1983.649) -- 0:01:56
640900 -- (-2000.093) (-1992.367) [-1986.965] (-1988.338) * (-1979.883) (-1996.208) (-1997.068) [-1986.411] -- 0:01:56
641000 -- (-2001.677) [-1987.539] (-1991.444) (-1984.439) * [-1985.346] (-1991.956) (-2005.013) (-1986.399) -- 0:01:56
Average standard deviation of split frequencies: 0.002521
641100 -- (-1999.043) (-1990.156) (-1989.815) [-1983.421] * [-1983.553] (-2000.507) (-2001.428) (-1987.604) -- 0:01:56
641200 -- (-2007.209) (-1983.595) [-1981.719] (-1980.077) * [-1985.367] (-1995.330) (-1992.461) (-1992.109) -- 0:01:56
641300 -- (-2005.252) (-1985.499) (-1984.432) [-1982.724] * (-1985.852) (-1989.938) [-1982.738] (-1992.335) -- 0:01:56
641400 -- (-1998.836) [-1986.066] (-1983.371) (-1991.824) * (-1991.730) (-1995.590) [-1983.346] (-1996.800) -- 0:01:56
641500 -- (-1991.051) (-2002.808) (-1986.287) [-1989.109] * [-1989.100] (-1997.403) (-1988.193) (-2008.019) -- 0:01:56
641600 -- (-1991.395) (-1998.091) (-1985.672) [-1982.182] * (-1990.913) [-2001.258] (-1986.103) (-1997.622) -- 0:01:56
641700 -- (-1988.729) (-1988.814) [-1991.502] (-1989.805) * [-1988.353] (-1998.012) (-1986.102) (-1989.951) -- 0:01:56
641800 -- (-1987.741) (-1992.498) [-1987.931] (-1991.243) * (-1987.500) (-1992.935) (-1988.223) [-1989.418] -- 0:01:56
641900 -- (-1991.097) (-2003.029) [-1983.270] (-1991.042) * [-1982.568] (-1996.159) (-1994.709) (-1991.928) -- 0:01:56
642000 -- (-1994.435) (-2002.878) (-1982.553) [-1987.563] * (-1988.753) (-1996.147) (-1994.206) [-1993.725] -- 0:01:55
Average standard deviation of split frequencies: 0.002559
642100 -- (-1994.300) (-2010.816) [-1983.260] (-1992.924) * (-1988.378) (-1994.505) [-1992.256] (-1990.010) -- 0:01:55
642200 -- (-1993.193) (-2017.081) [-1985.163] (-1996.741) * (-1990.507) (-2002.110) (-1995.702) [-1985.764] -- 0:01:55
642300 -- (-2000.148) (-1995.291) (-1995.848) [-1988.640] * (-1992.806) (-1999.686) (-1995.367) [-1983.018] -- 0:01:55
642400 -- (-1997.913) (-1996.771) (-1992.712) [-1985.440] * [-1996.250] (-2002.979) (-2004.288) (-1983.292) -- 0:01:55
642500 -- (-2000.314) (-1991.465) (-2002.675) [-1985.061] * [-1996.682] (-2013.855) (-1998.830) (-1982.447) -- 0:01:55
642600 -- (-1995.892) [-1989.890] (-1999.262) (-1988.806) * [-1984.301] (-1992.226) (-1989.943) (-1996.917) -- 0:01:55
642700 -- (-1997.439) (-1995.962) (-2000.416) [-1987.918] * (-1986.941) (-1991.331) (-1992.766) [-1996.615] -- 0:01:55
642800 -- (-1995.187) (-1997.573) (-1995.803) [-1984.694] * [-1987.219] (-1989.006) (-1990.911) (-1989.903) -- 0:01:55
642900 -- (-1996.949) (-1997.812) [-1994.105] (-1985.520) * [-1986.878] (-1988.950) (-1999.203) (-1988.288) -- 0:01:55
643000 -- (-1995.808) [-1989.570] (-1989.042) (-1989.808) * (-1988.993) [-1988.523] (-1995.321) (-1989.631) -- 0:01:55
Average standard deviation of split frequencies: 0.002492
643100 -- (-1986.818) (-1997.920) (-1991.781) [-1988.599] * (-1992.993) (-1992.026) (-1993.739) [-1990.883] -- 0:01:55
643200 -- (-1986.360) (-2001.774) [-1986.351] (-1991.029) * (-1987.399) (-1988.522) [-1990.771] (-1999.619) -- 0:01:55
643300 -- (-1987.143) (-1998.935) [-1986.215] (-1997.256) * (-1982.467) (-1988.036) [-1989.298] (-2002.429) -- 0:01:55
643400 -- (-1992.260) (-2004.233) [-1990.813] (-1997.018) * (-1983.554) (-1992.015) [-1988.290] (-2005.220) -- 0:01:55
643500 -- (-1985.184) (-2012.641) [-1987.950] (-1999.475) * [-1985.804] (-1996.133) (-1988.763) (-1998.446) -- 0:01:55
643600 -- (-1991.833) (-2006.734) [-1988.034] (-1994.188) * (-1988.298) [-1995.559] (-1998.758) (-1999.635) -- 0:01:55
643700 -- [-1988.149] (-2004.792) (-1990.149) (-1994.932) * (-1986.620) (-1988.701) [-1996.221] (-1999.472) -- 0:01:55
643800 -- (-1994.417) (-2013.344) (-1986.770) [-1984.335] * [-1986.154] (-1992.172) (-1992.009) (-1998.137) -- 0:01:55
643900 -- (-1992.887) (-1995.450) (-1985.515) [-1979.760] * (-1978.875) (-1997.888) [-1989.223] (-1987.790) -- 0:01:55
644000 -- (-1998.799) (-1992.106) (-1999.452) [-1979.818] * (-1982.852) (-1994.519) (-1990.872) [-1990.398] -- 0:01:55
Average standard deviation of split frequencies: 0.002530
644100 -- (-1995.185) [-1989.465] (-1989.950) (-1979.903) * (-1979.362) [-1991.810] (-1988.349) (-2000.126) -- 0:01:55
644200 -- (-1998.127) [-1990.271] (-1983.738) (-1985.833) * [-1979.832] (-1987.833) (-1998.032) (-1992.560) -- 0:01:55
644300 -- (-2003.006) (-1991.643) [-1986.177] (-1984.306) * [-1977.665] (-1988.767) (-2000.151) (-1997.416) -- 0:01:55
644400 -- (-1998.058) (-1998.791) (-1995.622) [-1985.589] * (-1978.383) (-1995.707) (-1999.228) [-1990.542] -- 0:01:55
644500 -- (-1996.463) (-1992.413) (-1992.233) [-1987.154] * [-1976.613] (-1999.153) (-1995.125) (-1990.777) -- 0:01:55
644600 -- (-1998.034) (-1997.782) [-1993.615] (-1984.469) * [-1981.250] (-1992.379) (-2002.927) (-1994.959) -- 0:01:55
644700 -- (-1994.812) [-1993.418] (-1990.552) (-1986.192) * [-1979.423] (-1993.441) (-2002.001) (-1994.165) -- 0:01:55
644800 -- (-1994.160) (-1994.031) [-1983.910] (-1981.714) * [-1977.572] (-1993.783) (-1998.182) (-1996.653) -- 0:01:55
644900 -- (-1988.481) (-2013.853) (-1986.715) [-1978.202] * [-1979.889] (-2008.696) (-1993.679) (-1989.586) -- 0:01:55
645000 -- [-1988.740] (-2003.198) (-1979.631) (-1978.520) * (-1981.787) (-2000.655) [-1989.122] (-1996.190) -- 0:01:55
Average standard deviation of split frequencies: 0.002568
645100 -- (-1989.973) (-2012.451) [-1981.926] (-1980.087) * [-1980.322] (-1996.743) (-1990.865) (-1991.364) -- 0:01:54
645200 -- (-1986.011) (-2002.089) (-1981.350) [-1983.916] * [-1983.074] (-1997.560) (-1996.085) (-1987.460) -- 0:01:54
645300 -- (-1987.874) (-2004.982) (-1990.396) [-1979.409] * (-1984.387) (-1989.816) (-1998.203) [-1986.576] -- 0:01:54
645400 -- (-1983.667) (-2003.302) (-1995.288) [-1982.947] * (-1980.491) (-1993.259) [-1995.300] (-1983.680) -- 0:01:54
645500 -- (-1991.569) (-1998.985) (-1995.350) [-1980.278] * (-1983.322) [-1986.271] (-1987.261) (-1991.248) -- 0:01:54
645600 -- (-1995.379) (-1998.784) (-1990.812) [-1978.789] * (-1981.569) (-1991.165) [-1985.002] (-1986.278) -- 0:01:54
645700 -- (-1993.620) (-1996.249) (-1992.145) [-1983.010] * (-1987.195) (-1991.731) [-1986.920] (-1995.026) -- 0:01:54
645800 -- [-1992.647] (-1995.920) (-1991.904) (-1985.731) * (-1992.860) (-1996.945) (-1990.448) [-1987.786] -- 0:01:54
645900 -- [-1994.811] (-1996.829) (-1993.876) (-1980.140) * [-1987.817] (-2004.952) (-1993.789) (-1990.755) -- 0:01:54
646000 -- (-1992.390) (-1997.113) (-1983.280) [-1984.140] * [-1987.136] (-2002.390) (-1991.918) (-1996.546) -- 0:01:55
Average standard deviation of split frequencies: 0.002606
646100 -- (-2007.115) (-2003.652) [-1979.089] (-1983.886) * [-1983.722] (-2005.124) (-1994.204) (-1999.019) -- 0:01:55
646200 -- (-2000.876) (-2001.584) [-1981.661] (-1986.306) * [-1984.972] (-1998.320) (-1996.329) (-1994.181) -- 0:01:54
646300 -- (-1993.270) (-1996.416) [-1980.799] (-1983.087) * [-1984.015] (-1997.774) (-1988.344) (-1994.250) -- 0:01:54
646400 -- (-2004.769) (-1998.250) (-1986.619) [-1984.259] * [-1986.628] (-2013.779) (-1988.096) (-1990.442) -- 0:01:54
646500 -- (-1997.271) (-1995.114) [-1980.678] (-1984.004) * [-1989.607] (-2008.796) (-1990.872) (-1986.061) -- 0:01:54
646600 -- (-1990.027) (-2002.978) (-1983.955) [-1980.483] * (-1993.129) (-2000.755) (-1988.270) [-1981.241] -- 0:01:54
646700 -- (-1991.133) (-2004.714) (-1992.884) [-1984.934] * [-1984.388] (-2003.137) (-1990.472) (-1992.603) -- 0:01:54
646800 -- (-1986.283) (-2006.136) (-1994.362) [-1985.891] * (-1983.692) (-2001.653) [-1989.056] (-1992.093) -- 0:01:54
646900 -- [-1985.787] (-2011.074) (-2000.607) (-1990.260) * (-1983.598) (-1999.282) [-1981.890] (-1986.283) -- 0:01:54
647000 -- (-1992.279) (-2010.624) [-1995.685] (-1986.474) * [-1983.955] (-2001.495) (-1982.584) (-1984.297) -- 0:01:54
Average standard deviation of split frequencies: 0.002560
647100 -- (-1989.674) (-1999.592) [-1981.183] (-1985.573) * (-1987.604) (-1995.984) [-1985.725] (-1994.117) -- 0:01:54
647200 -- (-1992.774) (-2001.245) [-1980.965] (-1987.923) * (-1992.084) (-2002.653) [-1984.291] (-1997.768) -- 0:01:54
647300 -- (-1991.275) (-2002.558) (-1982.570) [-1983.254] * (-1987.730) (-2004.614) [-1977.109] (-1993.834) -- 0:01:54
647400 -- (-1990.083) (-1992.759) (-1983.063) [-1981.563] * (-1990.193) (-2002.818) [-1980.606] (-1988.824) -- 0:01:54
647500 -- (-1989.984) (-1989.902) (-1979.062) [-1978.763] * (-1984.288) (-2008.871) (-1987.932) [-1983.591] -- 0:01:54
647600 -- (-2001.107) (-1994.834) (-1984.030) [-1984.190] * [-1985.651] (-2006.954) (-1981.820) (-1983.403) -- 0:01:54
647700 -- [-1994.983] (-1996.407) (-1985.426) (-1977.738) * (-1991.946) (-2004.527) [-1982.172] (-1988.720) -- 0:01:54
647800 -- (-1992.999) (-2002.684) (-1989.948) [-1982.168] * (-1993.952) (-2005.061) [-1979.721] (-1990.126) -- 0:01:54
647900 -- (-2001.488) (-1999.278) (-1990.909) [-1978.972] * (-1996.204) (-2001.024) (-1981.283) [-1989.964] -- 0:01:54
648000 -- (-2001.591) (-1994.924) (-1995.081) [-1980.423] * (-2003.067) (-2010.789) [-1978.975] (-1985.984) -- 0:01:54
Average standard deviation of split frequencies: 0.002639
648100 -- (-2007.991) (-2002.481) (-1985.250) [-1980.637] * (-1996.627) (-2002.036) (-1985.945) [-1985.695] -- 0:01:54
648200 -- (-1999.438) (-1997.334) [-1982.758] (-1983.649) * (-1991.570) (-1998.146) (-1987.050) [-1984.655] -- 0:01:53
648300 -- (-1998.138) (-1995.381) (-1991.017) [-1982.360] * (-1995.007) [-1993.818] (-1995.011) (-1988.944) -- 0:01:53
648400 -- (-1989.010) (-1997.618) [-1985.405] (-1991.252) * (-1985.619) (-1991.735) (-1990.201) [-1985.219] -- 0:01:53
648500 -- (-1996.215) (-1993.219) [-1985.442] (-1986.282) * [-1979.072] (-1997.782) (-1985.437) (-1983.889) -- 0:01:53
648600 -- (-1988.923) [-1989.493] (-1988.681) (-1996.411) * [-1981.480] (-1996.024) (-1987.562) (-1984.065) -- 0:01:53
648700 -- (-1994.022) (-1988.046) [-1985.527] (-1991.410) * [-1981.007] (-1995.567) (-1985.810) (-1990.253) -- 0:01:53
648800 -- (-1999.197) (-1986.415) (-2001.965) [-1988.473] * (-1984.544) (-1995.452) [-1986.912] (-1993.040) -- 0:01:53
648900 -- [-2002.271] (-1994.902) (-2005.334) (-1992.813) * [-1984.993] (-1994.946) (-1990.345) (-1985.174) -- 0:01:53
649000 -- (-2005.400) (-1995.681) (-2002.251) [-1981.502] * (-1995.808) (-1988.383) [-1981.998] (-1985.297) -- 0:01:53
Average standard deviation of split frequencies: 0.002697
649100 -- (-1998.906) (-1995.732) (-1998.648) [-1980.198] * (-1997.089) (-1989.136) (-1988.142) [-1985.205] -- 0:01:54
649200 -- (-1999.173) [-1993.702] (-2000.085) (-1988.869) * (-1995.219) (-1988.886) (-1988.875) [-1982.756] -- 0:01:54
649300 -- (-1996.434) (-1988.123) (-1998.886) [-1986.378] * (-1995.087) [-1985.596] (-1990.784) (-1991.917) -- 0:01:53
649400 -- (-1989.874) [-1990.486] (-2011.241) (-1990.867) * (-1997.981) [-1984.083] (-1999.920) (-2001.905) -- 0:01:53
649500 -- (-1989.402) (-1994.469) (-2006.109) [-1987.190] * (-1990.349) (-1995.693) [-1989.283] (-1994.732) -- 0:01:53
649600 -- [-1983.657] (-1993.599) (-1994.580) (-1990.564) * (-1988.164) (-2001.708) [-1982.116] (-1993.579) -- 0:01:53
649700 -- (-1989.818) (-1991.653) (-2002.997) [-1987.013] * (-1988.377) (-2007.764) [-1977.113] (-1997.912) -- 0:01:53
649800 -- [-1994.315] (-1991.939) (-1999.194) (-1990.602) * (-1990.749) (-1997.704) (-1984.856) [-1991.766] -- 0:01:53
649900 -- (-1995.773) (-1995.545) (-1995.905) [-1986.753] * (-2000.488) (-1995.353) (-1980.279) [-1984.985] -- 0:01:53
650000 -- (-2008.201) (-1989.414) (-1995.363) [-1984.182] * (-2003.000) (-2000.019) [-1981.294] (-1988.645) -- 0:01:53
Average standard deviation of split frequencies: 0.002817
650100 -- (-2010.543) (-1993.732) (-1994.254) [-1980.183] * (-1994.601) [-1995.878] (-1982.825) (-1993.886) -- 0:01:53
650200 -- (-1999.849) (-1991.229) [-1985.765] (-1984.351) * (-1997.434) (-1992.433) [-1986.899] (-1990.163) -- 0:01:53
650300 -- (-1994.355) (-1986.349) (-1984.605) [-1988.198] * (-2000.219) (-1990.662) [-1987.702] (-1987.991) -- 0:01:53
650400 -- (-1993.413) (-1993.740) [-1985.344] (-1988.436) * (-1999.383) (-1988.328) (-1984.825) [-1982.499] -- 0:01:53
650500 -- (-1992.898) (-1988.294) (-1990.019) [-1981.610] * (-1998.981) (-1984.648) [-1983.197] (-1990.249) -- 0:01:53
650600 -- (-2002.267) (-1989.525) [-1988.321] (-1980.605) * (-1988.910) (-1997.404) [-1980.035] (-1996.752) -- 0:01:53
650700 -- (-2002.204) (-1991.246) (-1986.686) [-1981.516] * [-1986.815] (-1994.867) (-1992.962) (-1989.186) -- 0:01:53
650800 -- (-1997.303) (-1993.200) (-1986.746) [-1983.441] * [-1982.825] (-1992.780) (-1998.503) (-1995.536) -- 0:01:53
650900 -- (-1991.332) (-1993.948) (-1986.555) [-1982.663] * (-1989.025) (-1994.504) [-1983.549] (-1990.372) -- 0:01:53
651000 -- (-1994.984) (-2003.115) (-1983.014) [-1983.319] * [-1985.806] (-1997.635) (-1984.919) (-1991.965) -- 0:01:53
Average standard deviation of split frequencies: 0.002792
651100 -- (-1994.799) (-1993.760) (-1988.522) [-1978.681] * (-1985.869) (-1992.675) [-1982.904] (-1991.945) -- 0:01:53
651200 -- (-1992.133) (-2002.873) (-1986.933) [-1978.342] * (-1982.873) (-1998.183) [-1979.732] (-1988.251) -- 0:01:53
651300 -- [-1989.837] (-1994.829) (-1990.901) (-1982.279) * [-1985.910] (-2012.280) (-1987.050) (-1988.994) -- 0:01:52
651400 -- [-1987.579] (-1991.257) (-1993.575) (-1987.458) * [-1994.105] (-2013.101) (-1987.017) (-1987.228) -- 0:01:52
651500 -- (-1991.483) (-1991.779) (-1994.194) [-1986.534] * (-1993.394) (-2001.135) [-1980.923] (-1984.183) -- 0:01:52
651600 -- (-1994.155) [-1985.431] (-1999.389) (-1982.191) * (-1992.574) (-2009.614) (-1983.489) [-1977.699] -- 0:01:52
651700 -- (-1991.507) [-1987.724] (-1994.366) (-1989.110) * (-1993.948) (-2009.642) (-1984.317) [-1979.550] -- 0:01:52
651800 -- (-1990.370) (-1985.253) (-1997.155) [-1985.879] * (-1990.687) (-2011.540) [-1985.833] (-1982.687) -- 0:01:52
651900 -- (-1998.140) (-1994.353) (-1990.333) [-1983.824] * (-1985.162) (-2010.489) (-1988.615) [-1981.012] -- 0:01:52
652000 -- (-1993.248) (-1988.656) [-1992.598] (-1982.979) * (-1979.725) (-2012.514) (-1987.515) [-1982.755] -- 0:01:52
Average standard deviation of split frequencies: 0.002809
652100 -- (-1989.282) (-1990.113) (-1993.566) [-1982.326] * [-1983.023] (-2006.374) (-1998.749) (-1981.998) -- 0:01:53
652200 -- (-1992.025) (-1989.537) (-1987.773) [-1978.544] * (-1979.454) (-2002.626) (-1990.831) [-1982.287] -- 0:01:53
652300 -- (-1992.264) (-1986.095) (-1990.566) [-1977.593] * [-1982.538] (-1989.567) (-1995.683) (-1981.088) -- 0:01:53
652400 -- (-1992.909) [-1988.605] (-1999.437) (-1986.024) * (-1981.761) (-2002.544) (-1992.937) [-1980.592] -- 0:01:52
652500 -- [-1991.690] (-1987.366) (-2003.440) (-1986.152) * (-1978.519) (-1996.736) [-1995.519] (-1981.886) -- 0:01:52
652600 -- (-1989.372) [-1986.325] (-1995.335) (-1987.161) * [-1976.484] (-1996.426) (-1986.956) (-1984.213) -- 0:01:52
652700 -- (-1990.584) [-1988.590] (-2001.204) (-1983.745) * (-1981.362) (-1987.198) (-1994.770) [-1983.611] -- 0:01:52
652800 -- (-1991.910) (-1989.463) [-1993.524] (-1984.643) * (-1986.216) (-1994.299) (-1998.021) [-1984.488] -- 0:01:52
652900 -- (-2001.917) [-1985.585] (-1991.824) (-1989.087) * (-1981.874) (-1991.366) (-2002.506) [-1986.033] -- 0:01:52
653000 -- (-1997.232) (-1985.638) [-1995.203] (-1981.869) * [-1979.013] (-1988.194) (-1995.112) (-1989.980) -- 0:01:52
Average standard deviation of split frequencies: 0.002825
653100 -- (-1995.811) (-1987.670) (-2006.111) [-1991.100] * [-1979.985] (-1991.913) (-1991.273) (-1983.863) -- 0:01:52
653200 -- (-1995.307) [-1988.198] (-1985.136) (-1995.136) * (-1984.455) (-1990.726) (-1990.521) [-1985.980] -- 0:01:52
653300 -- (-1990.746) [-1985.368] (-1988.215) (-1997.122) * [-1983.782] (-1991.482) (-1992.114) (-1998.333) -- 0:01:52
653400 -- [-1989.343] (-1988.002) (-1995.381) (-1995.631) * [-1984.981] (-1988.422) (-1991.543) (-2001.121) -- 0:01:52
653500 -- [-1985.796] (-1987.360) (-2002.209) (-1989.885) * [-1986.871] (-1987.108) (-1990.043) (-1989.570) -- 0:01:52
653600 -- (-1992.467) (-1992.166) (-2013.481) [-1989.366] * (-1984.646) (-1989.395) (-1993.144) [-1979.404] -- 0:01:52
653700 -- [-1986.283] (-1996.550) (-2024.827) (-1987.557) * (-1983.589) (-1994.256) (-1993.866) [-1980.237] -- 0:01:52
653800 -- (-1998.003) [-1994.355] (-1996.115) (-1991.698) * (-1985.256) (-1999.587) (-1985.505) [-1983.055] -- 0:01:52
653900 -- [-1987.896] (-1993.153) (-1989.546) (-1994.458) * (-1986.745) (-1998.846) [-1991.278] (-1982.531) -- 0:01:52
654000 -- [-1985.028] (-1994.154) (-1988.909) (-1995.421) * (-1984.523) (-1993.499) (-1992.485) [-1986.922] -- 0:01:52
Average standard deviation of split frequencies: 0.002697
654100 -- (-1987.236) (-1995.754) (-1989.440) [-1991.805] * (-1986.634) (-1995.798) [-1987.900] (-1989.991) -- 0:01:52
654200 -- (-1993.259) (-1996.132) [-1982.462] (-1998.209) * (-1988.324) (-2005.337) [-1984.603] (-1981.980) -- 0:01:52
654300 -- [-1988.800] (-2000.429) (-1986.922) (-1989.270) * [-1990.153] (-1998.935) (-1982.355) (-1983.805) -- 0:01:52
654400 -- (-1992.059) (-1999.513) [-1983.101] (-1989.752) * (-1988.731) (-2001.520) (-1981.608) [-1983.456] -- 0:01:51
654500 -- (-1995.205) (-1996.910) [-1980.975] (-2000.222) * (-2000.273) (-2003.396) (-1985.466) [-1992.800] -- 0:01:51
654600 -- (-1990.791) (-2003.837) [-1988.088] (-2008.746) * (-1992.413) (-1998.578) [-1987.831] (-1994.153) -- 0:01:51
654700 -- (-1990.981) (-2000.207) [-1994.150] (-2007.501) * (-1991.148) (-1992.304) [-1984.747] (-1994.837) -- 0:01:51
654800 -- (-1987.585) (-1997.605) [-1990.652] (-1993.959) * (-1993.956) [-1985.789] (-1983.429) (-2000.882) -- 0:01:51
654900 -- [-1989.189] (-1991.314) (-1985.153) (-1994.871) * (-1995.400) [-1989.097] (-1986.377) (-1999.857) -- 0:01:51
655000 -- (-1989.149) (-1993.676) (-1989.807) [-1990.178] * (-1993.605) [-1991.024] (-1988.360) (-1991.093) -- 0:01:51
Average standard deviation of split frequencies: 0.002775
655100 -- (-1993.069) (-1997.149) [-1991.331] (-1990.686) * (-1987.807) (-1997.389) (-1989.899) [-1988.063] -- 0:01:52
655200 -- (-1999.750) (-1998.074) [-1991.995] (-1992.009) * (-1985.723) [-1992.788] (-1994.129) (-1989.912) -- 0:01:52
655300 -- (-2001.002) [-1992.287] (-1989.222) (-1992.867) * [-1987.114] (-1995.916) (-1986.110) (-1988.771) -- 0:01:52
655400 -- (-2003.150) (-1996.646) (-1996.472) [-1992.782] * [-1991.187] (-2019.795) (-1994.809) (-1992.699) -- 0:01:51
655500 -- (-1992.509) (-1994.852) [-1987.418] (-1991.702) * [-1985.502] (-2006.219) (-1989.160) (-1998.919) -- 0:01:51
655600 -- (-1992.529) [-1990.942] (-1988.413) (-1988.469) * [-1983.887] (-2009.041) (-1989.100) (-2002.551) -- 0:01:51
655700 -- (-1991.895) (-2002.354) (-1996.347) [-1986.807] * (-1982.760) (-2002.255) [-1987.376] (-2004.279) -- 0:01:51
655800 -- [-1993.143] (-2002.021) (-2004.760) (-1986.761) * [-1978.936] (-2005.844) (-1984.225) (-1999.001) -- 0:01:51
655900 -- (-1992.101) (-1992.943) (-2004.848) [-1990.353] * (-1987.898) (-2000.658) [-1988.292] (-1992.297) -- 0:01:51
656000 -- (-1992.279) (-1996.429) [-1994.954] (-1994.058) * (-1986.985) (-2002.715) [-1987.174] (-1996.952) -- 0:01:51
Average standard deviation of split frequencies: 0.002751
656100 -- [-1995.610] (-1996.833) (-2002.302) (-1998.077) * [-1980.833] (-1993.772) (-1988.262) (-2000.888) -- 0:01:51
656200 -- [-1995.993] (-1999.075) (-1991.830) (-1994.508) * (-1987.074) [-1993.581] (-1985.375) (-1997.651) -- 0:01:51
656300 -- (-1996.236) (-1998.054) (-1988.343) [-1993.053] * (-1982.196) (-1994.282) [-1984.679] (-1997.880) -- 0:01:51
656400 -- (-1994.680) [-1986.528] (-1994.908) (-1986.549) * (-1981.230) [-1990.225] (-1984.995) (-2003.916) -- 0:01:51
656500 -- (-1994.288) (-1984.725) (-1990.426) [-1985.676] * [-1982.275] (-1989.146) (-1985.099) (-1994.924) -- 0:01:51
656600 -- (-1997.029) (-1985.716) (-1990.389) [-1986.890] * (-1982.229) [-1989.101] (-1992.012) (-1999.927) -- 0:01:51
656700 -- (-2003.770) (-1991.618) (-1989.727) [-1993.458] * (-1986.891) (-2000.264) [-1988.286] (-1989.177) -- 0:01:51
656800 -- [-1992.528] (-1996.546) (-1990.195) (-1983.462) * [-1987.983] (-1993.242) (-1987.948) (-1996.241) -- 0:01:51
656900 -- (-2002.963) (-2005.555) (-1984.716) [-1980.734] * (-1984.786) (-1990.479) [-1981.185] (-1998.178) -- 0:01:51
657000 -- (-1998.328) (-2005.402) [-1987.408] (-1985.751) * (-1986.025) (-1991.219) [-1983.279] (-1996.169) -- 0:01:51
Average standard deviation of split frequencies: 0.002603
657100 -- (-1992.920) (-2006.316) (-1993.491) [-1990.004] * [-1991.279] (-1992.367) (-1981.811) (-1999.657) -- 0:01:51
657200 -- (-1992.372) (-2007.584) [-1989.952] (-1991.262) * [-1990.178] (-1997.542) (-1979.217) (-1993.547) -- 0:01:51
657300 -- (-1989.723) (-2001.580) [-1984.734] (-1988.158) * (-1991.879) (-1997.458) [-1979.611] (-1995.857) -- 0:01:51
657400 -- (-1998.050) (-1999.324) [-1983.720] (-1991.745) * (-1984.945) (-1991.993) [-1980.369] (-1998.631) -- 0:01:51
657500 -- [-1995.590] (-2009.436) (-1985.525) (-1992.464) * [-1981.530] (-2001.193) (-1986.630) (-1993.974) -- 0:01:50
657600 -- (-1997.255) (-2007.465) (-1987.074) [-1988.982] * (-1990.280) (-1987.670) [-1982.863] (-1986.916) -- 0:01:50
657700 -- (-1994.591) (-1998.540) (-1987.892) [-1991.453] * (-1990.256) (-1990.302) [-1984.189] (-1993.371) -- 0:01:50
657800 -- (-1988.995) (-1993.760) [-1989.549] (-1994.887) * [-1985.422] (-1989.644) (-1982.267) (-1989.706) -- 0:01:50
657900 -- (-1993.985) (-1992.831) (-1992.621) [-1988.057] * (-1986.517) (-1992.631) [-1978.061] (-1988.378) -- 0:01:50
658000 -- (-1998.060) [-1990.579] (-1993.648) (-1990.529) * (-1985.561) (-1990.321) [-1980.422] (-1992.533) -- 0:01:50
Average standard deviation of split frequencies: 0.002640
658100 -- (-1999.387) (-1993.933) [-1989.677] (-1986.190) * (-1984.429) (-1996.761) [-1981.341] (-1987.735) -- 0:01:51
658200 -- (-1993.749) (-1997.895) (-1998.152) [-1987.485] * [-1983.798] (-1987.982) (-1986.460) (-1984.908) -- 0:01:51
658300 -- (-1994.672) (-1998.725) (-1994.841) [-1982.962] * (-1985.450) (-1989.347) [-1983.627] (-1987.167) -- 0:01:51
658400 -- (-1993.203) (-2002.672) (-1992.955) [-1982.066] * (-1983.016) (-1992.438) [-1980.132] (-1983.682) -- 0:01:51
658500 -- (-1989.248) (-2002.968) (-1995.952) [-1985.046] * (-1982.412) (-1988.285) (-1981.398) [-1984.478] -- 0:01:50
658600 -- (-1990.482) (-2010.588) (-2004.421) [-1984.792] * (-1987.527) (-1988.858) (-1984.547) [-1988.672] -- 0:01:50
658700 -- [-1994.216] (-1992.212) (-1996.353) (-1990.042) * (-1986.565) (-1990.057) (-1981.759) [-1987.313] -- 0:01:50
658800 -- [-1989.932] (-1992.013) (-1996.546) (-1983.101) * [-1988.085] (-1994.924) (-1984.737) (-1988.202) -- 0:01:50
658900 -- (-1989.040) (-1993.704) (-1999.299) [-1984.359] * [-1984.388] (-1995.253) (-1987.597) (-1984.096) -- 0:01:50
659000 -- (-1990.501) (-1998.834) (-2003.330) [-1986.378] * (-1988.529) (-1992.977) [-1982.650] (-1985.226) -- 0:01:50
Average standard deviation of split frequencies: 0.002656
659100 -- (-1988.425) [-1991.857] (-1997.689) (-1993.382) * (-1993.166) (-1999.298) [-1979.278] (-1987.631) -- 0:01:50
659200 -- (-1993.002) [-1985.657] (-1991.592) (-1998.932) * (-1996.921) (-1997.699) [-1979.681] (-1987.200) -- 0:01:50
659300 -- (-1990.569) (-1990.276) (-1989.428) [-1990.943] * (-1988.086) (-1989.840) [-1979.243] (-1990.224) -- 0:01:50
659400 -- (-1989.898) (-1993.271) [-1987.680] (-1997.869) * (-1989.051) (-1997.677) [-1980.543] (-1989.593) -- 0:01:50
659500 -- (-1991.925) (-1993.948) [-1986.256] (-1994.190) * (-1994.754) (-1995.896) [-1982.482] (-1992.096) -- 0:01:50
659600 -- (-1992.871) (-1999.383) [-1988.446] (-1991.081) * (-1989.419) (-1996.334) [-1979.710] (-1990.571) -- 0:01:50
659700 -- (-1989.350) (-1992.457) (-1986.528) [-1987.503] * (-1994.502) (-1989.624) [-1979.642] (-1985.585) -- 0:01:50
659800 -- (-1988.715) (-1993.949) (-1989.188) [-1992.812] * (-1987.839) (-1987.658) [-1978.822] (-1986.829) -- 0:01:50
659900 -- (-1989.379) (-2005.685) [-1991.439] (-1991.492) * (-1987.179) (-1991.714) [-1980.676] (-1983.369) -- 0:01:50
660000 -- (-1991.404) (-2004.941) (-1994.907) [-1986.829] * (-1985.217) (-1995.945) [-1977.937] (-1983.755) -- 0:01:50
Average standard deviation of split frequencies: 0.002795
660100 -- (-1996.377) (-1998.218) (-1998.230) [-1986.393] * (-1989.935) (-1997.251) (-1981.713) [-1982.229] -- 0:01:50
660200 -- (-1996.130) (-1992.795) [-1988.490] (-1988.255) * (-2003.052) (-1998.059) (-1980.695) [-1976.205] -- 0:01:50
660300 -- (-1992.030) (-1996.682) [-1991.083] (-1989.375) * (-2005.579) (-1994.582) (-1983.822) [-1980.847] -- 0:01:50
660400 -- (-1991.757) (-1994.289) (-1989.740) [-1986.084] * (-1995.674) (-1998.558) (-1984.252) [-1982.202] -- 0:01:50
660500 -- [-1991.760] (-2002.259) (-1994.758) (-1993.652) * [-1988.632] (-2002.383) (-1987.713) (-1985.636) -- 0:01:49
660600 -- (-1991.638) (-1998.628) (-1994.959) [-1985.880] * [-1990.538] (-2002.244) (-1987.000) (-1987.276) -- 0:01:49
660700 -- (-2000.089) (-2005.222) (-1999.997) [-1986.000] * (-1992.395) (-2001.251) (-1987.204) [-1982.170] -- 0:01:49
660800 -- [-1992.071] (-1996.332) (-2003.179) (-1996.572) * (-1996.912) (-1997.906) [-1987.770] (-1995.064) -- 0:01:49
660900 -- [-1985.328] (-1996.446) (-2001.304) (-1996.069) * (-1994.639) (-2003.080) (-1990.576) [-1983.460] -- 0:01:49
661000 -- (-1990.880) (-1997.339) (-1994.349) [-1992.589] * (-1984.754) (-2003.026) [-1989.191] (-1988.519) -- 0:01:49
Average standard deviation of split frequencies: 0.002893
661100 -- (-1991.253) (-1996.636) [-1995.911] (-1988.170) * (-1987.971) (-2004.711) [-1984.685] (-1988.479) -- 0:01:50
661200 -- (-1992.688) (-2000.956) [-1992.209] (-1988.377) * (-1987.940) (-2014.284) [-1983.070] (-1991.632) -- 0:01:50
661300 -- [-1986.175] (-1993.193) (-1998.850) (-1987.531) * (-1992.429) (-2012.339) [-1985.406] (-1995.960) -- 0:01:50
661400 -- [-1984.885] (-1996.791) (-2003.997) (-1990.665) * (-1988.860) (-2015.786) [-1985.938] (-1994.298) -- 0:01:50
661500 -- [-1983.226] (-1998.631) (-1991.700) (-1987.707) * (-1991.513) (-2005.249) [-1984.286] (-1997.274) -- 0:01:50
661600 -- [-1989.553] (-1994.877) (-1990.521) (-1993.613) * (-1998.869) (-1997.420) [-1986.634] (-1998.330) -- 0:01:49
661700 -- (-1989.800) (-1991.308) (-1989.577) [-1987.038] * (-1994.936) [-1990.542] (-1987.454) (-1997.219) -- 0:01:49
661800 -- [-1986.499] (-1986.805) (-1989.852) (-1989.903) * (-2004.716) (-1990.523) [-1986.296] (-1995.830) -- 0:01:49
661900 -- (-1989.266) (-2000.615) [-1991.019] (-1989.560) * (-1993.228) (-1988.571) [-1985.405] (-1990.811) -- 0:01:49
662000 -- [-1991.752] (-1999.362) (-1992.934) (-1997.738) * [-1990.624] (-1995.649) (-1985.136) (-1998.498) -- 0:01:49
Average standard deviation of split frequencies: 0.002929
662100 -- (-1991.539) (-1996.287) [-1985.918] (-1994.868) * (-1987.523) (-2000.226) [-1983.783] (-2006.504) -- 0:01:49
662200 -- (-1996.745) (-2001.962) [-1984.833] (-1990.114) * (-1988.666) (-1999.802) [-1985.784] (-1995.753) -- 0:01:49
662300 -- (-2002.706) (-2000.590) [-1989.900] (-2002.479) * (-1987.571) (-1997.175) [-1990.421] (-1992.470) -- 0:01:49
662400 -- (-2010.864) (-1990.247) [-1985.985] (-1998.759) * (-1991.566) (-1990.842) [-1984.452] (-1995.580) -- 0:01:49
662500 -- (-2003.735) (-1994.643) [-1989.707] (-1998.700) * [-1987.060] (-1995.084) (-1982.814) (-1991.911) -- 0:01:49
662600 -- (-1999.948) (-1998.859) [-1987.898] (-2001.139) * (-1985.778) (-1992.948) [-1980.399] (-1992.631) -- 0:01:49
662700 -- (-1989.590) [-1993.182] (-1989.175) (-2002.110) * [-1985.275] (-2000.813) (-1981.743) (-1988.632) -- 0:01:49
662800 -- (-1997.564) (-1993.399) [-1987.757] (-2007.829) * (-1987.530) (-2011.298) [-1977.209] (-1986.702) -- 0:01:49
662900 -- [-1990.426] (-1990.407) (-1983.252) (-2002.353) * (-1986.456) (-1999.039) [-1983.754] (-1987.265) -- 0:01:49
663000 -- (-1993.420) (-1985.936) [-1989.072] (-2003.856) * (-1994.663) (-1991.584) (-1984.409) [-1989.262] -- 0:01:49
Average standard deviation of split frequencies: 0.002823
663100 -- (-1996.027) (-1990.130) [-1984.751] (-1996.158) * [-1987.783] (-1992.714) (-1990.613) (-1990.897) -- 0:01:49
663200 -- [-1991.034] (-1996.634) (-1988.851) (-2002.236) * [-1991.321] (-2001.758) (-1985.481) (-1991.140) -- 0:01:49
663300 -- (-1989.133) (-1999.382) [-1993.435] (-1995.703) * (-1990.692) (-1994.992) (-1981.293) [-1986.066] -- 0:01:49
663400 -- (-1986.772) (-1998.633) [-1994.939] (-2000.292) * [-1985.106] (-1999.579) (-1984.231) (-1988.540) -- 0:01:49
663500 -- [-1988.667] (-1994.391) (-1991.540) (-2004.729) * [-1984.482] (-1993.159) (-1992.183) (-1992.551) -- 0:01:49
663600 -- (-1998.391) (-1993.164) (-1998.856) [-2000.024] * (-1982.563) [-1998.695] (-2009.774) (-1989.169) -- 0:01:48
663700 -- (-1993.611) [-1990.163] (-1991.195) (-1994.096) * [-1984.827] (-1992.984) (-2005.014) (-1995.180) -- 0:01:48
663800 -- (-1999.122) [-1995.745] (-1995.672) (-1990.209) * [-1984.579] (-1991.908) (-2001.348) (-1991.107) -- 0:01:48
663900 -- (-1993.434) (-1992.972) [-1990.848] (-1993.349) * [-1976.929] (-2002.286) (-1994.106) (-1987.213) -- 0:01:48
664000 -- (-1998.145) [-1991.291] (-1986.893) (-1989.496) * [-1977.387] (-2001.326) (-1999.833) (-1993.845) -- 0:01:48
Average standard deviation of split frequencies: 0.002718
664100 -- (-2003.048) (-2000.431) [-1989.559] (-1990.643) * [-1984.754] (-1995.525) (-1998.674) (-1994.391) -- 0:01:49
664200 -- (-2003.654) (-1989.925) (-1983.565) [-1984.370] * [-1986.180] (-1993.800) (-1987.686) (-1995.017) -- 0:01:49
664300 -- (-2005.435) (-2000.940) (-1993.611) [-1996.105] * [-1984.447] (-2001.852) (-1985.988) (-1990.101) -- 0:01:49
664400 -- (-2003.585) [-1992.795] (-1991.331) (-1996.657) * [-1979.428] (-1994.215) (-1988.277) (-1982.392) -- 0:01:49
664500 -- (-2002.687) [-1987.224] (-1994.922) (-1992.703) * [-1984.619] (-1994.805) (-1988.341) (-1987.219) -- 0:01:49
664600 -- (-1990.940) (-1984.878) (-1994.735) [-1989.201] * (-1987.896) (-1988.347) [-1987.635] (-1990.067) -- 0:01:49
664700 -- (-1995.363) (-1993.200) (-1997.496) [-1996.287] * (-1979.367) [-1986.471] (-1983.010) (-1987.813) -- 0:01:48
664800 -- [-1991.538] (-1996.754) (-1999.010) (-1988.790) * (-1985.864) (-1986.496) (-1991.018) [-1984.856] -- 0:01:48
664900 -- (-1993.541) (-1997.807) (-1995.711) [-1985.211] * [-1987.156] (-1989.840) (-1993.230) (-1986.477) -- 0:01:48
665000 -- [-1991.836] (-2007.822) (-2007.890) (-1989.555) * [-1983.476] (-1992.352) (-1990.001) (-1983.494) -- 0:01:48
Average standard deviation of split frequencies: 0.002754
665100 -- [-1990.559] (-2004.841) (-2004.089) (-1989.942) * [-1982.193] (-1990.673) (-1990.490) (-1988.633) -- 0:01:48
665200 -- (-1990.562) (-1996.640) (-2018.103) [-1986.126] * [-1981.426] (-1992.622) (-1990.669) (-1990.931) -- 0:01:48
665300 -- (-1984.043) (-1989.173) (-2005.160) [-1982.944] * [-1983.321] (-1992.695) (-1993.285) (-1988.959) -- 0:01:48
665400 -- [-1988.062] (-1988.143) (-2005.192) (-1984.930) * [-1984.829] (-1987.823) (-1988.361) (-1982.865) -- 0:01:48
665500 -- [-1986.936] (-1991.966) (-2001.008) (-1988.243) * (-1984.442) [-1983.423] (-1991.724) (-1984.194) -- 0:01:48
665600 -- [-1986.819] (-1986.307) (-2003.645) (-1989.547) * (-1984.228) (-1985.800) (-1986.890) [-1983.845] -- 0:01:48
665700 -- (-1987.950) [-1991.046] (-2009.663) (-1987.351) * (-1985.114) [-1983.226] (-1989.958) (-1983.019) -- 0:01:48
665800 -- [-1990.452] (-1995.105) (-2008.919) (-1988.800) * (-1986.585) [-1981.784] (-1995.354) (-1987.975) -- 0:01:48
665900 -- (-1995.909) (-1999.523) [-2001.701] (-1984.037) * (-1988.371) [-1982.617] (-1989.192) (-1991.038) -- 0:01:48
666000 -- (-1999.108) (-1994.877) (-1999.674) [-1981.020] * [-1981.080] (-2006.162) (-1993.152) (-1987.971) -- 0:01:48
Average standard deviation of split frequencies: 0.002790
666100 -- (-1987.017) [-1987.547] (-2000.588) (-1983.547) * [-1980.991] (-1996.358) (-1993.630) (-1999.326) -- 0:01:48
666200 -- (-1992.618) (-1985.963) (-2007.308) [-1982.314] * [-1982.325] (-1994.999) (-1996.401) (-2007.425) -- 0:01:48
666300 -- (-1990.208) [-1987.694] (-1994.671) (-1982.495) * [-1980.182] (-1994.843) (-1996.040) (-2001.103) -- 0:01:48
666400 -- (-1992.300) (-1990.256) (-1997.930) [-1985.243] * [-1977.196] (-1996.330) (-1994.599) (-2003.466) -- 0:01:48
666500 -- (-1998.144) [-1989.458] (-1995.576) (-1980.541) * [-1978.370] (-1992.844) (-1993.877) (-2000.278) -- 0:01:48
666600 -- (-1993.506) (-1988.981) [-1996.220] (-1978.953) * [-1981.691] (-1996.896) (-1999.540) (-2000.383) -- 0:01:48
666700 -- (-1997.049) [-1989.545] (-1994.099) (-1985.688) * (-1982.008) (-1992.498) [-1990.567] (-2010.604) -- 0:01:47
666800 -- [-2001.291] (-1990.096) (-1993.854) (-1987.382) * [-1984.249] (-1997.609) (-1985.772) (-1999.851) -- 0:01:47
666900 -- (-2005.516) [-1988.327] (-1995.569) (-1987.374) * (-1982.048) (-1998.266) [-1984.162] (-1999.481) -- 0:01:47
667000 -- (-2002.700) (-1987.814) [-1990.872] (-1986.010) * [-1977.047] (-1995.968) (-1982.139) (-2003.943) -- 0:01:47
Average standard deviation of split frequencies: 0.002826
667100 -- (-1993.423) (-1993.883) (-1991.675) [-1982.816] * [-1977.745] (-1997.518) (-1980.747) (-2001.573) -- 0:01:48
667200 -- (-1993.334) (-1996.877) (-1991.791) [-1982.052] * [-1979.221] (-1992.141) (-1983.996) (-2000.744) -- 0:01:48
667300 -- (-1991.326) [-1988.637] (-1997.237) (-1989.292) * [-1984.971] (-1988.228) (-1989.515) (-1999.191) -- 0:01:48
667400 -- (-1990.274) (-1987.603) (-2001.119) [-1988.741] * [-1980.013] (-1990.088) (-1992.240) (-1994.165) -- 0:01:48
667500 -- (-1994.198) (-1990.920) [-1995.089] (-1986.814) * [-1981.618] (-1992.248) (-1984.902) (-1993.174) -- 0:01:48
667600 -- (-1998.931) (-1989.485) (-1995.219) [-1984.115] * [-1983.561] (-1996.650) (-1986.283) (-1992.262) -- 0:01:48
667700 -- (-2001.107) (-1991.561) (-2003.917) [-1984.516] * (-1982.523) (-1989.536) [-1985.294] (-1989.519) -- 0:01:47
667800 -- (-2000.908) [-1986.134] (-1996.175) (-1985.565) * (-1991.337) [-1988.648] (-1987.752) (-1987.290) -- 0:01:47
667900 -- (-2000.668) (-1988.511) (-1998.172) [-1987.890] * [-1985.491] (-1998.376) (-1987.568) (-1987.473) -- 0:01:47
668000 -- (-2006.262) [-1990.630] (-1999.645) (-1986.797) * (-1984.668) (-2002.451) [-1983.963] (-1989.041) -- 0:01:47
Average standard deviation of split frequencies: 0.002903
668100 -- (-2005.869) (-1990.611) (-2004.522) [-1984.304] * (-1995.272) (-2005.965) [-1985.498] (-1988.925) -- 0:01:47
668200 -- (-2001.007) [-1992.745] (-1989.887) (-1988.852) * (-1992.955) (-1993.181) [-1986.676] (-1983.801) -- 0:01:47
668300 -- (-1996.145) (-2019.463) (-1992.404) [-1984.751] * (-1996.765) (-2005.898) (-1985.908) [-1983.020] -- 0:01:47
668400 -- (-1989.539) (-2009.123) [-1989.659] (-1982.757) * (-1990.721) (-2002.667) (-1987.248) [-1981.273] -- 0:01:47
668500 -- (-1988.836) (-1998.031) (-1991.774) [-1979.950] * (-2000.221) (-2002.822) (-1990.920) [-1984.268] -- 0:01:47
668600 -- (-1998.098) (-2001.362) [-1985.211] (-1976.473) * (-1999.839) (-2002.429) (-1998.519) [-1984.467] -- 0:01:47
668700 -- (-1998.479) (-2002.359) [-1987.124] (-1978.767) * [-1988.986] (-1993.375) (-1998.403) (-1987.115) -- 0:01:47
668800 -- (-1993.322) (-2007.109) (-1994.371) [-1988.390] * [-1989.814] (-1983.757) (-1985.875) (-1993.942) -- 0:01:47
668900 -- (-1988.786) (-1997.283) [-1986.602] (-1984.834) * (-1990.435) (-1992.216) (-1987.941) [-1983.569] -- 0:01:47
669000 -- (-1991.453) (-1995.754) (-1985.644) [-1985.226] * (-1982.083) (-1987.010) (-2004.449) [-1983.487] -- 0:01:47
Average standard deviation of split frequencies: 0.002818
669100 -- (-1999.035) (-2005.344) (-1988.124) [-1987.261] * (-1990.711) [-1994.222] (-2001.176) (-1983.855) -- 0:01:47
669200 -- (-1998.834) (-2007.002) [-1993.691] (-1986.044) * [-1978.954] (-1985.721) (-1998.665) (-1988.512) -- 0:01:47
669300 -- (-2005.263) (-2007.645) [-1997.024] (-1987.069) * [-1980.656] (-1990.535) (-1994.366) (-1990.043) -- 0:01:47
669400 -- (-2007.668) (-1994.961) (-1990.295) [-1983.574] * (-1986.574) (-1988.486) (-1993.985) [-1993.996] -- 0:01:47
669500 -- (-2002.990) (-1992.457) [-1989.890] (-1980.434) * (-1988.112) (-1998.720) (-1987.794) [-1984.307] -- 0:01:47
669600 -- (-1993.736) (-1995.686) (-1991.605) [-1983.784] * (-1988.225) (-1992.199) (-1987.219) [-1980.866] -- 0:01:47
669700 -- (-1993.577) (-1999.201) (-1992.611) [-1983.661] * (-1997.737) (-1988.203) (-1986.176) [-1980.580] -- 0:01:47
669800 -- (-1988.274) (-1996.504) (-1991.241) [-1985.455] * (-1991.742) (-1993.838) (-1985.402) [-1977.667] -- 0:01:46
669900 -- [-1986.239] (-1994.981) (-1989.358) (-1990.866) * [-1985.683] (-1990.544) (-1992.357) (-1982.780) -- 0:01:46
670000 -- (-1991.637) (-1992.235) (-1994.778) [-1992.578] * [-1983.615] (-1992.223) (-1993.597) (-1982.393) -- 0:01:46
Average standard deviation of split frequencies: 0.002874
670100 -- (-1986.664) [-1985.501] (-2002.373) (-1988.725) * [-1982.671] (-2005.369) (-1990.774) (-1988.285) -- 0:01:46
670200 -- (-1998.279) (-1988.671) (-2005.627) [-1990.028] * [-1980.313] (-2013.348) (-1991.114) (-1984.745) -- 0:01:47
670300 -- (-1998.707) (-1989.117) (-2005.035) [-1989.443] * [-1981.745] (-2000.809) (-2003.075) (-1985.695) -- 0:01:47
670400 -- (-1997.127) [-1997.038] (-2004.232) (-1989.330) * [-1980.328] (-2006.829) (-1991.046) (-1988.495) -- 0:01:47
670500 -- (-1991.573) (-1998.350) (-1997.231) [-1986.467] * [-1980.464] (-2004.477) (-1995.278) (-1995.184) -- 0:01:47
670600 -- (-1993.158) (-1999.908) (-1997.096) [-1986.886] * [-1979.279] (-2002.354) (-1991.464) (-1986.875) -- 0:01:47
670700 -- (-1995.190) (-2005.997) (-1994.295) [-1984.993] * (-1978.880) (-2007.220) (-1988.412) [-1985.064] -- 0:01:47
670800 -- (-1998.478) (-2007.102) (-1990.067) [-1982.078] * [-1977.042] (-1994.291) (-1990.501) (-1983.490) -- 0:01:46
670900 -- (-1995.306) (-1996.635) (-1988.631) [-1980.571] * (-1980.819) (-2000.919) [-1988.946] (-1983.846) -- 0:01:46
671000 -- (-1987.434) (-1998.568) (-1994.712) [-1975.588] * [-1977.818] (-1994.436) (-1986.864) (-1984.208) -- 0:01:46
Average standard deviation of split frequencies: 0.002829
671100 -- (-1989.294) (-1995.931) (-2000.564) [-1975.997] * [-1985.416] (-1997.021) (-1989.316) (-1985.384) -- 0:01:46
671200 -- (-1991.161) (-1995.925) (-1993.927) [-1977.854] * [-1980.264] (-1994.251) (-1987.356) (-1993.382) -- 0:01:46
671300 -- (-1986.364) (-1998.113) (-2001.516) [-1975.452] * [-1982.212] (-1992.786) (-1991.653) (-1988.351) -- 0:01:46
671400 -- (-1989.854) (-2004.574) (-1995.934) [-1977.467] * (-1979.066) [-1993.811] (-1997.775) (-1991.254) -- 0:01:46
671500 -- (-1992.310) (-1994.643) (-1993.733) [-1982.190] * [-1982.149] (-1992.902) (-1998.646) (-1997.249) -- 0:01:46
671600 -- (-1991.512) (-1996.203) (-1996.824) [-1983.855] * [-1982.638] (-1991.823) (-1998.982) (-1989.320) -- 0:01:46
671700 -- [-1994.486] (-1997.667) (-1998.224) (-1983.202) * [-1979.302] (-1995.729) (-1989.733) (-1985.529) -- 0:01:46
671800 -- (-1994.976) [-1985.925] (-1994.480) (-1984.894) * (-1980.642) (-1999.821) [-1985.536] (-1988.039) -- 0:01:46
671900 -- (-1996.993) [-1988.638] (-2000.356) (-1987.909) * (-1985.842) (-2000.208) (-1994.445) [-1985.667] -- 0:01:46
672000 -- [-1995.084] (-1991.635) (-1988.732) (-1989.570) * (-1994.431) (-1990.868) (-1991.370) [-1988.895] -- 0:01:46
Average standard deviation of split frequencies: 0.002805
672100 -- (-1996.625) [-1991.238] (-2002.933) (-1995.958) * (-1988.965) [-1994.940] (-1992.820) (-1987.732) -- 0:01:46
672200 -- (-1994.032) [-1988.065] (-1997.429) (-1991.337) * [-1985.129] (-1992.208) (-1991.959) (-1995.233) -- 0:01:46
672300 -- (-1998.241) [-1986.094] (-1994.167) (-1994.575) * (-1984.992) [-1986.587] (-1991.114) (-1984.987) -- 0:01:46
672400 -- (-2002.225) [-1985.832] (-2000.207) (-1994.591) * (-1989.768) (-1993.584) (-1990.665) [-1988.556] -- 0:01:46
672500 -- (-1996.607) [-1989.499] (-1999.019) (-1993.454) * [-1987.710] (-1996.222) (-1994.791) (-1984.828) -- 0:01:46
672600 -- (-1992.029) (-1995.645) (-1993.929) [-1985.893] * (-1986.405) (-1992.724) [-1992.034] (-1984.479) -- 0:01:46
672700 -- (-1997.343) (-2000.396) (-1993.240) [-1987.405] * (-2003.057) (-1994.363) (-1992.598) [-1980.951] -- 0:01:46
672800 -- (-1996.419) (-1996.962) [-1992.318] (-1976.724) * (-2005.667) (-1994.273) (-1991.279) [-1979.868] -- 0:01:46
672900 -- (-1991.959) (-1992.529) (-1993.758) [-1980.336] * (-2000.876) (-1991.269) (-1998.131) [-1987.054] -- 0:01:45
673000 -- (-1992.052) (-1992.629) (-1990.152) [-1979.515] * (-1986.892) (-1996.624) (-1993.765) [-1991.487] -- 0:01:45
Average standard deviation of split frequencies: 0.002741
673100 -- (-1995.150) (-1992.590) (-1996.350) [-1978.197] * [-1985.609] (-1997.072) (-1996.479) (-1995.411) -- 0:01:45
673200 -- (-1990.557) (-2001.599) (-1988.769) [-1978.043] * (-1984.677) (-1994.332) [-1991.718] (-1993.204) -- 0:01:46
673300 -- (-1993.312) (-1999.929) (-1989.276) [-1979.289] * [-1988.907] (-1992.434) (-1990.268) (-1991.224) -- 0:01:46
673400 -- (-1991.757) (-2002.979) (-1983.342) [-1982.032] * [-1988.308] (-1991.756) (-1989.208) (-2000.406) -- 0:01:46
673500 -- (-1994.247) (-2002.281) (-1980.480) [-1984.688] * (-1992.024) [-1992.156] (-1995.925) (-1993.454) -- 0:01:46
673600 -- (-1998.145) (-2002.546) [-1983.284] (-1986.557) * [-1983.813] (-1995.405) (-1990.776) (-2002.308) -- 0:01:46
673700 -- (-1996.776) (-1999.801) (-1990.081) [-1989.254] * [-1983.059] (-1998.053) (-1992.656) (-1996.686) -- 0:01:46
673800 -- (-1994.958) (-2002.068) [-1989.069] (-1995.338) * (-1988.419) (-1996.769) [-1989.740] (-1989.111) -- 0:01:46
673900 -- (-1995.729) (-2003.425) [-1986.486] (-1996.415) * [-1987.212] (-2002.736) (-1998.131) (-1988.327) -- 0:01:45
674000 -- (-1997.662) (-2015.456) (-1985.757) [-1992.481] * [-1986.163] (-1988.614) (-1994.593) (-1994.061) -- 0:01:45
Average standard deviation of split frequencies: 0.002817
674100 -- (-2000.991) (-1989.779) [-1987.488] (-1988.664) * (-1985.145) [-1988.110] (-1997.764) (-1992.274) -- 0:01:45
674200 -- (-2004.977) (-1989.634) (-1992.789) [-1984.357] * (-1986.545) [-1987.040] (-1995.832) (-2000.967) -- 0:01:45
674300 -- (-2008.764) (-1998.471) (-1990.065) [-1977.551] * (-1991.539) (-1985.547) (-1992.277) [-1996.350] -- 0:01:45
674400 -- (-2009.953) (-1999.406) (-1993.178) [-1980.075] * (-1988.826) (-1993.971) (-1990.034) [-1987.152] -- 0:01:45
674500 -- (-1999.068) (-1994.138) [-1989.808] (-1981.794) * [-1987.940] (-1989.018) (-1990.550) (-1986.035) -- 0:01:45
674600 -- (-1992.723) (-1990.023) (-1992.396) [-1985.081] * (-1985.011) (-1992.924) [-1987.974] (-1998.014) -- 0:01:45
674700 -- (-1990.602) (-1989.234) (-1990.366) [-1983.539] * (-1983.056) [-1989.710] (-1994.748) (-2001.191) -- 0:01:45
674800 -- (-1990.521) (-1988.411) (-1996.171) [-1979.829] * [-1982.174] (-1989.281) (-2000.286) (-1992.831) -- 0:01:45
674900 -- (-1992.361) (-1990.496) (-1992.203) [-1987.068] * [-1981.632] (-1991.300) (-1991.554) (-1986.134) -- 0:01:45
675000 -- (-1986.999) (-1995.114) [-1985.900] (-1985.447) * [-1977.442] (-1998.872) (-1989.827) (-1990.464) -- 0:01:45
Average standard deviation of split frequencies: 0.002693
675100 -- (-1995.103) (-1990.787) [-1986.193] (-1988.917) * [-1980.271] (-2005.291) (-1987.041) (-1986.708) -- 0:01:45
675200 -- (-1987.872) [-1994.998] (-1989.604) (-1992.413) * [-1980.279] (-1998.432) (-1991.139) (-1992.183) -- 0:01:45
675300 -- (-1997.233) (-1995.372) (-1988.488) [-1981.574] * (-1983.451) (-1994.714) (-1996.468) [-1992.618] -- 0:01:45
675400 -- (-1999.366) (-1999.910) [-1989.955] (-1988.460) * (-1981.688) (-1996.363) [-1990.992] (-1994.761) -- 0:01:45
675500 -- (-2008.310) (-2002.949) (-1991.471) [-1983.275] * [-1987.865] (-1991.851) (-1993.713) (-1994.083) -- 0:01:45
675600 -- (-1997.442) (-2001.506) (-1987.671) [-1985.801] * (-1989.179) (-1989.654) (-1992.916) [-1990.960] -- 0:01:45
675700 -- [-1989.995] (-1994.038) (-1995.487) (-1984.365) * (-1987.784) (-1995.243) [-1986.601] (-1992.461) -- 0:01:45
675800 -- [-1986.672] (-1989.060) (-1993.782) (-1986.204) * [-1986.806] (-1992.856) (-1984.798) (-1992.523) -- 0:01:45
675900 -- (-1995.651) (-1997.767) (-1989.292) [-1985.596] * (-1988.197) (-1994.987) [-1983.000] (-1984.909) -- 0:01:45
676000 -- [-1985.056] (-1997.285) (-1996.864) (-1986.195) * (-1986.369) (-1999.868) [-1985.690] (-1994.759) -- 0:01:44
Average standard deviation of split frequencies: 0.002649
676100 -- [-1984.141] (-1989.534) (-1998.251) (-1990.644) * [-1988.543] (-1996.390) (-1986.172) (-2013.613) -- 0:01:44
676200 -- [-1989.858] (-1984.442) (-1996.094) (-1995.764) * [-1983.855] (-2000.763) (-1983.866) (-2011.565) -- 0:01:45
676300 -- [-1995.504] (-1995.230) (-2000.051) (-2010.494) * [-1981.849] (-1999.689) (-1987.609) (-2005.713) -- 0:01:45
676400 -- (-1993.407) [-1989.801] (-1996.266) (-2011.496) * [-1983.762] (-1997.410) (-1988.354) (-2004.098) -- 0:01:45
676500 -- (-1994.123) (-1998.787) (-1998.544) [-1993.788] * [-1980.867] (-1995.984) (-1986.507) (-2002.169) -- 0:01:45
676600 -- (-1987.928) (-1990.648) (-1992.124) [-1988.978] * [-1982.144] (-1988.456) (-1993.159) (-1997.919) -- 0:01:45
676700 -- (-1988.088) (-1991.566) (-1996.575) [-1985.584] * (-1986.722) [-1988.704] (-1997.492) (-1998.289) -- 0:01:45
676800 -- (-1989.699) [-1988.898] (-1996.432) (-1993.975) * [-1983.603] (-1997.193) (-1995.803) (-1993.174) -- 0:01:45
676900 -- [-1985.957] (-1994.057) (-1994.535) (-1990.878) * [-1981.151] (-2000.579) (-1994.539) (-1991.371) -- 0:01:45
677000 -- [-1986.346] (-1995.414) (-1992.633) (-1988.744) * [-1985.884] (-2004.771) (-2003.784) (-1991.737) -- 0:01:44
Average standard deviation of split frequencies: 0.002705
677100 -- [-1984.600] (-1999.726) (-1998.726) (-1988.640) * [-1985.588] (-1997.832) (-1996.126) (-1997.104) -- 0:01:44
677200 -- [-1986.816] (-1988.277) (-1993.832) (-1989.948) * (-1990.110) [-1990.272] (-1997.312) (-1992.962) -- 0:01:44
677300 -- (-2002.821) (-1990.326) (-1991.254) [-1989.786] * (-1985.366) (-1989.595) (-2010.772) [-1993.663] -- 0:01:44
677400 -- (-1997.637) (-1988.686) (-1986.740) [-1989.651] * [-1984.451] (-1985.044) (-2001.693) (-1999.329) -- 0:01:44
677500 -- (-2004.306) (-1988.696) (-1989.880) [-1985.216] * (-1990.103) [-1987.063] (-1994.944) (-1994.483) -- 0:01:44
677600 -- (-2004.670) (-1988.116) [-1989.605] (-1985.801) * [-1990.796] (-1986.968) (-1994.159) (-2003.878) -- 0:01:44
677700 -- (-2011.097) (-1989.383) [-1988.038] (-1986.566) * (-1987.049) [-1991.020] (-1994.803) (-2002.966) -- 0:01:44
677800 -- (-2004.623) (-1993.456) (-1986.106) [-1988.366] * (-1984.102) (-1989.890) [-1989.008] (-2000.570) -- 0:01:44
677900 -- (-1994.533) [-1987.486] (-1989.278) (-1993.548) * (-1985.578) [-1993.228] (-1996.721) (-1999.774) -- 0:01:44
678000 -- (-1991.966) [-1986.162] (-1989.855) (-1991.480) * (-1992.797) (-1999.019) (-1992.239) [-1991.106] -- 0:01:44
Average standard deviation of split frequencies: 0.002602
678100 -- [-1990.212] (-1989.000) (-1999.481) (-1997.188) * [-1986.421] (-2000.224) (-1998.848) (-1993.058) -- 0:01:44
678200 -- (-1993.142) (-1989.811) [-1992.665] (-2001.487) * (-1980.592) (-1997.669) [-1992.661] (-1993.882) -- 0:01:44
678300 -- [-1986.335] (-1988.149) (-1988.835) (-1992.108) * [-1984.616] (-2001.258) (-1992.661) (-2000.049) -- 0:01:44
678400 -- (-1992.386) [-1994.208] (-1993.898) (-1995.132) * (-1992.304) [-1994.628] (-1991.968) (-1991.645) -- 0:01:44
678500 -- (-1988.644) (-1997.910) [-1988.872] (-1989.501) * [-1984.044] (-1996.948) (-1993.791) (-1997.037) -- 0:01:44
678600 -- (-1986.996) (-1995.799) (-1983.547) [-1986.100] * [-1984.914] (-1992.620) (-1987.266) (-1999.845) -- 0:01:44
678700 -- [-1985.357] (-2005.519) (-1991.173) (-1982.309) * (-1993.073) (-1988.813) [-1985.848] (-1992.844) -- 0:01:44
678800 -- (-1986.145) [-1998.608] (-1992.784) (-1986.844) * (-1994.916) (-1989.510) [-1988.642] (-1988.573) -- 0:01:44
678900 -- (-1993.948) (-2003.179) (-1988.155) [-1989.177] * (-2004.733) [-1990.845] (-1989.683) (-1994.999) -- 0:01:44
679000 -- (-1991.078) (-2000.140) [-1991.586] (-1995.170) * (-1993.745) [-1987.368] (-1987.655) (-2004.065) -- 0:01:44
Average standard deviation of split frequencies: 0.002737
679100 -- (-1989.533) (-2004.526) [-1990.558] (-1995.332) * (-1990.612) (-1989.830) (-1995.617) [-1991.429] -- 0:01:43
679200 -- [-1987.720] (-1997.549) (-1986.224) (-1990.961) * [-1984.831] (-1997.573) (-1991.355) (-1993.606) -- 0:01:44
679300 -- [-1986.327] (-1997.128) (-1994.914) (-1993.900) * [-1982.473] (-1998.135) (-2001.605) (-1984.595) -- 0:01:44
679400 -- (-1983.885) (-1994.625) [-1991.979] (-1998.879) * [-1985.723] (-1991.096) (-2002.104) (-1985.849) -- 0:01:44
679500 -- [-1985.475] (-1993.547) (-2006.543) (-1986.784) * (-1989.796) [-1988.647] (-1999.880) (-1991.687) -- 0:01:44
679600 -- [-1990.571] (-2007.016) (-1992.974) (-1984.487) * (-1997.096) (-1987.702) (-2000.798) [-1987.668] -- 0:01:44
679700 -- (-1989.997) (-2005.093) (-1987.544) [-1986.304] * (-1994.220) (-1993.312) (-1994.304) [-1986.726] -- 0:01:44
679800 -- (-1994.951) (-1999.942) (-1986.271) [-1984.709] * [-1987.721] (-1991.395) (-2000.307) (-1986.132) -- 0:01:44
679900 -- (-1996.803) (-2002.991) [-1982.901] (-1985.130) * [-1983.471] (-1986.571) (-1999.696) (-1986.778) -- 0:01:44
680000 -- (-2003.367) (-2006.182) (-1988.173) [-1993.497] * (-1985.598) (-1994.716) (-2000.218) [-1983.372] -- 0:01:44
Average standard deviation of split frequencies: 0.002970
680100 -- (-2004.988) (-1995.494) [-1983.255] (-1989.305) * (-1989.114) (-1999.567) (-2000.382) [-1987.739] -- 0:01:43
680200 -- (-2003.651) (-2004.146) (-1986.361) [-1991.766] * (-1990.867) [-1994.358] (-1993.817) (-1985.362) -- 0:01:43
680300 -- (-1992.467) (-2007.869) (-1995.261) [-1988.635] * [-1984.573] (-1990.824) (-1996.391) (-1985.111) -- 0:01:43
680400 -- (-1995.614) (-1991.609) [-1995.103] (-1996.040) * [-1985.606] (-2002.450) (-1994.416) (-1993.159) -- 0:01:43
680500 -- (-1998.286) (-1995.722) (-1998.439) [-1982.973] * [-1985.522] (-2002.583) (-1993.057) (-1997.065) -- 0:01:43
680600 -- (-2005.476) (-1992.744) (-1998.516) [-1982.344] * [-1986.600] (-1999.118) (-1997.992) (-1992.240) -- 0:01:43
680700 -- (-1988.060) (-2002.112) (-1997.761) [-1987.838] * [-1982.988] (-2001.931) (-1992.460) (-1987.883) -- 0:01:43
680800 -- (-1987.261) (-2003.683) (-1995.648) [-1983.340] * [-1982.768] (-1999.924) (-1989.270) (-1991.790) -- 0:01:43
680900 -- [-1986.658] (-1996.216) (-1990.113) (-1983.440) * [-1982.204] (-1999.709) (-1994.328) (-1993.417) -- 0:01:43
681000 -- (-1995.132) [-1992.155] (-1990.228) (-1993.588) * (-1986.681) (-2005.708) (-1994.044) [-1991.199] -- 0:01:43
Average standard deviation of split frequencies: 0.002926
681100 -- (-2000.171) (-1995.716) (-1994.873) [-1988.897] * [-1983.533] (-2009.575) (-1988.850) (-1990.872) -- 0:01:43
681200 -- (-2001.145) [-1989.082] (-1996.451) (-1983.691) * [-1983.501] (-2005.749) (-1999.774) (-1992.825) -- 0:01:43
681300 -- (-1997.080) (-1988.607) [-1998.152] (-1985.536) * [-1978.032] (-2005.280) (-1997.640) (-1991.255) -- 0:01:43
681400 -- (-1999.629) (-1993.176) (-1996.835) [-1982.143] * [-1981.747] (-2006.440) (-1993.844) (-1991.852) -- 0:01:43
681500 -- (-1992.866) (-1993.726) (-1990.372) [-1984.936] * [-1989.633] (-2000.815) (-1992.999) (-1992.650) -- 0:01:43
681600 -- (-1990.546) (-1999.997) (-1989.562) [-1985.569] * [-1989.709] (-1999.157) (-1997.242) (-1997.104) -- 0:01:43
681700 -- (-1988.135) (-1995.953) [-1990.649] (-1990.688) * (-1986.146) (-2001.224) (-2002.543) [-1989.451] -- 0:01:43
681800 -- [-1988.461] (-1997.091) (-1991.130) (-1985.629) * (-1984.655) (-2003.815) (-2006.371) [-1993.127] -- 0:01:43
681900 -- [-1988.013] (-1988.778) (-1991.596) (-1991.557) * (-1989.012) (-1998.044) [-1994.427] (-2001.924) -- 0:01:43
682000 -- (-1986.722) (-1991.610) [-1985.269] (-1988.653) * (-1988.119) (-1997.367) (-2000.294) [-2001.301] -- 0:01:43
Average standard deviation of split frequencies: 0.002903
682100 -- [-1980.686] (-1991.679) (-1996.413) (-1988.785) * (-1987.634) (-1998.825) [-1991.498] (-1993.813) -- 0:01:42
682200 -- (-1985.459) (-1992.388) (-1993.483) [-1988.626] * (-1987.663) [-1991.797] (-1991.665) (-2003.526) -- 0:01:42
682300 -- [-1985.546] (-1999.492) (-1986.307) (-1989.914) * (-1987.289) [-1996.004] (-1998.230) (-2005.142) -- 0:01:43
682400 -- (-1989.441) (-2002.349) [-1992.053] (-1991.161) * [-1986.132] (-1995.311) (-1993.583) (-1999.545) -- 0:01:43
682500 -- [-1988.516] (-2000.574) (-1991.934) (-1986.671) * [-1990.058] (-1996.169) (-1998.589) (-1996.093) -- 0:01:43
682600 -- (-1987.459) (-2005.146) (-1997.027) [-1986.764] * [-1986.563] (-1994.697) (-1998.229) (-2003.402) -- 0:01:43
682700 -- (-1988.310) (-1999.269) (-1998.630) [-1992.247] * [-1988.675] (-2000.041) (-1997.857) (-2002.110) -- 0:01:43
682800 -- (-1992.514) (-1998.657) (-1992.000) [-1988.514] * [-1985.600] (-2006.309) (-1995.631) (-2011.873) -- 0:01:43
682900 -- (-1992.392) (-1998.027) [-1992.455] (-1988.852) * (-1989.146) (-2006.273) [-1993.102] (-2013.330) -- 0:01:43
683000 -- [-1987.932] (-2003.151) (-2001.474) (-1990.529) * [-1983.263] (-2003.726) (-1993.429) (-2003.821) -- 0:01:43
Average standard deviation of split frequencies: 0.002859
683100 -- (-1992.852) (-1999.039) (-2008.097) [-1990.541] * (-1987.368) (-2002.387) (-1993.228) [-1998.234] -- 0:01:42
683200 -- (-1992.032) (-1996.541) (-1998.942) [-1991.824] * (-1988.245) [-1993.897] (-1997.199) (-2007.189) -- 0:01:42
683300 -- (-1992.621) (-1995.226) (-1992.399) [-1991.796] * (-1987.219) [-1995.869] (-1993.688) (-1990.621) -- 0:01:42
683400 -- (-1994.709) (-1993.420) (-1989.151) [-1982.093] * (-1997.534) (-1993.262) (-1996.424) [-1986.027] -- 0:01:42
683500 -- [-1986.903] (-1995.456) (-1991.132) (-1983.528) * (-2003.796) [-1991.244] (-1990.398) (-1993.673) -- 0:01:42
683600 -- (-1989.555) (-1989.261) (-1999.300) [-1989.319] * (-2001.037) (-1990.209) [-1987.914] (-1997.939) -- 0:01:42
683700 -- [-1993.103] (-1988.109) (-1996.609) (-1984.545) * [-1997.154] (-1989.706) (-1993.414) (-1996.901) -- 0:01:42
683800 -- (-1987.378) (-1988.467) (-1991.309) [-1982.806] * (-1993.412) [-1987.795] (-1999.288) (-1993.658) -- 0:01:42
683900 -- (-1990.838) (-1989.160) [-1993.257] (-1981.327) * [-1988.033] (-1995.622) (-2007.385) (-1985.382) -- 0:01:42
684000 -- (-1991.259) [-1990.489] (-1997.261) (-1983.512) * [-1981.061] (-1998.894) (-1994.939) (-1989.229) -- 0:01:42
Average standard deviation of split frequencies: 0.002874
684100 -- (-1988.444) [-1989.592] (-2008.837) (-1989.623) * [-1982.802] (-2000.601) (-1991.907) (-1989.197) -- 0:01:42
684200 -- (-1985.937) (-1989.073) (-1992.740) [-1985.064] * [-1981.597] (-2000.528) (-1992.582) (-1994.160) -- 0:01:42
684300 -- (-1986.748) [-1984.116] (-1997.544) (-1991.656) * [-1981.456] (-1996.374) (-1995.584) (-1997.807) -- 0:01:42
684400 -- (-1989.490) (-1984.366) [-1996.294] (-2003.205) * (-1983.497) (-1999.217) (-1992.534) [-1995.924] -- 0:01:42
684500 -- [-1991.497] (-1989.068) (-1995.922) (-1999.618) * (-1981.018) (-2001.014) (-1992.928) [-1994.080] -- 0:01:42
684600 -- (-1997.053) [-1988.329] (-2005.095) (-1992.795) * [-1983.626] (-1992.831) (-1996.967) (-1995.213) -- 0:01:42
684700 -- (-1992.773) [-1987.683] (-2002.589) (-1992.122) * [-1985.549] (-2000.509) (-1993.896) (-1995.382) -- 0:01:42
684800 -- (-2001.310) [-1987.645] (-1995.955) (-1992.096) * (-1982.701) (-2000.381) (-1998.238) [-1988.924] -- 0:01:42
684900 -- (-2000.259) (-1985.937) (-2000.724) [-1991.608] * [-1988.706] (-1998.113) (-1991.614) (-1986.419) -- 0:01:42
685000 -- (-1997.686) [-1988.350] (-1997.130) (-1991.303) * (-1986.338) (-1997.812) [-1988.629] (-1998.884) -- 0:01:42
Average standard deviation of split frequencies: 0.002870
685100 -- (-1995.046) (-1986.388) [-1995.146] (-1996.018) * (-1986.795) (-1997.938) (-1990.715) [-1993.748] -- 0:01:42
685200 -- (-1993.973) (-1990.078) (-2003.651) [-1988.448] * [-1989.452] (-1998.223) (-1987.305) (-1987.723) -- 0:01:41
685300 -- (-1993.764) (-1987.722) (-1997.130) [-1984.687] * (-1987.049) (-2002.311) [-1988.922] (-1995.334) -- 0:01:42
685400 -- (-1996.856) [-1986.590] (-1998.108) (-1986.788) * [-1987.110] (-1999.386) (-1992.260) (-1993.309) -- 0:01:42
685500 -- (-1988.568) [-1984.166] (-1997.249) (-1988.455) * [-1984.042] (-1995.825) (-1987.758) (-1994.239) -- 0:01:42
685600 -- [-1988.093] (-1988.329) (-1999.400) (-1990.071) * [-1987.497] (-1991.375) (-1991.643) (-1987.809) -- 0:01:42
685700 -- (-1984.166) (-1991.422) (-2006.085) [-1985.734] * [-1986.638] (-1992.437) (-1990.557) (-1989.988) -- 0:01:42
685800 -- (-1989.904) [-1987.456] (-2004.330) (-1990.770) * (-1992.961) [-1990.729] (-1991.743) (-2000.407) -- 0:01:42
685900 -- [-1982.100] (-1989.871) (-2006.980) (-1995.040) * (-2004.109) [-1985.845] (-1988.558) (-1988.211) -- 0:01:42
686000 -- [-1986.257] (-1989.405) (-1998.102) (-1995.063) * (-2007.406) (-1989.054) [-1985.723] (-1994.756) -- 0:01:42
Average standard deviation of split frequencies: 0.002748
686100 -- [-1988.904] (-1990.581) (-1991.552) (-1990.619) * [-2000.904] (-1996.032) (-1989.358) (-1997.497) -- 0:01:42
686200 -- [-1988.210] (-1990.965) (-1993.733) (-1994.287) * (-1998.354) (-1997.090) (-1987.286) [-1986.904] -- 0:01:41
686300 -- (-1987.062) [-1985.440] (-1999.138) (-1988.616) * (-1991.868) (-1997.882) (-1998.252) [-1984.330] -- 0:01:41
686400 -- [-1986.030] (-1992.692) (-1995.019) (-1987.959) * (-1991.147) (-1993.160) [-1993.429] (-1988.173) -- 0:01:41
686500 -- (-1991.701) (-1992.390) (-1993.769) [-1985.468] * [-1987.775] (-1990.509) (-2002.080) (-1988.910) -- 0:01:41
686600 -- [-1987.856] (-1992.019) (-1996.682) (-1992.836) * (-1989.169) (-1990.771) (-2002.223) [-1990.006] -- 0:01:41
686700 -- [-1987.192] (-2003.497) (-1988.119) (-1993.695) * (-1991.828) [-1985.838] (-1999.209) (-1994.867) -- 0:01:41
686800 -- (-1984.928) (-1992.733) [-1987.670] (-1999.096) * (-2000.879) [-1986.635] (-1995.575) (-1992.876) -- 0:01:41
686900 -- (-1982.274) (-1998.931) (-1989.538) [-1988.794] * (-1998.181) (-1990.238) (-1992.742) [-1988.784] -- 0:01:41
687000 -- [-1984.884] (-1998.869) (-1988.711) (-2001.003) * (-1990.511) (-1993.262) [-1989.396] (-1995.035) -- 0:01:41
Average standard deviation of split frequencies: 0.002724
687100 -- [-1986.553] (-2002.179) (-1991.579) (-2005.764) * (-1996.457) (-1995.489) [-1986.515] (-1997.204) -- 0:01:41
687200 -- [-1987.360] (-1991.603) (-1990.788) (-2020.327) * (-1992.796) (-1989.902) [-1986.923] (-1999.895) -- 0:01:41
687300 -- [-1984.933] (-1988.409) (-1995.499) (-1999.101) * [-1990.348] (-1996.806) (-1989.425) (-1999.930) -- 0:01:41
687400 -- [-1989.398] (-1987.616) (-2008.642) (-1996.150) * (-1987.622) (-2001.768) [-1990.216] (-1988.595) -- 0:01:41
687500 -- (-1992.158) [-1985.242] (-2008.852) (-1987.420) * (-1985.923) (-2004.925) [-1987.731] (-1989.813) -- 0:01:41
687600 -- (-1988.152) (-1984.337) (-1999.939) [-1988.382] * (-1992.026) (-2012.137) (-1989.147) [-1995.306] -- 0:01:41
687700 -- (-1992.618) (-1989.715) (-1994.560) [-1985.071] * (-1993.846) (-1995.616) [-1990.601] (-1997.823) -- 0:01:41
687800 -- (-1997.517) (-1992.941) (-2006.414) [-1984.904] * (-2003.451) (-1998.971) [-1985.605] (-1989.435) -- 0:01:41
687900 -- (-1990.429) (-1986.574) (-2005.144) [-1983.980] * (-1997.035) (-1989.064) [-1982.222] (-1991.833) -- 0:01:41
688000 -- (-2000.255) (-1987.670) (-2004.834) [-1987.488] * (-2002.792) [-1988.698] (-1986.893) (-1997.726) -- 0:01:41
Average standard deviation of split frequencies: 0.002721
688100 -- (-1998.468) [-1987.700] (-2002.907) (-1991.169) * (-1997.034) [-1983.837] (-1988.626) (-1988.796) -- 0:01:41
688200 -- (-1993.241) [-1983.389] (-1997.469) (-1985.797) * (-1988.995) [-1989.451] (-1990.819) (-1988.959) -- 0:01:41
688300 -- (-1987.828) [-1986.968] (-1993.553) (-1995.702) * (-1992.626) (-1986.256) (-1990.936) [-1989.340] -- 0:01:41
688400 -- (-2001.379) [-1985.685] (-1990.099) (-1991.654) * (-1993.779) (-1989.766) (-1989.250) [-1988.289] -- 0:01:41
688500 -- (-2000.026) (-1993.108) (-1989.024) [-1994.706] * (-1996.775) [-1987.510] (-1994.878) (-1996.659) -- 0:01:41
688600 -- (-1999.960) (-1980.041) [-1989.996] (-2002.473) * (-1993.879) (-1986.991) [-1993.863] (-1999.260) -- 0:01:41
688700 -- (-1995.628) (-1980.818) [-1987.851] (-1995.352) * (-1993.005) [-1989.676] (-1986.705) (-1995.697) -- 0:01:41
688800 -- (-2013.030) [-1981.509] (-1989.116) (-1994.954) * (-1990.520) (-1985.419) [-1983.806] (-1992.241) -- 0:01:41
688900 -- (-2002.067) (-1983.741) (-1991.669) [-1993.776] * (-1996.103) (-1983.363) [-1985.084] (-1996.217) -- 0:01:41
689000 -- (-1992.790) [-1984.224] (-1997.081) (-1994.198) * (-2000.111) [-1982.270] (-1986.549) (-1996.067) -- 0:01:41
Average standard deviation of split frequencies: 0.002716
689100 -- (-1996.272) [-1985.811] (-1988.660) (-1998.094) * (-2006.353) [-1984.473] (-1985.158) (-1991.191) -- 0:01:41
689200 -- (-1992.655) [-1978.528] (-1990.813) (-1988.199) * (-2015.314) (-1983.511) (-1986.264) [-1988.443] -- 0:01:41
689300 -- (-2000.238) [-1977.107] (-1986.798) (-1985.640) * (-2001.319) (-1989.922) [-1995.139] (-1995.720) -- 0:01:40
689400 -- (-1997.289) (-1982.589) (-1988.337) [-1987.397] * (-2000.948) (-1992.541) [-1982.695] (-2001.574) -- 0:01:40
689500 -- (-1993.372) [-1983.779] (-1987.133) (-1985.669) * (-1999.796) (-2000.587) [-1983.639] (-2004.326) -- 0:01:40
689600 -- (-1991.065) (-1984.307) (-1988.938) [-1985.140] * (-1997.620) [-1988.702] (-1984.675) (-2015.743) -- 0:01:40
689700 -- (-1988.749) [-1985.104] (-1985.081) (-1996.350) * (-2006.658) [-1983.592] (-1991.112) (-2008.013) -- 0:01:40
689800 -- (-1988.082) [-1984.212] (-1987.795) (-1989.922) * (-2000.021) (-1983.252) [-1992.572] (-2002.814) -- 0:01:40
689900 -- (-1997.988) (-1986.719) [-1987.819] (-1984.940) * [-1988.076] (-1987.547) (-1986.739) (-1996.359) -- 0:01:40
690000 -- (-1996.625) (-1984.058) (-1991.442) [-1984.272] * [-1989.808] (-1998.495) (-1986.878) (-1994.399) -- 0:01:40
Average standard deviation of split frequencies: 0.002849
690100 -- (-1995.900) (-1985.110) (-1994.894) [-1989.152] * (-1997.497) (-1993.875) [-1987.842] (-2003.511) -- 0:01:40
690200 -- (-1989.568) [-1985.963] (-1999.659) (-1983.777) * (-2001.113) (-1989.868) [-1989.601] (-2002.715) -- 0:01:40
690300 -- (-1993.372) (-1992.945) (-1996.928) [-1983.487] * [-1991.626] (-1988.406) (-1979.648) (-1996.193) -- 0:01:40
690400 -- (-1989.081) (-1995.566) (-1996.372) [-1984.665] * (-1992.272) (-1987.387) [-1979.254] (-1989.824) -- 0:01:40
690500 -- (-1990.137) (-1985.531) [-1983.708] (-1985.222) * (-1995.421) (-1985.569) [-1986.504] (-1986.849) -- 0:01:40
690600 -- (-1988.592) [-1991.169] (-1989.320) (-1983.595) * (-1992.056) [-1985.632] (-1985.917) (-1985.924) -- 0:01:40
690700 -- [-1989.413] (-1992.555) (-1992.393) (-1989.217) * (-2003.612) (-1992.147) [-1984.537] (-1986.612) -- 0:01:40
690800 -- (-1994.428) (-1995.076) (-1987.522) [-1978.607] * (-1993.906) (-1991.189) [-1984.434] (-1993.104) -- 0:01:40
690900 -- (-1993.129) (-1985.362) (-1983.941) [-1976.872] * [-1993.088] (-1991.069) (-1987.071) (-1994.755) -- 0:01:40
691000 -- (-1987.438) [-1988.569] (-1984.626) (-1983.058) * (-1999.604) [-1989.300] (-1987.828) (-2000.161) -- 0:01:40
Average standard deviation of split frequencies: 0.002825
691100 -- (-1988.203) (-1982.896) [-1989.023] (-1986.456) * (-1993.671) [-1989.388] (-1990.974) (-2004.879) -- 0:01:40
691200 -- (-1990.120) [-1981.456] (-1998.899) (-1986.992) * (-1992.357) (-1995.145) [-1986.793] (-2001.481) -- 0:01:40
691300 -- (-1999.627) [-1986.308] (-1989.789) (-1992.929) * (-1994.172) (-1990.286) [-1987.974] (-2000.149) -- 0:01:40
691400 -- (-1993.710) [-1986.162] (-1994.178) (-1994.327) * (-1992.396) [-1987.522] (-1981.345) (-1992.544) -- 0:01:40
691500 -- [-1987.744] (-1998.006) (-1993.978) (-1994.724) * (-1999.410) (-1991.155) [-1981.659] (-1998.988) -- 0:01:40
691600 -- [-1992.502] (-1997.624) (-1996.370) (-1983.454) * (-1997.258) (-1990.929) (-1983.128) [-1992.224] -- 0:01:40
691700 -- (-1993.732) (-1992.911) (-1993.227) [-1984.846] * (-1995.904) [-1992.404] (-1980.836) (-2002.390) -- 0:01:40
691800 -- [-1993.307] (-1998.075) (-1987.409) (-1997.606) * (-1993.600) [-1991.030] (-1989.456) (-1993.707) -- 0:01:40
691900 -- (-1994.929) (-1994.732) [-1994.591] (-2001.767) * [-1990.856] (-1994.742) (-1984.900) (-2000.361) -- 0:01:40
692000 -- (-1996.514) [-1989.479] (-1994.398) (-1996.857) * (-1991.452) (-1993.383) [-1985.187] (-2004.984) -- 0:01:40
Average standard deviation of split frequencies: 0.002841
692100 -- (-2001.285) [-1988.567] (-1994.656) (-1995.071) * (-1988.815) [-1984.025] (-1987.987) (-1993.549) -- 0:01:40
692200 -- (-1996.454) [-1987.628] (-2000.471) (-1988.774) * (-1992.660) (-1985.876) (-1985.806) [-1991.158] -- 0:01:40
692300 -- (-2000.569) (-1983.820) (-1998.181) [-1981.164] * (-1992.604) [-1984.222] (-1988.534) (-1994.931) -- 0:01:40
692400 -- (-2002.833) (-1982.847) (-1986.843) [-1988.242] * (-1996.329) (-1982.671) [-1988.194] (-1997.994) -- 0:01:39
692500 -- (-2006.302) [-1979.522] (-1989.150) (-1984.688) * (-1994.037) (-1985.634) [-1986.328] (-1999.069) -- 0:01:39
692600 -- (-1999.491) [-1987.165] (-1991.386) (-1987.569) * (-1999.847) [-1985.795] (-1991.629) (-1999.825) -- 0:01:39
692700 -- (-1991.676) [-1986.020] (-1991.208) (-1992.507) * (-2009.231) [-1984.539] (-1990.425) (-1987.548) -- 0:01:39
692800 -- (-1994.176) [-1988.753] (-1985.990) (-1993.233) * (-1994.548) [-1986.101] (-1996.412) (-1986.165) -- 0:01:39
692900 -- (-1995.410) [-1983.711] (-1990.278) (-1989.586) * [-1983.567] (-1985.293) (-1994.894) (-1990.848) -- 0:01:39
693000 -- (-2004.168) [-1983.125] (-1996.303) (-1984.142) * [-1985.812] (-1990.953) (-1988.343) (-1991.373) -- 0:01:39
Average standard deviation of split frequencies: 0.002798
693100 -- (-1994.084) [-1985.716] (-1998.715) (-1988.309) * (-1989.640) (-1998.668) (-1990.128) [-1986.944] -- 0:01:39
693200 -- (-1985.820) (-1999.251) [-1993.968] (-1988.226) * (-1992.663) (-2000.158) (-1992.265) [-1988.827] -- 0:01:39
693300 -- (-1983.217) (-1995.149) (-2003.477) [-1983.447] * (-2000.502) (-2003.157) [-1987.276] (-1992.374) -- 0:01:39
693400 -- [-1986.965] (-1990.231) (-1996.233) (-1983.196) * (-2003.142) (-2000.684) (-1987.703) [-1996.409] -- 0:01:39
693500 -- (-1991.591) (-1986.344) (-2003.531) [-1986.663] * (-1987.800) (-2010.036) (-1991.071) [-1988.094] -- 0:01:39
693600 -- (-1989.970) [-1986.393] (-2000.957) (-1981.197) * (-1985.582) (-2015.732) [-1982.579] (-1987.705) -- 0:01:39
693700 -- (-1989.062) [-1984.752] (-2007.374) (-1983.759) * [-1983.780] (-2018.217) (-1979.629) (-1986.167) -- 0:01:39
693800 -- (-1988.772) [-1987.948] (-1999.086) (-1990.624) * [-1982.245] (-2007.058) (-1976.953) (-1990.485) -- 0:01:39
693900 -- [-1988.012] (-1987.683) (-2007.305) (-1992.462) * (-1984.616) (-2000.681) [-1977.585] (-1998.101) -- 0:01:39
694000 -- (-1986.894) [-1981.810] (-2005.289) (-1992.224) * (-1988.430) (-1998.063) [-1978.459] (-1995.234) -- 0:01:39
Average standard deviation of split frequencies: 0.002949
694100 -- (-1985.660) [-1982.754] (-2005.423) (-1991.509) * (-1990.963) (-1996.173) [-1981.968] (-1993.753) -- 0:01:39
694200 -- [-1987.957] (-1985.313) (-1993.349) (-1992.268) * (-1992.300) [-1990.268] (-1984.474) (-1999.887) -- 0:01:39
694300 -- [-1989.901] (-1986.982) (-1997.779) (-1992.042) * [-1984.933] (-1990.488) (-1990.558) (-2009.454) -- 0:01:39
694400 -- (-1989.685) [-1983.749] (-1992.652) (-1995.820) * (-1990.619) [-1985.915] (-1997.349) (-2018.710) -- 0:01:39
694500 -- (-1998.717) [-1984.733] (-1994.174) (-1996.515) * (-1992.628) [-1984.289] (-1997.918) (-2004.261) -- 0:01:39
694600 -- (-2000.058) (-1984.674) [-1988.345] (-1985.740) * (-1990.549) (-1991.585) (-1997.275) [-1996.266] -- 0:01:39
694700 -- [-1991.362] (-1991.554) (-1988.639) (-1983.829) * (-1986.739) [-1984.886] (-2001.757) (-1989.118) -- 0:01:39
694800 -- (-1992.283) (-1988.363) [-1991.284] (-1983.607) * (-1991.141) [-1985.045] (-1998.131) (-1991.423) -- 0:01:39
694900 -- (-2002.457) [-1985.256] (-1996.398) (-1985.289) * (-1986.542) (-1986.610) (-1991.569) [-1991.434] -- 0:01:39
695000 -- (-2004.662) [-1982.280] (-1997.414) (-1985.041) * [-1981.179] (-1982.676) (-1997.900) (-1993.097) -- 0:01:39
Average standard deviation of split frequencies: 0.003003
695100 -- (-2003.757) [-1987.035] (-1998.591) (-1989.029) * (-1995.385) (-1988.348) (-2002.469) [-1985.455] -- 0:01:39
695200 -- [-1996.929] (-2003.045) (-2000.064) (-1987.030) * (-1995.308) [-1981.440] (-1996.990) (-1987.131) -- 0:01:39
695300 -- (-2001.333) [-1985.983] (-2001.155) (-1998.421) * (-1995.978) [-1975.877] (-1994.678) (-1987.743) -- 0:01:39
695400 -- (-1990.716) (-1986.296) (-2000.668) [-1991.485] * (-2000.833) [-1982.969] (-1991.952) (-1988.301) -- 0:01:38
695500 -- (-1995.042) (-1997.772) [-1996.669] (-1994.996) * (-1994.959) [-1981.008] (-1991.024) (-1987.009) -- 0:01:38
695600 -- (-1997.897) (-2007.993) (-1998.959) [-1986.905] * [-1986.122] (-1980.876) (-1992.437) (-1986.089) -- 0:01:38
695700 -- (-2004.811) (-2004.631) (-2003.001) [-1986.349] * (-1992.681) [-1987.182] (-1981.997) (-1983.828) -- 0:01:38
695800 -- (-2001.583) (-1996.024) (-2008.312) [-1987.374] * (-1993.168) (-1990.973) [-1982.719] (-1986.591) -- 0:01:38
695900 -- (-2000.886) [-1987.212] (-2005.056) (-1997.985) * (-1991.958) (-1987.275) [-1983.894] (-1992.008) -- 0:01:38
696000 -- (-1994.998) (-1990.959) (-1999.258) [-1992.637] * [-1990.271] (-1991.994) (-1983.124) (-1990.389) -- 0:01:38
Average standard deviation of split frequencies: 0.002999
696100 -- [-1994.134] (-1998.031) (-1993.763) (-1988.936) * (-1985.984) [-1983.071] (-1983.274) (-1993.270) -- 0:01:38
696200 -- [-1991.951] (-1995.542) (-1991.324) (-1986.854) * (-1990.092) [-1985.797] (-1985.891) (-1995.930) -- 0:01:38
696300 -- [-1987.022] (-1992.814) (-1995.595) (-1989.954) * (-1990.960) (-1987.504) [-1981.749] (-2002.676) -- 0:01:38
696400 -- [-1987.231] (-1987.724) (-2000.201) (-1982.240) * [-1988.413] (-1987.195) (-1984.332) (-2000.894) -- 0:01:38
696500 -- (-1989.732) [-1984.622] (-2001.303) (-1982.663) * [-1981.001] (-1984.839) (-1981.923) (-1998.176) -- 0:01:38
696600 -- (-1983.581) (-1986.125) (-1992.349) [-1982.220] * (-1982.501) (-1985.017) [-1977.648] (-2002.463) -- 0:01:38
696700 -- [-1986.093] (-1987.077) (-1993.211) (-1986.228) * (-1981.353) (-1982.178) [-1979.891] (-1992.895) -- 0:01:38
696800 -- [-1987.431] (-1996.915) (-1995.929) (-1986.076) * [-1977.870] (-1978.310) (-1985.292) (-1988.433) -- 0:01:38
696900 -- (-1990.633) (-1995.284) (-1996.677) [-1985.854] * [-1980.481] (-1982.699) (-1992.290) (-1993.514) -- 0:01:38
697000 -- (-1982.485) (-1995.765) [-1989.505] (-1983.408) * (-1979.864) [-1978.358] (-2007.634) (-1990.044) -- 0:01:38
Average standard deviation of split frequencies: 0.003091
697100 -- [-1986.918] (-1990.648) (-1998.939) (-1984.951) * [-1984.129] (-1978.547) (-1994.904) (-1991.159) -- 0:01:38
697200 -- [-1984.434] (-1994.547) (-2011.159) (-1986.206) * (-1982.937) [-1979.851] (-1989.254) (-1987.697) -- 0:01:38
697300 -- [-1986.908] (-1994.019) (-2000.802) (-1988.026) * (-1986.220) (-1983.459) (-1985.797) [-1984.165] -- 0:01:38
697400 -- (-1986.298) (-1994.551) (-2001.312) [-1985.726] * (-1986.944) [-1981.031] (-1991.107) (-1992.095) -- 0:01:38
697500 -- (-1984.594) (-2002.267) (-1996.730) [-1986.964] * [-1982.918] (-1982.660) (-1998.272) (-1989.769) -- 0:01:38
697600 -- (-1991.023) (-1999.411) [-1991.732] (-1989.689) * [-1979.301] (-1985.019) (-1997.844) (-1999.798) -- 0:01:38
697700 -- (-1991.153) (-1994.648) (-1989.199) [-1989.249] * [-1980.817] (-1994.266) (-1996.484) (-1999.198) -- 0:01:38
697800 -- (-1996.113) (-1996.335) [-1986.317] (-1987.501) * [-1981.351] (-1990.318) (-1989.662) (-1999.899) -- 0:01:38
697900 -- (-1991.042) (-1997.475) [-1988.669] (-1992.982) * [-1980.328] (-1988.112) (-1995.361) (-1996.136) -- 0:01:38
698000 -- [-1985.546] (-1999.140) (-1995.217) (-1990.109) * [-1981.995] (-1989.931) (-1992.986) (-1989.187) -- 0:01:38
Average standard deviation of split frequencies: 0.003222
698100 -- (-1986.666) (-1998.849) [-1988.974] (-1987.137) * (-1983.305) (-1991.285) (-1997.241) [-1988.508] -- 0:01:38
698200 -- (-1990.739) (-1992.560) (-1986.517) [-1984.746] * (-1990.342) (-1995.340) (-1993.302) [-1989.213] -- 0:01:38
698300 -- (-1994.444) (-1996.214) [-1986.723] (-1994.157) * [-1988.588] (-1997.985) (-1994.616) (-1983.937) -- 0:01:38
698400 -- (-1988.529) (-1997.897) [-1984.677] (-2001.440) * (-1986.698) (-2000.292) [-1991.468] (-1987.844) -- 0:01:38
698500 -- (-1994.315) (-1986.541) [-1985.414] (-1992.123) * [-1981.725] (-1997.630) (-1989.636) (-1982.590) -- 0:01:37
698600 -- [-1997.058] (-1989.970) (-1987.708) (-1998.845) * [-1981.549] (-1994.679) (-1997.995) (-1989.199) -- 0:01:37
698700 -- (-1997.282) [-1985.579] (-1987.566) (-2008.971) * [-1983.951] (-1995.147) (-1996.273) (-1988.768) -- 0:01:37
698800 -- (-1994.566) (-1979.652) [-1987.743] (-2014.709) * [-1982.677] (-1998.914) (-1997.456) (-1989.019) -- 0:01:37
698900 -- (-1995.748) [-1983.845] (-1991.423) (-2016.640) * (-1981.096) [-1996.560] (-1993.268) (-1995.863) -- 0:01:37
699000 -- [-1992.783] (-1986.740) (-1991.295) (-2007.621) * [-1980.270] (-1982.645) (-1992.287) (-1993.555) -- 0:01:37
Average standard deviation of split frequencies: 0.003217
699100 -- (-1991.175) (-1983.673) [-1990.858] (-2009.819) * [-1978.467] (-1983.432) (-1986.774) (-1999.330) -- 0:01:37
699200 -- (-1993.006) (-1992.615) [-1992.951] (-2007.379) * [-1983.297] (-1987.490) (-1988.768) (-1993.020) -- 0:01:37
699300 -- (-1991.671) (-1991.330) [-1986.502] (-2007.726) * [-1984.447] (-1987.151) (-1992.809) (-1996.267) -- 0:01:37
699400 -- (-1990.538) [-1990.678] (-1984.217) (-1999.913) * (-1984.898) (-1990.840) [-1986.760] (-1994.981) -- 0:01:37
699500 -- (-1990.982) [-1984.567] (-1996.248) (-1994.368) * [-1979.474] (-1988.924) (-1993.654) (-1991.241) -- 0:01:37
699600 -- [-1986.640] (-1984.504) (-1991.120) (-1992.760) * (-1986.558) (-1988.594) (-1992.842) [-1986.955] -- 0:01:37
699700 -- (-1988.181) [-1983.238] (-1993.383) (-1993.278) * (-1987.693) (-1989.150) (-1987.147) [-1981.511] -- 0:01:37
699800 -- (-1994.694) [-1984.316] (-1990.292) (-1987.940) * (-1989.568) (-1994.384) (-1988.805) [-1982.848] -- 0:01:37
699900 -- (-1994.627) [-1983.280] (-1999.505) (-1995.667) * (-1986.717) (-1988.109) (-1994.318) [-1987.276] -- 0:01:37
700000 -- [-1993.322] (-1981.958) (-1998.907) (-2001.628) * (-1988.287) (-1988.792) [-1991.574] (-1989.003) -- 0:01:37
Average standard deviation of split frequencies: 0.003232
700100 -- (-1988.807) [-1985.006] (-1998.489) (-2003.301) * (-1996.052) (-1995.183) (-1993.548) [-1985.873] -- 0:01:37
700200 -- [-1987.227] (-1986.482) (-1995.748) (-1999.846) * (-1990.227) (-1996.778) (-1987.595) [-1985.055] -- 0:01:37
700300 -- [-1987.379] (-1991.152) (-1987.788) (-2000.766) * (-1997.223) (-2005.913) [-1992.013] (-1984.017) -- 0:01:37
700400 -- [-1990.550] (-1991.239) (-1991.713) (-1995.893) * (-1997.727) (-1996.219) (-1990.692) [-1984.062] -- 0:01:37
700500 -- (-1993.001) (-1989.021) [-1989.288] (-1991.643) * [-1987.653] (-1994.314) (-1998.113) (-1982.283) -- 0:01:37
700600 -- (-2000.910) [-1996.037] (-1989.463) (-1997.399) * (-1989.016) (-1997.979) (-1995.908) [-1982.981] -- 0:01:37
700700 -- (-1996.750) [-1986.781] (-1985.726) (-2009.215) * [-1989.935] (-1999.210) (-1993.721) (-1984.946) -- 0:01:37
700800 -- (-2005.182) [-1980.506] (-1990.375) (-2002.210) * (-1988.915) (-1994.124) [-1990.476] (-1991.583) -- 0:01:37
700900 -- (-1999.296) [-1979.268] (-1987.016) (-1997.018) * (-1996.057) (-2000.256) (-1988.276) [-1985.900] -- 0:01:37
701000 -- (-1988.383) [-1981.305] (-1988.099) (-1995.570) * [-1993.830] (-1992.709) (-1998.316) (-1986.259) -- 0:01:37
Average standard deviation of split frequencies: 0.003246
701100 -- (-1994.794) [-1981.592] (-1995.412) (-2000.747) * (-1991.301) (-1994.795) (-1996.112) [-1986.988] -- 0:01:37
701200 -- (-1997.752) (-1978.698) (-1990.358) [-1990.530] * [-1987.363] (-1995.605) (-1991.847) (-1994.803) -- 0:01:37
701300 -- (-1992.219) [-1980.547] (-1991.613) (-1984.919) * [-1988.486] (-1986.045) (-1990.902) (-1987.988) -- 0:01:37
701400 -- (-1996.464) (-1980.581) (-1991.430) [-1984.104] * (-1989.756) (-1988.157) [-1993.399] (-1981.953) -- 0:01:37
701500 -- (-2007.087) [-1981.065] (-1987.904) (-1984.779) * (-1991.105) (-1995.435) (-2000.317) [-1981.319] -- 0:01:37
701600 -- (-2008.020) (-1983.829) [-1986.701] (-1987.745) * [-1994.392] (-1989.882) (-1995.397) (-1981.561) -- 0:01:36
701700 -- (-1999.764) (-1988.984) [-1987.594] (-1987.809) * (-1988.980) (-1995.323) (-1990.143) [-1984.831] -- 0:01:36
701800 -- (-2004.871) [-1986.318] (-1986.288) (-1985.785) * [-1993.840] (-2001.607) (-1995.100) (-1988.371) -- 0:01:36
701900 -- (-1995.306) (-1982.472) [-1986.758] (-1988.697) * [-1982.484] (-1995.927) (-1991.753) (-1983.135) -- 0:01:36
702000 -- (-1988.923) [-1980.912] (-1989.756) (-1988.957) * [-1986.134] (-1987.944) (-1995.641) (-1984.734) -- 0:01:36
Average standard deviation of split frequencies: 0.003146
702100 -- (-1990.668) [-1980.128] (-1984.226) (-1986.135) * (-1983.488) (-1986.665) (-1995.215) [-1983.217] -- 0:01:36
702200 -- (-1998.201) [-1980.982] (-1984.923) (-1989.598) * (-1997.284) [-1984.940] (-1993.033) (-1988.694) -- 0:01:36
702300 -- (-1997.939) [-1982.637] (-1991.433) (-2003.729) * (-1996.704) [-1989.575] (-1997.394) (-1997.407) -- 0:01:36
702400 -- (-1995.235) [-1984.675] (-1989.815) (-1998.104) * (-1991.645) (-1996.564) [-1989.981] (-2003.559) -- 0:01:36
702500 -- (-1997.876) [-1986.398] (-1988.232) (-1990.673) * [-1987.056] (-1991.762) (-1988.172) (-1998.570) -- 0:01:36
702600 -- (-1994.778) (-1987.660) [-1986.755] (-1992.719) * [-1985.268] (-1987.103) (-1987.083) (-1991.477) -- 0:01:36
702700 -- (-1990.983) [-1980.811] (-2002.725) (-1989.665) * [-1984.805] (-1986.924) (-2001.310) (-1984.692) -- 0:01:36
702800 -- (-2002.295) [-1983.072] (-1994.968) (-1995.022) * (-1984.725) (-1996.413) (-1995.722) [-1980.962] -- 0:01:36
702900 -- (-1999.033) [-1981.471] (-1996.522) (-1991.851) * [-1992.655] (-1993.298) (-1991.994) (-1982.176) -- 0:01:36
703000 -- (-2000.491) [-1987.256] (-1990.599) (-1998.192) * (-1990.972) [-1989.435] (-1998.391) (-1984.229) -- 0:01:36
Average standard deviation of split frequencies: 0.002988
703100 -- (-2002.288) [-1982.569] (-1993.847) (-1995.149) * [-1986.216] (-1991.535) (-1990.403) (-1987.669) -- 0:01:36
703200 -- (-1993.857) (-1989.840) (-1984.827) [-1988.500] * [-1985.385] (-1998.758) (-1992.758) (-1994.525) -- 0:01:36
703300 -- (-1997.190) [-1982.993] (-1987.640) (-1985.267) * [-1984.110] (-2000.288) (-1993.287) (-1997.617) -- 0:01:36
703400 -- (-2008.213) [-1983.045] (-1990.158) (-1991.107) * (-1984.693) (-2013.686) (-1993.153) [-1996.340] -- 0:01:36
703500 -- [-1997.280] (-1989.530) (-1991.813) (-1994.832) * [-1985.592] (-2011.363) (-1990.434) (-1993.174) -- 0:01:36
703600 -- [-1993.164] (-1987.398) (-1992.602) (-1997.265) * [-1981.337] (-2003.687) (-1992.020) (-1993.247) -- 0:01:36
703700 -- (-1989.888) [-1982.196] (-1997.375) (-1993.997) * [-1978.871] (-2007.997) (-1994.255) (-1996.959) -- 0:01:36
703800 -- (-1994.338) [-1980.963] (-1997.356) (-1986.890) * (-1983.125) (-1994.591) [-1985.307] (-1987.978) -- 0:01:36
703900 -- (-1999.139) [-1979.338] (-1994.716) (-1988.633) * (-1980.102) (-2001.182) [-1978.198] (-2000.371) -- 0:01:36
704000 -- (-1989.171) [-1984.686] (-2004.005) (-1994.328) * (-1979.612) (-2002.989) [-1979.251] (-1994.184) -- 0:01:36
Average standard deviation of split frequencies: 0.003118
704100 -- (-1986.276) [-1984.386] (-1994.521) (-1989.989) * (-1986.193) (-2009.787) [-1978.289] (-1994.896) -- 0:01:36
704200 -- (-1985.433) [-1979.726] (-1998.086) (-1998.501) * (-1983.962) (-2011.530) [-1981.404] (-1989.769) -- 0:01:36
704300 -- (-1985.696) [-1982.852] (-2005.508) (-1998.937) * (-1984.768) (-2007.041) [-1985.134] (-1995.037) -- 0:01:36
704400 -- (-1987.095) [-1977.402] (-1993.094) (-1995.646) * [-1986.188] (-1993.383) (-1990.962) (-1992.911) -- 0:01:36
704500 -- (-1989.919) [-1982.437] (-1996.116) (-2000.079) * (-1983.354) [-1989.814] (-1984.063) (-1996.769) -- 0:01:36
704600 -- (-1990.872) [-1987.274] (-1997.008) (-1989.509) * [-1983.627] (-1996.132) (-1985.243) (-2002.672) -- 0:01:36
704700 -- (-1995.194) (-1985.503) (-1998.047) [-1990.889] * (-1987.378) (-1994.233) [-1986.187] (-1998.228) -- 0:01:35
704800 -- (-1992.910) [-1988.119] (-1996.934) (-1993.639) * (-1990.122) [-1992.350] (-1984.790) (-1996.878) -- 0:01:35
704900 -- (-1990.320) (-1986.652) (-1990.930) [-1985.951] * (-1995.743) (-1999.104) [-1983.363] (-1997.573) -- 0:01:35
705000 -- (-1995.962) (-1990.565) [-1993.169] (-1987.035) * (-1995.617) (-1991.691) [-1983.189] (-1995.356) -- 0:01:35
Average standard deviation of split frequencies: 0.003190
705100 -- (-1994.554) (-1992.970) [-1988.187] (-1998.878) * (-1991.315) [-1990.400] (-1981.781) (-1996.705) -- 0:01:35
705200 -- (-1998.670) (-1993.496) [-1985.113] (-1993.950) * (-1987.868) (-1996.683) [-1984.262] (-1998.720) -- 0:01:35
705300 -- (-2006.119) [-1988.196] (-1989.287) (-1990.477) * (-1983.418) (-1990.965) (-1988.109) [-1993.646] -- 0:01:35
705400 -- (-2003.029) [-1987.648] (-1992.614) (-1993.007) * [-1983.514] (-1994.090) (-1985.508) (-1989.771) -- 0:01:35
705500 -- (-2003.387) (-1980.822) [-1989.563] (-1994.355) * (-1984.874) (-2001.444) (-1991.657) [-1988.884] -- 0:01:35
705600 -- (-1996.432) [-1982.349] (-2003.527) (-1993.720) * (-1984.767) [-1992.929] (-1992.560) (-1991.894) -- 0:01:35
705700 -- (-1997.750) [-1982.920] (-1997.871) (-1988.731) * [-1986.104] (-2003.247) (-1990.817) (-1999.239) -- 0:01:35
705800 -- (-1998.582) [-1986.766] (-1991.565) (-1991.583) * (-1983.373) (-1998.957) [-1983.875] (-2002.752) -- 0:01:35
705900 -- (-1999.480) (-1985.272) (-1988.019) [-1986.640] * [-1985.185] (-1991.917) (-1983.491) (-2009.871) -- 0:01:35
706000 -- (-2005.103) (-1987.240) [-1986.123] (-1982.825) * [-1983.772] (-1995.270) (-1996.559) (-2000.634) -- 0:01:35
Average standard deviation of split frequencies: 0.003147
706100 -- (-2004.486) [-1988.868] (-1985.429) (-1981.012) * [-1987.443] (-1995.472) (-1992.126) (-1996.480) -- 0:01:35
706200 -- (-2004.114) (-1990.698) (-1987.136) [-1982.462] * (-1986.642) (-2005.538) (-1990.203) [-1999.910] -- 0:01:35
706300 -- (-2003.867) (-1992.875) (-1985.667) [-1981.087] * [-1991.930] (-2006.472) (-1990.291) (-1995.274) -- 0:01:35
706400 -- (-1995.547) [-1989.779] (-1989.504) (-1982.032) * (-1984.560) [-1998.635] (-1988.579) (-1994.567) -- 0:01:35
706500 -- (-1994.050) (-1993.610) (-1987.260) [-1984.287] * [-1982.741] (-2003.273) (-1995.772) (-1998.898) -- 0:01:35
706600 -- (-1999.997) (-1994.199) (-1987.415) [-1984.824] * (-1982.879) (-2011.493) (-1985.331) [-1990.011] -- 0:01:35
706700 -- (-1993.395) (-2002.768) (-1992.562) [-1983.670] * [-1986.842] (-1998.127) (-1984.470) (-1987.678) -- 0:01:35
706800 -- (-1993.276) (-1998.624) (-1987.566) [-1983.256] * [-1987.987] (-1996.924) (-1987.194) (-1991.512) -- 0:01:35
706900 -- (-1990.946) (-1995.568) (-2000.884) [-1983.068] * [-1994.459] (-1989.638) (-1990.886) (-1993.960) -- 0:01:35
707000 -- (-1989.884) (-1998.636) (-2002.985) [-1983.089] * (-1986.602) (-1991.803) [-1983.361] (-1992.745) -- 0:01:35
Average standard deviation of split frequencies: 0.003238
707100 -- (-1991.089) [-1997.181] (-1994.851) (-1986.457) * [-1991.620] (-1989.104) (-1982.166) (-1993.295) -- 0:01:35
707200 -- [-1991.346] (-1993.801) (-1991.547) (-1989.342) * (-1990.629) [-1985.441] (-1980.992) (-1998.889) -- 0:01:35
707300 -- (-1988.927) (-1989.723) (-1995.967) [-1984.957] * (-1993.032) (-1983.969) [-1982.243] (-2002.526) -- 0:01:35
707400 -- [-1990.041] (-2001.564) (-2005.376) (-1992.965) * (-1987.974) [-1985.984] (-1986.861) (-2000.698) -- 0:01:35
707500 -- (-1988.725) (-1991.996) (-2002.934) [-1992.185] * (-1995.851) (-1983.011) [-1980.277] (-2004.739) -- 0:01:35
707600 -- [-1987.889] (-1992.675) (-1998.869) (-1990.984) * (-1990.360) [-1986.265] (-1979.002) (-2000.086) -- 0:01:35
707700 -- (-1991.798) [-1985.890] (-1992.338) (-2002.504) * [-1988.439] (-1987.129) (-1981.851) (-1996.377) -- 0:01:34
707800 -- (-1996.741) [-1983.950] (-2000.225) (-1996.498) * (-1994.730) [-1984.481] (-1981.435) (-2003.675) -- 0:01:34
707900 -- (-2002.562) [-1982.663] (-1994.320) (-1992.383) * (-1991.212) (-1994.402) [-1978.454] (-1997.609) -- 0:01:34
708000 -- (-1996.762) (-1983.701) (-1998.703) [-1991.406] * (-1988.861) (-1990.970) [-1979.297] (-2000.226) -- 0:01:34
Average standard deviation of split frequencies: 0.003157
708100 -- (-1995.505) (-1990.709) (-1994.423) [-1988.929] * (-1984.211) (-1991.486) [-1980.578] (-1990.393) -- 0:01:34
708200 -- (-1994.980) (-1991.754) (-1996.750) [-1987.619] * (-1979.870) (-1997.808) [-1987.975] (-1999.790) -- 0:01:34
708300 -- (-2001.985) [-1989.313] (-2003.856) (-1984.323) * [-1978.382] (-1995.509) (-1981.740) (-1994.343) -- 0:01:34
708400 -- (-2004.583) [-1983.099] (-2000.896) (-1986.636) * (-1982.163) (-1991.933) [-1980.696] (-1991.086) -- 0:01:34
708500 -- (-2008.123) (-1981.101) (-2001.662) [-1988.554] * (-1986.426) (-1995.125) [-1984.623] (-2003.476) -- 0:01:34
708600 -- (-2005.704) [-1981.253] (-2003.806) (-1986.742) * (-1987.454) (-1994.508) [-1985.906] (-2007.640) -- 0:01:34
708700 -- (-1992.388) [-1979.459] (-1999.398) (-1987.103) * (-1985.889) (-2000.884) [-1985.059] (-1997.773) -- 0:01:34
708800 -- (-1993.353) [-1980.940] (-2003.605) (-1990.578) * [-1984.510] (-1996.593) (-1982.637) (-1992.385) -- 0:01:34
708900 -- (-1990.989) [-1989.760] (-1997.756) (-1987.395) * [-1985.225] (-1995.381) (-1986.443) (-1990.834) -- 0:01:34
709000 -- (-1991.933) (-1999.444) (-2010.377) [-1981.263] * (-1994.327) (-1992.445) [-1978.279] (-1983.912) -- 0:01:34
Average standard deviation of split frequencies: 0.003191
709100 -- [-1990.348] (-1994.267) (-1996.214) (-1986.276) * (-1990.336) (-1990.857) [-1983.297] (-1990.043) -- 0:01:34
709200 -- (-1994.533) (-1990.635) (-1995.501) [-1983.572] * [-1986.980] (-1995.224) (-1990.251) (-1994.174) -- 0:01:34
709300 -- (-1990.985) (-1995.676) (-1995.194) [-1986.488] * (-1987.914) [-1990.118] (-1995.530) (-1984.215) -- 0:01:34
709400 -- (-1993.317) (-2002.247) (-1990.398) [-1988.898] * (-1986.906) (-1985.906) [-1985.148] (-1988.768) -- 0:01:34
709500 -- (-1993.610) (-1992.706) (-2001.145) [-1984.879] * [-1985.052] (-1985.787) (-1988.487) (-1985.061) -- 0:01:34
709600 -- (-1998.345) [-1988.963] (-1990.175) (-1987.188) * [-1980.877] (-1986.487) (-1991.412) (-1985.132) -- 0:01:34
709700 -- (-1996.615) (-1994.462) (-1996.731) [-1983.575] * [-1984.001] (-1988.134) (-1986.697) (-1982.890) -- 0:01:34
709800 -- (-1988.138) (-1988.509) (-1997.701) [-1988.565] * (-1987.277) (-1993.312) (-1995.437) [-1986.636] -- 0:01:34
709900 -- (-1989.115) [-1986.078] (-1997.640) (-1999.273) * [-1984.118] (-1995.806) (-1987.250) (-1992.347) -- 0:01:34
710000 -- (-1991.000) [-1985.077] (-1992.989) (-1992.853) * [-1985.764] (-2004.053) (-1989.837) (-1997.201) -- 0:01:34
Average standard deviation of split frequencies: 0.003186
710100 -- (-1993.143) (-1990.412) [-1990.181] (-1994.795) * (-1989.776) (-1996.912) (-1988.498) [-1995.498] -- 0:01:34
710200 -- (-1991.527) [-1991.501] (-1991.073) (-1987.247) * (-1984.408) (-2003.847) [-1982.546] (-1993.591) -- 0:01:34
710300 -- (-1993.525) (-1988.501) (-1994.083) [-1979.864] * (-1986.656) (-1997.294) [-1982.367] (-2010.272) -- 0:01:34
710400 -- (-1989.741) (-1992.029) (-1995.480) [-1979.005] * [-1984.404] (-1994.775) (-1987.355) (-2002.622) -- 0:01:34
710500 -- (-1993.596) (-1983.350) (-1997.441) [-1977.259] * (-1985.548) (-1992.956) [-1990.173] (-1996.789) -- 0:01:34
710600 -- (-1996.186) (-1987.244) (-1996.333) [-1979.176] * [-1985.682] (-1992.257) (-1989.978) (-2001.419) -- 0:01:34
710700 -- (-1989.001) (-1981.888) (-1997.921) [-1979.706] * [-1981.890] (-1992.957) (-1988.801) (-2002.089) -- 0:01:34
710800 -- (-1990.582) (-1983.890) (-1989.879) [-1981.636] * (-1987.560) (-1994.194) [-1984.421] (-2000.337) -- 0:01:33
710900 -- (-1989.723) (-1982.006) (-1988.444) [-1979.408] * (-1986.899) (-1995.253) [-1985.139] (-1997.960) -- 0:01:33
711000 -- (-1993.523) (-1980.721) (-1993.172) [-1980.439] * (-1993.322) (-1995.974) [-1992.889] (-2000.296) -- 0:01:33
Average standard deviation of split frequencies: 0.003068
711100 -- (-1988.581) [-1979.190] (-1988.561) (-1982.973) * (-1988.187) (-1996.386) [-1986.638] (-2005.999) -- 0:01:33
711200 -- (-1985.423) [-1979.951] (-1998.365) (-1985.425) * [-1983.509] (-1998.705) (-1985.904) (-1997.254) -- 0:01:33
711300 -- (-1997.865) [-1982.280] (-1997.194) (-1983.694) * [-1981.170] (-1999.437) (-1985.001) (-2002.277) -- 0:01:33
711400 -- (-1992.594) (-1981.982) (-2010.373) [-1982.319] * [-1985.493] (-1997.756) (-1989.040) (-2003.049) -- 0:01:33
711500 -- (-1983.824) [-1981.515] (-1996.375) (-1989.279) * (-1984.514) (-1998.850) [-1979.632] (-2007.183) -- 0:01:33
711600 -- (-1987.536) (-1989.577) (-2009.224) [-1992.610] * [-1981.352] (-1993.682) (-1980.608) (-2015.597) -- 0:01:33
711700 -- [-1987.333] (-1988.569) (-1998.408) (-1992.205) * (-1985.432) (-1992.052) [-1979.815] (-2020.181) -- 0:01:33
711800 -- (-1990.697) [-1998.719] (-1996.642) (-1986.591) * (-1985.260) (-1992.839) [-1981.925] (-2007.550) -- 0:01:33
711900 -- (-2003.563) (-2007.327) [-1986.060] (-1989.618) * [-1982.840] (-1986.485) (-1981.637) (-2001.532) -- 0:01:33
712000 -- (-1999.748) (-1992.875) (-1987.225) [-1991.468] * [-1981.412] (-1995.788) (-1983.588) (-2002.645) -- 0:01:33
Average standard deviation of split frequencies: 0.003140
712100 -- (-2003.970) [-1991.614] (-1982.728) (-1991.115) * (-1988.137) (-1991.681) [-1982.965] (-1992.351) -- 0:01:33
712200 -- (-1999.215) (-1991.004) (-1988.271) [-1993.247] * (-1985.951) (-1993.197) [-1984.100] (-1993.298) -- 0:01:33
712300 -- (-1999.494) (-1989.612) [-1989.432] (-1989.328) * (-1992.207) (-1997.076) [-1982.804] (-1997.232) -- 0:01:33
712400 -- (-1995.087) [-1985.511] (-1994.081) (-1985.686) * [-1987.896] (-1992.868) (-1985.639) (-1997.062) -- 0:01:33
712500 -- [-2000.523] (-1993.566) (-1991.581) (-1988.958) * (-1987.973) (-1994.216) [-1982.012] (-1995.975) -- 0:01:33
712600 -- (-1992.687) [-1986.061] (-1990.717) (-1988.971) * (-1987.370) (-1989.590) [-1984.052] (-2003.470) -- 0:01:33
712700 -- (-2000.412) (-1987.561) (-1992.261) [-1981.597] * (-1991.250) (-1984.629) [-1984.508] (-1993.231) -- 0:01:33
712800 -- (-2000.485) (-1987.305) [-1987.354] (-1981.608) * (-1990.452) (-1983.546) [-1983.097] (-1994.466) -- 0:01:33
712900 -- (-1996.942) (-1988.962) (-1990.719) [-1984.484] * [-1986.354] (-1984.928) (-1985.565) (-1987.808) -- 0:01:33
713000 -- (-1995.619) (-1985.904) (-1998.166) [-1983.812] * [-1990.936] (-1986.628) (-1985.919) (-1998.970) -- 0:01:33
Average standard deviation of split frequencies: 0.003248
713100 -- (-1989.130) (-1989.508) (-2001.300) [-1985.490] * (-1988.883) (-1987.719) [-1982.672] (-1997.535) -- 0:01:33
713200 -- [-1988.033] (-2002.019) (-1995.823) (-1994.826) * (-1982.490) [-1991.332] (-1979.942) (-1993.060) -- 0:01:33
713300 -- [-1988.034] (-1990.076) (-1997.204) (-2003.490) * (-1985.576) (-1988.574) [-1985.369] (-1995.274) -- 0:01:33
713400 -- (-1994.811) [-1987.637] (-1990.637) (-1992.536) * (-1987.524) (-1988.278) [-1979.871] (-2002.184) -- 0:01:33
713500 -- (-1991.050) (-1985.559) [-1984.774] (-1997.946) * (-1988.909) (-1988.838) [-1981.499] (-2003.789) -- 0:01:33
713600 -- (-1991.046) [-1990.498] (-1989.940) (-2012.731) * (-1992.892) (-1988.815) [-1983.297] (-1994.394) -- 0:01:33
713700 -- (-1995.561) [-1981.493] (-1988.769) (-1997.960) * (-1994.985) [-1989.373] (-1982.596) (-1996.364) -- 0:01:33
713800 -- [-1989.313] (-1984.858) (-1995.245) (-1999.632) * (-1991.068) (-2003.776) [-1981.818] (-2011.740) -- 0:01:33
713900 -- (-1988.610) (-1984.870) [-1991.310] (-1986.383) * (-1983.727) (-1997.894) [-1984.654] (-2006.669) -- 0:01:32
714000 -- (-1988.909) [-1987.081] (-1991.912) (-1984.378) * [-1986.678] (-1996.927) (-1985.421) (-1998.080) -- 0:01:32
Average standard deviation of split frequencies: 0.003282
714100 -- (-1991.937) (-1982.608) (-1991.243) [-1982.800] * (-1988.765) (-1998.867) [-1981.656] (-1993.035) -- 0:01:32
714200 -- (-1987.426) [-1985.420] (-1999.132) (-1980.977) * (-1990.897) (-2001.178) [-1981.634] (-1997.940) -- 0:01:32
714300 -- (-2005.652) [-1984.735] (-2003.961) (-1982.234) * (-1990.839) (-1997.368) [-1985.065] (-2000.265) -- 0:01:32
714400 -- (-1996.148) [-1984.820] (-1993.789) (-1982.420) * (-1989.710) (-2004.007) [-1989.335] (-1997.209) -- 0:01:32
714500 -- (-1990.140) [-1981.743] (-2003.564) (-1982.148) * [-1983.863] (-1999.446) (-1987.033) (-2006.351) -- 0:01:32
714600 -- [-1990.758] (-1983.725) (-2001.030) (-1982.878) * (-1984.509) (-1994.493) [-1996.349] (-2001.335) -- 0:01:32
714700 -- (-1994.685) (-1986.363) (-2004.594) [-1983.852] * [-1981.413] (-1991.951) (-1991.893) (-1991.975) -- 0:01:32
714800 -- (-1996.842) [-1983.305] (-2006.771) (-1989.152) * (-1988.577) (-2000.976) [-1991.897] (-1994.392) -- 0:01:32
714900 -- (-1995.683) [-1980.468] (-1991.113) (-1989.194) * (-1987.825) (-1993.799) [-1980.464] (-2002.038) -- 0:01:32
715000 -- (-1991.817) (-1984.208) (-1995.535) [-1983.633] * (-1986.239) (-1997.187) [-1985.951] (-1998.987) -- 0:01:32
Average standard deviation of split frequencies: 0.003126
715100 -- (-1992.305) [-1986.389] (-1992.836) (-1997.865) * (-1984.732) (-1993.641) [-1989.215] (-2003.862) -- 0:01:32
715200 -- (-1986.140) [-1980.327] (-1991.007) (-2000.640) * (-1987.576) (-1984.607) [-1982.491] (-2006.521) -- 0:01:32
715300 -- (-1988.802) (-1982.361) [-1987.408] (-2002.076) * [-1981.386] (-1994.495) (-1988.442) (-1994.108) -- 0:01:32
715400 -- (-1993.360) [-1981.712] (-1988.825) (-1991.894) * [-1986.814] (-1993.309) (-1988.026) (-1990.381) -- 0:01:32
715500 -- (-1993.450) (-1991.983) [-1990.560] (-1993.460) * [-1989.595] (-1995.085) (-2009.256) (-1990.481) -- 0:01:32
715600 -- (-1989.348) (-1991.925) [-1989.535] (-1992.005) * [-1995.772] (-1998.400) (-1999.117) (-2010.547) -- 0:01:32
715700 -- (-1991.667) [-1987.891] (-1989.380) (-1996.906) * (-1996.061) (-1993.814) [-1995.631] (-1998.045) -- 0:01:32
715800 -- (-1992.634) (-1988.647) [-1988.815] (-1992.428) * (-1990.666) (-1995.572) (-1996.651) [-1991.082] -- 0:01:32
715900 -- (-1993.853) (-1991.896) (-1989.867) [-1985.841] * [-1989.925] (-2001.175) (-1991.707) (-1991.215) -- 0:01:32
716000 -- (-1995.546) [-1984.314] (-2005.209) (-1990.693) * [-1990.372] (-1992.754) (-1992.330) (-1993.605) -- 0:01:32
Average standard deviation of split frequencies: 0.003122
716100 -- (-1989.503) [-1985.389] (-1994.451) (-1987.869) * (-1982.659) (-1992.900) (-1985.492) [-1992.236] -- 0:01:32
716200 -- (-1997.617) [-1988.759] (-1991.619) (-1986.167) * [-1983.767] (-1994.399) (-2003.310) (-1997.946) -- 0:01:32
716300 -- (-1995.724) (-1988.038) [-1989.456] (-1989.572) * [-1985.907] (-2000.164) (-2000.499) (-1996.714) -- 0:01:32
716400 -- (-1991.011) [-1985.079] (-1994.964) (-1991.096) * [-1983.250] (-2002.448) (-1994.019) (-1992.257) -- 0:01:32
716500 -- (-1993.606) [-1986.333] (-2006.849) (-1996.244) * [-1981.622] (-2003.726) (-2002.625) (-1989.272) -- 0:01:32
716600 -- (-1999.110) [-1979.495] (-2004.669) (-1990.561) * (-1981.645) (-2003.804) [-1994.796] (-1990.065) -- 0:01:32
716700 -- (-1998.124) (-1986.488) (-1996.494) [-1995.592] * [-1981.763] (-1996.261) (-2006.037) (-1994.443) -- 0:01:32
716800 -- (-2000.058) [-1988.573] (-1994.275) (-1988.365) * (-1990.778) (-1994.858) (-1999.189) [-1986.675] -- 0:01:32
716900 -- (-1993.197) [-1992.224] (-1999.792) (-1984.406) * (-1985.783) (-1990.774) (-1995.138) [-1984.741] -- 0:01:32
717000 -- (-2002.680) (-1998.614) (-1988.698) [-1981.923] * [-1984.121] (-1992.515) (-1992.201) (-1987.251) -- 0:01:31
Average standard deviation of split frequencies: 0.003080
717100 -- (-2014.327) (-2003.456) (-1989.432) [-1981.691] * (-1987.682) (-1992.589) (-1991.174) [-1986.065] -- 0:01:31
717200 -- (-2003.178) (-1991.806) [-1986.813] (-1997.289) * (-1988.244) [-1994.466] (-1986.814) (-1999.535) -- 0:01:31
717300 -- (-1995.409) [-1996.606] (-1992.389) (-2001.215) * [-1988.206] (-1991.752) (-1998.465) (-1999.959) -- 0:01:31
717400 -- (-1994.127) (-1992.552) [-1993.457] (-1998.902) * [-1976.837] (-1991.902) (-1992.511) (-1993.436) -- 0:01:31
717500 -- (-1992.435) [-1991.606] (-2006.168) (-1988.188) * [-1975.046] (-1996.067) (-1992.462) (-1986.792) -- 0:01:31
717600 -- (-1991.795) (-1996.038) (-2000.865) [-1985.036] * [-1979.798] (-1991.733) (-2000.056) (-1986.968) -- 0:01:31
717700 -- (-1989.406) [-1998.037] (-2000.122) (-1987.421) * (-1983.998) (-1982.116) (-1999.452) [-1991.680] -- 0:01:31
717800 -- (-1986.738) (-1994.219) (-2002.367) [-1986.057] * [-1990.063] (-1985.481) (-1992.681) (-1996.119) -- 0:01:31
717900 -- (-1987.063) (-1999.562) (-2002.706) [-1982.108] * (-1990.709) [-1986.199] (-2000.806) (-1988.770) -- 0:01:31
718000 -- (-1988.900) (-1994.917) (-1997.437) [-1986.618] * (-1987.178) [-1987.248] (-1999.365) (-1987.421) -- 0:01:31
Average standard deviation of split frequencies: 0.003226
718100 -- (-1991.790) (-1993.029) (-2001.280) [-1985.001] * (-1987.155) (-1987.970) (-2005.457) [-1985.479] -- 0:01:31
718200 -- (-1993.239) (-1993.163) (-1996.129) [-1984.249] * [-1982.931] (-1988.409) (-2005.731) (-1985.555) -- 0:01:31
718300 -- (-2003.362) (-1994.770) (-1990.035) [-1989.967] * (-1988.250) (-1990.554) [-1996.679] (-1990.697) -- 0:01:31
718400 -- (-2003.938) (-1997.024) (-1986.446) [-1992.170] * (-1992.047) (-1989.316) [-1995.638] (-1994.478) -- 0:01:31
718500 -- (-1998.324) (-1995.344) [-1983.633] (-1991.177) * (-1992.316) [-1990.179] (-1994.310) (-1999.060) -- 0:01:31
718600 -- (-1998.497) (-2000.085) (-1987.745) [-1989.473] * (-2001.969) [-1987.970] (-2000.292) (-1998.017) -- 0:01:31
718700 -- (-2004.140) (-1992.712) (-1988.390) [-1983.709] * (-1995.702) [-1988.879] (-1995.468) (-1987.193) -- 0:01:31
718800 -- (-1991.716) (-1994.106) (-1991.246) [-1979.815] * (-1997.116) [-1981.607] (-1992.866) (-1985.038) -- 0:01:31
718900 -- [-1993.777] (-2002.493) (-2000.912) (-1986.516) * (-1992.064) (-1989.055) (-1995.723) [-1987.909] -- 0:01:31
719000 -- (-1995.508) (-1998.526) (-1998.879) [-1987.258] * [-1987.670] (-1987.940) (-2006.076) (-1987.016) -- 0:01:31
Average standard deviation of split frequencies: 0.003296
719100 -- [-1991.237] (-1995.962) (-1990.201) (-1988.226) * (-1989.473) [-1984.170] (-1991.725) (-1992.904) -- 0:01:31
719200 -- (-1986.382) (-1994.505) [-1985.612] (-1996.411) * (-1994.946) [-1987.815] (-1991.704) (-1993.519) -- 0:01:31
719300 -- [-1984.220] (-1992.108) (-1990.441) (-1992.585) * (-1982.973) (-1993.174) [-1990.477] (-1985.416) -- 0:01:31
719400 -- [-1986.005] (-2005.179) (-1992.401) (-1990.897) * (-1985.017) (-1998.734) [-1982.879] (-1980.048) -- 0:01:31
719500 -- [-1988.463] (-1997.293) (-1990.156) (-1991.982) * (-1985.469) (-2000.722) [-1989.832] (-1985.779) -- 0:01:31
719600 -- (-1990.348) (-1982.911) [-1987.047] (-1992.093) * (-1979.446) (-1995.836) (-1987.632) [-1984.305] -- 0:01:31
719700 -- (-1991.861) [-1990.120] (-1993.986) (-1991.304) * (-1990.752) (-2001.654) (-1988.794) [-1980.089] -- 0:01:31
719800 -- (-1992.882) [-1984.780] (-1996.457) (-1995.371) * (-1983.539) (-2010.588) (-1996.754) [-1978.985] -- 0:01:31
719900 -- (-1993.643) [-1982.645] (-1995.818) (-1993.277) * [-1987.876] (-1995.701) (-1988.618) (-1978.499) -- 0:01:31
720000 -- (-1998.296) [-1981.366] (-1990.079) (-1989.529) * (-1986.228) (-1990.370) (-1987.618) [-1981.369] -- 0:01:31
Average standard deviation of split frequencies: 0.003292
720100 -- (-1997.743) [-1983.558] (-1993.035) (-1989.740) * (-1987.259) (-1997.662) (-1989.782) [-1983.619] -- 0:01:30
720200 -- (-1996.101) [-1980.309] (-1993.002) (-1991.309) * (-1986.780) (-1995.994) [-1982.187] (-1980.585) -- 0:01:30
720300 -- (-2000.370) [-1983.565] (-1992.256) (-2000.090) * (-1987.735) (-1995.725) [-1987.085] (-1983.714) -- 0:01:30
720400 -- (-2015.395) [-1985.608] (-1996.369) (-1996.631) * (-1989.170) (-1995.901) (-1981.026) [-1989.699] -- 0:01:30
720500 -- (-2006.934) [-1986.396] (-2005.770) (-1990.661) * (-2002.869) [-1991.340] (-1983.751) (-1986.304) -- 0:01:30
720600 -- (-2017.408) [-1984.104] (-2005.760) (-1994.663) * (-1997.984) (-1992.844) (-1986.357) [-1984.106] -- 0:01:30
720700 -- (-1991.787) [-1988.860] (-2010.910) (-1990.092) * (-2006.380) (-1990.044) (-1986.086) [-1986.254] -- 0:01:30
720800 -- (-1993.338) [-1988.395] (-2003.889) (-1989.528) * (-2012.322) (-1987.364) (-1987.679) [-1984.496] -- 0:01:30
720900 -- (-1993.593) (-1998.390) (-2007.080) [-1989.027] * (-1995.823) (-1986.265) (-1989.852) [-1989.052] -- 0:01:30
721000 -- [-1989.650] (-1992.392) (-1996.549) (-1989.710) * (-1992.182) (-1990.402) (-1985.724) [-1985.983] -- 0:01:30
Average standard deviation of split frequencies: 0.003250
721100 -- (-1985.560) (-1993.769) (-1990.177) [-1981.551] * (-1989.050) (-1988.484) (-1989.940) [-1986.953] -- 0:01:30
721200 -- (-1989.332) (-1990.101) (-1989.788) [-1985.278] * (-1983.300) (-1999.331) [-1989.166] (-1984.447) -- 0:01:30
721300 -- (-1991.905) (-1990.157) [-1985.498] (-1986.673) * (-1985.363) (-1999.546) (-1989.982) [-1985.964] -- 0:01:30
721400 -- (-1991.375) (-1990.450) [-1981.294] (-1992.107) * [-1979.271] (-2002.878) (-1998.529) (-1982.046) -- 0:01:30
721500 -- (-1999.850) (-1988.164) [-1983.418] (-1990.437) * (-1981.974) [-1990.464] (-2002.340) (-1983.742) -- 0:01:30
721600 -- (-2002.128) (-1987.321) [-1985.814] (-1988.450) * [-1982.191] (-1991.826) (-1990.864) (-1991.361) -- 0:01:30
721700 -- (-2002.828) (-1987.330) [-1984.713] (-1995.189) * [-1983.230] (-1989.745) (-1986.507) (-1992.858) -- 0:01:30
721800 -- [-1995.619] (-1997.793) (-1987.037) (-2004.067) * [-1980.290] (-1993.637) (-1990.033) (-1997.299) -- 0:01:30
721900 -- (-1993.176) (-1990.466) [-1985.991] (-1998.303) * [-1977.781] (-1990.558) (-1986.782) (-1997.916) -- 0:01:30
722000 -- (-1990.776) (-1991.674) [-1985.655] (-1996.639) * [-1986.117] (-1989.652) (-1988.705) (-2000.903) -- 0:01:30
Average standard deviation of split frequencies: 0.003208
722100 -- (-1997.136) (-1997.353) (-1989.742) [-1983.798] * [-1985.081] (-1982.695) (-1984.952) (-2007.598) -- 0:01:30
722200 -- (-1998.079) (-1994.199) (-1989.023) [-1983.942] * (-1989.225) [-1984.161] (-1988.395) (-2003.012) -- 0:01:30
722300 -- (-2020.708) (-1996.269) (-1990.034) [-1981.507] * [-1984.881] (-1988.213) (-1989.636) (-1994.848) -- 0:01:30
722400 -- (-1993.218) (-1998.169) (-1996.593) [-1984.245] * (-1984.818) (-1987.663) [-1989.623] (-2007.625) -- 0:01:30
722500 -- (-1992.507) (-1999.580) (-2001.419) [-1985.703] * (-1988.351) [-1987.848] (-1991.043) (-1999.755) -- 0:01:30
722600 -- (-1994.808) (-2000.814) (-1995.273) [-1989.296] * (-1995.440) (-1998.615) (-1991.773) [-1989.594] -- 0:01:30
722700 -- [-1998.919] (-2004.901) (-1999.110) (-1995.534) * (-1987.846) (-2000.476) (-1988.961) [-1985.871] -- 0:01:30
722800 -- [-1990.223] (-2000.116) (-1995.402) (-2002.200) * [-1985.166] (-2002.736) (-1992.448) (-1984.388) -- 0:01:30
722900 -- (-1996.730) (-1996.307) (-1995.450) [-1993.157] * [-1985.881] (-1993.599) (-1994.491) (-1984.003) -- 0:01:30
723000 -- (-1985.605) (-1994.797) (-2000.120) [-1987.641] * [-1989.073] (-1989.218) (-1992.681) (-1985.235) -- 0:01:30
Average standard deviation of split frequencies: 0.003185
723100 -- (-1991.191) [-1990.054] (-1998.154) (-1985.118) * [-1984.218] (-1992.620) (-1994.707) (-1987.044) -- 0:01:29
723200 -- (-1994.734) (-1991.790) (-1994.289) [-1982.889] * [-1985.843] (-1989.519) (-1997.380) (-1986.853) -- 0:01:29
723300 -- (-2009.247) (-1984.626) [-1987.976] (-1990.608) * [-1988.929] (-1992.989) (-1997.071) (-1986.896) -- 0:01:29
723400 -- (-2001.440) [-1984.385] (-1986.445) (-1990.168) * [-1980.408] (-1991.627) (-2006.001) (-1986.144) -- 0:01:29
723500 -- (-2003.587) [-1982.516] (-1988.968) (-1994.644) * [-1983.532] (-1994.793) (-2006.825) (-1987.046) -- 0:01:29
723600 -- (-1993.075) [-1984.368] (-1993.104) (-1991.789) * [-1983.734] (-1992.439) (-1997.722) (-1985.197) -- 0:01:29
723700 -- (-1995.870) (-1981.340) (-1997.366) [-1985.547] * [-1985.008] (-1995.939) (-2003.017) (-1990.963) -- 0:01:29
723800 -- [-1995.223] (-1983.347) (-1994.503) (-1986.720) * (-1981.940) [-1987.492] (-1997.770) (-1993.938) -- 0:01:29
723900 -- (-2001.726) (-1986.061) [-1982.259] (-1986.551) * (-1985.513) [-1990.740] (-2002.547) (-1990.838) -- 0:01:29
724000 -- (-2002.705) [-1982.777] (-1990.518) (-1989.387) * (-1991.106) [-1986.028] (-2009.172) (-1987.094) -- 0:01:29
Average standard deviation of split frequencies: 0.003162
724100 -- (-2001.209) [-1981.042] (-1998.072) (-1999.610) * (-1988.859) [-1987.606] (-2004.677) (-1991.376) -- 0:01:29
724200 -- (-1997.256) (-1988.813) (-2002.846) [-1999.347] * (-1997.716) [-1983.208] (-2011.959) (-1985.090) -- 0:01:29
724300 -- (-1993.126) [-1985.328] (-1992.713) (-2004.149) * (-1995.568) (-1985.613) (-2011.420) [-1982.705] -- 0:01:29
724400 -- (-1991.592) [-1983.811] (-1989.019) (-1995.622) * (-1997.141) (-1991.988) (-2013.394) [-1985.485] -- 0:01:29
724500 -- [-1996.016] (-1981.318) (-1990.242) (-1993.547) * (-1996.387) (-1999.512) (-2001.477) [-1988.407] -- 0:01:29
724600 -- (-1989.356) (-1980.162) [-1986.427] (-2002.572) * (-1986.429) (-1989.423) (-2008.277) [-1985.686] -- 0:01:29
724700 -- [-1987.121] (-1986.789) (-1982.878) (-1993.231) * [-1983.168] (-1991.956) (-2007.680) (-1994.013) -- 0:01:29
724800 -- (-1990.490) [-1983.749] (-1984.272) (-1989.456) * [-1983.969] (-1998.042) (-2005.770) (-1994.988) -- 0:01:29
724900 -- (-1994.038) [-1983.379] (-1990.074) (-1994.621) * [-1982.829] (-1992.194) (-1998.473) (-1997.459) -- 0:01:29
725000 -- (-1996.085) (-1985.728) (-1987.384) [-1989.139] * (-1987.253) [-1991.168] (-1998.462) (-1998.818) -- 0:01:29
Average standard deviation of split frequencies: 0.003213
725100 -- (-1992.603) (-1984.290) (-1988.263) [-1984.756] * [-1985.029] (-1991.583) (-1998.432) (-1994.464) -- 0:01:29
725200 -- (-1999.026) [-1984.411] (-1987.309) (-1992.004) * [-1980.712] (-1992.139) (-2000.781) (-2001.169) -- 0:01:29
725300 -- (-2003.874) [-1983.693] (-1984.492) (-1985.510) * [-1982.141] (-1991.259) (-1999.331) (-1991.694) -- 0:01:29
725400 -- (-2000.804) (-1981.021) (-2000.056) [-1987.360] * (-1983.440) [-1989.957] (-2001.819) (-1993.437) -- 0:01:29
725500 -- (-1991.549) [-1980.414] (-1988.959) (-1989.990) * (-1990.099) [-1987.084] (-2006.619) (-1997.895) -- 0:01:29
725600 -- (-1995.415) [-1984.669] (-1983.742) (-1987.189) * (-1988.452) [-1986.537] (-2002.823) (-2003.966) -- 0:01:29
725700 -- (-1988.060) (-1987.768) [-1985.709] (-1989.463) * (-1987.072) (-1993.760) [-1996.209] (-1993.869) -- 0:01:29
725800 -- (-1991.040) (-1994.150) (-1987.582) [-1986.363] * [-1987.342] (-1983.418) (-1997.774) (-2000.403) -- 0:01:29
725900 -- (-1989.783) [-1983.779] (-1992.205) (-1982.788) * [-1982.872] (-1990.076) (-1995.020) (-1986.955) -- 0:01:29
726000 -- (-1990.799) [-1980.242] (-1995.406) (-1985.865) * (-1983.697) (-1990.691) (-1995.373) [-1987.708] -- 0:01:29
Average standard deviation of split frequencies: 0.003246
726100 -- [-1990.087] (-1990.026) (-1994.779) (-1983.202) * (-1986.291) (-1990.116) (-1996.301) [-1989.069] -- 0:01:29
726200 -- (-1992.640) [-1982.995] (-1987.307) (-1986.033) * (-1989.124) [-1983.113] (-1991.458) (-1992.272) -- 0:01:28
726300 -- (-1989.877) (-1988.212) (-1994.065) [-1984.196] * (-1992.114) [-1991.236] (-1996.694) (-2001.887) -- 0:01:28
726400 -- (-1986.024) [-1986.414] (-1988.065) (-1982.840) * (-1986.008) (-1998.545) (-1996.594) [-2000.518] -- 0:01:28
726500 -- (-1997.087) (-1988.904) (-1991.498) [-1980.951] * [-1987.220] (-1994.039) (-2002.263) (-1996.163) -- 0:01:28
726600 -- (-1994.938) (-1986.575) (-1989.510) [-1980.457] * [-1983.135] (-1994.893) (-1993.458) (-1989.727) -- 0:01:28
726700 -- (-1997.468) (-1986.604) (-1986.362) [-1983.301] * [-1987.886] (-2004.896) (-1999.487) (-1995.419) -- 0:01:28
726800 -- (-1996.540) (-1983.107) [-1981.868] (-1983.302) * [-1991.491] (-2009.996) (-1998.723) (-1994.386) -- 0:01:28
726900 -- (-1989.586) [-1979.098] (-1985.618) (-1984.742) * [-1988.506] (-2005.828) (-1993.816) (-1990.538) -- 0:01:28
727000 -- [-1988.697] (-1981.166) (-1985.487) (-1981.552) * [-1987.336] (-2002.845) (-1992.230) (-1989.005) -- 0:01:28
Average standard deviation of split frequencies: 0.003075
727100 -- (-1987.835) (-1983.188) [-1981.718] (-1988.188) * [-1982.928] (-1999.625) (-1993.064) (-1991.109) -- 0:01:28
727200 -- (-1990.993) (-1983.990) [-1981.451] (-1993.020) * [-1983.461] (-2000.736) (-1995.970) (-1995.428) -- 0:01:28
727300 -- (-1995.779) [-1983.941] (-1982.099) (-1993.459) * [-1983.787] (-1998.315) (-1994.906) (-1995.487) -- 0:01:28
727400 -- (-1996.505) (-1983.249) [-1982.570] (-1989.215) * [-1985.115] (-1995.758) (-1992.271) (-1995.409) -- 0:01:28
727500 -- (-2001.859) (-1978.816) [-1982.396] (-1983.629) * (-1981.123) (-1993.026) (-1989.385) [-1993.622] -- 0:01:28
727600 -- (-1995.588) [-1982.354] (-1982.308) (-1985.868) * [-1978.464] (-1997.771) (-1995.532) (-1994.723) -- 0:01:28
727700 -- [-1987.703] (-1988.719) (-1988.738) (-1989.294) * [-1978.767] (-1991.069) (-1999.069) (-1995.351) -- 0:01:28
727800 -- (-1991.347) [-1990.369] (-1984.645) (-1997.576) * [-1980.275] (-1986.675) (-1986.486) (-1993.990) -- 0:01:28
727900 -- (-1993.478) [-1989.480] (-1989.234) (-2002.764) * [-1981.910] (-1985.898) (-1983.879) (-1994.701) -- 0:01:28
728000 -- (-1998.480) [-1984.237] (-1982.235) (-1985.398) * (-1988.860) (-1992.293) [-1985.725] (-1983.651) -- 0:01:28
Average standard deviation of split frequencies: 0.003089
728100 -- (-2000.838) [-1982.455] (-1987.368) (-1983.837) * (-1988.025) (-1991.927) (-1984.272) [-1983.627] -- 0:01:28
728200 -- (-2002.393) [-1986.979] (-1987.510) (-1986.085) * (-1991.647) (-1994.501) (-1995.903) [-1983.936] -- 0:01:28
728300 -- (-1992.579) (-1979.894) (-1983.451) [-1981.196] * (-1992.766) (-1985.957) (-1989.945) [-1981.214] -- 0:01:28
728400 -- (-1998.136) [-1978.950] (-1988.578) (-1984.105) * (-1994.876) (-1993.968) (-1986.072) [-1983.486] -- 0:01:28
728500 -- (-2001.373) (-1980.843) [-1984.258] (-1987.474) * (-1989.129) (-1995.501) (-1982.244) [-1982.949] -- 0:01:28
728600 -- (-1991.043) (-1984.836) [-1988.419] (-1988.436) * (-1985.176) (-1998.431) [-1985.883] (-1985.314) -- 0:01:28
728700 -- (-1987.557) [-1985.133] (-1991.272) (-1991.232) * [-1978.880] (-1998.240) (-1984.476) (-1987.836) -- 0:01:28
728800 -- (-1991.909) [-1984.638] (-1986.724) (-1988.995) * [-1983.970] (-1997.975) (-1986.458) (-1987.938) -- 0:01:28
728900 -- (-2001.749) (-1987.989) [-1987.222] (-1988.787) * (-1984.492) (-2000.700) [-1986.212] (-1988.557) -- 0:01:28
729000 -- (-1999.186) (-1985.700) (-1990.590) [-1983.179] * (-1983.807) (-2001.468) (-1991.956) [-1985.322] -- 0:01:28
Average standard deviation of split frequencies: 0.003066
729100 -- (-1998.979) [-1994.272] (-1989.416) (-1981.485) * (-1981.371) (-1997.607) (-1991.220) [-1985.543] -- 0:01:28
729200 -- (-2000.234) [-1986.321] (-1997.137) (-1989.328) * (-1982.080) (-1997.110) (-1989.037) [-1982.860] -- 0:01:28
729300 -- (-1999.335) [-1983.926] (-2006.342) (-1988.674) * (-1988.939) (-1994.926) [-1990.102] (-1982.613) -- 0:01:27
729400 -- (-1988.972) [-1984.761] (-2007.220) (-1992.023) * (-1991.144) (-1993.888) (-1992.547) [-1986.538] -- 0:01:27
729500 -- (-1991.015) [-1984.052] (-2001.866) (-1984.007) * (-1981.548) (-1992.760) [-1985.211] (-2000.889) -- 0:01:27
729600 -- (-1989.649) (-1981.780) (-2003.494) [-1982.771] * [-1980.057] (-1992.859) (-1988.475) (-1998.924) -- 0:01:27
729700 -- (-1990.706) [-1983.615] (-1994.921) (-1985.959) * [-1982.807] (-1993.025) (-1990.101) (-1997.029) -- 0:01:27
729800 -- (-1993.399) [-1985.041] (-1997.506) (-1988.946) * [-1981.352] (-1992.284) (-1991.190) (-1995.630) -- 0:01:27
729900 -- (-1989.463) (-1985.228) (-1997.751) [-1985.551] * [-1980.287] (-1992.911) (-1993.379) (-1995.316) -- 0:01:27
730000 -- (-1992.472) (-1981.050) (-2001.927) [-1982.766] * (-1988.058) (-2005.680) (-1994.495) [-1990.697] -- 0:01:27
Average standard deviation of split frequencies: 0.003118
730100 -- (-1987.041) (-1980.662) (-1996.209) [-1983.510] * [-1987.384] (-1994.783) (-1993.372) (-1995.652) -- 0:01:27
730200 -- (-1992.507) (-1985.025) (-2000.037) [-1979.049] * [-1984.188] (-2000.663) (-1989.955) (-1993.494) -- 0:01:27
730300 -- (-1997.338) (-1983.085) (-1993.098) [-1980.416] * [-1985.648] (-2012.865) (-1986.180) (-2003.200) -- 0:01:27
730400 -- (-1998.090) (-1983.904) (-1993.112) [-1982.444] * (-1984.886) (-2001.141) [-1984.026] (-1985.438) -- 0:01:27
730500 -- (-1998.499) (-1985.677) (-1992.428) [-1983.238] * (-1981.908) (-1996.729) [-1984.393] (-1983.259) -- 0:01:27
730600 -- (-2001.320) (-1985.845) (-2003.115) [-1990.747] * (-1989.857) (-2005.756) (-1987.531) [-1982.254] -- 0:01:27
730700 -- (-1987.221) [-1985.057] (-1993.243) (-1990.478) * (-1994.235) (-1994.895) (-1988.186) [-1981.169] -- 0:01:27
730800 -- (-1999.351) [-1981.709] (-1990.989) (-1994.060) * [-1986.141] (-1998.510) (-1988.179) (-1983.311) -- 0:01:27
730900 -- (-1993.796) [-1984.745] (-1988.901) (-1994.543) * (-1990.448) [-1996.408] (-1990.716) (-1984.570) -- 0:01:27
731000 -- [-1988.241] (-1989.245) (-1990.740) (-2004.909) * (-1986.293) (-2001.703) (-1993.701) [-1978.489] -- 0:01:27
Average standard deviation of split frequencies: 0.003095
731100 -- (-1986.974) [-1991.328] (-1982.213) (-2007.285) * (-1988.277) (-1997.487) (-1994.513) [-1979.279] -- 0:01:27
731200 -- [-1986.161] (-1998.277) (-1987.447) (-2001.881) * [-1985.256] (-1991.344) (-1992.441) (-1980.060) -- 0:01:27
731300 -- (-1991.417) (-1991.103) [-1983.383] (-1990.492) * (-1983.655) (-1993.178) (-1991.329) [-1984.086] -- 0:01:27
731400 -- (-1998.389) (-1987.380) [-1981.286] (-1987.799) * [-1984.615] (-1998.732) (-1996.470) (-1984.405) -- 0:01:27
731500 -- (-1989.676) (-1984.956) (-1986.152) [-1984.731] * (-1984.348) (-1994.790) (-1996.939) [-1988.365] -- 0:01:27
731600 -- (-1986.002) [-1979.970] (-1986.425) (-1990.624) * [-1984.312] (-1996.484) (-2000.709) (-1989.369) -- 0:01:27
731700 -- (-1987.589) (-1985.109) [-1983.195] (-1998.417) * [-1985.093] (-2003.069) (-2002.327) (-1993.795) -- 0:01:27
731800 -- (-1990.647) (-1982.545) [-1980.014] (-1987.475) * (-1985.307) (-1997.496) [-1997.814] (-1985.862) -- 0:01:27
731900 -- (-2000.628) [-1983.383] (-1978.605) (-1988.106) * [-1986.398] (-2001.830) (-1999.093) (-1988.681) -- 0:01:27
732000 -- (-2012.661) (-1982.362) (-1981.535) [-1983.979] * (-1994.150) (-1996.359) [-1997.797] (-1988.567) -- 0:01:27
Average standard deviation of split frequencies: 0.003091
732100 -- (-1999.783) (-1979.003) [-1987.548] (-1983.751) * (-1986.976) (-1994.159) (-2000.347) [-1986.068] -- 0:01:27
732200 -- (-1999.878) (-1987.180) (-1984.739) [-1983.105] * (-1995.297) (-1995.976) (-2002.138) [-1984.494] -- 0:01:27
732300 -- [-1991.251] (-1985.688) (-1988.406) (-1983.781) * (-1997.376) (-1993.887) (-1998.603) [-1987.379] -- 0:01:27
732400 -- (-1987.191) (-1982.341) (-1983.955) [-1984.228] * (-1997.812) (-1993.925) (-1993.343) [-1987.031] -- 0:01:26
732500 -- (-1991.250) [-1987.509] (-1985.737) (-1988.349) * (-1999.506) [-1988.586] (-1985.990) (-1989.287) -- 0:01:26
732600 -- (-1989.925) [-1986.120] (-1988.659) (-1987.662) * (-1995.972) [-1992.094] (-1992.761) (-1991.805) -- 0:01:26
732700 -- (-1990.525) (-2000.956) [-1980.610] (-1990.692) * [-1991.547] (-1993.376) (-1994.703) (-1986.398) -- 0:01:26
732800 -- (-1988.814) (-1995.352) [-1982.029] (-1996.293) * (-1994.054) (-1992.614) [-1988.486] (-1989.588) -- 0:01:26
732900 -- (-1990.475) (-1997.566) [-1978.540] (-1991.144) * [-1989.197] (-1992.084) (-1986.927) (-1992.810) -- 0:01:26
733000 -- (-1989.856) (-2001.137) [-1977.437] (-1995.742) * [-1985.581] (-1985.803) (-1985.563) (-1991.410) -- 0:01:26
Average standard deviation of split frequencies: 0.003013
733100 -- (-1992.421) (-1987.321) [-1975.815] (-1998.533) * (-1993.524) [-1984.836] (-1986.382) (-1988.748) -- 0:01:26
733200 -- (-1988.977) (-1993.125) [-1981.986] (-1990.548) * (-1999.363) (-1986.226) [-1987.879] (-1991.062) -- 0:01:26
733300 -- (-1990.972) (-1995.840) [-1979.220] (-1983.653) * (-2006.246) (-1984.938) (-1989.991) [-1991.735] -- 0:01:26
733400 -- (-1998.137) (-1993.319) (-1989.017) [-1984.118] * (-2001.817) (-1988.473) (-1990.534) [-1989.650] -- 0:01:26
733500 -- (-2002.368) (-1988.841) [-1983.705] (-1979.795) * (-2001.648) (-1993.192) [-1986.903] (-1996.251) -- 0:01:26
733600 -- (-2000.363) (-1984.273) (-1985.665) [-1983.412] * (-1998.822) [-1988.216] (-1992.448) (-2002.858) -- 0:01:26
733700 -- (-2001.271) (-1984.846) [-1982.844] (-1989.016) * (-1992.341) (-1990.713) (-1989.459) [-1995.315] -- 0:01:26
733800 -- (-2007.347) (-1983.306) [-1979.148] (-1992.242) * [-1991.983] (-1988.733) (-1998.105) (-1999.251) -- 0:01:26
733900 -- (-1989.053) (-1976.868) [-1984.437] (-1986.602) * [-1989.550] (-1999.291) (-1989.340) (-1992.140) -- 0:01:26
734000 -- (-1992.297) (-1977.423) [-1986.766] (-1985.342) * (-1986.204) (-2000.701) (-1993.709) [-1987.369] -- 0:01:26
Average standard deviation of split frequencies: 0.002935
734100 -- (-1989.506) (-1978.758) (-1996.159) [-1983.896] * [-1988.981] (-1992.246) (-1991.791) (-1991.116) -- 0:01:26
734200 -- (-1989.503) [-1978.911] (-1993.142) (-1979.928) * [-1987.335] (-1993.929) (-1994.655) (-1989.728) -- 0:01:26
734300 -- (-1988.987) (-1980.563) (-1999.100) [-1985.370] * (-1987.282) (-1996.549) (-1992.581) [-1988.755] -- 0:01:26
734400 -- (-1993.535) (-1981.546) (-1988.612) [-1984.342] * (-1994.729) (-1996.289) (-1997.273) [-1988.500] -- 0:01:26
734500 -- (-1991.188) [-1984.362] (-1993.576) (-1987.657) * (-1991.218) (-1999.045) (-1992.754) [-1987.620] -- 0:01:26
734600 -- (-1998.082) (-1991.751) (-1995.251) [-1988.802] * (-1991.287) (-1993.276) (-1995.462) [-1983.888] -- 0:01:26
734700 -- (-2007.997) (-1988.053) [-1981.195] (-1990.849) * (-1985.940) (-1991.582) (-1994.172) [-1983.473] -- 0:01:26
734800 -- (-2002.655) (-1985.383) [-1978.770] (-1982.520) * [-1983.867] (-1999.010) (-1995.905) (-1984.260) -- 0:01:26
734900 -- (-2005.439) (-1988.576) [-1983.834] (-1983.486) * (-1996.830) (-1996.870) (-1995.777) [-1985.779] -- 0:01:26
735000 -- (-1995.977) (-1989.641) (-1986.707) [-1980.387] * (-2001.276) (-1998.092) [-1994.539] (-1993.788) -- 0:01:26
Average standard deviation of split frequencies: 0.002803
735100 -- (-1999.143) (-1988.682) (-1986.904) [-1982.535] * (-1996.458) [-1997.351] (-1997.521) (-1991.958) -- 0:01:26
735200 -- (-1998.440) (-1988.739) [-1984.024] (-1983.168) * [-1990.869] (-1998.241) (-2002.805) (-1994.136) -- 0:01:26
735300 -- (-1995.819) (-1985.474) [-1983.639] (-1984.912) * [-1990.453] (-1995.569) (-1996.378) (-1996.822) -- 0:01:26
735400 -- (-1993.931) (-1991.538) [-1987.272] (-1989.253) * [-1987.391] (-1986.454) (-2005.275) (-1995.023) -- 0:01:25
735500 -- (-1993.257) (-1986.954) (-1983.479) [-1987.377] * (-1992.058) [-1985.992] (-1996.606) (-1998.860) -- 0:01:25
735600 -- (-1992.214) [-1984.975] (-1985.077) (-1986.188) * (-1996.739) [-1987.326] (-1988.689) (-1992.773) -- 0:01:25
735700 -- (-1992.191) (-1984.322) (-1982.764) [-1986.677] * (-1993.117) [-1991.628] (-1988.352) (-1991.651) -- 0:01:25
735800 -- (-2006.246) [-1980.342] (-1996.578) (-1985.819) * (-1995.450) (-1991.931) [-1987.916] (-1992.931) -- 0:01:25
735900 -- (-2002.848) [-1984.410] (-1992.317) (-1985.480) * (-1984.078) (-1993.458) (-1985.603) [-1994.805] -- 0:01:25
736000 -- (-2000.647) [-1993.212] (-1993.229) (-1987.358) * (-1985.881) (-1993.593) [-1989.866] (-1994.901) -- 0:01:25
Average standard deviation of split frequencies: 0.002763
736100 -- (-1999.050) (-1991.738) (-1994.152) [-1984.137] * [-1987.706] (-1989.068) (-1989.296) (-1991.045) -- 0:01:25
736200 -- (-2008.123) (-2004.809) (-1986.160) [-1984.432] * [-1988.326] (-1995.109) (-1991.548) (-1991.528) -- 0:01:25
736300 -- (-1992.066) (-1995.054) (-1986.560) [-1986.095] * [-1990.505] (-1991.459) (-1992.685) (-1990.562) -- 0:01:25
736400 -- (-1990.364) (-2006.234) [-1983.043] (-1993.437) * (-1986.748) [-1988.563] (-1989.313) (-1985.886) -- 0:01:25
736500 -- (-1991.711) (-1993.622) [-1982.611] (-1991.632) * (-1990.310) (-1988.844) [-1987.186] (-1991.337) -- 0:01:25
736600 -- (-1993.366) (-1987.714) [-1981.262] (-1989.345) * [-1990.511] (-1991.984) (-1996.660) (-1995.144) -- 0:01:25
736700 -- (-1993.682) [-1986.813] (-1983.704) (-1990.971) * (-1986.968) (-1988.025) (-1994.486) [-1991.269] -- 0:01:25
736800 -- (-1998.641) [-1990.023] (-1982.245) (-1993.380) * [-1986.503] (-1990.387) (-1996.163) (-1989.618) -- 0:01:25
736900 -- (-1994.450) (-1987.635) [-1987.156] (-2001.634) * [-1986.710] (-1993.253) (-1986.244) (-1989.919) -- 0:01:25
737000 -- (-1989.832) [-1990.648] (-1985.220) (-2005.811) * (-1996.513) [-1997.481] (-1992.220) (-1990.422) -- 0:01:25
Average standard deviation of split frequencies: 0.002704
737100 -- (-1991.502) (-1985.753) [-1990.271] (-1994.481) * (-1999.174) (-1999.222) [-1986.385] (-1987.414) -- 0:01:25
737200 -- (-1990.808) [-1983.586] (-2003.603) (-2001.936) * (-1991.238) (-2000.853) (-1993.469) [-1987.175] -- 0:01:25
737300 -- (-1991.067) [-1983.672] (-1998.594) (-1995.737) * (-1992.092) (-1989.820) (-1986.749) [-1987.487] -- 0:01:25
737400 -- (-1996.664) [-1982.146] (-1986.095) (-1994.731) * (-1993.355) (-1995.563) [-1985.122] (-1988.201) -- 0:01:25
737500 -- [-1994.159] (-1982.827) (-1999.411) (-1991.220) * (-1986.576) (-1994.863) [-1989.375] (-1993.404) -- 0:01:25
737600 -- (-1997.146) [-1979.945] (-1993.191) (-1991.278) * (-1986.832) [-1989.426] (-1988.812) (-1993.859) -- 0:01:25
737700 -- (-1993.572) [-1986.386] (-1995.363) (-1999.355) * [-1988.119] (-1991.376) (-1997.953) (-1992.193) -- 0:01:25
737800 -- (-1989.335) [-1983.584] (-1990.220) (-1992.467) * (-1986.491) (-1991.606) (-1991.025) [-1986.562] -- 0:01:25
737900 -- (-1998.481) [-1982.097] (-1982.484) (-1988.399) * (-2001.375) (-1993.569) [-1990.194] (-1997.219) -- 0:01:25
738000 -- (-1986.864) [-1982.412] (-1980.801) (-1987.184) * (-2003.871) (-1995.776) [-1984.927] (-1992.006) -- 0:01:25
Average standard deviation of split frequencies: 0.002701
738100 -- (-1993.611) [-1979.268] (-1990.436) (-1992.735) * (-2009.176) (-1985.491) [-1984.463] (-1993.556) -- 0:01:25
738200 -- (-1988.575) [-1976.879] (-1990.571) (-1995.096) * (-2003.396) (-1984.325) [-1985.003] (-1991.437) -- 0:01:25
738300 -- (-1994.592) (-1988.211) [-1985.670] (-1991.002) * (-1996.183) [-1989.882] (-1988.135) (-1998.576) -- 0:01:25
738400 -- (-1987.516) (-1998.786) [-1981.943] (-1991.016) * (-2005.359) [-1985.243] (-1988.166) (-1993.553) -- 0:01:25
738500 -- (-1988.747) (-1998.305) [-1988.270] (-1999.145) * (-1999.069) [-1988.221] (-1986.428) (-1995.854) -- 0:01:24
738600 -- [-1986.340] (-1994.820) (-1988.445) (-1993.613) * (-1990.966) [-1987.462] (-1992.975) (-1996.615) -- 0:01:24
738700 -- [-1981.235] (-1998.348) (-1989.029) (-2001.514) * (-1993.237) [-1994.203] (-1996.911) (-1991.026) -- 0:01:24
738800 -- [-1980.597] (-1996.925) (-1986.001) (-2001.475) * (-1996.515) (-1993.819) (-1997.486) [-1991.973] -- 0:01:24
738900 -- (-1986.284) (-1986.189) [-1980.683] (-1991.521) * (-1995.613) (-2001.865) (-1999.215) [-1990.517] -- 0:01:24
739000 -- [-1984.630] (-1990.599) (-1980.067) (-1994.988) * (-1990.723) (-2000.522) (-2000.364) [-1988.876] -- 0:01:24
Average standard deviation of split frequencies: 0.002660
739100 -- (-1987.683) (-1985.848) [-1979.082] (-1985.751) * (-2002.137) (-1996.978) (-1998.040) [-1986.142] -- 0:01:24
739200 -- (-1988.951) (-1989.950) (-1983.222) [-1981.362] * (-1992.066) (-1993.498) (-1994.974) [-1986.475] -- 0:01:25
739300 -- (-1992.582) (-1994.944) (-1986.818) [-1980.176] * [-1987.937] (-1996.547) (-1995.899) (-1989.918) -- 0:01:24
739400 -- (-1991.692) (-1991.909) [-1980.477] (-1980.562) * [-1989.712] (-1990.809) (-1994.583) (-1990.934) -- 0:01:24
739500 -- (-1988.260) (-1989.800) [-1978.813] (-1995.962) * (-1994.112) (-1983.432) (-1991.984) [-1983.833] -- 0:01:24
739600 -- (-1996.340) [-1981.092] (-1977.626) (-1992.554) * (-1989.996) (-1992.058) (-1997.470) [-1986.988] -- 0:01:24
739700 -- (-1996.190) (-1986.762) [-1981.199] (-1988.576) * (-1992.338) [-1987.943] (-1987.568) (-1990.766) -- 0:01:24
739800 -- (-2000.094) [-1987.960] (-1981.466) (-1993.797) * [-1984.451] (-1995.246) (-1986.740) (-2000.404) -- 0:01:24
739900 -- (-1998.780) (-1986.991) (-1987.293) [-1984.239] * [-1987.706] (-1998.028) (-1998.850) (-1993.402) -- 0:01:24
740000 -- (-1995.037) [-1984.422] (-1990.997) (-1979.563) * (-1982.025) (-1994.772) (-1997.868) [-1985.902] -- 0:01:24
Average standard deviation of split frequencies: 0.002639
740100 -- (-1987.417) [-1981.192] (-1985.037) (-1985.594) * [-1977.483] (-1992.110) (-2009.412) (-1993.247) -- 0:01:24
740200 -- (-1989.912) (-1978.595) [-1991.614] (-1995.881) * [-1979.610] (-1985.720) (-1995.853) (-1992.042) -- 0:01:24
740300 -- (-1988.115) (-1985.429) (-1977.925) [-1982.571] * (-1986.464) (-1985.072) (-2014.755) [-1989.482] -- 0:01:24
740400 -- (-1994.191) (-1985.010) [-1978.206] (-1984.258) * (-1982.990) [-1986.934] (-2001.079) (-1993.046) -- 0:01:24
740500 -- (-1984.670) (-1990.614) [-1981.711] (-1986.295) * (-1985.957) [-1991.760] (-1998.035) (-1990.705) -- 0:01:24
740600 -- (-1989.113) (-1990.856) (-1982.769) [-1980.709] * [-1982.687] (-1987.731) (-1999.421) (-1994.586) -- 0:01:24
740700 -- [-1984.095] (-2001.550) (-1986.945) (-1981.315) * [-1988.802] (-1990.445) (-2001.388) (-1991.865) -- 0:01:24
740800 -- (-1985.542) (-1989.735) (-1990.406) [-1982.900] * (-1987.435) (-1992.362) (-2007.816) [-1988.715] -- 0:01:24
740900 -- (-1985.874) (-1995.384) (-1993.671) [-1979.824] * [-1983.808] (-1985.592) (-1997.155) (-2004.494) -- 0:01:24
741000 -- (-1984.404) (-1993.907) (-1986.238) [-1984.812] * [-1980.158] (-1985.002) (-1996.685) (-2006.861) -- 0:01:24
Average standard deviation of split frequencies: 0.002599
741100 -- (-1984.650) (-2006.984) (-1995.778) [-1981.500] * [-1979.286] (-1990.123) (-1999.671) (-2003.339) -- 0:01:24
741200 -- (-1990.264) (-2000.904) [-1989.253] (-1984.012) * (-1985.498) (-1997.363) [-1996.115] (-2004.481) -- 0:01:24
741300 -- (-1990.322) (-1988.691) (-1990.409) [-1982.722] * [-1989.853] (-1995.293) (-2002.899) (-2000.945) -- 0:01:24
741400 -- [-1989.069] (-1989.161) (-1987.019) (-1986.858) * [-1987.214] (-1997.882) (-1997.230) (-2004.972) -- 0:01:24
741500 -- (-1985.082) (-1985.895) (-1991.476) [-1979.258] * [-1983.275] (-1995.285) (-1991.390) (-1993.861) -- 0:01:24
741600 -- (-1985.148) (-1988.184) (-1992.466) [-1976.255] * [-1978.400] (-1997.366) (-1994.736) (-1991.597) -- 0:01:23
741700 -- (-1991.890) (-1991.024) (-1994.340) [-1985.716] * (-1984.580) (-1992.542) (-1999.942) [-1988.916] -- 0:01:23
741800 -- [-1983.832] (-1989.906) (-1997.997) (-1989.899) * [-1986.171] (-1990.838) (-1996.006) (-1989.973) -- 0:01:23
741900 -- (-1985.787) (-1995.682) [-1983.395] (-1986.556) * [-1984.982] (-1991.149) (-1988.232) (-1988.160) -- 0:01:23
742000 -- [-1979.120] (-2001.819) (-1979.057) (-1984.146) * [-1989.352] (-1991.024) (-2001.343) (-1987.034) -- 0:01:23
Average standard deviation of split frequencies: 0.002577
742100 -- (-1980.784) (-1996.552) [-1978.784] (-1984.943) * [-1988.276] (-1992.816) (-2006.898) (-1987.923) -- 0:01:23
742200 -- (-1986.405) (-1989.072) [-1977.977] (-1988.721) * (-1993.366) (-1995.378) (-2002.541) [-1989.300] -- 0:01:24
742300 -- (-1993.354) (-1986.674) [-1978.315] (-1992.342) * [-1987.844] (-1993.386) (-1999.845) (-1988.186) -- 0:01:24
742400 -- (-1996.014) [-1983.526] (-1983.683) (-1992.947) * (-1988.733) (-2003.399) (-2002.989) [-1991.510] -- 0:01:23
742500 -- (-1987.781) [-1983.338] (-1989.951) (-1990.057) * [-1988.881] (-1988.566) (-1995.239) (-1989.830) -- 0:01:23
742600 -- (-1997.130) (-1993.998) [-1988.000] (-1986.943) * [-1983.552] (-1987.856) (-1994.634) (-1996.473) -- 0:01:23
742700 -- (-1996.881) (-1995.163) [-1989.099] (-1986.954) * [-1986.283] (-1990.526) (-2000.829) (-1996.090) -- 0:01:23
742800 -- (-2001.091) (-1998.613) [-1991.116] (-1994.786) * [-1981.087] (-2000.306) (-2008.369) (-1992.517) -- 0:01:23
742900 -- (-2002.237) (-1991.354) [-1985.629] (-1988.777) * [-1985.023] (-1998.991) (-1999.917) (-1995.077) -- 0:01:23
743000 -- (-2017.222) (-1996.944) [-1984.292] (-1987.761) * (-1985.930) (-2000.431) [-1989.583] (-1993.046) -- 0:01:23
Average standard deviation of split frequencies: 0.002537
743100 -- (-2004.651) (-1995.306) [-1987.570] (-1985.446) * (-1988.699) (-1998.778) [-1987.896] (-2003.478) -- 0:01:23
743200 -- (-2003.549) (-1994.940) (-1992.722) [-1982.929] * [-1990.483] (-1999.190) (-1985.132) (-2000.641) -- 0:01:23
743300 -- (-1996.880) (-1999.688) (-1987.792) [-1981.975] * (-1988.656) [-1992.087] (-1988.038) (-1997.731) -- 0:01:23
743400 -- (-1989.273) (-1995.554) (-1985.569) [-1982.041] * (-1986.944) (-1994.850) [-1989.576] (-1991.832) -- 0:01:23
743500 -- (-1997.266) (-1994.140) [-1983.373] (-1988.544) * (-1985.652) (-1994.149) [-1982.259] (-1989.672) -- 0:01:23
743600 -- (-2000.429) (-1993.081) (-1984.912) [-1982.877] * (-1989.690) (-1989.451) [-1982.434] (-1986.490) -- 0:01:23
743700 -- (-1996.603) (-1993.710) (-1987.831) [-1978.435] * (-1989.685) [-1986.807] (-1986.784) (-1993.692) -- 0:01:23
743800 -- (-1993.751) (-1991.694) [-1991.245] (-1990.492) * (-1994.543) (-2004.969) (-1992.935) [-1989.473] -- 0:01:23
743900 -- (-1995.755) (-1988.766) (-1991.387) [-1982.411] * (-1988.375) (-1991.261) (-1992.956) [-1985.460] -- 0:01:23
744000 -- (-1995.151) (-1988.498) (-1994.424) [-1988.329] * (-1989.270) (-1985.247) [-1988.999] (-1997.845) -- 0:01:23
Average standard deviation of split frequencies: 0.002516
744100 -- (-1995.208) (-1987.791) (-1991.201) [-1990.813] * [-1982.967] (-1992.628) (-1987.687) (-1997.056) -- 0:01:23
744200 -- (-1994.692) (-1985.562) [-1987.608] (-1983.407) * (-1983.290) [-1988.363] (-1987.196) (-1990.455) -- 0:01:23
744300 -- (-1993.957) (-1986.067) [-1983.637] (-1982.784) * (-1992.027) [-1987.744] (-1989.369) (-1992.421) -- 0:01:23
744400 -- (-1992.179) (-1990.024) [-1983.833] (-1987.550) * (-1990.108) [-1988.704] (-1989.120) (-2003.246) -- 0:01:23
744500 -- (-1990.003) (-1988.276) [-1984.348] (-1985.025) * [-1986.043] (-1990.689) (-1990.456) (-2009.787) -- 0:01:23
744600 -- (-1986.241) (-1990.023) (-1987.446) [-1983.971] * (-1987.574) (-1992.515) [-1986.218] (-2003.616) -- 0:01:23
744700 -- (-1989.027) (-1990.832) (-1987.675) [-1981.024] * (-1989.406) (-1991.529) (-1988.692) [-1987.843] -- 0:01:22
744800 -- (-1989.676) (-1994.531) (-1990.631) [-1982.397] * [-1991.640] (-1993.388) (-2003.676) (-1985.251) -- 0:01:22
744900 -- (-1989.651) (-1992.002) (-1991.613) [-1984.945] * [-1981.310] (-1994.838) (-2002.824) (-1985.619) -- 0:01:22
745000 -- [-1985.301] (-1994.340) (-1994.994) (-1986.362) * [-1982.559] (-1988.164) (-2014.266) (-1986.298) -- 0:01:22
Average standard deviation of split frequencies: 0.002440
745100 -- [-1987.930] (-1989.183) (-1993.514) (-1987.731) * (-1985.251) (-1987.693) (-1998.517) [-1985.689] -- 0:01:22
745200 -- [-1985.117] (-1992.597) (-1998.101) (-1995.978) * [-1981.539] (-1992.364) (-1993.615) (-1987.733) -- 0:01:23
745300 -- (-1988.911) [-1995.497] (-1990.817) (-1991.542) * [-1984.324] (-1989.405) (-1993.637) (-1990.430) -- 0:01:23
745400 -- (-1990.321) (-1993.718) [-1988.533] (-1983.627) * [-1978.808] (-1988.929) (-1994.836) (-1988.434) -- 0:01:22
745500 -- (-1993.935) (-2002.806) (-1983.792) [-1977.830] * [-1979.737] (-1989.672) (-1994.097) (-1991.639) -- 0:01:22
745600 -- (-1990.764) (-2014.375) (-1983.348) [-1978.660] * [-1979.539] (-1988.320) (-2002.534) (-1986.147) -- 0:01:22
745700 -- (-1992.610) (-1993.116) [-1985.493] (-1980.023) * [-1985.383] (-1991.679) (-1998.072) (-1991.381) -- 0:01:22
745800 -- (-1993.531) (-1993.421) (-1984.599) [-1979.605] * [-1985.070] (-1992.301) (-2004.954) (-1993.768) -- 0:01:22
745900 -- (-1993.717) (-1995.119) [-1983.667] (-1979.251) * (-1986.880) [-1990.574] (-2001.606) (-1998.914) -- 0:01:22
746000 -- (-2005.628) (-1994.586) (-1984.769) [-1983.070] * [-1984.715] (-1999.587) (-1994.474) (-1992.981) -- 0:01:22
Average standard deviation of split frequencies: 0.002365
746100 -- (-1995.210) (-1991.744) (-1989.998) [-1979.486] * [-1986.198] (-1994.470) (-1997.124) (-1994.335) -- 0:01:22
746200 -- [-1987.552] (-1994.076) (-1995.006) (-1984.183) * (-1993.389) (-1994.765) (-2001.157) [-1992.911] -- 0:01:22
746300 -- [-1989.805] (-1993.936) (-1994.037) (-1984.426) * [-1989.681] (-1994.224) (-2005.212) (-1992.522) -- 0:01:22
746400 -- (-1986.426) (-2005.493) (-1993.319) [-1982.697] * (-1991.078) (-1994.445) (-1986.179) [-1988.604] -- 0:01:22
746500 -- (-1994.445) (-1995.528) (-1994.910) [-1985.947] * (-1984.124) [-1991.666] (-1987.495) (-1993.724) -- 0:01:22
746600 -- (-1995.683) (-1994.693) (-1991.440) [-1986.199] * [-1979.381] (-1994.199) (-1987.377) (-1999.230) -- 0:01:22
746700 -- (-1998.490) (-1995.420) [-1984.478] (-1989.745) * [-1982.887] (-1999.822) (-1991.527) (-1999.029) -- 0:01:22
746800 -- (-1996.964) (-1995.759) [-1983.613] (-1995.952) * [-1982.467] (-2005.697) (-1998.970) (-2008.382) -- 0:01:22
746900 -- (-1989.856) (-1993.226) [-1986.231] (-1993.358) * [-1980.903] (-2011.561) (-2001.453) (-2001.731) -- 0:01:22
747000 -- [-1984.986] (-1993.837) (-1992.488) (-1992.885) * [-1981.209] (-1996.072) (-2002.665) (-1992.488) -- 0:01:22
Average standard deviation of split frequencies: 0.002271
747100 -- (-1986.360) (-2001.895) (-1987.907) [-2004.019] * [-1979.638] (-1996.809) (-1999.032) (-2001.641) -- 0:01:22
747200 -- [-1987.827] (-1991.177) (-1985.081) (-1994.845) * [-1981.831] (-1994.769) (-1995.455) (-2002.864) -- 0:01:22
747300 -- [-1989.420] (-1993.168) (-1987.892) (-1997.387) * [-1981.389] (-1996.417) (-2000.166) (-1997.490) -- 0:01:22
747400 -- [-1989.443] (-1999.169) (-1988.306) (-1995.466) * (-1990.875) (-1994.346) [-1985.658] (-1992.007) -- 0:01:22
747500 -- (-1992.950) (-2000.341) [-1989.910] (-1992.229) * (-1988.503) (-1989.868) [-1987.502] (-1992.601) -- 0:01:22
747600 -- (-1996.946) (-2009.075) [-1991.350] (-1990.693) * (-1992.319) (-1988.596) [-1985.348] (-1993.758) -- 0:01:22
747700 -- (-1998.369) (-1998.066) (-1981.158) [-1990.507] * (-1988.290) (-1996.394) (-1999.410) [-1993.173] -- 0:01:21
747800 -- (-1993.986) (-1999.729) (-1985.192) [-1984.505] * [-1984.775] (-1989.243) (-2002.780) (-1991.755) -- 0:01:21
747900 -- (-1997.391) (-1997.045) (-1982.556) [-1987.147] * [-1982.026] (-1990.511) (-1999.194) (-1998.505) -- 0:01:21
748000 -- (-1999.877) (-1991.841) (-1980.004) [-1987.713] * [-1982.228] (-1992.371) (-1992.330) (-1994.332) -- 0:01:21
Average standard deviation of split frequencies: 0.002232
748100 -- (-1991.002) (-2000.823) [-1986.211] (-1993.685) * [-1982.644] (-1998.747) (-1992.844) (-1998.552) -- 0:01:21
748200 -- [-1986.886] (-1993.437) (-1982.559) (-1986.557) * [-1979.904] (-1992.593) (-1992.127) (-2000.797) -- 0:01:22
748300 -- (-1990.271) (-1995.683) [-1978.646] (-1985.717) * [-1984.621] (-1987.760) (-1994.051) (-1995.840) -- 0:01:22
748400 -- (-1995.058) (-1997.199) [-1978.755] (-1992.127) * [-1986.487] (-1986.357) (-1999.535) (-1996.113) -- 0:01:22
748500 -- (-2000.326) (-1994.406) [-1975.523] (-1990.626) * (-1988.341) [-1983.533] (-1991.547) (-1988.226) -- 0:01:21
748600 -- (-1998.215) (-1989.191) [-1978.390] (-1985.446) * [-1988.228] (-1982.712) (-1991.491) (-1997.645) -- 0:01:21
748700 -- (-1994.226) (-1987.893) [-1980.238] (-1989.142) * [-1985.435] (-1981.404) (-1997.407) (-2001.814) -- 0:01:21
748800 -- (-1991.665) (-1989.943) (-1982.452) [-1989.168] * [-1983.300] (-1987.900) (-1991.377) (-1995.954) -- 0:01:21
748900 -- (-1995.381) (-1987.055) [-1985.081] (-1993.860) * [-1981.716] (-1992.876) (-1987.752) (-1994.436) -- 0:01:21
749000 -- (-1990.521) (-1989.822) (-1990.557) [-1988.849] * [-1979.209] (-1992.517) (-1993.058) (-1998.153) -- 0:01:21
Average standard deviation of split frequencies: 0.002157
749100 -- (-1989.431) [-1988.399] (-1989.176) (-1996.316) * [-1988.542] (-1985.893) (-1999.051) (-2000.502) -- 0:01:21
749200 -- (-1990.017) (-1989.600) (-1997.481) [-1987.967] * [-1980.664] (-1990.724) (-2001.104) (-1988.371) -- 0:01:21
749300 -- [-1988.511] (-1989.208) (-1995.936) (-1998.880) * (-1984.647) [-1986.626] (-1991.521) (-1984.461) -- 0:01:21
749400 -- (-2001.883) [-1977.595] (-1992.305) (-1989.210) * (-1991.982) [-1979.126] (-1995.197) (-1986.203) -- 0:01:21
749500 -- (-1992.911) (-1981.314) [-1981.208] (-1992.905) * (-1993.205) (-1982.951) (-1998.385) [-1988.414] -- 0:01:21
749600 -- (-1997.177) [-1983.915] (-1981.546) (-1985.815) * (-1992.777) [-1988.893] (-1991.443) (-1988.999) -- 0:01:21
749700 -- (-2003.799) (-1978.711) [-1986.030] (-1982.760) * (-1984.115) [-1983.005] (-2000.978) (-1990.854) -- 0:01:21
749800 -- (-2003.226) [-1985.804] (-1982.975) (-1986.169) * (-1991.204) (-1987.699) (-1994.778) [-1989.446] -- 0:01:21
749900 -- (-2005.922) (-1992.420) [-1981.498] (-1991.383) * (-1991.608) [-1987.987] (-1993.147) (-1993.080) -- 0:01:21
750000 -- (-2001.751) [-1984.962] (-1979.459) (-1985.819) * (-1987.515) [-1982.522] (-1990.770) (-1996.226) -- 0:01:21
Average standard deviation of split frequencies: 0.002137
750100 -- (-1996.881) (-1985.736) [-1979.736] (-1996.589) * (-1985.433) [-1985.507] (-1987.202) (-1987.661) -- 0:01:21
750200 -- (-2001.503) [-1985.714] (-1984.581) (-1992.647) * [-1986.601] (-1989.943) (-1994.207) (-1992.922) -- 0:01:21
750300 -- (-2002.592) [-1988.563] (-1986.283) (-1991.861) * [-1987.940] (-1987.159) (-1989.858) (-2000.061) -- 0:01:21
750400 -- (-2006.834) (-1990.321) (-1986.557) [-1987.087] * (-1987.591) [-1984.643] (-1995.734) (-2011.505) -- 0:01:21
750500 -- (-2010.796) [-1983.687] (-1984.972) (-1984.576) * (-1987.692) [-1981.650] (-1999.258) (-2010.496) -- 0:01:21
750600 -- (-2012.099) (-1981.510) (-1987.637) [-1985.576] * (-1986.723) [-1982.249] (-2000.092) (-2005.933) -- 0:01:21
750700 -- (-2012.114) [-1982.433] (-1986.651) (-1982.409) * [-1986.771] (-1982.339) (-2000.879) (-2003.952) -- 0:01:21
750800 -- (-2011.379) (-1988.054) [-1986.522] (-1986.874) * (-1983.958) (-1989.017) (-1992.564) [-1990.728] -- 0:01:20
750900 -- (-2004.492) [-1980.986] (-1986.792) (-1989.177) * [-1984.434] (-1984.263) (-1991.370) (-1990.430) -- 0:01:20
751000 -- (-1998.017) (-1984.515) [-1988.261] (-1982.482) * (-1995.175) [-1982.181] (-1986.478) (-1994.037) -- 0:01:20
Average standard deviation of split frequencies: 0.002098
751100 -- (-2006.002) (-1987.718) (-2000.814) [-1980.744] * (-1987.627) (-1988.178) [-1987.359] (-1999.493) -- 0:01:20
751200 -- (-1995.665) (-1988.783) (-1991.344) [-1979.616] * [-1985.241] (-1984.175) (-1988.457) (-1994.174) -- 0:01:21
751300 -- (-1994.442) [-1976.573] (-1987.312) (-1983.547) * (-1985.956) [-1981.921] (-1986.793) (-1991.675) -- 0:01:21
751400 -- (-2007.538) [-1977.122] (-1987.709) (-1986.071) * (-1994.295) [-1977.198] (-1995.176) (-2003.774) -- 0:01:21
751500 -- (-2007.596) [-1974.952] (-2007.831) (-1989.843) * (-1989.463) [-1981.715] (-1997.735) (-2013.244) -- 0:01:21
751600 -- (-1999.415) [-1979.899] (-1999.228) (-1988.429) * (-1990.855) [-1980.439] (-1996.158) (-2011.583) -- 0:01:20
751700 -- (-2000.864) [-1979.787] (-1991.210) (-1986.521) * [-1988.314] (-1985.745) (-1995.079) (-2016.147) -- 0:01:20
751800 -- (-1995.952) [-1983.126] (-1989.869) (-1987.381) * (-1987.218) (-1987.570) [-1985.986] (-2010.935) -- 0:01:20
751900 -- (-1993.026) [-1980.455] (-1994.289) (-1994.329) * (-1991.769) (-1989.020) [-1983.565] (-2011.531) -- 0:01:20
752000 -- [-1995.202] (-1985.566) (-2000.650) (-1994.214) * (-1987.058) (-1982.662) [-1978.114] (-2006.302) -- 0:01:20
Average standard deviation of split frequencies: 0.002113
752100 -- (-1996.110) [-1982.827] (-1998.076) (-1988.070) * (-1988.048) (-1994.645) [-1985.083] (-2004.512) -- 0:01:20
752200 -- (-1999.700) [-1980.502] (-1996.835) (-1995.909) * (-1999.862) (-1994.952) [-1983.191] (-1999.631) -- 0:01:20
752300 -- (-1992.448) (-1983.598) (-1993.786) [-1989.013] * (-2007.608) (-1994.000) [-1984.205] (-2001.761) -- 0:01:20
752400 -- (-1991.132) [-1987.088] (-1994.834) (-1993.871) * (-1998.674) (-2005.694) [-1981.898] (-2004.356) -- 0:01:20
752500 -- (-1994.442) [-1978.636] (-1997.398) (-1987.088) * (-2004.568) (-1997.337) [-1979.916] (-2000.829) -- 0:01:20
752600 -- (-1997.673) [-1980.308] (-1995.383) (-1988.435) * (-2000.657) [-1990.286] (-2002.240) (-1991.718) -- 0:01:20
752700 -- (-1995.389) [-1979.034] (-1998.427) (-1987.878) * (-1990.972) [-1985.241] (-1987.106) (-1992.342) -- 0:01:20
752800 -- (-2005.269) [-1979.597] (-2006.058) (-1993.446) * (-1989.579) (-1985.693) [-1986.458] (-1993.330) -- 0:01:20
752900 -- (-1998.992) (-1983.340) (-2001.666) [-1994.362] * (-1987.533) [-1985.824] (-1992.216) (-2007.309) -- 0:01:20
753000 -- (-1992.250) (-1989.524) (-1994.534) [-1988.349] * [-1985.579] (-1985.316) (-1986.182) (-1998.965) -- 0:01:20
Average standard deviation of split frequencies: 0.002110
753100 -- (-1992.594) (-1993.651) [-1991.610] (-1988.195) * (-1987.656) (-1980.566) [-1979.756] (-1984.203) -- 0:01:20
753200 -- (-1998.339) (-1988.803) (-1992.625) [-1990.534] * (-1998.025) (-1983.597) (-1980.780) [-1982.855] -- 0:01:20
753300 -- [-1999.053] (-1993.729) (-1990.042) (-1987.633) * (-1993.049) (-1978.676) [-1986.376] (-1992.025) -- 0:01:20
753400 -- (-1997.399) (-1996.807) (-1991.751) [-1985.395] * (-1987.792) (-1989.858) (-1983.395) [-1990.583] -- 0:01:20
753500 -- (-1996.712) (-2002.938) (-1995.867) [-1986.159] * (-1989.968) (-1985.399) [-1978.848] (-1998.547) -- 0:01:20
753600 -- (-1997.513) (-2005.453) [-1990.494] (-1986.496) * (-1986.060) [-1984.551] (-1991.052) (-1992.759) -- 0:01:20
753700 -- (-1997.932) (-1998.744) [-1985.375] (-1992.855) * (-1988.860) [-1987.230] (-1980.890) (-1998.916) -- 0:01:20
753800 -- (-2008.010) (-1993.884) (-1983.302) [-1989.907] * (-1994.363) [-1983.748] (-1987.198) (-1999.148) -- 0:01:20
753900 -- (-1995.641) (-1988.587) [-1985.556] (-1993.226) * (-1994.853) [-1982.694] (-1986.802) (-2003.859) -- 0:01:19
754000 -- (-1997.797) (-2002.028) [-1985.302] (-1990.339) * (-1983.899) [-1983.531] (-1987.746) (-1998.758) -- 0:01:19
Average standard deviation of split frequencies: 0.002143
754100 -- (-2000.610) (-1992.338) [-1987.286] (-1999.171) * (-1989.697) (-1989.563) [-1994.984] (-1997.170) -- 0:01:19
754200 -- (-1996.441) [-1991.935] (-1988.114) (-1991.280) * [-1992.855] (-1988.311) (-1987.567) (-1996.694) -- 0:01:20
754300 -- (-1996.032) [-1993.094] (-1994.018) (-1989.852) * (-1992.728) (-1993.182) [-1984.377] (-1995.040) -- 0:01:20
754400 -- [-1986.842] (-1995.124) (-1987.454) (-1988.798) * (-2009.246) [-1981.071] (-1991.068) (-1991.063) -- 0:01:20
754500 -- [-1984.902] (-1992.438) (-1992.428) (-1994.150) * (-2011.438) (-1985.371) [-1982.702] (-1991.923) -- 0:01:20
754600 -- (-1987.075) (-1992.493) (-1993.887) [-1986.628] * (-2003.571) (-1988.330) [-1981.559] (-1994.161) -- 0:01:20
754700 -- [-1985.682] (-2001.118) (-1994.886) (-1988.714) * (-1996.642) (-1981.764) (-1978.716) [-1997.209] -- 0:01:19
754800 -- (-1990.550) (-1996.288) (-1997.639) [-1986.808] * (-1996.505) [-1979.917] (-1985.029) (-2002.046) -- 0:01:19
754900 -- [-1987.041] (-1992.967) (-1994.741) (-1991.939) * (-1986.847) [-1983.134] (-1986.230) (-1993.904) -- 0:01:19
755000 -- (-1996.497) (-1990.768) (-1997.791) [-1985.412] * (-1997.242) [-1982.392] (-1979.765) (-1991.560) -- 0:01:19
Average standard deviation of split frequencies: 0.002087
755100 -- [-1995.265] (-2005.506) (-1992.050) (-1985.684) * (-2000.489) [-1978.475] (-1983.428) (-1992.867) -- 0:01:19
755200 -- (-2000.197) (-2000.595) (-1989.428) [-1983.846] * (-1996.884) [-1981.981] (-1986.378) (-1989.008) -- 0:01:19
755300 -- (-1995.397) (-1996.983) (-1990.010) [-1982.316] * (-2001.177) [-1983.453] (-1987.230) (-1988.470) -- 0:01:19
755400 -- (-1993.785) (-1991.233) [-1989.078] (-1978.574) * (-2003.695) [-1981.747] (-1993.263) (-1993.779) -- 0:01:19
755500 -- (-1991.866) (-1990.780) (-1995.548) [-1981.702] * (-1993.430) [-1978.617] (-1981.905) (-1995.652) -- 0:01:19
755600 -- (-1998.502) (-1991.656) (-1996.853) [-1989.579] * (-1992.183) (-1983.129) [-1981.688] (-1992.063) -- 0:01:19
755700 -- (-1995.673) (-1991.983) [-1994.359] (-1990.969) * (-1992.750) (-1987.746) [-1979.927] (-1992.737) -- 0:01:19
755800 -- (-1996.469) (-1992.668) (-1995.167) [-1988.070] * (-1996.262) (-1984.877) [-1977.199] (-1989.384) -- 0:01:19
755900 -- (-1997.606) (-1997.203) (-1995.960) [-1984.866] * (-1991.404) (-1990.851) [-1978.075] (-1994.928) -- 0:01:19
756000 -- (-1995.680) (-1998.561) (-1997.211) [-1991.374] * (-1990.908) [-1981.698] (-1982.652) (-2004.335) -- 0:01:19
Average standard deviation of split frequencies: 0.002031
756100 -- (-2003.913) (-2001.220) [-1994.562] (-1989.489) * (-1992.038) [-1983.970] (-1984.688) (-2001.226) -- 0:01:19
756200 -- (-1997.036) (-2016.225) [-1985.734] (-1983.229) * (-2001.235) [-1986.410] (-1984.057) (-2001.376) -- 0:01:19
756300 -- (-1999.595) (-2002.988) (-1992.267) [-1980.050] * (-1995.618) [-1992.637] (-1985.221) (-1996.891) -- 0:01:19
756400 -- (-1996.796) (-1996.269) (-1990.944) [-1978.998] * (-1995.028) [-1990.040] (-1988.003) (-1998.827) -- 0:01:19
756500 -- (-1998.713) (-2004.347) (-1992.591) [-1979.942] * (-1997.755) [-1991.046] (-1994.173) (-1999.767) -- 0:01:19
756600 -- (-1998.717) (-2005.702) (-1999.873) [-1981.914] * (-1996.566) (-1986.249) [-1982.012] (-1998.286) -- 0:01:19
756700 -- (-1993.699) (-2002.353) (-1992.332) [-1981.774] * (-1995.308) (-1989.840) [-1986.870] (-2002.891) -- 0:01:19
756800 -- (-2000.646) [-1999.960] (-1996.554) (-1982.955) * (-1992.372) (-1989.608) [-1984.142] (-2001.409) -- 0:01:19
756900 -- (-2001.609) (-2008.042) (-2001.729) [-1980.011] * (-1990.889) [-1989.470] (-1984.826) (-2008.372) -- 0:01:19
757000 -- (-1998.066) (-2013.692) (-1993.909) [-1981.006] * (-1997.248) [-1987.092] (-1986.754) (-2004.114) -- 0:01:18
Average standard deviation of split frequencies: 0.002028
757100 -- (-1996.173) (-2014.591) (-1993.685) [-1988.037] * (-1994.220) (-1988.811) [-1989.111] (-1994.421) -- 0:01:19
757200 -- (-1996.801) (-1993.347) (-1994.901) [-1985.918] * (-1999.038) [-1990.496] (-1986.761) (-1993.842) -- 0:01:19
757300 -- (-1997.472) [-1990.003] (-1996.915) (-1989.031) * (-1992.016) (-1992.272) (-1991.492) [-1991.056] -- 0:01:19
757400 -- (-2000.739) (-1987.720) [-1991.309] (-1989.155) * (-1995.577) [-1996.394] (-1990.606) (-1992.409) -- 0:01:19
757500 -- (-1990.191) (-1991.272) (-1991.154) [-1987.554] * (-1992.495) (-2007.319) [-1986.652] (-1994.336) -- 0:01:19
757600 -- (-1992.277) [-1989.453] (-1996.006) (-1989.284) * (-1990.438) (-1990.179) [-1985.751] (-1992.827) -- 0:01:19
757700 -- (-1993.471) (-1992.214) (-2000.260) [-1985.914] * (-2001.710) (-1986.615) [-1981.040] (-1996.010) -- 0:01:18
757800 -- (-2002.842) (-1996.254) (-1995.935) [-1985.587] * (-2003.555) (-1990.611) [-1982.091] (-1995.355) -- 0:01:18
757900 -- (-2001.135) [-1994.940] (-1995.411) (-1988.475) * (-2001.236) (-1990.802) [-1980.754] (-2005.602) -- 0:01:18
758000 -- (-2004.788) (-2000.327) (-2001.913) [-1981.429] * (-2003.114) (-1989.444) [-1982.877] (-1998.081) -- 0:01:18
Average standard deviation of split frequencies: 0.001972
758100 -- (-1998.607) (-1993.159) (-1994.879) [-1980.835] * (-1998.621) (-1990.725) [-1981.203] (-2007.308) -- 0:01:18
758200 -- (-1995.211) (-1993.228) (-1996.004) [-1983.050] * (-2004.614) (-1997.507) [-1981.334] (-1996.777) -- 0:01:18
758300 -- (-1994.027) (-1987.426) (-2000.188) [-1980.446] * (-2001.730) (-1992.882) [-1982.300] (-2004.808) -- 0:01:18
758400 -- (-1995.934) (-1989.892) (-1991.879) [-1983.495] * (-1993.789) (-1997.131) [-1979.699] (-1996.891) -- 0:01:18
758500 -- (-1995.720) (-1995.640) (-2007.456) [-1983.991] * (-1992.742) (-1992.713) [-1981.710] (-1997.733) -- 0:01:18
758600 -- (-1994.586) (-1995.647) (-1994.191) [-1980.947] * (-1993.802) (-1987.477) [-1982.329] (-1988.029) -- 0:01:18
758700 -- (-1998.869) (-1994.771) (-1998.107) [-1979.022] * [-1990.513] (-1988.349) (-1988.431) (-1993.905) -- 0:01:18
758800 -- (-2009.631) (-1987.813) (-2001.862) [-1980.403] * (-1986.536) (-1988.654) [-1983.959] (-1993.431) -- 0:01:18
758900 -- (-2000.526) (-1989.356) (-2014.999) [-1985.782] * (-1986.284) (-1983.782) [-1982.735] (-1995.973) -- 0:01:18
759000 -- [-1996.969] (-1988.043) (-2013.744) (-1986.841) * (-1993.100) (-1981.917) [-1978.856] (-1995.924) -- 0:01:18
Average standard deviation of split frequencies: 0.001863
759100 -- (-1992.622) [-1984.783] (-2000.590) (-1982.033) * (-1992.724) [-1977.712] (-1980.970) (-1987.891) -- 0:01:18
759200 -- [-1989.474] (-1989.974) (-1999.402) (-1978.744) * (-2000.943) (-1983.478) [-1985.529] (-1988.585) -- 0:01:18
759300 -- (-1985.796) (-1986.896) (-1995.026) [-1982.445] * (-2004.616) (-1983.727) [-1983.401] (-1985.256) -- 0:01:18
759400 -- (-1988.881) (-1989.648) (-2003.767) [-1981.997] * (-2006.505) (-1985.009) [-1984.210] (-1984.280) -- 0:01:18
759500 -- (-1985.793) (-1995.102) (-2005.814) [-1981.736] * (-1999.983) (-1981.515) (-1994.718) [-1985.500] -- 0:01:18
759600 -- (-1990.897) (-1993.255) (-2001.559) [-1980.573] * (-2002.882) [-1979.730] (-1997.349) (-1985.539) -- 0:01:18
759700 -- (-1993.040) (-1993.347) (-2000.774) [-1981.806] * (-1998.456) (-1983.435) (-1994.806) [-1994.271] -- 0:01:18
759800 -- (-1983.842) (-1995.579) (-2005.713) [-1983.492] * (-1998.881) [-1987.899] (-1996.541) (-1997.206) -- 0:01:18
759900 -- [-1986.307] (-1994.926) (-2001.767) (-1984.836) * (-2000.339) [-1987.883] (-1993.771) (-1990.508) -- 0:01:18
760000 -- (-1987.172) (-1989.658) (-2005.240) [-1984.836] * (-1998.761) [-1984.246] (-2009.448) (-1995.923) -- 0:01:18
Average standard deviation of split frequencies: 0.001843
760100 -- [-1986.858] (-1994.114) (-2000.882) (-1989.675) * [-1994.835] (-1981.414) (-2000.475) (-1995.776) -- 0:01:18
760200 -- (-1992.001) (-1992.027) (-1995.765) [-1986.103] * (-1998.578) [-1985.215] (-1998.577) (-1991.066) -- 0:01:18
760300 -- (-1992.942) (-1991.711) (-1998.624) [-1983.972] * (-2001.562) (-1988.209) (-1994.008) [-1986.923] -- 0:01:18
760400 -- (-1995.604) (-1987.581) (-1995.353) [-1985.831] * (-2003.334) (-1987.525) [-1991.907] (-1984.358) -- 0:01:18
760500 -- (-1991.145) [-1989.446] (-1994.199) (-1987.937) * (-1999.315) (-1981.341) (-1992.384) [-1985.639] -- 0:01:18
760600 -- (-1995.400) (-1988.252) (-1993.802) [-1984.188] * (-1993.170) [-1993.299] (-1982.656) (-1986.840) -- 0:01:18
760700 -- (-1993.230) (-1990.293) (-1999.382) [-1981.677] * (-1993.528) (-1986.522) [-1984.126] (-1984.075) -- 0:01:18
760800 -- (-1993.437) (-1993.818) (-1994.331) [-1981.467] * (-1991.594) [-1986.549] (-1987.884) (-1986.325) -- 0:01:17
760900 -- (-1991.813) (-1989.861) (-2002.444) [-1982.699] * (-1993.011) (-1996.877) (-1986.393) [-1988.282] -- 0:01:17
761000 -- (-2002.187) (-1991.404) (-1998.924) [-1983.095] * (-1992.555) (-1993.299) [-1981.046] (-1991.407) -- 0:01:17
Average standard deviation of split frequencies: 0.001858
761100 -- (-1988.480) [-1989.179] (-1997.603) (-1991.303) * (-1987.735) (-2004.290) [-1980.909] (-1989.035) -- 0:01:17
761200 -- (-1991.138) [-1989.457] (-1997.076) (-1997.799) * (-1991.553) (-1996.198) [-1979.936] (-1984.409) -- 0:01:17
761300 -- (-1996.320) [-1982.442] (-1994.041) (-1994.122) * (-1993.976) (-1995.377) [-1983.677] (-1990.654) -- 0:01:17
761400 -- (-1993.295) [-1981.756] (-1993.261) (-1990.321) * (-1991.757) (-2003.586) [-1978.700] (-1992.988) -- 0:01:17
761500 -- (-1989.535) [-1981.792] (-1992.677) (-1986.901) * (-1990.826) (-2005.963) [-1980.161] (-1992.509) -- 0:01:17
761600 -- (-1994.321) [-1985.559] (-1995.837) (-2001.218) * (-1993.376) (-1995.787) [-1981.006] (-1992.277) -- 0:01:17
761700 -- (-1989.552) [-1986.303] (-1999.464) (-1998.025) * (-1999.255) (-1994.677) [-1981.656] (-1995.780) -- 0:01:17
761800 -- [-1991.671] (-1986.523) (-2003.742) (-1988.804) * (-1999.229) (-1993.207) [-1975.805] (-1995.770) -- 0:01:17
761900 -- (-1998.452) (-1982.621) (-1999.204) [-1989.652] * (-2005.517) (-1994.013) [-1981.150] (-1992.579) -- 0:01:17
762000 -- (-2004.024) [-1978.833] (-2004.780) (-1986.513) * (-1997.825) (-1996.707) [-1980.401] (-1990.754) -- 0:01:17
Average standard deviation of split frequencies: 0.001926
762100 -- (-1996.338) [-1981.993] (-1996.054) (-1989.942) * (-1998.273) [-1984.624] (-1981.311) (-1996.122) -- 0:01:17
762200 -- (-1998.838) (-1981.799) (-1999.845) [-1986.490] * (-2007.515) [-1979.822] (-1982.434) (-1996.647) -- 0:01:17
762300 -- (-2004.487) [-1978.518] (-1994.190) (-1990.621) * (-1999.478) (-1983.411) [-1985.732] (-1999.033) -- 0:01:17
762400 -- (-1996.505) (-1978.392) [-1986.793] (-1995.726) * (-1994.133) [-1985.542] (-1988.693) (-1996.772) -- 0:01:17
762500 -- (-1992.682) [-1979.050] (-1985.201) (-2007.453) * (-1996.272) [-1984.210] (-1988.248) (-1995.074) -- 0:01:17
762600 -- (-1993.113) [-1984.159] (-1986.323) (-2014.781) * (-1990.311) (-1993.626) [-1982.570] (-1998.791) -- 0:01:17
762700 -- [-1988.207] (-1985.868) (-1987.085) (-1996.112) * (-1998.396) (-1986.892) [-1983.010] (-1997.325) -- 0:01:17
762800 -- (-1989.297) [-1978.877] (-1994.970) (-2000.168) * (-1992.110) (-1991.804) [-1986.202] (-1999.391) -- 0:01:17
762900 -- [-1991.630] (-1983.676) (-1989.715) (-1994.416) * (-1994.307) (-1996.874) [-1979.964] (-2004.875) -- 0:01:17
763000 -- [-1989.179] (-1976.627) (-1989.884) (-1996.701) * [-1987.744] (-1990.408) (-1984.807) (-1999.418) -- 0:01:17
Average standard deviation of split frequencies: 0.002047
763100 -- (-1983.876) [-1977.248] (-1986.234) (-2000.016) * [-1987.906] (-1989.374) (-1983.792) (-2005.759) -- 0:01:17
763200 -- (-1989.018) [-1977.084] (-1985.644) (-1989.466) * (-1984.931) (-1985.628) [-1985.045] (-2005.406) -- 0:01:17
763300 -- (-1989.325) (-1982.126) [-1984.842] (-1997.695) * (-1995.382) (-1984.352) [-1982.434] (-1998.005) -- 0:01:17
763400 -- [-1990.643] (-1979.293) (-1986.923) (-1996.652) * (-1992.684) (-1992.014) [-1978.574] (-1996.963) -- 0:01:17
763500 -- (-2004.665) (-1982.718) (-1986.637) [-1994.396] * (-1998.209) (-1984.230) [-1979.751] (-2005.754) -- 0:01:17
763600 -- (-2000.362) [-1978.493] (-1991.560) (-1993.200) * (-2006.394) (-1984.920) [-1985.308] (-1992.256) -- 0:01:17
763700 -- (-1996.868) [-1976.094] (-1986.053) (-2000.787) * (-1999.049) [-1982.069] (-1992.632) (-1994.096) -- 0:01:17
763800 -- (-1998.826) (-1977.546) [-1989.223] (-1993.644) * (-1991.489) [-1988.144] (-1988.835) (-1998.263) -- 0:01:17
763900 -- (-1998.088) [-1979.181] (-1988.470) (-2005.444) * (-1995.349) [-1992.391] (-1991.680) (-2000.149) -- 0:01:16
764000 -- (-2007.390) [-1976.815] (-1986.641) (-1993.874) * (-1996.105) (-1991.077) [-1991.647] (-1999.912) -- 0:01:16
Average standard deviation of split frequencies: 0.001974
764100 -- (-2007.847) (-1981.084) [-1984.876] (-1996.573) * (-1996.877) [-1988.909] (-1985.810) (-1991.153) -- 0:01:16
764200 -- (-2000.933) (-1978.132) [-1982.371] (-1991.948) * (-1997.127) (-1980.351) [-1985.538] (-1996.337) -- 0:01:16
764300 -- (-2000.971) [-1981.925] (-1983.415) (-1992.038) * (-1996.357) [-1981.732] (-1983.439) (-1996.795) -- 0:01:16
764400 -- (-2001.270) [-1983.432] (-1985.227) (-1991.607) * (-1997.571) [-1984.441] (-1991.597) (-1991.248) -- 0:01:16
764500 -- (-1991.827) [-1984.411] (-1986.108) (-2001.695) * (-2001.429) [-1979.499] (-1998.593) (-1987.846) -- 0:01:16
764600 -- (-1995.177) [-1989.485] (-1987.425) (-1996.811) * (-2002.370) [-1978.101] (-1989.954) (-1995.743) -- 0:01:16
764700 -- (-1999.518) (-1994.667) [-1983.766] (-1995.378) * (-1996.046) [-1984.740] (-1994.375) (-1994.035) -- 0:01:16
764800 -- (-2009.729) [-1984.648] (-1989.861) (-2000.399) * (-1995.161) [-1981.717] (-1999.112) (-1990.528) -- 0:01:16
764900 -- (-2000.357) (-1984.604) (-1989.313) [-1997.034] * (-1995.479) [-1980.790] (-1991.957) (-1993.309) -- 0:01:16
765000 -- [-1994.712] (-1981.249) (-1991.575) (-2004.725) * (-2009.193) (-1980.035) (-1986.029) [-1986.090] -- 0:01:16
Average standard deviation of split frequencies: 0.002042
765100 -- (-1996.800) [-1985.196] (-1995.134) (-1994.160) * (-2009.629) (-1978.503) [-1979.985] (-1988.724) -- 0:01:16
765200 -- (-2001.389) [-1980.541] (-1993.499) (-1997.637) * (-2003.840) [-1977.764] (-1982.180) (-1992.059) -- 0:01:16
765300 -- (-1997.944) [-1982.261] (-1992.472) (-1992.787) * (-1998.549) [-1984.088] (-1982.002) (-1993.055) -- 0:01:16
765400 -- (-1996.621) [-1981.299] (-1998.135) (-1989.527) * (-2003.405) (-1982.049) [-1980.383] (-1996.619) -- 0:01:16
765500 -- (-2002.346) [-1978.713] (-1990.697) (-1999.909) * (-2004.132) (-1989.266) [-1984.447] (-1996.679) -- 0:01:16
765600 -- (-2001.537) [-1979.819] (-1993.899) (-2000.244) * (-2001.378) (-1991.352) (-1981.547) [-1991.267] -- 0:01:16
765700 -- (-1997.315) [-1977.895] (-2003.308) (-1997.147) * (-2005.013) (-1980.105) [-1984.156] (-1989.299) -- 0:01:16
765800 -- (-1996.510) [-1987.919] (-2007.389) (-1997.793) * (-1995.187) [-1983.802] (-1994.248) (-1991.466) -- 0:01:16
765900 -- (-1993.587) [-1981.912] (-2000.016) (-1994.399) * [-1992.404] (-1987.371) (-1983.151) (-1993.370) -- 0:01:16
766000 -- (-1991.951) [-1977.373] (-1997.981) (-1992.976) * (-1994.007) (-1986.754) [-1979.659] (-1995.937) -- 0:01:16
Average standard deviation of split frequencies: 0.002039
766100 -- (-1986.662) [-1982.465] (-1994.269) (-1994.824) * (-1994.131) (-1982.618) [-1979.589] (-1989.603) -- 0:01:16
766200 -- (-1990.456) [-1983.342] (-2003.275) (-1991.284) * (-1992.395) [-1980.091] (-1979.637) (-1987.246) -- 0:01:16
766300 -- (-1986.092) [-1978.442] (-2001.544) (-1984.375) * (-1994.000) [-1985.471] (-1983.004) (-1988.387) -- 0:01:16
766400 -- [-1989.429] (-1982.762) (-2008.958) (-1997.041) * (-1987.909) (-1987.036) [-1981.740] (-1991.045) -- 0:01:16
766500 -- (-1989.778) [-1980.953] (-1995.522) (-1992.642) * (-1991.433) [-1992.355] (-1977.795) (-1993.198) -- 0:01:16
766600 -- (-1987.561) [-1981.347] (-1994.647) (-1992.131) * (-2002.838) [-1988.476] (-1987.383) (-1989.782) -- 0:01:16
766700 -- (-1991.595) [-1982.615] (-1996.979) (-1989.857) * (-1996.817) [-1987.619] (-1985.307) (-1986.743) -- 0:01:16
766800 -- (-1999.559) [-1983.921] (-1995.806) (-1985.063) * (-2003.254) [-1982.518] (-1981.820) (-1989.606) -- 0:01:16
766900 -- (-1992.865) [-1983.319] (-2011.648) (-1989.601) * (-1997.789) (-1984.938) [-1984.549] (-1988.139) -- 0:01:15
767000 -- (-1992.569) (-1982.829) (-2018.017) [-1992.111] * (-2000.560) (-1982.212) [-1990.776] (-1991.035) -- 0:01:15
Average standard deviation of split frequencies: 0.002142
767100 -- (-2002.678) [-1984.270] (-2014.738) (-1988.968) * (-1997.626) [-1978.879] (-1992.001) (-1992.982) -- 0:01:15
767200 -- (-2001.621) [-1985.093] (-2000.293) (-1991.430) * (-2003.037) [-1979.675] (-1989.857) (-1991.066) -- 0:01:15
767300 -- (-2000.847) (-1994.839) (-2006.370) [-1996.392] * (-1990.225) [-1985.885] (-1986.261) (-1989.886) -- 0:01:15
767400 -- (-1993.867) [-1985.799] (-1990.401) (-1995.709) * (-2001.171) (-1991.472) (-1985.364) [-1986.549] -- 0:01:15
767500 -- (-1994.644) [-1990.434] (-1998.423) (-1994.654) * (-1999.728) (-1989.835) (-1991.384) [-1984.528] -- 0:01:15
767600 -- [-1989.497] (-1984.908) (-1999.307) (-1997.899) * [-1990.910] (-1989.789) (-1995.180) (-1986.139) -- 0:01:15
767700 -- (-1994.314) [-1979.594] (-1996.343) (-1993.897) * (-1984.842) [-1984.375] (-1999.476) (-1988.918) -- 0:01:15
767800 -- (-1990.260) [-1980.588] (-2002.658) (-1998.305) * (-1987.552) [-1985.770] (-2002.247) (-1987.637) -- 0:01:15
767900 -- (-1986.204) [-1979.350] (-1992.663) (-1996.428) * (-1989.318) (-1989.227) (-2000.882) [-1988.377] -- 0:01:15
768000 -- (-1993.333) [-1978.541] (-1996.607) (-2001.033) * (-1992.067) [-1985.624] (-1997.724) (-1998.142) -- 0:01:15
Average standard deviation of split frequencies: 0.002122
768100 -- (-1988.482) [-1978.131] (-2003.679) (-1999.543) * (-1993.213) [-1987.081] (-2015.441) (-2003.104) -- 0:01:15
768200 -- (-1993.079) [-1978.442] (-2004.384) (-2000.374) * (-1999.028) [-1984.651] (-1994.165) (-2005.028) -- 0:01:15
768300 -- (-1990.482) [-1980.154] (-2006.938) (-1996.843) * (-2002.540) [-1982.270] (-1996.651) (-1999.568) -- 0:01:15
768400 -- (-1993.604) (-1985.841) (-2008.363) [-1990.238] * (-1987.636) [-1983.425] (-1990.062) (-1997.678) -- 0:01:15
768500 -- (-1994.902) [-1978.473] (-2005.578) (-1994.920) * (-1997.981) [-1985.041] (-1988.703) (-1994.335) -- 0:01:15
768600 -- (-1990.714) [-1981.457] (-2003.622) (-1989.564) * (-1998.787) [-1981.383] (-1990.475) (-1988.338) -- 0:01:15
768700 -- (-1990.825) [-1979.329] (-1990.452) (-1996.068) * (-2000.946) [-1984.196] (-1993.043) (-1987.881) -- 0:01:15
768800 -- (-1985.698) [-1976.641] (-1994.839) (-1995.625) * (-1997.700) [-1982.793] (-1993.676) (-1990.610) -- 0:01:15
768900 -- (-1984.265) [-1981.660] (-2000.715) (-1999.751) * (-1992.947) [-1988.685] (-1994.526) (-1985.495) -- 0:01:15
769000 -- (-1985.209) [-1980.134] (-2001.639) (-1996.176) * [-1989.106] (-1984.787) (-1997.819) (-1998.487) -- 0:01:15
Average standard deviation of split frequencies: 0.002049
769100 -- (-1983.697) [-1980.479] (-1994.382) (-1995.074) * (-1990.782) (-1987.166) (-1997.228) [-1989.701] -- 0:01:15
769200 -- (-1986.517) [-1980.998] (-1996.087) (-1988.057) * [-1990.586] (-1990.195) (-1995.941) (-1990.061) -- 0:01:15
769300 -- (-1983.094) [-1981.684] (-1993.718) (-1989.980) * (-1994.896) [-1983.567] (-1992.037) (-1987.173) -- 0:01:15
769400 -- (-1984.921) (-1993.307) (-1991.220) [-1985.470] * (-2000.736) [-1989.928] (-1992.989) (-2008.263) -- 0:01:15
769500 -- (-1985.553) [-1983.455] (-1994.325) (-1988.685) * (-1999.844) (-1985.277) (-2000.668) [-1995.541] -- 0:01:15
769600 -- (-1983.219) [-1985.921] (-1996.950) (-1983.877) * (-1997.588) [-1985.100] (-1998.251) (-1992.810) -- 0:01:15
769700 -- [-1982.217] (-1983.848) (-1995.923) (-1993.813) * (-1997.103) [-1984.968] (-1998.025) (-2001.049) -- 0:01:15
769800 -- (-1995.741) [-1992.693] (-1998.207) (-1998.880) * (-2004.224) [-1983.895] (-1996.522) (-2009.007) -- 0:01:15
769900 -- [-1993.557] (-1984.145) (-1999.040) (-1997.072) * (-2003.123) [-1984.780] (-1997.266) (-2006.723) -- 0:01:15
770000 -- (-1993.877) (-1985.827) (-1992.520) [-1991.747] * (-1993.643) (-1993.213) [-1992.798] (-1996.649) -- 0:01:14
Average standard deviation of split frequencies: 0.002029
770100 -- (-1999.237) [-1982.585] (-1995.092) (-1987.042) * (-1998.264) (-1985.648) (-1993.390) [-1989.382] -- 0:01:14
770200 -- (-2002.011) [-1990.413] (-1992.201) (-1984.534) * (-2010.236) (-1986.956) [-1988.768] (-1991.445) -- 0:01:14
770300 -- [-1995.741] (-1984.789) (-1993.200) (-1986.086) * (-2000.607) (-1988.494) (-1990.482) [-1993.275] -- 0:01:14
770400 -- (-1994.586) [-1984.076] (-1990.453) (-1983.106) * (-1998.838) (-1994.651) [-1983.698] (-1985.577) -- 0:01:14
770500 -- (-1997.707) (-1985.859) (-1994.512) [-1986.170] * (-2007.081) (-1991.802) [-1985.645] (-1986.133) -- 0:01:14
770600 -- (-1991.557) (-1980.332) (-2001.067) [-1986.792] * (-2008.244) (-1985.734) [-1989.615] (-1992.695) -- 0:01:14
770700 -- (-1992.448) (-1982.416) (-2008.437) [-1994.953] * (-2000.131) [-1978.986] (-1990.016) (-1991.851) -- 0:01:14
770800 -- (-1995.048) [-1979.847] (-1995.972) (-2004.067) * (-1999.499) [-1982.404] (-1989.143) (-1986.604) -- 0:01:14
770900 -- (-1986.876) [-1977.428] (-1997.546) (-2003.079) * (-1991.461) [-1983.481] (-1995.828) (-2000.383) -- 0:01:14
771000 -- (-1988.472) [-1979.213] (-2002.500) (-1988.720) * (-2003.678) (-1982.634) [-1987.400] (-1991.304) -- 0:01:14
Average standard deviation of split frequencies: 0.002096
771100 -- (-1985.291) (-1976.655) (-2005.963) [-1991.436] * (-2007.648) (-1991.799) (-1990.373) [-1993.194] -- 0:01:14
771200 -- (-1988.889) [-1984.135] (-2005.562) (-1993.786) * (-1997.287) [-1987.639] (-1992.151) (-1994.156) -- 0:01:14
771300 -- (-1987.671) [-1981.845] (-2002.235) (-1994.699) * (-1989.073) (-1984.639) (-1992.071) [-1985.839] -- 0:01:14
771400 -- [-1985.684] (-1982.295) (-1992.278) (-1998.301) * (-1983.492) [-1982.135] (-1999.609) (-1984.195) -- 0:01:14
771500 -- (-1989.218) [-1982.115] (-1996.368) (-1988.288) * (-1984.312) [-1979.199] (-1996.621) (-1994.459) -- 0:01:14
771600 -- (-1986.259) [-1982.021] (-1999.632) (-1985.316) * (-1983.099) [-1978.163] (-1996.388) (-1987.732) -- 0:01:14
771700 -- [-1984.913] (-1981.692) (-1999.004) (-1990.208) * (-1984.524) [-1988.142] (-1997.183) (-1992.164) -- 0:01:14
771800 -- (-1985.926) [-1984.473] (-1993.764) (-1988.897) * (-1984.957) (-1986.436) (-1998.784) [-1982.589] -- 0:01:14
771900 -- [-1983.968] (-1980.139) (-1999.116) (-1996.855) * [-1989.546] (-1990.295) (-2009.304) (-1984.405) -- 0:01:14
772000 -- (-1987.856) [-1984.321] (-2000.655) (-1998.932) * (-1989.866) (-1998.489) (-2003.073) [-1980.191] -- 0:01:14
Average standard deviation of split frequencies: 0.002058
772100 -- [-1982.682] (-1985.519) (-1999.205) (-2004.016) * (-1991.601) (-2003.362) (-2004.040) [-1981.512] -- 0:01:14
772200 -- [-1985.063] (-1983.036) (-1994.891) (-1997.325) * (-1992.683) (-1989.348) (-1998.353) [-1980.757] -- 0:01:14
772300 -- [-1977.773] (-1990.535) (-1993.197) (-1994.700) * (-1988.864) (-1990.898) (-1996.926) [-1983.233] -- 0:01:14
772400 -- [-1979.641] (-1999.717) (-1989.468) (-1997.067) * (-2000.401) [-1986.484] (-1997.308) (-1983.867) -- 0:01:14
772500 -- [-1981.329] (-2002.631) (-1998.157) (-1998.263) * (-1995.740) (-1986.402) [-1995.428] (-1990.759) -- 0:01:14
772600 -- [-1983.255] (-2002.048) (-1994.297) (-2012.632) * (-1994.992) (-1981.654) [-1986.781] (-1986.282) -- 0:01:14
772700 -- [-1988.713] (-2011.844) (-1996.757) (-2002.709) * (-1993.450) [-1978.843] (-1984.757) (-1997.969) -- 0:01:14
772800 -- (-1990.518) (-1999.330) [-1987.399] (-1995.494) * (-1993.667) (-1979.363) [-1983.235] (-1992.658) -- 0:01:14
772900 -- [-1987.319] (-1999.402) (-1989.152) (-2006.962) * (-2000.839) [-1988.791] (-1985.049) (-1990.324) -- 0:01:14
773000 -- [-1988.437] (-2012.160) (-1993.660) (-2001.232) * (-1994.738) (-1988.870) [-1986.301] (-2004.113) -- 0:01:14
Average standard deviation of split frequencies: 0.002055
773100 -- [-1986.485] (-2006.052) (-2003.089) (-2001.579) * (-2002.307) (-1993.964) [-1983.684] (-2003.615) -- 0:01:13
773200 -- [-1987.620] (-1992.391) (-2001.422) (-1994.448) * (-1994.052) [-1991.195] (-1992.235) (-1992.708) -- 0:01:13
773300 -- (-1987.641) (-1996.048) (-2009.805) [-1991.161] * (-1992.706) [-1987.195] (-1989.308) (-1991.262) -- 0:01:13
773400 -- [-1984.317] (-2002.449) (-2003.984) (-1991.184) * (-1995.567) [-1982.481] (-1993.439) (-1991.246) -- 0:01:13
773500 -- [-1986.661] (-1994.226) (-2007.862) (-1990.031) * (-1994.658) [-1987.118] (-1999.371) (-2003.104) -- 0:01:13
773600 -- (-1988.028) (-1993.102) (-2007.930) [-1991.657] * (-1987.965) [-1982.246] (-2000.209) (-1996.956) -- 0:01:13
773700 -- (-1990.684) (-1994.423) (-2011.488) [-1989.218] * (-1992.104) [-1980.316] (-1998.612) (-1992.714) -- 0:01:13
773800 -- [-1988.026] (-1997.583) (-2002.759) (-1989.817) * (-1993.781) [-1978.069] (-1997.715) (-1994.210) -- 0:01:13
773900 -- (-1989.329) (-1998.705) (-1989.951) [-1987.029] * (-1997.003) [-1976.725] (-1996.255) (-1995.951) -- 0:01:13
774000 -- (-1992.475) (-1990.945) [-1992.152] (-2002.455) * (-1997.232) [-1981.782] (-1997.173) (-1999.798) -- 0:01:13
Average standard deviation of split frequencies: 0.002157
774100 -- (-1989.488) [-1988.486] (-1990.421) (-2001.934) * [-1989.897] (-1982.208) (-1991.763) (-2003.119) -- 0:01:13
774200 -- (-1989.610) (-1986.372) [-1991.808] (-1997.053) * (-1998.441) [-1982.476] (-1987.452) (-1993.941) -- 0:01:13
774300 -- (-1988.329) (-1995.500) (-1998.798) [-1991.335] * (-1998.967) [-1983.646] (-1992.341) (-1991.705) -- 0:01:13
774400 -- (-1987.082) (-1990.693) (-1995.736) [-1993.843] * (-1995.029) [-1984.422] (-1993.276) (-1994.792) -- 0:01:13
774500 -- (-1991.213) [-1986.502] (-1995.952) (-2007.597) * (-1991.599) (-1986.924) (-1996.388) [-1993.628] -- 0:01:13
774600 -- (-1989.667) [-1991.012] (-1992.700) (-1999.656) * (-1991.449) (-1988.631) [-1993.731] (-1991.757) -- 0:01:13
774700 -- [-1982.370] (-1997.161) (-2001.261) (-1992.856) * (-1995.142) (-1992.419) (-1994.520) [-1989.945] -- 0:01:13
774800 -- (-1986.839) (-1993.545) (-1992.874) [-1988.390] * (-1988.734) (-1989.972) (-1989.139) [-1988.676] -- 0:01:13
774900 -- (-1986.171) (-1985.823) (-1997.989) [-1986.135] * (-1990.416) [-1992.458] (-1992.832) (-1989.300) -- 0:01:13
775000 -- (-1989.425) [-1985.943] (-1991.780) (-1993.333) * (-1990.997) (-1995.731) (-1988.263) [-1985.265] -- 0:01:13
Average standard deviation of split frequencies: 0.002137
775100 -- (-1992.287) [-1984.034] (-1991.401) (-1988.397) * (-1990.999) (-1986.951) (-1995.847) [-1984.667] -- 0:01:13
775200 -- (-1994.975) (-1984.144) [-1989.198] (-1994.501) * (-1992.398) (-1988.427) (-1990.948) [-1983.144] -- 0:01:13
775300 -- (-1999.901) [-1986.796] (-1988.880) (-1998.523) * (-1994.937) (-1989.173) (-1985.873) [-1980.637] -- 0:01:13
775400 -- (-1996.245) [-1991.427] (-1990.583) (-1994.990) * (-1997.658) (-1985.950) (-1991.841) [-1978.949] -- 0:01:13
775500 -- (-2001.588) (-1987.012) [-1991.597] (-1995.120) * (-1998.136) (-1989.334) (-1989.929) [-1983.428] -- 0:01:13
775600 -- (-1998.384) [-1980.079] (-1997.473) (-1988.796) * (-2001.716) [-1983.478] (-1986.480) (-1994.630) -- 0:01:13
775700 -- (-1992.234) [-1978.226] (-1987.504) (-1986.905) * (-1994.239) [-1982.971] (-1989.709) (-1990.247) -- 0:01:13
775800 -- (-1990.014) (-1985.152) [-1988.473] (-1985.568) * (-1996.622) (-1992.304) [-1995.865] (-1996.067) -- 0:01:13
775900 -- (-1997.744) [-1979.112] (-1992.588) (-1986.699) * (-1997.101) [-1989.259] (-1995.532) (-1996.488) -- 0:01:13
776000 -- (-1994.715) [-1977.403] (-1995.512) (-1992.901) * (-1997.164) [-1989.344] (-1995.790) (-1992.231) -- 0:01:13
Average standard deviation of split frequencies: 0.002117
776100 -- (-2001.244) [-1982.594] (-2001.726) (-1982.764) * (-1996.771) (-1982.563) (-1999.432) [-1987.972] -- 0:01:12
776200 -- (-2000.046) [-1980.045] (-2008.738) (-1979.945) * (-2000.840) [-1978.614] (-2007.264) (-1986.544) -- 0:01:12
776300 -- (-1999.582) [-1979.591] (-1999.836) (-1988.295) * (-2000.353) (-1983.407) (-2000.063) [-1987.669] -- 0:01:12
776400 -- (-2007.500) [-1978.245] (-1996.578) (-1987.442) * (-1994.342) [-1985.973] (-2000.751) (-1981.565) -- 0:01:12
776500 -- (-2002.754) [-1987.434] (-1990.878) (-1993.242) * (-1997.020) [-1986.971] (-1999.738) (-1983.908) -- 0:01:12
776600 -- (-1999.690) [-1985.055] (-2006.028) (-1978.594) * (-1992.976) (-1984.107) (-1995.811) [-1982.423] -- 0:01:12
776700 -- (-1993.829) (-1990.347) (-2000.416) [-1977.273] * (-1997.055) (-1987.708) (-1995.462) [-1982.549] -- 0:01:12
776800 -- (-2000.094) (-1991.390) (-1996.482) [-1979.689] * (-2002.551) (-1986.489) (-1993.341) [-1986.710] -- 0:01:12
776900 -- (-1989.907) (-1988.183) (-1995.555) [-1980.430] * (-1999.840) (-1983.874) (-1989.683) [-1982.883] -- 0:01:12
777000 -- (-1996.426) (-1983.756) (-1996.488) [-1980.157] * (-1995.384) (-1983.795) (-1988.580) [-1980.341] -- 0:01:12
Average standard deviation of split frequencies: 0.002114
777100 -- (-1993.444) [-1985.589] (-1997.235) (-1980.923) * (-1995.813) (-1988.265) (-1993.312) [-1982.606] -- 0:01:12
777200 -- (-1995.173) (-1990.061) (-2006.942) [-1984.400] * (-1993.519) (-1992.408) (-1993.785) [-1977.875] -- 0:01:12
777300 -- (-1988.685) (-1993.769) [-1990.368] (-1986.526) * (-1990.228) (-1997.046) (-1994.860) [-1977.745] -- 0:01:12
777400 -- (-1989.359) [-1984.773] (-1982.724) (-1990.218) * (-1987.634) (-1990.363) (-1994.279) [-1987.006] -- 0:01:12
777500 -- (-2006.524) (-1988.092) [-1988.474] (-1993.166) * (-1987.478) [-1986.042] (-1988.851) (-1986.749) -- 0:01:12
777600 -- (-1997.858) (-1991.143) (-1998.355) [-1984.070] * (-1993.475) [-1986.234] (-1992.871) (-1982.929) -- 0:01:12
777700 -- (-1996.026) [-1987.363] (-1996.866) (-1987.145) * (-1991.274) [-1979.749] (-1994.482) (-1987.308) -- 0:01:12
777800 -- (-2001.302) (-1986.848) (-1991.771) [-1984.745] * (-1996.066) [-1980.668] (-1990.547) (-1987.255) -- 0:01:12
777900 -- (-2003.737) (-1981.325) (-1987.193) [-1986.572] * (-1991.078) [-1982.721] (-1997.828) (-1985.081) -- 0:01:12
778000 -- (-2005.631) (-1981.564) (-1992.238) [-1980.520] * (-1991.127) [-1984.925] (-1997.498) (-1991.992) -- 0:01:12
Average standard deviation of split frequencies: 0.002042
778100 -- (-2003.161) (-1983.925) (-1989.835) [-1981.711] * (-1996.762) (-1986.114) (-1996.426) [-1984.745] -- 0:01:12
778200 -- (-1994.193) (-1988.004) [-1987.438] (-1981.067) * (-1994.758) (-1988.503) [-1990.778] (-1991.824) -- 0:01:12
778300 -- (-2000.543) (-1985.490) (-1991.805) [-1984.209] * (-2011.331) (-1988.462) (-1995.341) [-1990.605] -- 0:01:12
778400 -- (-1995.924) (-1987.445) (-1988.921) [-1986.914] * (-2005.941) (-1987.083) (-1999.268) [-1983.346] -- 0:01:12
778500 -- (-1997.427) [-1986.367] (-1990.812) (-1993.850) * (-2006.881) (-1990.752) (-2003.778) [-1985.116] -- 0:01:12
778600 -- (-1991.382) [-1978.684] (-1987.550) (-1995.681) * (-2010.586) (-1988.223) (-1996.885) [-1985.856] -- 0:01:12
778700 -- (-1991.384) (-1987.013) [-1988.008] (-1989.811) * (-2003.116) (-1985.690) (-2000.548) [-1983.095] -- 0:01:12
778800 -- [-1986.672] (-1983.833) (-1993.832) (-1992.947) * (-2001.766) (-1990.481) (-2001.132) [-1985.457] -- 0:01:12
778900 -- (-1990.312) [-1987.482] (-1992.245) (-2000.957) * (-2009.867) (-1988.323) (-1998.237) [-1982.939] -- 0:01:12
779000 -- (-1988.994) [-1980.930] (-1995.185) (-1997.448) * (-1990.042) (-1994.257) (-1999.411) [-1983.129] -- 0:01:12
Average standard deviation of split frequencies: 0.002074
779100 -- [-1991.971] (-1983.272) (-2000.238) (-1992.946) * (-1989.183) (-1996.288) (-1990.945) [-1980.013] -- 0:01:12
779200 -- (-1987.859) [-1980.899] (-1997.818) (-1988.808) * (-1993.031) (-1994.541) (-1992.016) [-1981.995] -- 0:01:11
779300 -- (-1988.221) [-1981.558] (-1995.486) (-1985.126) * (-1998.459) (-1989.076) (-1994.683) [-1987.117] -- 0:01:11
779400 -- (-1987.572) (-1984.110) (-1990.334) [-1981.075] * (-2001.819) (-1988.003) (-1996.538) [-1980.702] -- 0:01:11
779500 -- (-1984.042) [-1980.701] (-1988.107) (-1989.058) * (-2003.234) (-1991.411) (-1991.888) [-1980.260] -- 0:01:11
779600 -- (-1987.093) [-1984.061] (-1991.468) (-1986.177) * (-2003.109) (-1994.934) (-2001.784) [-1982.940] -- 0:01:11
779700 -- (-1986.226) (-1986.112) (-1994.479) [-1985.404] * (-2001.270) [-1996.825] (-2008.194) (-1984.967) -- 0:01:11
779800 -- [-1983.906] (-1986.362) (-1990.661) (-1984.235) * (-1997.675) [-1987.976] (-2023.649) (-1991.936) -- 0:01:11
779900 -- [-1983.600] (-1994.433) (-1994.073) (-1985.697) * (-2001.473) (-1986.751) (-2013.015) [-1984.528] -- 0:01:11
780000 -- [-1987.140] (-1987.687) (-1991.773) (-1983.284) * (-1996.527) [-1994.252] (-2002.557) (-1987.193) -- 0:01:11
Average standard deviation of split frequencies: 0.002089
780100 -- (-1983.080) (-1994.491) (-1990.980) [-1981.492] * (-1998.243) [-1982.553] (-1999.093) (-1988.932) -- 0:01:11
780200 -- (-1990.132) (-1994.635) (-1992.949) [-1978.782] * (-1999.760) [-1982.597] (-1994.439) (-1985.967) -- 0:01:11
780300 -- (-1985.595) (-1989.920) [-1994.903] (-1979.093) * (-1992.814) (-1982.074) (-1999.249) [-1978.096] -- 0:01:11
780400 -- [-1988.340] (-1986.531) (-1988.631) (-1980.500) * (-2004.131) [-1977.923] (-1997.536) (-1983.314) -- 0:01:11
780500 -- (-1992.587) [-1983.968] (-1991.633) (-1983.093) * (-1999.056) (-1982.590) (-1993.352) [-1984.312] -- 0:01:11
780600 -- (-1991.781) (-1996.116) (-1992.419) [-1989.903] * (-2008.884) [-1983.649] (-1993.313) (-1985.373) -- 0:01:11
780700 -- (-1985.672) (-1992.400) [-1990.765] (-1985.282) * (-2003.522) [-1983.514] (-1988.716) (-1984.072) -- 0:01:11
780800 -- [-1984.356] (-1994.566) (-1994.759) (-1995.963) * (-1995.083) [-1979.079] (-1995.457) (-1983.988) -- 0:01:11
780900 -- (-1991.032) (-1989.185) [-1993.524] (-1998.475) * (-1999.025) [-1982.335] (-1993.705) (-1991.721) -- 0:01:11
781000 -- (-1994.591) [-1981.819] (-1990.589) (-1993.868) * (-1995.299) [-1979.705] (-1991.495) (-2000.516) -- 0:01:11
Average standard deviation of split frequencies: 0.002086
781100 -- (-2005.581) (-1982.995) (-1991.474) [-1985.173] * [-1994.904] (-1982.891) (-1993.217) (-1992.291) -- 0:01:11
781200 -- (-2004.212) [-1981.274] (-1989.696) (-1989.393) * (-1994.040) [-1987.457] (-1994.433) (-1992.031) -- 0:01:11
781300 -- (-1996.250) [-1987.109] (-1991.048) (-1992.126) * (-1997.617) [-1984.189] (-1992.795) (-1990.325) -- 0:01:11
781400 -- (-1997.468) (-1984.728) (-2001.076) [-1994.038] * (-1992.519) [-1985.650] (-1997.494) (-1987.658) -- 0:01:11
781500 -- (-1998.157) [-1980.653] (-2002.496) (-1995.938) * (-1994.473) (-1993.859) (-1993.145) [-1989.088] -- 0:01:11
781600 -- (-2002.808) [-1981.641] (-2001.837) (-1990.138) * (-1995.168) [-1989.005] (-1988.266) (-1986.320) -- 0:01:11
781700 -- (-2001.549) (-1984.915) (-2003.405) [-1987.979] * (-1992.780) (-1992.961) (-1993.890) [-1992.123] -- 0:01:11
781800 -- (-1996.501) [-1985.754] (-2007.212) (-1990.574) * (-1988.100) (-1991.854) (-1996.866) [-1994.960] -- 0:01:11
781900 -- (-1994.993) [-1980.498] (-1998.651) (-1991.629) * (-1991.369) (-1984.569) [-1991.214] (-1998.446) -- 0:01:11
782000 -- (-1992.085) [-1982.950] (-2002.749) (-1991.060) * (-1989.591) [-1983.193] (-1988.453) (-2002.101) -- 0:01:11
Average standard deviation of split frequencies: 0.002032
782100 -- (-2007.095) [-1983.042] (-1990.711) (-1993.996) * (-1992.242) [-1986.713] (-1986.247) (-2009.511) -- 0:01:11
782200 -- (-2002.469) [-1984.886] (-1989.512) (-2000.998) * (-1995.063) (-1985.944) [-1983.270] (-2006.248) -- 0:01:11
782300 -- (-1995.492) (-1981.915) (-1990.280) [-1988.387] * (-1996.835) [-1982.011] (-1985.637) (-2004.398) -- 0:01:10
782400 -- (-1984.178) (-1989.173) (-1988.144) [-1990.013] * (-1991.969) [-1990.005] (-1986.225) (-1999.076) -- 0:01:10
782500 -- (-1989.489) [-1989.296] (-1987.246) (-1994.060) * (-1999.543) (-1991.178) (-1992.864) [-1989.977] -- 0:01:10
782600 -- (-1991.885) [-1984.202] (-1991.752) (-2001.643) * (-2000.590) [-1985.290] (-1989.740) (-1991.442) -- 0:01:10
782700 -- (-1992.042) [-1987.722] (-1986.743) (-2004.661) * (-2000.279) (-1985.855) [-1989.661] (-1986.777) -- 0:01:10
782800 -- (-1990.883) [-1988.490] (-1993.512) (-1995.961) * (-2005.395) [-1982.019] (-1989.643) (-1985.134) -- 0:01:10
782900 -- (-1993.053) [-1986.669] (-1997.560) (-2000.267) * (-2003.241) (-1990.548) (-1991.649) [-1987.442] -- 0:01:10
783000 -- (-1995.262) (-1985.925) [-1992.985] (-1994.902) * (-1996.346) [-1990.483] (-1993.923) (-1988.368) -- 0:01:10
Average standard deviation of split frequencies: 0.001960
783100 -- (-1995.555) [-1981.432] (-1995.370) (-1997.758) * (-2004.375) [-1981.527] (-1998.654) (-1983.309) -- 0:01:10
783200 -- (-1999.123) [-1981.552] (-1986.007) (-1991.152) * (-1998.798) (-1989.402) (-1993.541) [-1983.975] -- 0:01:10
783300 -- (-1999.233) [-1982.018] (-1985.571) (-1993.057) * (-1988.547) [-1989.649] (-1995.619) (-1988.035) -- 0:01:10
783400 -- (-2000.661) [-1984.372] (-1982.607) (-1992.179) * (-1989.325) [-1993.342] (-1998.341) (-1985.526) -- 0:01:10
783500 -- (-1991.505) [-1984.971] (-1984.694) (-1999.633) * (-1992.909) [-1987.578] (-2003.512) (-1984.885) -- 0:01:10
783600 -- (-2002.831) (-1982.382) [-1983.233] (-1992.854) * (-1987.408) (-1988.255) (-2008.211) [-1986.005] -- 0:01:10
783700 -- (-1996.359) [-1987.482] (-1987.043) (-2001.366) * (-1986.911) [-1986.067] (-2001.012) (-1987.499) -- 0:01:10
783800 -- (-2002.964) (-1987.168) [-1980.950] (-1994.003) * (-1985.763) (-1988.674) (-1997.586) [-1994.784] -- 0:01:10
783900 -- (-2009.615) (-1991.527) [-1980.228] (-2003.164) * (-1992.353) [-1989.456] (-1993.993) (-1998.078) -- 0:01:10
784000 -- (-2009.241) (-1988.335) [-1984.629] (-2011.167) * (-1995.786) [-1986.348] (-1998.125) (-1989.169) -- 0:01:10
Average standard deviation of split frequencies: 0.001992
784100 -- (-2003.814) [-1983.176] (-1983.810) (-2010.445) * (-1992.877) [-1981.691] (-2007.099) (-1990.243) -- 0:01:10
784200 -- (-1993.537) (-1987.915) [-1979.298] (-2006.814) * [-1986.849] (-1988.060) (-1996.204) (-2002.734) -- 0:01:10
784300 -- (-1990.058) [-1984.425] (-1984.796) (-1998.964) * (-1986.844) [-1982.024] (-2006.025) (-2000.741) -- 0:01:10
784400 -- [-1988.389] (-1990.295) (-1988.647) (-2005.608) * (-1983.859) [-1982.802] (-2003.968) (-1999.946) -- 0:01:10
784500 -- (-1988.449) [-1984.597] (-1995.819) (-1993.250) * (-1985.117) [-1981.433] (-1996.859) (-1994.323) -- 0:01:10
784600 -- [-1992.447] (-1989.755) (-1995.529) (-1992.942) * (-1990.800) [-1979.761] (-2001.545) (-1990.318) -- 0:01:10
784700 -- (-1990.902) [-1986.340] (-1990.628) (-2003.525) * (-1995.039) [-1981.791] (-1997.284) (-1991.466) -- 0:01:10
784800 -- (-1990.162) (-1984.643) [-1983.506] (-1995.657) * (-1988.405) (-1990.443) (-2002.101) [-1984.723] -- 0:01:10
784900 -- (-1989.904) (-1988.650) [-1986.570] (-1999.255) * (-1990.461) [-1980.868] (-1998.843) (-1984.746) -- 0:01:10
785000 -- [-1991.900] (-1988.621) (-1990.575) (-1998.281) * (-2004.345) (-1982.912) (-1994.424) [-1984.933] -- 0:01:10
Average standard deviation of split frequencies: 0.002093
785100 -- (-1990.191) [-1985.802] (-1993.149) (-1999.446) * (-1995.752) (-1985.391) (-1993.422) [-1978.369] -- 0:01:10
785200 -- [-1992.628] (-1989.759) (-1998.107) (-1991.442) * (-1995.098) [-1980.921] (-2003.237) (-1980.624) -- 0:01:10
785300 -- (-1985.712) (-1982.465) (-2004.702) [-1992.524] * (-1998.130) [-1979.706] (-1996.168) (-1983.480) -- 0:01:09
785400 -- (-1987.795) [-1981.471] (-2002.503) (-1991.876) * (-1995.106) (-1978.556) (-1995.090) [-1982.257] -- 0:01:09
785500 -- [-1988.969] (-1995.550) (-2000.718) (-1989.038) * (-1995.076) [-1981.220] (-1993.914) (-1982.046) -- 0:01:09
785600 -- (-1987.782) [-1992.617] (-2000.486) (-1991.384) * (-1989.376) (-1983.756) (-1993.824) [-1980.956] -- 0:01:09
785700 -- (-1991.366) [-1981.489] (-1995.205) (-1990.627) * (-1987.077) [-1986.261] (-1993.397) (-1983.529) -- 0:01:09
785800 -- (-1988.308) [-1981.435] (-1994.171) (-1987.745) * (-1986.905) (-1985.657) (-1999.104) [-1985.070] -- 0:01:09
785900 -- (-1981.913) (-1997.758) (-2008.240) [-1990.101] * (-1992.200) (-1988.976) (-1996.503) [-1978.991] -- 0:01:09
786000 -- [-1982.764] (-1988.647) (-1997.279) (-1987.305) * (-1989.161) (-1988.646) (-1996.593) [-1977.051] -- 0:01:09
Average standard deviation of split frequencies: 0.002124
786100 -- (-1984.978) (-1996.849) [-1989.361] (-1984.561) * (-1986.918) (-1994.342) (-1990.460) [-1977.869] -- 0:01:09
786200 -- (-1988.561) (-1995.227) (-1989.703) [-1984.549] * (-1990.006) (-1993.844) (-1993.108) [-1977.379] -- 0:01:09
786300 -- [-1985.927] (-1993.038) (-1993.807) (-1987.184) * (-1993.890) [-1988.580] (-1992.044) (-1980.884) -- 0:01:09
786400 -- [-1984.325] (-1987.726) (-1993.268) (-1992.840) * (-1993.341) (-1984.987) (-1990.210) [-1981.246] -- 0:01:09
786500 -- (-1986.657) [-1987.142] (-1994.080) (-1994.410) * (-2002.175) [-1984.800] (-1996.544) (-1978.871) -- 0:01:09
786600 -- [-1984.355] (-1994.260) (-1988.971) (-1993.269) * (-2004.440) (-1982.241) (-1995.697) [-1982.250] -- 0:01:09
786700 -- [-1987.016] (-1991.879) (-1991.483) (-1997.426) * (-2000.854) [-1987.016] (-1987.592) (-1983.861) -- 0:01:09
786800 -- [-1987.438] (-1995.239) (-1987.333) (-1996.023) * (-1996.695) [-1981.417] (-1987.174) (-1980.264) -- 0:01:09
786900 -- [-1987.333] (-1992.567) (-1990.604) (-1989.071) * (-1994.409) [-1982.890] (-1992.822) (-1983.472) -- 0:01:09
787000 -- [-1988.729] (-1998.512) (-1998.223) (-1993.461) * (-1994.426) (-1988.091) (-1992.756) [-1980.697] -- 0:01:09
Average standard deviation of split frequencies: 0.002053
787100 -- [-1985.452] (-2002.679) (-2005.638) (-1991.185) * (-1998.315) (-1992.631) (-1997.417) [-1981.418] -- 0:01:09
787200 -- [-1981.050] (-1991.339) (-1999.292) (-1993.150) * (-1997.811) [-1994.162] (-1993.576) (-1983.857) -- 0:01:09
787300 -- [-1980.326] (-1990.072) (-1997.809) (-1993.398) * (-1997.947) (-1984.689) (-1995.102) [-1985.918] -- 0:01:09
787400 -- [-1981.050] (-1984.939) (-1990.595) (-1993.808) * (-1992.936) [-1982.960] (-1992.628) (-1988.949) -- 0:01:09
787500 -- [-1980.858] (-1996.986) (-1985.514) (-1994.883) * (-1992.221) [-1982.486] (-1992.575) (-1995.095) -- 0:01:09
787600 -- [-1987.788] (-2006.019) (-1991.502) (-1990.008) * (-1990.094) (-1988.408) (-1988.818) [-1982.922] -- 0:01:09
787700 -- (-1986.114) (-2001.239) (-1991.507) [-1990.016] * (-2002.951) (-1986.089) (-1988.748) [-1988.875] -- 0:01:09
787800 -- (-1989.097) (-1993.584) [-1993.507] (-1996.450) * (-1994.480) [-1982.496] (-1994.528) (-1995.020) -- 0:01:09
787900 -- (-1990.458) (-2000.990) [-1990.702] (-2004.002) * (-2000.978) [-1988.022] (-2002.231) (-2000.930) -- 0:01:09
788000 -- (-1986.545) (-1998.544) [-1982.995] (-2000.845) * (-2005.898) [-1983.709] (-1996.044) (-1986.291) -- 0:01:09
Average standard deviation of split frequencies: 0.002085
788100 -- (-1997.447) (-1994.025) [-1986.008] (-2000.478) * (-2003.917) (-1982.950) (-2002.335) [-1990.889] -- 0:01:09
788200 -- (-1993.274) (-1993.016) [-1984.087] (-1999.529) * (-2004.429) (-1988.179) (-1995.522) [-1983.906] -- 0:01:09
788300 -- (-1987.270) (-1999.370) [-1979.324] (-2003.750) * (-1997.862) (-1987.729) (-1993.037) [-1983.336] -- 0:01:09
788400 -- (-1991.502) (-1996.681) [-1985.132] (-2004.394) * (-2005.898) (-1987.707) [-1986.791] (-1988.561) -- 0:01:08
788500 -- [-1988.664] (-1996.444) (-1986.901) (-1999.597) * (-1996.741) [-1985.947] (-1986.645) (-2004.633) -- 0:01:08
788600 -- (-1996.286) (-1994.944) [-1979.130] (-1993.184) * [-1985.000] (-1989.683) (-1987.901) (-1994.540) -- 0:01:08
788700 -- (-1996.679) (-1988.038) [-1980.248] (-1996.036) * [-1989.362] (-1988.512) (-1989.359) (-1998.290) -- 0:01:08
788800 -- (-1996.111) (-1986.965) [-1980.469] (-1996.617) * (-1995.344) (-1994.448) (-1993.031) [-1989.653] -- 0:01:08
788900 -- (-1991.194) (-1990.262) [-1979.455] (-2004.254) * (-2002.965) (-1992.930) [-1990.454] (-1996.093) -- 0:01:08
789000 -- (-1992.524) [-1985.559] (-1986.160) (-2004.385) * [-1989.938] (-1987.210) (-1988.632) (-1999.836) -- 0:01:08
Average standard deviation of split frequencies: 0.002048
789100 -- (-2007.231) (-1994.425) [-1987.330] (-1996.844) * (-1993.284) (-1993.850) [-1992.628] (-1998.667) -- 0:01:08
789200 -- (-2014.328) [-1989.915] (-1985.707) (-2002.793) * (-1989.613) (-1994.891) (-1994.413) [-1992.682] -- 0:01:08
789300 -- (-1989.876) (-1993.225) [-1979.001] (-2000.242) * (-1985.143) (-2002.247) (-1993.819) [-1985.678] -- 0:01:08
789400 -- (-1988.269) (-2000.397) [-1980.660] (-1995.658) * (-1988.775) (-2000.980) [-1986.009] (-1988.273) -- 0:01:08
789500 -- (-1982.738) (-2000.657) [-1979.737] (-1997.095) * (-1990.001) (-2007.461) [-1993.766] (-1992.359) -- 0:01:08
789600 -- (-1982.952) (-1999.331) [-1982.813] (-1997.873) * (-1994.896) (-1995.901) [-1992.135] (-1993.519) -- 0:01:08
789700 -- (-1985.160) (-1998.509) [-1980.708] (-1997.266) * (-1989.123) (-2000.937) (-1992.772) [-1993.933] -- 0:01:08
789800 -- [-1987.473] (-1998.648) (-1986.168) (-2003.422) * (-1991.949) (-2003.311) (-1989.500) [-1988.103] -- 0:01:08
789900 -- [-1985.677] (-2001.095) (-1989.784) (-1993.052) * (-1992.432) (-2004.093) (-1995.017) [-1984.747] -- 0:01:08
790000 -- [-1983.816] (-2001.015) (-1992.921) (-1994.719) * (-2000.525) (-1994.699) [-1987.476] (-1989.305) -- 0:01:08
Average standard deviation of split frequencies: 0.001909
790100 -- [-1985.295] (-1992.226) (-1987.506) (-1989.539) * (-1995.731) (-1990.841) [-1988.694] (-1989.883) -- 0:01:08
790200 -- (-1983.955) [-1990.427] (-1989.746) (-1986.541) * (-2000.517) (-2000.655) [-1984.787] (-1990.816) -- 0:01:08
790300 -- (-1992.452) (-1993.319) (-1990.743) [-1986.470] * (-1990.815) (-1996.036) (-1986.548) [-1986.056] -- 0:01:08
790400 -- (-1982.702) (-1998.250) (-1995.690) [-1991.431] * (-1983.639) [-1990.168] (-1991.350) (-1989.191) -- 0:01:08
790500 -- (-1982.881) (-2008.379) [-1988.374] (-1992.419) * (-1994.057) (-1988.528) (-1993.043) [-1991.378] -- 0:01:08
790600 -- [-1981.618] (-2001.171) (-1984.762) (-1997.097) * (-1995.346) (-1993.544) [-1985.561] (-1999.241) -- 0:01:08
790700 -- (-1995.131) (-1993.427) [-1985.736] (-1996.829) * (-1995.246) (-1983.866) [-1984.477] (-2005.887) -- 0:01:08
790800 -- (-1992.737) (-1992.927) [-1980.974] (-1999.039) * (-1999.369) (-1984.480) [-1989.803] (-1998.098) -- 0:01:08
790900 -- [-1982.480] (-1998.162) (-1990.517) (-2002.955) * (-1996.362) [-1985.384] (-1993.859) (-1990.806) -- 0:01:08
791000 -- [-1984.623] (-1991.779) (-2003.177) (-1994.565) * (-1995.814) [-1980.914] (-1990.837) (-1989.548) -- 0:01:08
Average standard deviation of split frequencies: 0.001770
791100 -- [-1983.417] (-1990.182) (-1993.139) (-1991.345) * (-1995.484) [-1984.520] (-1992.518) (-1990.305) -- 0:01:08
791200 -- [-1982.821] (-1989.676) (-1995.123) (-1991.911) * (-1994.374) [-1987.409] (-1996.782) (-1995.252) -- 0:01:08
791300 -- (-1983.672) (-1989.947) (-1987.486) [-1989.673] * (-1990.397) (-1993.167) (-1994.095) [-1990.792] -- 0:01:08
791400 -- [-1985.172] (-2006.661) (-1989.886) (-1989.569) * (-1994.934) (-1989.841) [-1988.645] (-1993.087) -- 0:01:08
791500 -- [-1986.618] (-1996.045) (-1987.515) (-1986.798) * [-1990.273] (-1990.864) (-1993.858) (-1992.752) -- 0:01:07
791600 -- [-1990.528] (-1997.066) (-1986.360) (-1989.280) * (-1994.721) [-1981.973] (-1996.415) (-1992.311) -- 0:01:07
791700 -- (-1985.239) (-2007.149) [-1983.998] (-1992.866) * (-1989.489) [-1984.548] (-1997.817) (-1991.303) -- 0:01:07
791800 -- [-1985.455] (-2004.425) (-1985.664) (-1990.355) * (-1993.052) [-1983.534] (-2002.061) (-1996.861) -- 0:01:07
791900 -- (-1990.998) (-2000.851) [-1986.090] (-1995.334) * (-1989.830) (-1985.762) (-1999.322) [-1987.695] -- 0:01:07
792000 -- (-1990.794) (-2000.218) [-1983.023] (-1992.940) * (-1999.029) [-1980.978] (-2002.802) (-1981.642) -- 0:01:07
Average standard deviation of split frequencies: 0.001768
792100 -- (-1989.120) (-1998.742) [-1987.478] (-1992.713) * (-1995.983) [-1982.878] (-2001.273) (-1984.811) -- 0:01:07
792200 -- (-1989.874) (-1994.264) (-1993.304) [-1987.036] * (-1991.742) (-1987.014) (-2002.684) [-1984.028] -- 0:01:07
792300 -- (-1988.539) (-1999.226) [-1993.622] (-1998.676) * [-1987.148] (-1989.810) (-2007.434) (-1983.354) -- 0:01:07
792400 -- (-1982.801) (-1994.478) [-1983.920] (-1996.177) * (-1986.850) [-1982.445] (-1999.333) (-1987.629) -- 0:01:07
792500 -- [-1987.049] (-1987.904) (-1989.181) (-1994.770) * [-1982.993] (-1985.884) (-1997.883) (-1990.376) -- 0:01:07
792600 -- [-1981.842] (-1988.984) (-1983.442) (-1992.046) * [-1990.466] (-1987.927) (-1992.053) (-1987.494) -- 0:01:07
792700 -- [-1983.421] (-1988.754) (-1986.425) (-1996.494) * (-1991.887) (-1999.515) (-1993.374) [-1991.433] -- 0:01:07
792800 -- (-1981.959) (-1990.323) [-1985.757] (-1997.387) * [-1981.133] (-2001.676) (-1988.842) (-1996.780) -- 0:01:07
792900 -- (-1989.823) [-1994.262] (-1990.040) (-2002.740) * (-1987.687) [-1996.902] (-1991.590) (-1992.124) -- 0:01:07
793000 -- (-1989.775) (-1995.983) [-1982.521] (-2001.656) * [-1982.496] (-2002.657) (-1988.247) (-1995.593) -- 0:01:07
Average standard deviation of split frequencies: 0.001783
793100 -- (-1986.846) (-1999.698) [-1978.952] (-2001.320) * [-1986.896] (-2008.418) (-1992.243) (-1985.571) -- 0:01:07
793200 -- (-1983.672) [-2002.648] (-1985.741) (-1997.753) * [-1988.949] (-2004.784) (-1994.778) (-1988.342) -- 0:01:07
793300 -- [-1980.898] (-1995.213) (-1983.848) (-2000.609) * [-1986.133] (-2001.599) (-1991.246) (-1986.069) -- 0:01:07
793400 -- (-1982.754) (-1997.802) [-1982.767] (-1997.920) * [-1987.663] (-2008.452) (-1996.215) (-1983.829) -- 0:01:07
793500 -- (-1982.417) (-2004.483) (-1985.045) [-1996.967] * [-1982.754] (-2003.626) (-1999.241) (-1988.718) -- 0:01:07
793600 -- [-1986.179] (-1996.081) (-1986.357) (-1995.039) * (-1985.428) (-2003.797) (-2001.374) [-1989.700] -- 0:01:07
793700 -- (-1985.482) (-1989.821) [-1985.450] (-1994.623) * [-1989.767] (-2004.143) (-2002.692) (-1989.078) -- 0:01:07
793800 -- [-1980.460] (-1986.844) (-1985.513) (-1994.510) * (-1991.629) (-2003.404) (-1998.736) [-1984.367] -- 0:01:07
793900 -- [-1980.343] (-1989.754) (-1988.572) (-1988.743) * (-1990.811) (-1992.610) (-1999.567) [-1985.934] -- 0:01:07
794000 -- [-1981.552] (-1991.118) (-1989.254) (-1987.166) * (-1995.621) (-1997.020) (-1999.375) [-1986.476] -- 0:01:07
Average standard deviation of split frequencies: 0.001696
794100 -- (-1980.564) (-1990.390) [-1984.917] (-1994.492) * (-1995.112) (-1996.900) (-2005.408) [-1981.708] -- 0:01:07
794200 -- [-1984.657] (-1990.420) (-1989.058) (-1986.362) * (-1997.985) (-1990.682) (-2007.422) [-1980.138] -- 0:01:07
794300 -- (-1983.296) [-1986.170] (-1992.143) (-1990.088) * (-1996.450) (-1988.938) (-2002.826) [-1980.028] -- 0:01:07
794400 -- [-1983.197] (-1991.974) (-1992.687) (-1991.682) * (-2002.060) (-1997.665) (-1992.488) [-1977.645] -- 0:01:07
794500 -- [-1979.496] (-1995.506) (-1988.132) (-1991.112) * (-1996.375) (-1996.516) (-1990.703) [-1979.814] -- 0:01:06
794600 -- (-1983.530) (-1992.282) [-1990.503] (-1995.645) * (-1998.052) (-1991.319) (-1990.023) [-1985.952] -- 0:01:06
794700 -- (-1991.867) (-1992.966) [-1990.871] (-1995.968) * (-1999.280) (-1988.611) (-1999.963) [-1980.595] -- 0:01:06
794800 -- (-1991.111) (-1993.148) [-1989.972] (-1994.653) * (-2001.659) (-1990.798) (-1997.832) [-1983.100] -- 0:01:06
794900 -- [-1989.234] (-1993.002) (-1992.763) (-1993.838) * (-1986.305) [-1986.303] (-2005.975) (-1989.256) -- 0:01:06
795000 -- (-2004.178) (-1999.653) (-1988.489) [-1986.553] * (-1988.652) (-1996.194) (-1998.671) [-1990.916] -- 0:01:06
Average standard deviation of split frequencies: 0.001711
795100 -- (-1991.583) (-2002.145) (-1993.277) [-1981.190] * (-1999.280) (-1990.617) (-2001.382) [-1988.036] -- 0:01:06
795200 -- (-1990.770) (-1999.713) (-1986.424) [-1985.002] * (-1993.470) (-1986.697) (-1998.698) [-1986.759] -- 0:01:06
795300 -- (-1987.649) (-1994.763) [-1988.775] (-1988.470) * (-1996.320) (-1991.998) (-1996.159) [-1989.899] -- 0:01:06
795400 -- (-1988.745) (-1993.689) (-1986.692) [-1985.353] * (-1995.034) (-1989.025) (-1991.819) [-1983.163] -- 0:01:06
795500 -- [-1987.780] (-1995.543) (-1986.599) (-1990.069) * (-1996.621) (-1989.057) (-1987.084) [-1983.124] -- 0:01:06
795600 -- (-1991.356) (-1994.635) [-1985.332] (-1989.283) * (-1997.406) (-1997.019) (-1987.012) [-1990.873] -- 0:01:06
795700 -- (-1996.528) (-1987.415) (-1984.929) [-1986.303] * (-1990.183) (-1998.292) (-1984.828) [-1983.680] -- 0:01:06
795800 -- (-1994.684) (-1999.566) [-1982.377] (-1981.582) * (-1998.527) (-1992.381) [-1984.350] (-1987.392) -- 0:01:06
795900 -- (-1990.028) (-1995.666) (-1984.259) [-1986.548] * (-1999.576) [-1990.753] (-1984.549) (-1987.683) -- 0:01:06
796000 -- (-1997.734) (-2000.291) (-1985.942) [-1993.800] * (-1997.742) (-1991.810) [-1984.947] (-1986.823) -- 0:01:06
Average standard deviation of split frequencies: 0.001709
796100 -- (-1994.795) (-1992.778) [-1983.668] (-1994.536) * (-1995.845) (-1999.514) (-1993.414) [-1982.898] -- 0:01:06
796200 -- (-1998.610) (-1990.204) [-1982.074] (-1997.437) * (-1999.453) (-1996.646) (-1993.867) [-1991.205] -- 0:01:06
796300 -- (-2009.065) (-1990.555) (-1983.317) [-1994.542] * (-2001.179) (-1986.869) [-1985.283] (-1989.067) -- 0:01:06
796400 -- (-2005.928) (-1991.856) (-1985.921) [-1993.929] * (-2001.689) (-1990.799) [-1982.878] (-1996.642) -- 0:01:06
796500 -- (-1995.675) (-2003.709) (-1985.843) [-1989.235] * (-1998.859) (-1992.497) [-1985.390] (-1994.036) -- 0:01:06
796600 -- (-2004.428) (-1998.797) [-1989.312] (-1990.629) * [-1996.307] (-1989.664) (-1990.397) (-1994.606) -- 0:01:06
796700 -- (-2001.262) (-2001.166) (-1990.871) [-1997.636] * (-1994.489) (-1990.168) [-1990.311] (-1988.616) -- 0:01:06
796800 -- (-1992.758) (-2000.705) [-1987.999] (-1998.892) * (-1990.613) (-1990.499) [-1986.366] (-1989.504) -- 0:01:06
796900 -- (-1997.610) (-2003.381) [-1990.141] (-1999.413) * (-1997.098) [-1984.123] (-1993.016) (-1986.385) -- 0:01:06
797000 -- (-1992.394) (-1992.150) (-1983.889) [-1997.838] * (-1997.753) (-1983.735) (-1986.903) [-1983.982] -- 0:01:06
Average standard deviation of split frequencies: 0.001706
797100 -- [-1982.929] (-2002.644) (-1985.515) (-1999.691) * (-1995.095) [-1987.160] (-1991.656) (-1984.832) -- 0:01:06
797200 -- [-1984.796] (-1999.243) (-1984.502) (-2001.821) * (-1988.086) (-1995.393) [-1991.031] (-1993.727) -- 0:01:06
797300 -- (-1990.845) (-1992.503) [-1985.853] (-2007.925) * [-1982.544] (-2003.419) (-1992.428) (-1989.568) -- 0:01:06
797400 -- [-1987.131] (-1991.695) (-1985.182) (-1992.607) * [-1982.634] (-1999.056) (-1997.929) (-1985.820) -- 0:01:06
797500 -- (-1986.102) (-1998.789) [-1989.476] (-1993.736) * [-1989.411] (-1997.437) (-2008.806) (-1980.479) -- 0:01:06
797600 -- (-1983.566) (-1996.116) (-1987.823) [-1990.874] * (-1992.123) (-1993.995) (-1997.940) [-1983.943] -- 0:01:05
797700 -- [-1978.265] (-2000.275) (-1987.630) (-1991.275) * [-1988.452] (-1995.186) (-2006.179) (-1983.836) -- 0:01:05
797800 -- [-1982.055] (-2005.900) (-1986.931) (-1990.438) * (-1986.504) [-1984.958] (-2001.445) (-1982.942) -- 0:01:05
797900 -- [-1983.443] (-2010.538) (-1988.042) (-1988.077) * [-1983.713] (-1997.817) (-2000.672) (-1988.478) -- 0:01:05
798000 -- [-1982.405] (-2010.073) (-1989.383) (-2001.439) * [-1979.036] (-2008.700) (-2001.069) (-1979.253) -- 0:01:05
Average standard deviation of split frequencies: 0.001738
798100 -- (-1987.185) (-1999.415) [-1981.634] (-1999.295) * (-1989.321) (-2008.227) [-1996.959] (-1987.265) -- 0:01:05
798200 -- (-1982.023) (-1997.921) [-1986.534] (-1996.849) * (-1998.051) (-2000.528) (-1992.022) [-1980.714] -- 0:01:05
798300 -- [-1984.056] (-1992.163) (-1987.844) (-2009.504) * (-1992.658) (-1993.373) (-1993.086) [-1983.648] -- 0:01:05
798400 -- [-1985.055] (-1997.886) (-1987.910) (-2005.763) * (-1997.285) [-1997.724] (-1993.535) (-1984.967) -- 0:01:05
798500 -- [-1988.996] (-1990.431) (-1995.433) (-2001.400) * (-1995.952) (-1993.922) [-1987.815] (-1990.804) -- 0:01:05
798600 -- (-1985.750) [-1991.802] (-2003.873) (-2003.631) * [-1991.744] (-1985.749) (-1991.931) (-1989.106) -- 0:01:05
798700 -- [-1985.529] (-1985.341) (-1993.231) (-1997.597) * (-1988.984) [-1984.246] (-1989.801) (-1990.495) -- 0:01:05
798800 -- [-1979.525] (-1993.028) (-1996.394) (-1994.512) * [-1989.615] (-1995.425) (-1991.287) (-1991.229) -- 0:01:05
798900 -- [-1981.143] (-1991.148) (-1995.592) (-1990.879) * (-1990.167) (-1993.328) (-1990.830) [-1980.955] -- 0:01:05
799000 -- [-1978.603] (-1997.013) (-2006.262) (-1997.330) * (-1982.716) (-1990.798) (-1986.459) [-1981.743] -- 0:01:05
Average standard deviation of split frequencies: 0.001803
799100 -- (-1981.039) (-2004.195) (-2003.137) [-2000.413] * (-1987.132) [-1994.311] (-1990.911) (-1982.208) -- 0:01:05
799200 -- [-1980.158] (-1992.810) (-1996.526) (-1997.691) * (-1984.313) (-1993.809) [-1988.180] (-1984.787) -- 0:01:05
799300 -- [-1980.767] (-2005.696) (-1988.932) (-1996.596) * [-1979.992] (-1994.384) (-1988.191) (-1982.180) -- 0:01:05
799400 -- (-1983.180) (-1995.919) [-1982.195] (-2001.523) * [-1981.681] (-1991.122) (-1987.553) (-1979.219) -- 0:01:05
799500 -- (-1983.504) (-2001.078) [-1981.298] (-1999.899) * [-1980.971] (-1993.320) (-1985.621) (-1980.048) -- 0:01:05
799600 -- [-1985.313] (-2001.011) (-1985.773) (-1994.111) * (-1984.963) (-1990.963) (-1986.836) [-1989.852] -- 0:01:05
799700 -- (-1991.726) (-2003.738) [-1983.831] (-1996.394) * (-1988.597) (-1995.677) (-1988.606) [-1989.403] -- 0:01:05
799800 -- (-1992.180) (-2001.255) (-1983.395) [-1985.650] * (-1991.460) (-1997.979) [-1994.082] (-1992.841) -- 0:01:05
799900 -- (-1990.605) (-2000.016) [-1986.032] (-1988.715) * [-1990.986] (-1994.483) (-1999.240) (-1993.369) -- 0:01:05
800000 -- (-1991.499) (-1993.178) (-1985.805) [-1987.829] * [-1992.960] (-1993.225) (-2000.171) (-1992.812) -- 0:01:05
Average standard deviation of split frequencies: 0.001818
800100 -- (-1993.714) (-1989.787) (-1979.569) [-1987.426] * (-1986.322) (-1992.404) (-2001.922) [-1980.184] -- 0:01:05
800200 -- [-1988.004] (-1992.539) (-1989.790) (-1985.934) * (-1989.770) (-1998.299) (-2014.117) [-1979.336] -- 0:01:05
800300 -- (-1988.019) (-2003.465) (-1997.348) [-1988.632] * (-1993.317) (-1996.207) (-1997.755) [-1979.517] -- 0:01:05
800400 -- (-1985.350) (-1995.607) (-1997.296) [-1988.661] * (-1984.667) (-1995.296) (-1996.609) [-1981.837] -- 0:01:05
800500 -- (-1988.626) [-1987.517] (-1988.268) (-1998.400) * (-1987.225) (-1995.918) (-1994.561) [-1988.694] -- 0:01:05
800600 -- (-1981.690) (-1987.449) [-1986.143] (-1997.609) * (-1991.333) [-1989.395] (-2000.965) (-1988.732) -- 0:01:05
800700 -- [-1979.325] (-1996.067) (-1989.773) (-1992.242) * [-1981.143] (-1986.041) (-2007.764) (-1989.756) -- 0:01:04
800800 -- [-1982.232] (-1985.462) (-1989.389) (-1992.668) * (-1984.916) (-1987.391) (-2004.205) [-1983.804] -- 0:01:04
800900 -- (-1986.418) [-1985.018] (-1989.243) (-2001.576) * [-1988.842] (-1990.507) (-1997.543) (-1981.409) -- 0:01:04
801000 -- (-1982.220) [-1985.381] (-1990.484) (-2006.842) * (-1988.200) (-1995.038) (-1997.003) [-1983.087] -- 0:01:04
Average standard deviation of split frequencies: 0.001849
801100 -- [-1985.286] (-1988.469) (-1989.238) (-2005.409) * (-1986.358) (-1994.499) (-1995.835) [-1980.058] -- 0:01:04
801200 -- (-1980.668) (-1991.274) [-1988.258] (-2002.512) * (-1991.229) (-2000.034) (-1996.422) [-1983.645] -- 0:01:04
801300 -- [-1984.075] (-1998.774) (-1991.756) (-2009.044) * (-2001.226) (-1994.670) (-1993.972) [-1984.138] -- 0:01:04
801400 -- [-1986.434] (-1987.556) (-1992.665) (-2020.874) * (-1992.449) (-1997.155) (-1985.557) [-1979.781] -- 0:01:04
801500 -- [-1984.499] (-1987.644) (-1988.202) (-1996.325) * (-1986.704) (-1996.876) (-1984.767) [-1978.995] -- 0:01:04
801600 -- (-1990.239) [-1986.332] (-1986.656) (-1995.517) * [-1981.795] (-2001.379) (-1986.051) (-1985.072) -- 0:01:04
801700 -- (-1993.253) (-1984.494) [-1982.882] (-2001.288) * (-1988.337) [-1993.609] (-1987.928) (-1991.907) -- 0:01:04
801800 -- (-1992.068) [-1986.769] (-1981.000) (-2004.249) * [-1983.291] (-1995.029) (-1986.674) (-1985.655) -- 0:01:04
801900 -- (-1990.700) [-1988.499] (-1984.380) (-1999.329) * (-1978.174) (-1992.723) (-1985.054) [-1984.909] -- 0:01:04
802000 -- (-1994.860) [-1985.396] (-1988.982) (-2009.879) * [-1988.102] (-1992.904) (-1986.901) (-1983.085) -- 0:01:04
Average standard deviation of split frequencies: 0.001881
802100 -- (-1992.274) (-1995.518) [-1983.310] (-2001.347) * (-1980.863) (-1998.965) (-1988.253) [-1984.071] -- 0:01:04
802200 -- [-1991.199] (-2000.215) (-1985.478) (-2013.902) * [-1986.348] (-2002.496) (-1999.690) (-1982.194) -- 0:01:04
802300 -- [-1989.341] (-1995.461) (-1991.888) (-2006.736) * [-1986.532] (-2008.927) (-1993.303) (-1984.610) -- 0:01:04
802400 -- [-1989.656] (-2002.064) (-1990.856) (-2005.129) * [-1982.859] (-2013.788) (-1992.158) (-1990.911) -- 0:01:04
802500 -- [-1994.213] (-2002.544) (-1987.821) (-2004.275) * (-1996.050) (-2014.028) (-1998.391) [-1989.077] -- 0:01:04
802600 -- [-1989.770] (-2003.726) (-1993.484) (-2007.047) * (-1996.212) (-2011.993) [-1988.738] (-1991.675) -- 0:01:04
802700 -- (-1994.065) (-2006.214) [-1987.769] (-2001.877) * (-1991.109) (-2004.986) (-1988.457) [-1986.156] -- 0:01:04
802800 -- (-1992.197) (-1996.179) [-1989.019] (-1999.312) * (-1989.621) (-2005.705) (-1987.104) [-1987.831] -- 0:01:04
802900 -- (-1991.357) (-1997.246) [-1983.778] (-2003.769) * (-1995.826) (-1996.779) (-1988.508) [-1985.345] -- 0:01:04
803000 -- [-1989.474] (-1995.565) (-1987.836) (-1999.089) * (-2002.293) [-1991.849] (-1992.388) (-1984.675) -- 0:01:04
Average standard deviation of split frequencies: 0.001828
803100 -- (-1986.755) (-1994.427) (-1991.796) [-2000.328] * (-2008.799) (-1988.069) (-1988.444) [-1984.788] -- 0:01:04
803200 -- [-1987.279] (-1995.344) (-1997.902) (-2005.812) * (-1995.899) (-1991.659) (-1991.234) [-1981.930] -- 0:01:04
803300 -- [-1982.791] (-1994.111) (-1993.368) (-2000.123) * (-1993.709) (-1994.718) (-1991.189) [-1987.010] -- 0:01:04
803400 -- [-1983.092] (-1993.791) (-1988.436) (-2000.231) * (-1990.624) (-1985.285) (-1990.107) [-1990.242] -- 0:01:04
803500 -- (-1985.070) (-1990.728) [-1988.056] (-1994.597) * (-1985.916) (-1985.486) (-1997.964) [-1982.638] -- 0:01:04
803600 -- [-1982.565] (-1988.379) (-1993.777) (-1993.006) * (-1990.434) (-1984.744) (-2007.547) [-1987.011] -- 0:01:04
803700 -- (-1986.694) [-1986.985] (-1999.249) (-1992.775) * (-1990.072) (-1990.057) (-2006.504) [-1991.761] -- 0:01:03
803800 -- [-1990.055] (-1993.126) (-1997.072) (-1995.446) * [-1989.345] (-1984.199) (-1998.510) (-1987.167) -- 0:01:03
803900 -- (-1985.284) [-1996.472] (-1992.764) (-2000.383) * (-1985.190) (-1988.746) (-1998.223) [-1983.845] -- 0:01:03
804000 -- [-1982.561] (-1992.995) (-1993.173) (-2003.297) * (-1989.496) (-1989.629) (-1996.754) [-1987.035] -- 0:01:03
Average standard deviation of split frequencies: 0.001775
804100 -- (-1982.660) (-1987.106) [-1988.271] (-1994.627) * (-1988.370) [-1991.475] (-1989.939) (-1987.544) -- 0:01:03
804200 -- [-1980.438] (-1985.943) (-1999.655) (-1989.185) * (-1994.004) (-1987.979) [-1990.816] (-1988.395) -- 0:01:03
804300 -- [-1981.881] (-1994.455) (-1996.429) (-1990.693) * [-1990.703] (-1987.549) (-1995.825) (-1990.231) -- 0:01:03
804400 -- [-1984.884] (-2000.523) (-1991.400) (-1991.159) * [-1987.314] (-1991.441) (-1992.649) (-1990.566) -- 0:01:03
804500 -- [-1981.780] (-1990.375) (-2003.883) (-1993.336) * [-1988.564] (-1991.513) (-1999.001) (-1996.698) -- 0:01:03
804600 -- [-1987.524] (-1988.783) (-1998.637) (-1999.980) * (-1989.842) (-1986.841) [-1993.665] (-1999.283) -- 0:01:03
804700 -- [-1991.006] (-1991.581) (-1985.910) (-2003.728) * (-1986.812) (-1997.247) (-1994.925) [-1988.467] -- 0:01:03
804800 -- (-1992.695) [-1991.205] (-1992.217) (-2003.484) * (-1990.334) (-1996.958) (-1984.974) [-1987.461] -- 0:01:03
804900 -- (-1984.107) [-1992.877] (-1997.581) (-1996.954) * [-1988.347] (-1992.173) (-1986.026) (-1998.106) -- 0:01:03
805000 -- [-1985.784] (-2002.267) (-2003.183) (-1993.060) * (-1992.404) [-2000.321] (-1988.500) (-1998.506) -- 0:01:03
Average standard deviation of split frequencies: 0.001807
805100 -- [-1979.285] (-2003.354) (-1998.513) (-1999.548) * (-1984.145) (-1999.199) (-1991.917) [-1994.836] -- 0:01:03
805200 -- [-1979.645] (-1996.782) (-1998.956) (-1996.443) * [-1980.640] (-1994.087) (-1999.423) (-2003.594) -- 0:01:03
805300 -- [-1982.146] (-1990.904) (-1987.487) (-1993.710) * [-1983.653] (-1986.341) (-1996.362) (-1999.510) -- 0:01:03
805400 -- (-1987.148) (-1989.830) (-1991.513) [-1988.664] * [-1980.380] (-1981.517) (-1992.609) (-2003.022) -- 0:01:03
805500 -- (-1988.754) [-1987.004] (-1994.948) (-1985.347) * (-1982.561) [-1979.337] (-1986.584) (-2007.366) -- 0:01:03
805600 -- (-1987.860) [-1994.750] (-1996.065) (-1990.483) * (-1984.071) [-1981.012] (-1985.332) (-2000.498) -- 0:01:03
805700 -- [-1991.445] (-1992.151) (-1991.301) (-1992.659) * (-1983.317) (-1980.381) [-1990.454] (-2008.194) -- 0:01:03
805800 -- (-1998.719) (-1997.860) (-2001.108) [-1995.691] * [-1982.379] (-1986.683) (-1990.364) (-2000.837) -- 0:01:03
805900 -- (-1994.374) (-1995.861) [-1999.148] (-1996.688) * (-1981.178) (-1988.825) [-1989.249] (-1997.500) -- 0:01:03
806000 -- (-1987.887) (-1991.609) [-1989.266] (-2000.564) * [-1984.998] (-1986.178) (-1981.707) (-2007.384) -- 0:01:03
Average standard deviation of split frequencies: 0.001972
806100 -- (-1991.033) [-1992.838] (-2003.008) (-1996.662) * [-1983.706] (-2014.617) (-1983.949) (-1997.235) -- 0:01:03
806200 -- [-1987.185] (-1987.614) (-1995.768) (-1991.546) * (-1982.009) (-2017.252) [-1987.580] (-2000.912) -- 0:01:03
806300 -- (-1984.976) (-1989.975) (-1988.445) [-1988.550] * [-1982.988] (-2001.308) (-1985.137) (-2006.671) -- 0:01:03
806400 -- [-1987.288] (-1991.009) (-1990.610) (-1988.169) * (-1982.037) (-2000.965) [-1985.497] (-2004.851) -- 0:01:03
806500 -- (-1996.474) (-2008.526) [-1990.478] (-1988.997) * (-1983.327) (-1997.825) [-1983.655] (-1999.447) -- 0:01:03
806600 -- (-1986.382) (-2001.200) [-1986.920] (-1985.356) * (-1984.367) (-1997.523) [-1984.155] (-2005.637) -- 0:01:03
806700 -- (-1988.725) (-1998.044) [-1982.327] (-1986.978) * [-1987.051] (-2000.568) (-1990.233) (-2002.394) -- 0:01:03
806800 -- [-1986.283] (-2001.629) (-1987.590) (-1989.362) * (-1987.931) (-1993.158) [-1988.741] (-1999.710) -- 0:01:02
806900 -- (-1987.140) (-1998.855) [-1987.299] (-1990.146) * [-1989.502] (-1993.454) (-1996.276) (-1995.916) -- 0:01:02
807000 -- [-1983.984] (-1996.672) (-1996.350) (-1988.968) * (-1989.685) [-1985.831] (-1992.428) (-2000.789) -- 0:01:02
Average standard deviation of split frequencies: 0.001969
807100 -- (-1987.879) (-1998.627) [-1990.348] (-1990.435) * (-1986.291) [-1983.984] (-1989.492) (-1999.312) -- 0:01:02
807200 -- [-1983.391] (-2000.933) (-1990.084) (-1993.112) * (-1996.134) [-1991.110] (-1992.884) (-1994.105) -- 0:01:02
807300 -- [-1985.632] (-1994.412) (-1993.668) (-1995.942) * (-1993.747) [-1988.828] (-1993.780) (-1989.367) -- 0:01:02
807400 -- [-1985.530] (-1993.999) (-1994.217) (-1985.094) * (-1989.506) [-1985.944] (-1991.327) (-1987.724) -- 0:01:02
807500 -- (-1990.090) (-1998.340) (-2001.861) [-1985.790] * (-1985.253) [-1984.520] (-1995.277) (-1987.766) -- 0:01:02
807600 -- [-1987.131] (-1990.395) (-1994.001) (-1986.724) * (-1985.185) (-1989.603) (-1997.030) [-1988.782] -- 0:01:02
807700 -- (-1984.139) (-1996.989) (-1995.104) [-1984.854] * [-1984.486] (-1986.904) (-1998.939) (-1992.822) -- 0:01:02
807800 -- [-1984.471] (-1998.943) (-1999.871) (-1985.849) * [-1981.141] (-1985.693) (-2001.484) (-1990.164) -- 0:01:02
807900 -- (-1990.063) (-1990.501) [-1986.072] (-1988.937) * [-1987.501] (-1985.132) (-2004.314) (-1993.699) -- 0:01:02
808000 -- (-1991.457) (-1995.754) [-1988.859] (-2001.264) * [-1987.262] (-1984.314) (-2002.877) (-1994.897) -- 0:01:02
Average standard deviation of split frequencies: 0.001933
808100 -- (-1994.833) (-1996.899) [-1992.190] (-1999.967) * [-1980.594] (-1987.601) (-1994.137) (-1992.382) -- 0:01:02
808200 -- [-1992.348] (-1999.008) (-1994.349) (-2000.928) * [-1979.827] (-2000.578) (-1999.556) (-1994.179) -- 0:01:02
808300 -- (-1994.766) (-1994.606) [-1985.198] (-2004.483) * [-1982.043] (-1999.760) (-2008.007) (-1995.738) -- 0:01:02
808400 -- [-1987.807] (-1989.639) (-1987.991) (-2002.932) * [-1979.698] (-1995.414) (-2008.169) (-1996.757) -- 0:01:02
808500 -- [-1990.899] (-1988.353) (-1992.572) (-2000.451) * [-1981.636] (-1993.130) (-2004.972) (-2002.552) -- 0:01:02
808600 -- (-1990.516) [-1987.939] (-1985.093) (-1996.473) * [-1979.810] (-1998.841) (-2013.525) (-1999.715) -- 0:01:02
808700 -- (-1993.439) [-1986.734] (-1990.984) (-2006.255) * [-1984.633] (-1998.368) (-2010.087) (-1997.734) -- 0:01:02
808800 -- (-1987.146) [-1981.428] (-1985.035) (-1999.963) * [-1984.737] (-1998.630) (-2013.807) (-1999.583) -- 0:01:02
808900 -- (-1997.261) [-1985.178] (-1987.627) (-2002.576) * [-1983.349] (-1999.661) (-2011.049) (-2001.846) -- 0:01:02
809000 -- (-1998.020) [-1983.516] (-1987.375) (-1993.789) * [-1986.601] (-2001.027) (-2013.250) (-2010.225) -- 0:01:02
Average standard deviation of split frequencies: 0.001981
809100 -- (-1999.220) [-1983.732] (-1985.505) (-1993.531) * [-1983.319] (-2004.886) (-2006.959) (-2004.328) -- 0:01:02
809200 -- (-2001.110) [-1983.292] (-1988.182) (-1999.419) * [-1985.160] (-1992.126) (-2007.848) (-2008.410) -- 0:01:02
809300 -- (-1996.027) (-1984.730) [-1985.326] (-1995.550) * [-1982.492] (-1985.216) (-2009.841) (-2006.386) -- 0:01:02
809400 -- (-2001.703) (-1989.404) (-1989.796) [-1988.554] * (-1983.569) [-1978.776] (-2014.274) (-2000.661) -- 0:01:02
809500 -- (-1999.517) (-1982.836) (-1989.773) [-1990.606] * (-1988.348) [-1983.873] (-2014.232) (-1994.472) -- 0:01:02
809600 -- (-1994.111) [-1985.239] (-1988.379) (-1990.159) * (-1990.397) [-1982.873] (-2003.217) (-1993.067) -- 0:01:02
809700 -- (-1988.143) [-1985.508] (-1995.174) (-1992.901) * (-1992.119) [-1978.510] (-2010.930) (-1998.827) -- 0:01:02
809800 -- (-1986.008) [-1979.895] (-1999.994) (-1993.301) * (-1988.810) [-1980.099] (-2008.169) (-2006.679) -- 0:01:02
809900 -- [-1989.664] (-1982.339) (-1994.380) (-2003.296) * (-1985.918) [-1982.236] (-2003.179) (-1992.430) -- 0:01:01
810000 -- (-1991.032) [-1981.654] (-1990.245) (-2003.054) * [-1982.553] (-1983.989) (-2007.898) (-1988.814) -- 0:01:01
Average standard deviation of split frequencies: 0.001912
810100 -- (-1995.676) [-1980.241] (-1988.194) (-2010.244) * [-1982.614] (-1982.957) (-1997.610) (-1989.504) -- 0:01:01
810200 -- (-1988.890) (-1982.519) [-1991.607] (-2006.120) * (-1992.751) (-1980.802) [-1992.158] (-1991.538) -- 0:01:01
810300 -- [-1987.928] (-1985.348) (-1994.086) (-2023.825) * (-1988.236) [-1983.937] (-1993.743) (-1998.721) -- 0:01:01
810400 -- (-2004.939) [-1985.460] (-1993.802) (-2001.820) * (-1998.250) [-1980.099] (-1989.365) (-1991.140) -- 0:01:01
810500 -- (-2002.673) [-1988.097] (-1991.257) (-1996.450) * (-1998.039) [-1980.352] (-1992.517) (-1989.538) -- 0:01:01
810600 -- (-1988.645) [-1984.359] (-1986.677) (-1996.717) * (-1993.962) [-1981.980] (-1994.881) (-1989.764) -- 0:01:01
810700 -- (-1993.764) (-1984.967) (-1986.201) [-1991.833] * (-2002.415) [-1981.116] (-1992.158) (-1987.909) -- 0:01:01
810800 -- (-1998.564) [-1980.596] (-1989.019) (-1993.448) * (-1995.362) [-1980.248] (-2002.548) (-1990.532) -- 0:01:01
810900 -- (-1994.578) [-1980.045] (-1988.350) (-1997.685) * (-2011.918) [-1978.901] (-2001.308) (-1992.216) -- 0:01:01
811000 -- (-1989.232) [-1984.064] (-1990.997) (-2003.129) * (-1993.431) (-1989.666) (-2001.497) [-1992.521] -- 0:01:01
Average standard deviation of split frequencies: 0.001909
811100 -- (-1987.358) (-1981.279) [-1985.194] (-2000.815) * [-1986.869] (-1986.940) (-2003.472) (-1992.648) -- 0:01:01
811200 -- (-1993.716) [-1980.008] (-1987.127) (-2015.862) * (-1990.992) (-1985.558) (-1993.303) [-1988.377] -- 0:01:01
811300 -- (-1996.779) [-1980.437] (-1997.742) (-2012.832) * (-1990.795) [-1983.633] (-1987.058) (-1996.457) -- 0:01:01
811400 -- (-1991.509) [-1984.289] (-1991.209) (-2002.180) * (-1989.339) [-1981.213] (-1996.401) (-1997.907) -- 0:01:01
811500 -- (-1993.681) [-1984.754] (-1990.278) (-1996.690) * (-1987.107) [-1982.106] (-2005.089) (-1994.168) -- 0:01:01
811600 -- [-1989.423] (-1989.104) (-1990.387) (-1996.258) * (-1985.262) [-1982.373] (-2013.088) (-1992.104) -- 0:01:01
811700 -- (-1987.767) (-1984.867) [-1990.835] (-2000.834) * (-1986.023) [-1980.842] (-2005.087) (-1995.026) -- 0:01:01
811800 -- (-1988.429) [-1986.557] (-1991.286) (-1992.584) * (-1993.470) [-1989.088] (-2014.241) (-2002.391) -- 0:01:01
811900 -- (-1999.871) (-1987.586) [-1991.089] (-1989.273) * (-1993.559) [-1986.675] (-2009.348) (-1998.562) -- 0:01:01
812000 -- (-1997.988) (-1989.635) [-1996.090] (-1987.704) * [-1984.553] (-1985.727) (-2004.272) (-1990.357) -- 0:01:01
Average standard deviation of split frequencies: 0.001907
812100 -- (-2000.965) [-1978.833] (-2000.813) (-1990.636) * (-1989.899) [-1982.429] (-1988.570) (-1988.565) -- 0:01:01
812200 -- (-1996.339) [-1985.020] (-2000.509) (-1995.533) * (-1991.498) [-1981.483] (-1990.383) (-1991.750) -- 0:01:01
812300 -- (-1993.847) [-1987.270] (-1996.240) (-1988.649) * (-1986.492) [-1984.846] (-1987.432) (-2006.135) -- 0:01:01
812400 -- (-1992.042) [-1984.728] (-1998.139) (-1990.055) * (-1988.364) (-1994.108) [-1981.390] (-2005.906) -- 0:01:01
812500 -- (-1994.469) (-1986.502) (-1999.081) [-1990.533] * (-1988.949) (-1981.960) [-1986.348] (-2004.181) -- 0:01:01
812600 -- (-1993.068) (-1983.923) [-1989.710] (-1994.500) * (-1987.715) [-1987.543] (-1988.979) (-1997.239) -- 0:01:01
812700 -- (-1997.041) [-1985.723] (-1996.635) (-1997.298) * (-1996.030) (-1985.305) [-1988.160] (-2003.954) -- 0:01:01
812800 -- (-1990.015) [-1984.932] (-1996.293) (-2006.257) * (-2002.015) [-1985.355] (-1988.404) (-1995.017) -- 0:01:01
812900 -- (-1994.767) (-1994.840) [-1988.589] (-2000.494) * (-1999.463) [-1983.477] (-1990.623) (-1986.675) -- 0:01:00
813000 -- (-1989.781) (-2000.098) [-1985.408] (-1988.713) * (-2002.524) (-1980.508) (-1990.013) [-1984.986] -- 0:01:00
Average standard deviation of split frequencies: 0.001855
813100 -- [-1990.271] (-1990.677) (-1987.014) (-1996.842) * (-1993.101) [-1990.895] (-1998.732) (-1992.655) -- 0:01:00
813200 -- (-1990.199) (-1992.549) [-1988.614] (-2004.981) * (-1989.444) (-1989.522) [-1992.217] (-1993.762) -- 0:01:00
813300 -- (-1989.050) (-1993.797) [-1983.398] (-1993.630) * (-1995.961) [-1985.842] (-2001.120) (-1990.355) -- 0:01:00
813400 -- (-1988.472) (-1997.460) [-1990.889] (-1994.123) * (-1992.110) [-1985.763] (-2003.393) (-1987.307) -- 0:01:00
813500 -- (-1991.382) (-1993.785) (-1989.750) [-1984.791] * (-1989.567) [-1985.997] (-2001.839) (-1994.093) -- 0:01:00
813600 -- (-1997.613) (-1988.352) (-1992.782) [-1989.962] * (-1989.233) [-1987.445] (-2002.827) (-1991.188) -- 0:01:00
813700 -- (-2010.162) (-1996.495) (-1989.307) [-1987.645] * (-1992.346) [-1988.046] (-2000.730) (-1991.303) -- 0:01:00
813800 -- (-2009.498) [-1989.140] (-1998.857) (-1985.501) * (-1992.418) (-1994.484) (-1997.740) [-1988.568] -- 0:01:00
813900 -- (-2006.268) (-1990.880) (-1997.814) [-1989.355] * (-1994.327) (-1992.842) (-2002.232) [-1990.109] -- 0:01:00
814000 -- (-2001.682) (-1985.346) (-1991.630) [-1991.498] * (-1992.577) (-1988.040) [-1992.192] (-1993.966) -- 0:01:00
Average standard deviation of split frequencies: 0.001886
814100 -- (-1998.461) [-1986.238] (-1997.121) (-1986.025) * [-1995.570] (-1995.250) (-1997.312) (-1993.631) -- 0:01:00
814200 -- (-1996.653) [-1986.956] (-1994.718) (-1994.477) * [-1992.467] (-1996.372) (-1996.463) (-1985.867) -- 0:01:00
814300 -- (-1996.564) [-1983.091] (-2003.935) (-1996.883) * (-1998.453) (-1999.093) (-1998.638) [-1981.673] -- 0:01:00
814400 -- (-2001.785) [-1979.947] (-1991.218) (-1990.751) * (-1997.141) (-1997.953) (-1999.165) [-1984.460] -- 0:01:00
814500 -- (-1998.785) [-1978.546] (-1996.398) (-1991.767) * (-1992.075) (-1996.626) (-1995.919) [-1989.154] -- 0:01:00
814600 -- (-1991.534) (-1981.299) (-1997.156) [-1985.808] * [-1993.163] (-1993.736) (-1996.189) (-1990.148) -- 0:01:00
814700 -- [-1994.165] (-1983.250) (-1996.061) (-1991.919) * (-1987.268) (-1989.610) (-1995.346) [-1989.892] -- 0:01:00
814800 -- (-1993.353) [-1981.531] (-1997.717) (-2004.907) * [-1988.197] (-1992.295) (-1993.474) (-1993.265) -- 0:01:00
814900 -- (-1992.855) (-1987.223) [-1991.977] (-2003.603) * (-1996.015) (-1987.765) (-1990.257) [-1990.093] -- 0:01:00
815000 -- (-1995.447) [-1984.640] (-1993.887) (-2003.957) * (-1993.213) (-1983.510) (-1991.485) [-1985.936] -- 0:01:00
Average standard deviation of split frequencies: 0.001884
815100 -- (-1999.017) [-1981.257] (-1989.268) (-2007.418) * (-1997.151) (-1993.849) (-1990.437) [-1990.032] -- 0:01:00
815200 -- (-2000.122) [-1980.989] (-1993.344) (-2007.687) * (-1994.738) [-1991.490] (-2004.997) (-1990.728) -- 0:01:00
815300 -- (-1993.962) [-1984.655] (-1990.739) (-2004.799) * (-1990.354) (-1991.896) (-1996.418) [-1989.243] -- 0:01:00
815400 -- (-2000.712) (-1987.529) [-1989.377] (-2002.711) * (-1997.021) [-1995.577] (-1997.568) (-1986.622) -- 0:01:00
815500 -- (-2000.487) (-1987.825) [-1988.586] (-1994.808) * (-1997.705) (-2003.313) (-1996.507) [-1989.898] -- 0:01:00
815600 -- (-1993.035) [-1986.199] (-1991.987) (-1996.157) * (-1995.266) [-1991.387] (-1987.903) (-2003.877) -- 0:01:00
815700 -- (-1996.419) [-1982.710] (-1989.269) (-1993.777) * (-1988.938) [-1986.894] (-1987.730) (-1996.795) -- 0:01:00
815800 -- (-2002.068) (-1986.434) [-1988.557] (-1997.288) * (-1988.529) (-1991.592) [-1987.920] (-1994.226) -- 0:01:00
815900 -- (-1997.034) (-1985.018) [-1986.577] (-2007.739) * [-1984.842] (-1987.309) (-1992.482) (-1992.447) -- 0:01:00
816000 -- (-1990.341) [-1986.646] (-1987.413) (-2004.995) * (-1988.349) [-1985.621] (-1999.470) (-2003.612) -- 0:00:59
Average standard deviation of split frequencies: 0.001964
816100 -- [-1984.106] (-1985.306) (-1985.435) (-1997.081) * (-1985.094) [-1985.025] (-1991.961) (-2001.550) -- 0:00:59
816200 -- [-1989.527] (-1988.490) (-1989.633) (-2009.173) * [-1985.011] (-1989.487) (-1991.933) (-1997.569) -- 0:00:59
816300 -- [-1987.096] (-1985.594) (-1993.639) (-2001.316) * [-1984.505] (-1987.972) (-1998.120) (-2003.446) -- 0:00:59
816400 -- [-1982.732] (-1978.739) (-1993.881) (-1996.277) * (-1988.464) [-1983.504] (-1992.339) (-2002.709) -- 0:00:59
816500 -- (-1986.305) [-1985.565] (-1993.166) (-1992.238) * [-1978.999] (-1981.876) (-2001.047) (-1999.486) -- 0:00:59
816600 -- (-1992.974) (-1993.451) [-1989.277] (-1996.115) * [-1979.791] (-1984.432) (-1993.186) (-1995.983) -- 0:00:59
816700 -- (-1988.031) (-1997.109) (-1987.900) [-1992.645] * (-1988.651) [-1986.386] (-1996.089) (-1998.002) -- 0:00:59
816800 -- [-1987.111] (-2002.605) (-1985.773) (-1990.483) * [-1985.507] (-1984.512) (-1993.999) (-1998.030) -- 0:00:59
816900 -- [-1983.967] (-2001.872) (-1993.945) (-1993.210) * [-1982.012] (-1991.922) (-1992.613) (-1993.670) -- 0:00:59
817000 -- [-1985.707] (-2004.015) (-1985.640) (-1996.579) * [-1977.377] (-1988.024) (-1995.199) (-1991.517) -- 0:00:59
Average standard deviation of split frequencies: 0.001994
817100 -- [-1990.799] (-2004.854) (-1988.379) (-2007.887) * [-1978.413] (-1988.882) (-1989.615) (-1992.275) -- 0:00:59
817200 -- (-1987.712) (-1994.148) [-1987.880] (-1990.239) * [-1981.625] (-1993.430) (-1992.190) (-1999.984) -- 0:00:59
817300 -- (-1990.805) (-1999.081) [-1990.249] (-1994.714) * [-1983.218] (-1994.215) (-1995.868) (-2001.206) -- 0:00:59
817400 -- [-1991.272] (-1998.428) (-1992.905) (-1990.375) * (-1983.044) (-2001.050) [-1994.728] (-2000.224) -- 0:00:59
817500 -- (-1993.035) (-1997.930) [-1995.041] (-1987.385) * [-1982.354] (-1996.088) (-1996.553) (-1994.453) -- 0:00:59
817600 -- (-1992.585) (-1991.612) (-1992.978) [-1985.541] * (-1987.337) (-1997.607) (-1992.797) [-1991.766] -- 0:00:59
817700 -- (-1992.401) (-1995.568) (-1990.905) [-1987.867] * [-1986.446] (-1994.042) (-1991.743) (-1994.972) -- 0:00:59
817800 -- [-1992.633] (-1995.204) (-1996.151) (-1986.217) * [-1988.932] (-1990.590) (-2000.997) (-2001.667) -- 0:00:59
817900 -- (-1995.928) (-2004.393) [-1992.393] (-1989.754) * [-1981.546] (-1981.712) (-1998.601) (-1996.024) -- 0:00:59
818000 -- (-1987.723) (-2010.741) [-1989.411] (-1989.810) * [-1983.149] (-1988.442) (-1999.726) (-1992.022) -- 0:00:59
Average standard deviation of split frequencies: 0.002107
818100 -- [-1988.485] (-1999.945) (-1994.188) (-1994.045) * [-1983.490] (-1995.978) (-1998.505) (-1991.352) -- 0:00:59
818200 -- [-1994.705] (-2000.975) (-1999.008) (-1992.559) * [-1985.444] (-1997.249) (-1995.517) (-1988.235) -- 0:00:59
818300 -- (-1991.185) (-1998.885) (-1995.700) [-1987.631] * [-1988.191] (-1990.701) (-1990.342) (-1991.785) -- 0:00:59
818400 -- (-1998.565) [-1999.210] (-1994.111) (-1990.475) * (-1985.838) (-1998.819) [-1987.643] (-1994.833) -- 0:00:59
818500 -- (-2004.225) (-2006.941) (-1992.772) [-1991.876] * (-1986.096) (-2000.539) [-1988.722] (-1987.088) -- 0:00:59
818600 -- (-2009.806) (-2002.472) [-1988.117] (-1995.841) * (-1981.283) (-1990.784) [-1988.345] (-1991.337) -- 0:00:59
818700 -- (-1996.072) (-1998.881) (-1993.033) [-1991.628] * (-1982.553) [-1985.455] (-1990.685) (-1991.124) -- 0:00:59
818800 -- [-1993.913] (-1997.571) (-1994.309) (-1993.235) * (-1988.910) [-1986.042] (-1991.933) (-2006.164) -- 0:00:59
818900 -- [-1992.221] (-1997.630) (-1995.290) (-1988.167) * (-1985.914) (-1980.299) [-1983.573] (-2003.329) -- 0:00:59
819000 -- (-1992.809) (-1995.470) (-1987.514) [-1984.194] * [-1982.305] (-1982.121) (-1987.452) (-2000.924) -- 0:00:59
Average standard deviation of split frequencies: 0.002187
819100 -- (-1995.838) (-1986.838) (-1986.793) [-1989.186] * (-1990.549) (-1983.445) [-1987.228] (-1996.393) -- 0:00:58
819200 -- (-1992.867) [-1984.917] (-1989.231) (-1990.169) * (-1990.704) [-1981.291] (-1986.840) (-1994.904) -- 0:00:58
819300 -- (-2001.246) [-1979.583] (-1993.537) (-1996.459) * [-1985.967] (-1981.121) (-1987.995) (-1996.884) -- 0:00:58
819400 -- (-1996.753) (-1985.143) (-1993.673) [-1989.167] * (-1988.774) [-1979.602] (-1990.905) (-1995.191) -- 0:00:58
819500 -- (-1991.753) [-1983.034] (-2000.166) (-1990.082) * (-1992.616) [-1985.736] (-1996.401) (-2002.364) -- 0:00:58
819600 -- (-1995.608) (-1985.197) (-2018.413) [-1994.925] * [-1986.344] (-1990.528) (-1992.316) (-2001.227) -- 0:00:58
819700 -- (-1987.080) [-1984.424] (-2001.786) (-1991.060) * [-1983.304] (-1987.326) (-1989.050) (-2001.537) -- 0:00:58
819800 -- (-1991.637) (-1987.277) (-1993.266) [-1986.458] * [-1981.572] (-1986.511) (-1988.788) (-1998.641) -- 0:00:58
819900 -- (-1996.435) [-1986.747] (-2004.787) (-1988.686) * [-1981.822] (-1990.471) (-1992.749) (-1994.650) -- 0:00:58
820000 -- (-1997.664) (-1988.250) (-2002.553) [-1987.425] * (-1982.115) [-1985.746] (-1994.246) (-1995.041) -- 0:00:58
Average standard deviation of split frequencies: 0.002201
820100 -- (-1989.092) [-1990.511] (-1992.985) (-1988.522) * (-1985.029) [-1986.048] (-1993.724) (-1991.033) -- 0:00:58
820200 -- (-1989.273) (-1992.464) (-1996.097) [-1987.665] * (-1985.163) [-1982.961] (-1990.091) (-1992.563) -- 0:00:58
820300 -- [-1988.535] (-1993.848) (-1991.410) (-1994.518) * [-1982.492] (-1981.358) (-1988.382) (-1996.340) -- 0:00:58
820400 -- (-1991.381) (-1999.389) [-1983.716] (-1992.668) * (-1982.140) [-1980.499] (-1990.966) (-1996.997) -- 0:00:58
820500 -- (-1996.879) (-1993.023) [-1989.003] (-1985.986) * [-1983.161] (-1984.623) (-1995.073) (-2002.274) -- 0:00:58
820600 -- (-1992.535) (-1988.099) (-1991.241) [-1995.017] * (-1986.878) [-1983.956] (-1991.434) (-2003.961) -- 0:00:58
820700 -- [-1994.396] (-1983.326) (-1990.500) (-1985.769) * (-1986.718) [-1981.792] (-1992.144) (-2007.146) -- 0:00:58
820800 -- (-1994.060) (-1984.994) (-1993.742) [-1987.775] * (-1983.548) [-1981.999] (-1997.277) (-1993.956) -- 0:00:58
820900 -- (-1999.307) (-1984.932) (-1994.435) [-1988.393] * (-1983.932) [-1982.157] (-2000.330) (-1998.553) -- 0:00:58
821000 -- (-1996.746) [-1985.984] (-1992.194) (-1986.473) * (-1993.280) [-1979.845] (-1998.683) (-1995.644) -- 0:00:58
Average standard deviation of split frequencies: 0.002231
821100 -- (-2002.185) (-1990.063) (-1990.369) [-1984.985] * [-1985.537] (-1981.638) (-1988.353) (-1998.393) -- 0:00:58
821200 -- (-1997.033) (-1993.637) [-1986.191] (-1987.043) * (-1982.797) [-1983.778] (-2000.519) (-2000.196) -- 0:00:58
821300 -- (-1991.757) (-1990.444) (-1991.282) [-1991.460] * [-1990.464] (-1979.615) (-2002.499) (-1997.704) -- 0:00:58
821400 -- (-1991.722) [-1991.778] (-1989.577) (-1995.075) * (-1987.819) [-1979.631] (-2001.030) (-2001.933) -- 0:00:58
821500 -- (-1986.701) (-1990.477) (-1997.016) [-1991.957] * (-1988.163) [-1979.587] (-2000.305) (-1993.161) -- 0:00:58
821600 -- (-1986.191) [-1989.945] (-1984.783) (-1994.731) * (-1994.191) [-1977.470] (-1990.959) (-1991.412) -- 0:00:58
821700 -- [-1983.894] (-1997.629) (-1987.999) (-2002.849) * (-1990.006) (-1983.703) (-1990.133) [-1987.652] -- 0:00:58
821800 -- (-1984.578) (-1996.211) [-1984.571] (-1993.624) * (-1995.881) [-1984.938] (-1987.482) (-1990.372) -- 0:00:58
821900 -- [-1982.594] (-1997.100) (-1988.809) (-1993.342) * (-1994.402) [-1980.276] (-2002.296) (-1994.715) -- 0:00:58
822000 -- (-1985.535) (-1995.499) [-1989.664] (-1995.436) * (-1999.989) [-1982.711] (-1994.879) (-1992.479) -- 0:00:58
Average standard deviation of split frequencies: 0.002277
822100 -- (-1995.664) (-2006.566) [-1990.508] (-1994.900) * (-1993.667) [-1979.332] (-2002.129) (-1993.953) -- 0:00:57
822200 -- [-1987.704] (-1999.060) (-1987.183) (-1993.758) * (-1991.129) [-1978.037] (-2003.351) (-1998.095) -- 0:00:57
822300 -- (-1995.581) (-1998.691) [-1985.525] (-1988.555) * (-1994.410) [-1980.175] (-2011.940) (-1993.869) -- 0:00:57
822400 -- (-1990.010) (-1990.665) (-1988.065) [-1989.602] * (-1997.776) [-1978.173] (-2006.258) (-1990.639) -- 0:00:57
822500 -- (-1988.139) (-1989.218) [-1989.921] (-1992.168) * (-1992.582) [-1985.471] (-1993.716) (-1989.957) -- 0:00:57
822600 -- [-1986.912] (-1988.046) (-1995.737) (-1992.135) * (-1996.764) [-1982.821] (-2003.435) (-1991.634) -- 0:00:57
822700 -- [-1992.587] (-1983.007) (-1996.532) (-1993.904) * (-1992.907) [-1984.693] (-1996.539) (-1994.471) -- 0:00:57
822800 -- (-1996.547) (-1989.382) [-1992.266] (-1994.308) * [-1996.075] (-1989.209) (-1995.618) (-1994.949) -- 0:00:57
822900 -- [-1985.184] (-1989.980) (-1991.719) (-1996.881) * (-1995.638) [-1984.099] (-1992.458) (-1996.332) -- 0:00:57
823000 -- [-1988.750] (-1990.048) (-1996.809) (-1997.111) * (-1992.086) (-1989.941) [-1996.309] (-1987.983) -- 0:00:57
Average standard deviation of split frequencies: 0.002258
823100 -- [-1985.134] (-1994.957) (-1993.095) (-1995.877) * (-1996.322) [-1988.295] (-1998.094) (-1987.566) -- 0:00:57
823200 -- [-1986.335] (-1998.174) (-1992.462) (-1995.044) * (-1986.247) [-1989.417] (-2000.233) (-1986.921) -- 0:00:57
823300 -- [-1984.707] (-1997.806) (-1994.954) (-1988.619) * [-1986.871] (-1987.081) (-1994.765) (-1987.598) -- 0:00:57
823400 -- [-1989.876] (-2006.184) (-1992.125) (-1988.153) * (-1987.102) [-1982.820] (-2001.680) (-1991.381) -- 0:00:57
823500 -- (-1998.215) (-2003.129) [-1987.853] (-1995.426) * (-1997.112) [-1984.220] (-2010.894) (-1989.789) -- 0:00:57
823600 -- (-1992.200) (-1997.574) [-1985.977] (-1993.013) * (-1991.465) (-1986.378) (-1997.828) [-1987.318] -- 0:00:57
823700 -- (-1998.756) (-1992.465) (-1988.388) [-1983.693] * (-1993.926) [-1985.421] (-1997.301) (-1984.685) -- 0:00:57
823800 -- (-1999.717) (-1995.774) (-1998.908) [-1985.557] * (-1992.580) (-1990.111) (-2004.017) [-1987.429] -- 0:00:57
823900 -- [-1997.302] (-1999.198) (-1991.308) (-1989.571) * (-1993.556) (-1990.946) (-2005.971) [-1985.470] -- 0:00:57
824000 -- (-2004.441) (-1997.110) [-1993.481] (-1989.786) * (-1989.488) (-1989.036) (-2001.930) [-1984.976] -- 0:00:57
Average standard deviation of split frequencies: 0.002125
824100 -- (-2001.754) (-1995.451) (-1993.547) [-1992.422] * (-1989.602) (-1993.331) (-2000.979) [-1987.398] -- 0:00:57
824200 -- (-2000.566) (-1999.052) (-1991.837) [-1991.821] * [-1988.132] (-1993.007) (-2001.951) (-1992.323) -- 0:00:57
824300 -- (-2005.288) (-1997.457) [-1990.964] (-1992.832) * (-1988.083) (-1991.787) [-1992.287] (-1989.737) -- 0:00:57
824400 -- (-2006.914) (-1998.604) [-1988.129] (-1997.048) * (-2000.340) (-1991.104) [-1990.332] (-1988.455) -- 0:00:57
824500 -- (-2000.565) (-2003.604) (-1990.794) [-1987.309] * (-1997.957) (-1996.560) (-1991.485) [-1988.266] -- 0:00:57
824600 -- (-2000.598) (-2003.478) [-1990.644] (-2000.171) * (-1994.655) (-1995.061) [-1988.601] (-1987.590) -- 0:00:57
824700 -- (-2005.376) (-1997.263) (-1987.431) [-1991.646] * (-1990.257) (-1996.728) (-1990.686) [-1991.775] -- 0:00:57
824800 -- (-1995.902) (-2002.164) [-1994.737] (-1994.864) * (-1985.354) [-1997.924] (-1992.736) (-1997.086) -- 0:00:57
824900 -- (-2000.333) (-1999.994) [-1991.586] (-1989.610) * [-1982.262] (-1989.231) (-1984.873) (-1993.225) -- 0:00:57
825000 -- (-1995.015) (-1995.963) (-1997.607) [-1989.267] * (-1982.668) (-1987.453) [-1988.586] (-2006.413) -- 0:00:57
Average standard deviation of split frequencies: 0.002024
825100 -- [-1989.509] (-1995.475) (-1997.187) (-1991.086) * (-1985.590) (-1989.823) (-1985.717) [-1995.364] -- 0:00:57
825200 -- [-1989.009] (-1990.259) (-1990.127) (-1988.887) * (-1980.387) [-1987.653] (-1990.578) (-1988.726) -- 0:00:56
825300 -- (-1989.124) (-1990.919) (-1990.628) [-1991.738] * [-1979.187] (-1988.800) (-1992.715) (-1985.773) -- 0:00:56
825400 -- (-1991.476) (-1997.151) [-1983.286] (-1991.189) * [-1978.309] (-1993.591) (-2001.812) (-1989.654) -- 0:00:56
825500 -- [-1983.776] (-1995.334) (-1987.760) (-1994.608) * [-1980.614] (-1993.704) (-1998.680) (-1986.596) -- 0:00:56
825600 -- [-1989.725] (-1989.486) (-1986.368) (-1989.123) * [-1983.316] (-1985.113) (-1996.474) (-1985.681) -- 0:00:56
825700 -- [-1993.749] (-1998.181) (-1987.989) (-1993.201) * (-1986.038) (-1982.730) [-1996.459] (-1988.836) -- 0:00:56
825800 -- (-1987.485) (-1988.951) [-1989.668] (-1986.132) * [-1985.650] (-1986.317) (-1994.672) (-1989.711) -- 0:00:56
825900 -- [-1986.983] (-1987.664) (-1989.874) (-1983.848) * [-1978.879] (-1993.238) (-1996.374) (-1993.194) -- 0:00:56
826000 -- (-1985.219) (-1991.743) [-1989.147] (-1992.400) * [-1978.770] (-1986.735) (-1996.441) (-1993.997) -- 0:00:56
Average standard deviation of split frequencies: 0.002038
826100 -- (-1988.943) (-1996.272) (-1993.950) [-1991.774] * [-1983.934] (-1986.752) (-1993.538) (-1993.084) -- 0:00:56
826200 -- (-1994.589) (-1995.251) [-1992.166] (-1988.675) * [-1981.307] (-1987.005) (-1989.108) (-1987.766) -- 0:00:56
826300 -- (-1998.394) [-1985.692] (-1999.795) (-1991.576) * (-1979.587) [-1982.218] (-1993.693) (-2002.043) -- 0:00:56
826400 -- (-1994.511) (-1987.897) (-1999.334) [-1987.198] * (-1983.048) [-1983.680] (-1989.437) (-2006.384) -- 0:00:56
826500 -- (-2000.096) (-1987.235) (-2002.222) [-1986.661] * (-1979.177) (-1982.992) [-1985.893] (-1999.934) -- 0:00:56
826600 -- (-1995.909) (-1986.189) (-2000.822) [-1985.173] * (-1982.107) [-1985.399] (-1986.223) (-1994.124) -- 0:00:56
826700 -- (-1995.300) [-1996.436] (-1994.908) (-1983.400) * [-1980.445] (-1986.603) (-1993.245) (-1989.549) -- 0:00:56
826800 -- (-1989.844) (-1993.207) (-2006.752) [-1986.564] * [-1981.662] (-1981.483) (-1996.927) (-1988.719) -- 0:00:56
826900 -- (-1993.146) (-1996.855) (-2004.357) [-1985.956] * [-1974.971] (-1981.815) (-1994.847) (-1993.330) -- 0:00:56
827000 -- (-1988.601) (-1995.093) (-2002.941) [-1989.673] * (-1983.099) [-1979.820] (-1991.638) (-1986.809) -- 0:00:56
Average standard deviation of split frequencies: 0.002117
827100 -- (-1990.633) [-1993.970] (-2001.088) (-1990.425) * [-1985.859] (-1983.963) (-1992.348) (-1988.817) -- 0:00:56
827200 -- (-1989.985) [-1996.274] (-1994.508) (-1993.900) * (-1981.858) (-1989.234) (-1990.138) [-1987.438] -- 0:00:56
827300 -- [-1989.419] (-1993.708) (-1996.829) (-1992.307) * [-1982.910] (-1990.559) (-1990.059) (-1992.304) -- 0:00:56
827400 -- [-1990.302] (-2001.714) (-1998.572) (-1992.264) * [-1984.128] (-1990.282) (-1993.109) (-1986.816) -- 0:00:56
827500 -- [-1989.549] (-2004.376) (-1994.480) (-1997.214) * (-1982.310) (-1990.494) (-2001.028) [-1986.471] -- 0:00:56
827600 -- (-1985.929) (-1996.744) [-1990.252] (-1995.867) * [-1983.058] (-1995.186) (-1995.586) (-1990.379) -- 0:00:56
827700 -- [-1985.122] (-1996.395) (-1992.346) (-1993.063) * (-1987.641) (-1995.572) (-2000.130) [-1991.762] -- 0:00:56
827800 -- [-1992.296] (-2002.880) (-1998.048) (-1993.084) * (-1989.650) (-1991.665) (-2005.778) [-1989.603] -- 0:00:56
827900 -- [-1988.278] (-2000.683) (-1994.272) (-1995.877) * [-1987.209] (-1992.117) (-2007.114) (-1989.115) -- 0:00:56
828000 -- [-1987.985] (-1992.309) (-1990.773) (-1991.951) * [-1986.110] (-1988.107) (-2001.340) (-1995.162) -- 0:00:56
Average standard deviation of split frequencies: 0.002114
828100 -- (-1988.074) [-1989.864] (-1993.787) (-1988.279) * (-1988.316) [-1991.126] (-1996.897) (-1994.118) -- 0:00:56
828200 -- (-1992.142) (-1986.120) (-2000.852) [-1983.805] * (-1986.515) [-1985.439] (-1996.318) (-1996.942) -- 0:00:56
828300 -- (-1994.527) (-1984.942) (-1996.517) [-1986.239] * (-1986.809) [-1986.713] (-2000.999) (-2002.310) -- 0:00:55
828400 -- (-1995.323) (-1985.138) (-2001.076) [-1989.848] * (-1986.716) [-1980.811] (-2000.218) (-1996.861) -- 0:00:55
828500 -- [-1993.019] (-1990.764) (-2008.967) (-1993.092) * [-1986.442] (-1984.651) (-1999.314) (-1997.272) -- 0:00:55
828600 -- (-1992.749) (-1991.765) (-2001.352) [-1991.542] * (-1987.262) [-1985.751] (-2004.006) (-1989.793) -- 0:00:55
828700 -- (-2002.585) (-1985.549) (-2003.161) [-1992.039] * [-1986.757] (-1983.929) (-1997.361) (-1989.514) -- 0:00:56
828800 -- (-1995.267) [-1987.360] (-1998.512) (-1993.619) * [-1980.037] (-1987.166) (-2000.881) (-1993.103) -- 0:00:55
828900 -- (-1996.565) (-1984.798) (-1997.175) [-1993.764] * [-1982.110] (-1985.187) (-2002.699) (-1989.733) -- 0:00:55
829000 -- [-1991.120] (-1991.279) (-2001.745) (-1993.816) * [-1982.450] (-1992.560) (-1995.328) (-1989.255) -- 0:00:55
Average standard deviation of split frequencies: 0.002177
829100 -- (-1994.516) [-1985.096] (-2001.313) (-2001.823) * (-1989.235) [-1993.997] (-1993.581) (-1997.245) -- 0:00:55
829200 -- [-1990.969] (-1988.200) (-2000.521) (-2007.358) * (-1985.018) (-1996.794) [-1990.017] (-1991.937) -- 0:00:55
829300 -- (-1994.715) (-1993.321) (-1998.870) [-1991.533] * (-1985.372) [-1988.168] (-1989.030) (-1990.127) -- 0:00:55
829400 -- (-1996.514) (-1990.522) (-2005.220) [-1989.821] * (-1984.329) [-1985.789] (-1991.241) (-1986.369) -- 0:00:55
829500 -- [-1989.686] (-1993.783) (-2000.306) (-1989.187) * (-1989.172) [-1988.322] (-1994.271) (-1990.882) -- 0:00:55
829600 -- (-1985.224) (-1994.345) (-1996.540) [-1992.848] * [-1988.068] (-1993.580) (-1987.496) (-1989.251) -- 0:00:55
829700 -- (-1986.804) (-1995.770) [-1991.190] (-1994.451) * (-1988.739) (-1988.190) (-1990.492) [-1983.278] -- 0:00:55
829800 -- (-1993.160) (-2006.215) [-1994.350] (-1993.570) * (-1979.045) (-1987.136) (-1995.672) [-1985.671] -- 0:00:55
829900 -- [-1988.795] (-1992.771) (-1988.479) (-1992.518) * [-1980.581] (-1982.964) (-1999.841) (-2006.472) -- 0:00:55
830000 -- (-1993.941) [-1985.438] (-1996.698) (-1992.147) * [-1985.939] (-1984.494) (-1993.539) (-2004.142) -- 0:00:55
Average standard deviation of split frequencies: 0.002158
830100 -- (-1995.517) (-1987.813) (-1987.464) [-1988.982] * (-1990.559) (-1984.836) [-1992.606] (-2003.261) -- 0:00:55
830200 -- (-2000.830) (-1994.040) [-1986.281] (-1990.757) * (-1988.195) [-1982.195] (-1995.512) (-1996.755) -- 0:00:55
830300 -- (-2005.941) [-1985.196] (-1989.655) (-2006.258) * (-1992.144) [-1984.147] (-1990.939) (-2002.933) -- 0:00:55
830400 -- (-1996.741) [-1983.003] (-1988.859) (-1997.669) * [-1989.791] (-1986.892) (-2001.403) (-2003.817) -- 0:00:55
830500 -- (-1996.750) [-1984.615] (-1991.245) (-1996.299) * (-1990.936) [-1985.873] (-2005.818) (-1999.918) -- 0:00:55
830600 -- (-2002.066) [-1984.946] (-1991.940) (-1987.272) * [-1988.828] (-1989.725) (-2008.878) (-1993.523) -- 0:00:55
830700 -- (-2001.996) (-1986.126) (-1986.637) [-1992.898] * (-1982.139) [-1983.086] (-2013.898) (-1996.578) -- 0:00:55
830800 -- (-2000.698) (-1985.260) (-1987.105) [-1990.023] * (-1986.572) (-1991.715) (-2018.902) [-1989.068] -- 0:00:55
830900 -- (-2004.656) [-1990.694] (-1988.353) (-1991.639) * (-1986.849) (-1989.415) (-2017.984) [-1984.358] -- 0:00:55
831000 -- (-1994.732) (-1990.144) [-1990.925] (-1985.618) * [-1983.866] (-2000.885) (-2010.786) (-1986.940) -- 0:00:55
Average standard deviation of split frequencies: 0.002220
831100 -- (-1994.969) (-1988.043) (-1992.763) [-1986.297] * [-1981.764] (-1996.869) (-2000.857) (-1989.489) -- 0:00:55
831200 -- (-1996.064) (-1985.714) (-1997.760) [-1985.404] * (-1982.727) (-1987.321) (-1989.796) [-1985.886] -- 0:00:55
831300 -- (-1991.990) (-1987.071) (-1996.134) [-1982.765] * (-1981.441) (-1986.642) (-1995.993) [-1985.879] -- 0:00:54
831400 -- (-2001.154) [-1989.489] (-2000.800) (-1987.335) * (-1980.039) [-1987.410] (-1995.817) (-1994.832) -- 0:00:54
831500 -- (-1997.892) (-1992.966) (-1997.177) [-1984.352] * [-1980.472] (-1985.089) (-1995.751) (-1990.961) -- 0:00:54
831600 -- (-1999.110) (-1991.033) (-1990.316) [-1988.510] * [-1982.580] (-1985.960) (-2001.682) (-1992.785) -- 0:00:54
831700 -- (-1992.945) (-1990.264) (-1995.729) [-1990.962] * (-1981.640) [-1988.961] (-2000.178) (-1994.977) -- 0:00:55
831800 -- (-1995.392) [-1992.012] (-1995.581) (-1982.359) * [-1981.746] (-2000.596) (-1994.268) (-1997.262) -- 0:00:55
831900 -- (-1997.243) (-1998.953) (-2001.675) [-1985.969] * [-1989.052] (-2003.130) (-1993.980) (-2000.282) -- 0:00:54
832000 -- (-1997.537) (-1994.699) (-2006.579) [-1982.170] * [-1986.461] (-1998.971) (-1987.197) (-1992.925) -- 0:00:54
Average standard deviation of split frequencies: 0.002088
832100 -- (-1998.094) [-1987.197] (-1998.602) (-1994.392) * (-1985.201) (-1994.818) (-1992.986) [-1988.050] -- 0:00:54
832200 -- (-2004.060) [-1988.018] (-1999.266) (-1989.685) * [-1981.540] (-1985.910) (-1989.719) (-1998.461) -- 0:00:54
832300 -- (-1998.629) (-1990.709) (-2000.241) [-1988.416] * [-1982.113] (-1993.104) (-1994.739) (-1998.589) -- 0:00:54
832400 -- (-1996.162) (-1996.552) (-1997.620) [-1983.928] * [-1983.725] (-1992.552) (-1992.218) (-2004.656) -- 0:00:54
832500 -- (-2000.836) (-1989.919) (-1998.017) [-1981.572] * [-1982.369] (-1992.510) (-1996.294) (-2006.462) -- 0:00:54
832600 -- (-1998.652) (-1993.120) (-2005.099) [-1983.829] * [-1980.075] (-1998.538) (-1993.874) (-1999.885) -- 0:00:54
832700 -- (-2002.715) (-1991.908) (-1998.251) [-1982.006] * [-1981.134] (-1997.400) (-1989.876) (-2001.236) -- 0:00:54
832800 -- (-1998.615) (-1990.337) (-1994.844) [-1982.132] * [-1982.730] (-2013.689) (-1994.300) (-2005.330) -- 0:00:54
832900 -- (-2002.740) (-1990.480) (-1991.079) [-1981.887] * [-1981.416] (-1995.060) (-1998.174) (-1996.732) -- 0:00:54
833000 -- (-2004.914) (-1989.227) (-2001.627) [-1983.020] * [-1978.810] (-1995.384) (-2007.591) (-1998.130) -- 0:00:54
Average standard deviation of split frequencies: 0.002021
833100 -- (-2008.908) (-1991.804) (-1994.432) [-1980.873] * [-1978.389] (-1991.583) (-2003.677) (-1996.062) -- 0:00:54
833200 -- (-2000.543) (-1994.005) (-1988.604) [-1985.851] * [-1979.742] (-1993.488) (-2006.876) (-2002.198) -- 0:00:54
833300 -- (-2002.119) (-1995.463) (-1994.193) [-1981.097] * [-1985.677] (-1998.046) (-2009.541) (-2005.995) -- 0:00:54
833400 -- (-2005.814) (-2006.119) (-1997.905) [-1981.280] * (-1986.838) [-1990.243] (-2018.002) (-2007.123) -- 0:00:54
833500 -- (-1995.032) (-2000.865) (-1993.047) [-1982.821] * [-1983.656] (-1999.414) (-2003.760) (-1994.561) -- 0:00:54
833600 -- (-1995.462) (-1994.854) (-1991.453) [-1983.449] * [-1983.103] (-2006.043) (-2005.014) (-1999.290) -- 0:00:54
833700 -- (-2001.178) (-1993.369) [-1991.383] (-1983.110) * [-1984.254] (-1992.846) (-1998.068) (-1996.996) -- 0:00:54
833800 -- (-1994.911) (-1994.977) (-1998.726) [-1986.744] * (-1980.558) (-1988.743) (-2001.773) [-1994.762] -- 0:00:54
833900 -- (-1992.457) (-2007.986) (-1998.181) [-1991.850] * (-1986.325) (-1991.015) [-1994.698] (-2002.622) -- 0:00:54
834000 -- [-1989.483] (-1995.352) (-1998.553) (-1989.283) * [-1983.713] (-1993.503) (-1996.577) (-2002.118) -- 0:00:54
Average standard deviation of split frequencies: 0.002002
834100 -- (-1997.309) (-1990.323) (-1997.969) [-1985.456] * [-1984.673] (-1988.237) (-1990.194) (-2005.992) -- 0:00:54
834200 -- (-1996.276) (-1991.003) (-2000.144) [-1981.097] * [-1983.459] (-1989.785) (-1988.066) (-1996.933) -- 0:00:54
834300 -- (-1993.871) (-1997.669) (-2007.066) [-1982.346] * [-1985.627] (-1986.196) (-1989.728) (-2001.734) -- 0:00:54
834400 -- (-1993.852) (-2007.755) (-2000.948) [-1979.516] * [-1986.545] (-1987.832) (-1990.259) (-2009.676) -- 0:00:53
834500 -- (-1998.059) (-2000.235) (-2001.499) [-1985.369] * (-1985.772) [-1987.226] (-1990.236) (-2012.207) -- 0:00:53
834600 -- [-1989.071] (-1999.854) (-2002.411) (-1986.352) * [-1986.555] (-1991.671) (-1990.587) (-2009.839) -- 0:00:53
834700 -- (-1994.265) (-1996.032) (-2014.661) [-1985.194] * [-1985.083] (-1992.409) (-1998.187) (-2007.685) -- 0:00:54
834800 -- (-1997.773) [-1993.214] (-2009.137) (-1981.427) * [-1986.156] (-1988.046) (-1996.327) (-2003.751) -- 0:00:54
834900 -- (-2002.604) (-1993.163) (-1997.761) [-1982.722] * (-1984.299) (-1990.808) [-1989.829] (-2006.247) -- 0:00:53
835000 -- (-1994.136) (-1999.156) (-1989.460) [-1980.388] * [-1991.077] (-1988.785) (-1990.039) (-2010.070) -- 0:00:53
Average standard deviation of split frequencies: 0.002129
835100 -- (-1997.512) (-1992.432) (-1988.564) [-1981.366] * (-1988.348) [-1987.027] (-1993.027) (-2001.644) -- 0:00:53
835200 -- (-1992.716) (-1991.654) (-1984.340) [-1977.517] * [-1992.584] (-1989.897) (-1991.575) (-1998.363) -- 0:00:53
835300 -- (-1992.566) (-1990.078) (-1992.446) [-1983.768] * (-1996.251) [-1989.086] (-1995.713) (-1993.677) -- 0:00:53
835400 -- [-1985.643] (-1999.252) (-1991.657) (-1987.291) * (-1991.686) [-1990.700] (-1990.366) (-1997.557) -- 0:00:53
835500 -- [-1985.715] (-1992.007) (-1993.297) (-1990.626) * [-1992.622] (-1999.070) (-1987.663) (-1993.018) -- 0:00:53
835600 -- (-1985.220) (-1987.119) (-1996.794) [-1984.543] * (-1986.724) (-2001.336) [-1988.890] (-2000.805) -- 0:00:53
835700 -- (-1988.749) (-1987.385) (-1994.529) [-1986.718] * [-1990.048] (-1995.201) (-1985.462) (-1998.706) -- 0:00:53
835800 -- (-1995.300) [-1983.721] (-1997.805) (-1991.709) * [-1981.758] (-1995.033) (-1985.663) (-1998.466) -- 0:00:53
835900 -- [-1991.573] (-1986.060) (-1991.561) (-1995.784) * [-1981.857] (-2003.984) (-1989.280) (-2000.039) -- 0:00:53
836000 -- [-1989.589] (-1991.112) (-1997.115) (-1998.280) * (-1983.242) (-2002.942) [-1987.268] (-2001.635) -- 0:00:53
Average standard deviation of split frequencies: 0.002078
836100 -- [-1986.481] (-1988.353) (-2007.034) (-1995.510) * (-1986.835) (-1998.194) [-1987.689] (-1999.111) -- 0:00:53
836200 -- (-1987.092) (-1990.923) (-1997.836) [-1988.112] * [-1975.660] (-1999.275) (-1990.217) (-1998.061) -- 0:00:53
836300 -- (-2002.021) [-1989.707] (-1992.489) (-1989.563) * [-1989.203] (-1993.282) (-1987.679) (-1998.115) -- 0:00:53
836400 -- (-1996.137) [-1991.255] (-1994.404) (-1986.182) * [-1989.589] (-1994.943) (-1989.932) (-1992.594) -- 0:00:53
836500 -- (-2002.417) (-2000.431) (-1998.252) [-1984.930] * (-1996.033) (-1993.538) [-1986.639] (-1999.126) -- 0:00:53
836600 -- (-1995.092) (-1999.841) (-1994.353) [-1984.487] * (-1991.147) (-1992.380) [-1987.027] (-2001.240) -- 0:00:53
836700 -- (-1997.752) (-1998.583) (-1996.463) [-1985.540] * (-1996.004) (-1992.346) [-1986.657] (-2000.136) -- 0:00:53
836800 -- (-1988.610) [-1993.755] (-1989.918) (-1990.196) * (-1989.830) [-1987.294] (-1986.419) (-2008.427) -- 0:00:53
836900 -- (-1990.791) (-1992.146) (-1993.329) [-1987.449] * (-1988.889) (-1990.286) [-1987.176] (-1995.003) -- 0:00:53
837000 -- (-2003.115) (-1990.546) (-2002.863) [-1991.425] * [-1985.965] (-1998.284) (-1992.443) (-1994.371) -- 0:00:53
Average standard deviation of split frequencies: 0.002172
837100 -- (-1995.063) (-1988.266) (-2019.808) [-1999.483] * [-1982.772] (-2008.005) (-1999.596) (-1994.262) -- 0:00:53
837200 -- (-1993.672) [-1986.443] (-2004.735) (-1995.930) * [-1982.634] (-1999.777) (-1991.449) (-2005.142) -- 0:00:53
837300 -- (-1994.188) [-1986.376] (-2003.786) (-1989.897) * [-1979.354] (-2003.518) (-1988.055) (-1992.263) -- 0:00:53
837400 -- [-1983.014] (-1994.374) (-2004.529) (-1984.952) * [-1984.122] (-1991.037) (-1986.502) (-1993.364) -- 0:00:53
837500 -- (-1985.980) (-1992.566) (-2005.037) [-1991.104] * (-1988.529) (-1989.368) [-1985.558] (-1990.089) -- 0:00:52
837600 -- (-1993.595) [-1999.096] (-1995.771) (-1992.963) * (-1987.184) (-1999.595) [-1988.783] (-1994.921) -- 0:00:52
837700 -- (-1990.645) (-2007.834) [-1995.015] (-1994.085) * (-1983.010) (-1994.669) (-1998.560) [-1990.465] -- 0:00:53
837800 -- (-1986.529) (-2005.314) (-2010.862) [-1989.947] * (-1986.251) (-1991.998) (-1991.442) [-1986.567] -- 0:00:53
837900 -- [-1982.696] (-1992.783) (-1993.000) (-1988.100) * [-1984.487] (-1996.643) (-1993.204) (-1987.813) -- 0:00:53
838000 -- [-1985.283] (-1992.188) (-1999.267) (-1993.448) * (-1991.294) (-1995.846) (-1993.096) [-1988.510] -- 0:00:52
Average standard deviation of split frequencies: 0.002250
838100 -- [-1984.440] (-1994.973) (-1994.179) (-1988.546) * (-1989.387) (-1993.430) (-1995.775) [-1990.215] -- 0:00:52
838200 -- (-1990.164) (-1995.853) (-1995.628) [-1990.493] * (-1994.131) (-2006.883) [-1989.603] (-1984.839) -- 0:00:52
838300 -- [-1987.789] (-1997.092) (-1997.600) (-1987.759) * (-1988.827) (-2001.397) [-1993.021] (-1981.641) -- 0:00:52
838400 -- [-1987.291] (-2000.425) (-1996.245) (-1990.369) * (-1988.154) (-1996.720) (-2001.136) [-1986.759] -- 0:00:52
838500 -- (-1993.754) (-2004.084) (-1998.054) [-1986.584] * (-1986.662) [-1986.892] (-1997.015) (-1988.091) -- 0:00:52
838600 -- [-1995.056] (-1998.701) (-1989.261) (-1990.283) * (-1991.426) [-1986.631] (-1995.219) (-1999.022) -- 0:00:52
838700 -- (-1990.377) (-2002.298) (-1998.308) [-1986.496] * [-1988.010] (-1986.455) (-1990.715) (-1997.627) -- 0:00:52
838800 -- (-1987.070) (-1999.425) (-1993.388) [-1985.621] * (-1996.173) (-1992.443) [-1983.866] (-1995.309) -- 0:00:52
838900 -- (-1988.045) (-1994.741) (-1996.157) [-1984.378] * [-1983.739] (-1991.091) (-1982.492) (-2001.276) -- 0:00:52
839000 -- (-1993.214) (-1995.358) [-1987.401] (-1996.235) * [-1984.368] (-1992.998) (-1985.986) (-2001.175) -- 0:00:52
Average standard deviation of split frequencies: 0.002199
839100 -- (-1993.573) (-1998.849) [-1987.109] (-1998.574) * (-1984.645) (-1988.900) [-1983.346] (-2005.431) -- 0:00:52
839200 -- [-1988.372] (-1999.029) (-1989.274) (-1995.011) * [-1982.398] (-1992.983) (-1989.155) (-1995.764) -- 0:00:52
839300 -- (-1989.898) (-2004.957) [-1985.992] (-1990.599) * [-1982.860] (-2010.899) (-1993.499) (-1994.009) -- 0:00:52
839400 -- [-1983.945] (-2000.209) (-1987.991) (-1992.217) * [-1982.637] (-2003.087) (-1995.826) (-1996.617) -- 0:00:52
839500 -- [-1984.363] (-2002.006) (-1985.439) (-1988.326) * [-1978.686] (-2002.462) (-1997.302) (-1994.475) -- 0:00:52
839600 -- (-1988.665) (-2020.455) [-1988.619] (-1991.378) * [-1976.212] (-1995.423) (-1996.589) (-2000.059) -- 0:00:52
839700 -- (-1994.110) (-2022.930) (-1987.660) [-1990.154] * (-1978.524) (-1994.377) (-1995.222) [-1990.499] -- 0:00:52
839800 -- (-1995.544) (-2010.406) [-1990.490] (-1992.908) * (-1984.760) (-1995.996) (-1991.268) [-1990.835] -- 0:00:52
839900 -- (-1990.777) (-2010.530) (-1990.631) [-1990.615] * [-1978.863] (-1997.549) (-1993.888) (-1989.461) -- 0:00:52
840000 -- [-1988.180] (-1999.744) (-1989.495) (-1987.532) * [-1981.673] (-1995.784) (-2000.085) (-1999.313) -- 0:00:52
Average standard deviation of split frequencies: 0.002212
840100 -- (-1987.443) (-1989.952) [-1989.543] (-1991.440) * (-1987.428) [-1997.256] (-2006.659) (-2004.886) -- 0:00:52
840200 -- (-1986.866) (-1990.432) (-1998.052) [-1989.730] * [-1988.589] (-1996.337) (-2005.196) (-1991.704) -- 0:00:52
840300 -- [-1990.528] (-1987.998) (-1992.226) (-1997.052) * [-1990.450] (-2007.705) (-1992.593) (-1998.006) -- 0:00:52
840400 -- (-1997.310) [-1984.426] (-1991.781) (-2005.821) * (-1992.906) (-2007.242) [-1990.320] (-1996.349) -- 0:00:52
840500 -- (-1995.662) (-1984.428) [-1985.994] (-1995.628) * (-1998.211) (-1998.561) [-1986.620] (-1992.910) -- 0:00:51
840600 -- (-1998.481) [-1986.289] (-1991.313) (-1991.854) * [-1996.419] (-1998.338) (-1989.421) (-1998.767) -- 0:00:51
840700 -- (-1993.058) [-1988.227] (-1992.699) (-1994.953) * (-1998.671) (-1996.447) [-1991.735] (-1994.931) -- 0:00:52
840800 -- [-1990.035] (-1994.587) (-1999.960) (-1988.599) * (-1995.471) (-1995.040) [-1990.048] (-1992.989) -- 0:00:52
840900 -- (-1993.508) (-1992.875) (-1995.964) [-1990.504] * (-1995.284) (-1990.187) [-1984.183] (-1994.204) -- 0:00:52
841000 -- (-1997.105) [-1993.616] (-2000.571) (-1993.595) * (-1994.841) (-2000.520) (-1987.579) [-1991.048] -- 0:00:51
Average standard deviation of split frequencies: 0.002338
841100 -- (-1995.590) [-1992.908] (-1997.693) (-2000.089) * (-1999.581) (-1988.890) [-1984.795] (-1988.996) -- 0:00:51
841200 -- (-1998.781) (-1990.280) [-1991.098] (-1999.007) * (-1999.125) (-1991.714) [-1986.180] (-1995.225) -- 0:00:51
841300 -- [-1988.797] (-1991.770) (-1996.444) (-1992.103) * (-1997.213) [-1989.115] (-1983.262) (-1992.790) -- 0:00:51
841400 -- (-1992.307) [-1990.130] (-1993.082) (-1996.056) * (-2001.258) (-1989.241) [-1989.601] (-1992.381) -- 0:00:51
841500 -- (-2004.176) (-1984.407) [-1984.410] (-1993.942) * (-1995.885) (-1993.807) (-1989.711) [-1990.642] -- 0:00:51
841600 -- [-1994.365] (-1983.645) (-1993.832) (-1990.988) * (-1989.485) [-1998.472] (-1984.527) (-1987.929) -- 0:00:51
841700 -- [-1988.648] (-1983.089) (-1991.734) (-1992.441) * [-1984.919] (-1998.444) (-1987.385) (-1995.786) -- 0:00:51
841800 -- (-1990.542) [-1984.790] (-1993.815) (-1990.304) * [-1987.316] (-2006.329) (-1990.844) (-1992.445) -- 0:00:51
841900 -- (-1998.130) [-1985.544] (-1997.401) (-1996.818) * (-1995.381) (-2017.331) [-1987.105] (-1995.935) -- 0:00:51
842000 -- (-1993.359) (-1984.813) [-1998.042] (-1997.865) * (-1983.248) (-2002.065) [-1986.646] (-1991.807) -- 0:00:51
Average standard deviation of split frequencies: 0.002239
842100 -- (-1990.330) [-1983.668] (-1988.433) (-1990.768) * (-1981.153) (-2002.168) [-1991.641] (-1992.779) -- 0:00:51
842200 -- (-1994.260) [-1984.694] (-1994.791) (-1992.195) * [-1980.742] (-2003.745) (-1988.800) (-1992.285) -- 0:00:51
842300 -- (-1996.543) [-1985.888] (-1992.008) (-1986.477) * [-1981.493] (-1999.529) (-1988.230) (-1991.496) -- 0:00:51
842400 -- (-1997.641) [-1982.525] (-1992.890) (-1988.060) * (-1984.682) (-2004.888) (-1998.532) [-1989.596] -- 0:00:51
842500 -- (-1998.753) [-1980.716] (-1990.229) (-1992.763) * [-1980.452] (-2005.205) (-1994.564) (-1995.691) -- 0:00:51
842600 -- (-1995.374) [-1985.993] (-1989.232) (-1997.103) * [-1981.915] (-1994.275) (-1998.030) (-1996.665) -- 0:00:51
842700 -- (-1996.641) [-1980.852] (-1985.931) (-2000.768) * [-1989.549] (-1998.091) (-2002.099) (-2000.787) -- 0:00:51
842800 -- (-1986.608) [-1979.447] (-1991.000) (-1997.634) * [-1984.945] (-1993.592) (-2000.299) (-1999.430) -- 0:00:51
842900 -- [-1984.356] (-1980.926) (-1986.766) (-1992.792) * [-1985.339] (-1986.493) (-2003.128) (-1995.808) -- 0:00:51
843000 -- (-1992.927) [-1985.142] (-1993.343) (-1992.965) * [-1990.068] (-1993.782) (-1985.648) (-1993.963) -- 0:00:51
Average standard deviation of split frequencies: 0.002268
843100 -- (-1993.336) [-1981.096] (-1997.597) (-1997.369) * (-1989.178) [-1983.347] (-1993.736) (-1996.615) -- 0:00:51
843200 -- (-1996.046) [-1981.056] (-2000.085) (-1995.144) * (-1988.496) [-1984.604] (-1993.496) (-1995.513) -- 0:00:51
843300 -- (-1994.875) [-1982.587] (-1999.143) (-1999.198) * [-1983.943] (-1988.718) (-2002.348) (-1999.061) -- 0:00:51
843400 -- (-1990.629) (-1983.801) [-1988.510] (-1997.063) * (-1989.421) [-1989.802] (-1996.827) (-2003.284) -- 0:00:51
843500 -- (-1988.232) [-1981.466] (-1992.729) (-2000.675) * (-1988.119) [-1990.703] (-1994.197) (-2008.433) -- 0:00:51
843600 -- [-1986.367] (-1988.555) (-1999.294) (-2004.339) * [-1993.827] (-1988.534) (-1994.891) (-2001.746) -- 0:00:51
843700 -- [-1990.301] (-1990.774) (-2005.407) (-2001.048) * (-1991.593) [-1983.430] (-1991.206) (-2000.833) -- 0:00:51
843800 -- [-1984.833] (-1982.857) (-2009.143) (-1994.130) * (-1991.636) (-1984.966) (-1992.114) [-1994.255] -- 0:00:51
843900 -- (-1988.608) (-1987.752) (-2006.095) [-1991.752] * [-1987.294] (-1990.604) (-1992.028) (-1996.878) -- 0:00:51
844000 -- [-1988.978] (-1991.559) (-1991.709) (-1995.326) * [-1982.260] (-1996.704) (-1993.945) (-2003.390) -- 0:00:51
Average standard deviation of split frequencies: 0.002266
844100 -- [-1989.848] (-1991.170) (-1995.943) (-1997.132) * [-1980.633] (-1999.112) (-1992.892) (-1999.315) -- 0:00:50
844200 -- (-2003.663) [-1987.424] (-1992.802) (-1988.531) * [-1981.005] (-2002.561) (-1995.032) (-1995.447) -- 0:00:50
844300 -- (-2002.787) [-1995.984] (-1990.802) (-1991.693) * (-1990.906) (-2001.210) [-1990.970] (-1998.473) -- 0:00:50
844400 -- (-2011.152) [-1991.956] (-1992.426) (-2002.551) * [-1985.108] (-2001.935) (-1986.936) (-1996.239) -- 0:00:50
844500 -- (-2009.070) (-1996.438) (-1986.441) [-1994.982] * (-1994.612) (-2005.687) (-1988.591) [-1997.095] -- 0:00:50
844600 -- (-2015.533) (-1997.524) [-1990.559] (-1992.318) * (-1995.136) (-1993.951) [-1985.761] (-1995.115) -- 0:00:50
844700 -- (-2012.916) (-1989.201) [-1991.203] (-1990.695) * (-1995.134) (-1998.256) [-1988.125] (-1995.978) -- 0:00:50
844800 -- (-2001.889) (-1993.038) [-1989.937] (-1996.650) * (-1994.526) (-1999.080) [-1987.367] (-1998.535) -- 0:00:50
844900 -- (-1989.809) [-1987.477] (-1993.449) (-1998.020) * [-1991.149] (-1995.817) (-1987.486) (-1993.621) -- 0:00:50
845000 -- [-1987.060] (-1992.043) (-1991.377) (-1999.795) * (-1991.505) (-1999.274) [-1983.635] (-1989.923) -- 0:00:50
Average standard deviation of split frequencies: 0.002343
845100 -- (-1989.690) [-1990.128] (-1992.975) (-2005.410) * (-1996.609) [-1986.326] (-1984.954) (-1990.350) -- 0:00:50
845200 -- (-1987.489) (-1994.426) [-1989.438] (-2006.618) * (-2002.917) [-1991.819] (-1985.431) (-1985.742) -- 0:00:50
845300 -- [-1985.513] (-1993.889) (-1989.280) (-1995.777) * (-1989.372) (-2002.537) [-1992.858] (-1986.001) -- 0:00:50
845400 -- [-1983.100] (-1996.376) (-1988.091) (-1999.950) * (-1997.826) (-2007.152) (-1989.884) [-1990.139] -- 0:00:50
845500 -- [-1991.237] (-1990.663) (-2000.873) (-1997.610) * (-1993.154) (-2008.126) (-1990.539) [-1989.157] -- 0:00:50
845600 -- (-1985.616) [-1985.011] (-2000.262) (-2001.831) * (-1999.716) (-1997.518) (-1992.679) [-1986.366] -- 0:00:50
845700 -- [-1991.943] (-1986.723) (-2000.242) (-1995.215) * (-1994.112) (-2001.635) [-1988.524] (-1994.748) -- 0:00:50
845800 -- (-1986.583) [-1981.414] (-1997.951) (-1995.971) * [-1990.640] (-1996.539) (-1985.657) (-1997.592) -- 0:00:50
845900 -- [-1987.109] (-1986.745) (-1998.219) (-1997.736) * (-1994.641) (-1987.543) [-1983.956] (-2002.893) -- 0:00:50
846000 -- [-1986.558] (-1989.514) (-2007.857) (-1996.981) * [-1985.702] (-1990.600) (-1989.249) (-1995.120) -- 0:00:50
Average standard deviation of split frequencies: 0.002324
846100 -- [-1986.761] (-1998.187) (-2012.371) (-2004.812) * (-1986.683) [-1992.043] (-1991.822) (-1997.112) -- 0:00:50
846200 -- [-1988.286] (-1986.832) (-2005.031) (-1987.137) * (-1986.995) [-1992.382] (-1999.646) (-1992.400) -- 0:00:50
846300 -- (-1986.015) [-1986.418] (-2001.536) (-2006.013) * [-1987.633] (-1987.958) (-2007.321) (-1994.761) -- 0:00:50
846400 -- [-1984.007] (-1996.305) (-1998.819) (-2006.190) * (-1988.689) (-1991.399) (-1999.124) [-1989.184] -- 0:00:50
846500 -- [-1986.585] (-1992.655) (-1997.742) (-2002.250) * [-1982.406] (-1987.927) (-2004.048) (-1992.623) -- 0:00:50
846600 -- (-1989.730) [-1990.645] (-1995.400) (-2006.466) * (-1984.154) [-1987.220] (-2000.636) (-1995.273) -- 0:00:50
846700 -- (-1994.923) [-1988.578] (-1992.943) (-2001.863) * (-1985.679) [-1984.774] (-1994.121) (-1994.262) -- 0:00:50
846800 -- (-1999.098) [-1986.224] (-1989.040) (-1999.910) * (-1989.683) (-1998.729) (-1990.899) [-1995.372] -- 0:00:50
846900 -- (-2002.074) [-1983.294] (-1999.995) (-1989.576) * [-1994.663] (-2004.173) (-1989.711) (-1988.702) -- 0:00:50
847000 -- (-1995.521) [-1983.699] (-1995.313) (-1991.385) * [-1987.277] (-1992.088) (-1998.785) (-1989.761) -- 0:00:50
Average standard deviation of split frequencies: 0.002289
847100 -- (-1994.263) [-1982.424] (-1996.122) (-1992.242) * (-1991.494) (-1995.913) [-1990.561] (-1992.020) -- 0:00:49
847200 -- (-1995.629) [-1984.050] (-1996.687) (-1991.917) * [-1992.172] (-2001.548) (-1999.456) (-1999.167) -- 0:00:49
847300 -- (-2005.558) [-1987.237] (-1990.071) (-1991.922) * [-1992.027] (-2001.385) (-1991.075) (-1999.611) -- 0:00:49
847400 -- [-1992.221] (-1983.792) (-1994.453) (-1997.818) * (-1992.756) (-2009.880) (-1987.137) [-1996.683] -- 0:00:49
847500 -- (-2000.559) (-1984.236) [-1997.871] (-1994.366) * (-1999.784) (-2006.291) [-1988.622] (-2000.372) -- 0:00:49
847600 -- [-1992.035] (-1983.343) (-1992.261) (-1995.930) * (-1999.519) (-2005.077) [-1985.672] (-1996.695) -- 0:00:49
847700 -- (-2002.386) [-1981.656] (-1992.354) (-1995.013) * (-1997.601) (-1998.845) [-1988.597] (-1994.016) -- 0:00:49
847800 -- (-1992.853) [-1980.103] (-1998.373) (-1998.681) * (-2003.039) (-1994.590) [-1990.070] (-2001.081) -- 0:00:49
847900 -- (-1991.353) [-1983.787] (-1997.561) (-1996.378) * (-2006.835) (-1994.756) [-1991.446] (-2000.101) -- 0:00:49
848000 -- (-1990.797) [-1982.980] (-1995.470) (-1995.443) * (-1991.584) [-1991.321] (-1992.170) (-2007.411) -- 0:00:49
Average standard deviation of split frequencies: 0.002271
848100 -- (-2011.897) (-1990.643) [-1987.679] (-1996.515) * [-1995.354] (-1993.352) (-1993.967) (-2018.358) -- 0:00:49
848200 -- (-2005.457) [-1991.049] (-1990.416) (-1997.810) * [-1991.406] (-2002.828) (-1996.479) (-2006.868) -- 0:00:49
848300 -- (-2003.284) [-1990.267] (-1991.076) (-2000.310) * (-1989.772) (-2002.224) [-1995.259] (-2023.635) -- 0:00:49
848400 -- (-2000.395) (-2003.710) [-1991.933] (-2003.222) * [-1988.707] (-2002.332) (-1989.700) (-2013.774) -- 0:00:49
848500 -- [-1999.634] (-1996.313) (-1991.301) (-1996.106) * (-1993.601) (-2000.313) [-1987.383] (-2016.751) -- 0:00:49
848600 -- (-1994.039) (-1987.766) (-1995.725) [-1988.641] * (-1990.884) (-1993.388) [-1991.322] (-2024.897) -- 0:00:49
848700 -- (-1988.937) [-1988.386] (-1995.712) (-1987.207) * [-1992.423] (-1992.352) (-1996.981) (-2004.877) -- 0:00:49
848800 -- [-1988.143] (-1990.922) (-1992.411) (-1991.168) * (-1987.445) [-1991.771] (-1999.021) (-2007.546) -- 0:00:49
848900 -- (-1989.731) (-1987.573) [-1983.053] (-1986.207) * [-1982.758] (-1993.656) (-1997.419) (-2011.195) -- 0:00:49
849000 -- (-1990.548) (-1997.803) (-1984.199) [-1985.547] * [-1985.349] (-1994.133) (-1990.812) (-2006.672) -- 0:00:49
Average standard deviation of split frequencies: 0.002220
849100 -- (-1997.452) (-1998.878) [-1985.971] (-1987.044) * [-1982.920] (-1998.351) (-1990.093) (-2005.016) -- 0:00:49
849200 -- (-1993.698) (-1991.781) (-1986.121) [-1989.514] * [-1986.589] (-1996.003) (-1994.032) (-2010.187) -- 0:00:49
849300 -- (-1991.028) (-2001.002) [-1982.870] (-1997.394) * [-1989.652] (-2008.434) (-1991.588) (-2004.520) -- 0:00:49
849400 -- (-2000.669) (-1994.232) [-1981.557] (-1999.943) * (-1982.221) (-2005.815) [-1990.385] (-2000.472) -- 0:00:49
849500 -- (-2000.246) (-1997.390) [-1985.847] (-1993.690) * [-1985.906] (-2012.105) (-1990.768) (-1995.276) -- 0:00:49
849600 -- (-1999.892) (-2003.395) [-1982.909] (-1990.390) * [-1987.233] (-2001.243) (-1993.375) (-1993.003) -- 0:00:49
849700 -- (-2002.279) (-1996.883) (-1986.533) [-1993.520] * (-1988.090) (-2008.173) (-1995.755) [-1989.120] -- 0:00:49
849800 -- (-2004.361) (-1998.083) (-1993.035) [-1988.205] * [-1981.886] (-1999.913) (-2004.295) (-1999.889) -- 0:00:49
849900 -- (-2001.348) (-2000.237) [-1982.035] (-1992.145) * [-1980.778] (-1991.657) (-1987.361) (-2004.810) -- 0:00:49
850000 -- (-1997.172) (-1996.820) [-1983.318] (-1996.151) * (-1985.786) (-1989.631) [-1993.445] (-2005.759) -- 0:00:49
Average standard deviation of split frequencies: 0.002218
850100 -- (-1992.215) (-1994.796) (-1978.556) [-1992.740] * (-1985.569) [-1990.190] (-1992.044) (-2006.129) -- 0:00:49
850200 -- (-1994.840) (-1994.827) [-1978.318] (-1994.282) * [-1981.545] (-1990.005) (-1991.623) (-2004.940) -- 0:00:48
850300 -- (-1994.522) (-2001.009) [-1977.497] (-1993.535) * (-1988.024) [-1986.601] (-1989.919) (-2004.803) -- 0:00:48
850400 -- (-1995.715) (-2005.447) [-1979.185] (-1990.608) * [-1983.407] (-1985.317) (-1985.087) (-2004.247) -- 0:00:48
850500 -- (-2000.354) (-2000.635) [-1983.230] (-1991.476) * (-1987.139) [-1986.108] (-1984.040) (-2011.559) -- 0:00:48
850600 -- (-1997.898) (-1991.438) [-1981.746] (-1990.820) * [-1994.003] (-1985.738) (-1996.293) (-1991.034) -- 0:00:48
850700 -- (-1997.511) (-1992.583) [-1987.294] (-2001.034) * (-1990.008) (-1986.735) [-1987.674] (-1993.384) -- 0:00:48
850800 -- (-1992.393) (-1995.351) [-1989.034] (-1997.476) * (-1992.643) [-1986.448] (-1988.893) (-1994.126) -- 0:00:48
850900 -- (-1994.722) (-1992.910) [-1987.232] (-1996.416) * (-1987.863) (-1985.221) [-1982.830] (-1995.827) -- 0:00:48
851000 -- (-1995.471) (-1998.084) [-1998.629] (-1996.380) * [-1983.231] (-1984.989) (-1981.849) (-1991.645) -- 0:00:48
Average standard deviation of split frequencies: 0.002294
851100 -- (-1999.498) (-1997.172) (-2003.456) [-1986.766] * (-1984.181) (-1988.860) [-1984.852] (-1992.043) -- 0:00:48
851200 -- (-1996.031) (-1993.778) [-2000.313] (-1990.634) * (-1983.561) (-1990.478) [-1983.222] (-1991.594) -- 0:00:48
851300 -- [-1990.777] (-1991.138) (-1991.923) (-1987.729) * (-1986.658) (-2002.761) [-1983.886] (-1986.182) -- 0:00:48
851400 -- (-1992.670) (-1986.625) [-1991.834] (-1988.056) * (-2003.339) (-2009.128) [-1981.098] (-1994.694) -- 0:00:48
851500 -- (-1996.286) (-1989.937) (-1985.536) [-1988.135] * (-1990.560) (-2002.959) [-1979.807] (-1990.844) -- 0:00:48
851600 -- (-2000.654) [-1988.865] (-1991.408) (-1989.225) * (-1990.544) (-2001.228) [-1985.061] (-1988.776) -- 0:00:48
851700 -- (-2000.828) (-1995.230) (-1988.689) [-1986.504] * [-1989.432] (-1995.986) (-1983.680) (-1987.806) -- 0:00:48
851800 -- (-2005.345) (-1993.286) [-1988.091] (-1987.093) * (-1992.143) (-2000.097) (-1991.532) [-1991.539] -- 0:00:48
851900 -- (-1995.049) (-1994.631) (-1991.835) [-1988.293] * (-1986.915) (-1996.948) (-1992.012) [-1988.237] -- 0:00:48
852000 -- (-1996.136) (-1990.625) (-1992.153) [-1984.324] * (-1987.197) (-2004.789) [-1987.829] (-1993.755) -- 0:00:48
Average standard deviation of split frequencies: 0.002244
852100 -- (-2000.801) (-1993.535) (-1992.748) [-1986.163] * (-1984.549) (-1991.166) [-1981.216] (-1991.729) -- 0:00:48
852200 -- (-2002.865) (-1988.029) (-1988.006) [-1985.195] * (-2005.103) (-1990.381) (-1981.666) [-1985.314] -- 0:00:48
852300 -- (-1995.367) [-1986.273] (-1988.182) (-1987.680) * (-2007.651) (-1986.933) [-1980.615] (-1991.746) -- 0:00:48
852400 -- (-1992.012) (-1993.697) [-1983.669] (-1986.557) * (-2008.641) (-1985.138) [-1980.526] (-1995.324) -- 0:00:48
852500 -- (-1996.283) (-1996.767) (-1989.193) [-1986.432] * (-2008.441) (-1988.501) [-1979.879] (-1995.236) -- 0:00:48
852600 -- (-1987.411) (-1991.520) (-1992.798) [-1986.356] * (-2003.457) (-1994.124) [-1980.372] (-1994.436) -- 0:00:48
852700 -- (-1992.255) (-1989.701) (-2000.423) [-1987.607] * (-1999.547) (-1998.507) [-1980.926] (-2001.375) -- 0:00:48
852800 -- (-1984.214) (-1991.072) (-2005.697) [-1988.863] * (-2004.677) (-1998.195) [-1977.469] (-2010.066) -- 0:00:48
852900 -- [-1987.918] (-1993.205) (-2002.086) (-1993.940) * (-2012.156) (-1996.530) [-1982.743] (-2006.341) -- 0:00:48
853000 -- (-1990.928) (-1990.079) (-2003.033) [-1992.873] * (-2001.283) (-1987.843) [-1984.749] (-2003.884) -- 0:00:48
Average standard deviation of split frequencies: 0.002210
853100 -- (-1990.427) (-1997.676) (-1988.003) [-1982.395] * (-2004.964) (-1983.521) [-1981.812] (-1999.029) -- 0:00:48
853200 -- [-1987.519] (-1989.772) (-1984.478) (-1990.632) * (-1995.974) (-1987.784) [-1982.246] (-2004.358) -- 0:00:48
853300 -- (-1985.583) (-1992.579) [-1982.920] (-1984.557) * (-1998.276) (-1988.408) [-1985.102] (-1994.793) -- 0:00:47
853400 -- (-1991.998) [-1988.980] (-1985.543) (-1980.220) * (-2000.975) [-1987.688] (-1982.082) (-1996.847) -- 0:00:47
853500 -- (-1991.048) (-1989.952) [-1987.256] (-1990.294) * (-2000.252) (-1990.709) [-1982.013] (-2005.372) -- 0:00:47
853600 -- (-1983.789) (-1987.342) [-1980.579] (-1992.976) * (-2002.780) (-1989.957) (-1981.080) [-2004.421] -- 0:00:47
853700 -- (-1989.971) (-1993.442) [-1981.997] (-1991.142) * (-2003.906) [-1987.567] (-1976.453) (-1993.749) -- 0:00:47
853800 -- (-1993.065) [-1986.602] (-1986.573) (-1983.459) * (-1994.786) (-1995.175) [-1981.579] (-2011.288) -- 0:00:47
853900 -- (-1987.131) (-1988.849) (-1985.081) [-1982.465] * (-1989.538) (-1990.602) [-1982.457] (-1998.065) -- 0:00:47
854000 -- [-1983.683] (-2002.960) (-1988.280) (-1985.872) * [-1988.673] (-1995.342) (-1984.519) (-1993.397) -- 0:00:47
Average standard deviation of split frequencies: 0.002208
854100 -- (-1987.109) (-2002.994) (-1988.665) [-1982.850] * (-1987.978) (-1990.002) (-1984.813) [-1986.919] -- 0:00:47
854200 -- (-1994.271) (-2004.644) (-1991.082) [-1984.755] * (-1982.464) (-1987.748) [-1982.724] (-1994.603) -- 0:00:47
854300 -- [-1997.007] (-1989.298) (-1993.124) (-1984.355) * [-1983.599] (-1992.282) (-1982.574) (-1998.898) -- 0:00:47
854400 -- (-1991.314) (-1989.548) (-1991.201) [-1978.053] * (-1988.786) [-1986.486] (-1986.537) (-2001.708) -- 0:00:47
854500 -- (-1995.729) (-1984.626) (-1990.719) [-1977.686] * [-1983.176] (-1983.763) (-1992.949) (-1997.963) -- 0:00:47
854600 -- (-1999.478) (-1990.683) (-2007.114) [-1982.069] * [-1983.366] (-1985.865) (-2002.725) (-2008.199) -- 0:00:47
854700 -- (-1990.398) [-1987.238] (-1996.874) (-1979.133) * (-1985.080) [-1987.877] (-1996.694) (-2005.119) -- 0:00:47
854800 -- [-1991.521] (-1988.510) (-2001.061) (-1980.341) * [-1984.586] (-1989.081) (-1987.804) (-1997.915) -- 0:00:47
854900 -- (-1991.955) (-1989.958) [-1993.134] (-1981.859) * [-1988.309] (-1992.563) (-1982.306) (-2005.343) -- 0:00:47
855000 -- (-1992.315) (-1992.178) (-1989.092) [-1984.162] * (-2000.565) (-1998.768) [-1980.081] (-1991.981) -- 0:00:47
Average standard deviation of split frequencies: 0.002394
855100 -- (-2000.192) (-1989.567) (-1989.911) [-1983.573] * (-2007.689) (-1996.258) [-1979.769] (-1988.493) -- 0:00:47
855200 -- (-2002.234) (-1985.648) (-1987.981) [-1980.254] * (-2006.863) (-1998.746) [-1980.877] (-1990.717) -- 0:00:47
855300 -- (-1990.519) (-1987.916) (-1991.201) [-1982.314] * (-1992.640) (-2004.519) [-1983.309] (-1983.554) -- 0:00:47
855400 -- (-1990.829) [-1984.232] (-1987.122) (-1991.686) * (-1985.447) (-1988.648) [-1981.020] (-1984.916) -- 0:00:47
855500 -- (-1989.548) (-1987.158) [-1986.460] (-1986.195) * [-1989.595] (-1986.688) (-1985.492) (-1986.524) -- 0:00:47
855600 -- (-1991.894) (-1991.545) (-1988.815) [-1984.700] * (-1985.658) (-1990.027) (-1988.181) [-1984.965] -- 0:00:47
855700 -- (-1991.865) (-1998.660) [-1982.552] (-1984.165) * (-1986.222) (-1988.930) (-1984.701) [-1980.754] -- 0:00:47
855800 -- (-1996.350) (-1988.826) [-1982.077] (-1986.751) * (-1988.451) (-1983.502) (-1983.699) [-1987.216] -- 0:00:47
855900 -- (-1992.973) (-1990.223) [-1981.496] (-1990.438) * (-1985.221) (-1986.752) [-1980.899] (-1990.096) -- 0:00:47
856000 -- [-1993.364] (-1995.337) (-1982.954) (-1989.555) * (-1989.876) (-1985.268) [-1979.354] (-1981.754) -- 0:00:47
Average standard deviation of split frequencies: 0.002423
856100 -- (-1990.739) (-1990.341) (-1988.936) [-1981.413] * (-1986.640) (-1988.695) [-1980.147] (-1990.341) -- 0:00:47
856200 -- [-1987.036] (-1990.831) (-1989.981) (-1983.278) * (-1988.159) [-1988.092] (-1982.998) (-1989.053) -- 0:00:47
856300 -- (-1986.184) (-1992.832) (-1989.038) [-1982.669] * (-1990.102) (-1983.209) [-1980.524] (-1990.772) -- 0:00:46
856400 -- (-1988.085) (-1999.767) (-1993.225) [-1985.341] * [-1991.089] (-1993.137) (-1983.817) (-1992.977) -- 0:00:46
856500 -- (-1987.457) (-1995.703) (-2014.740) [-1984.446] * (-1989.745) [-1985.465] (-1978.456) (-1996.038) -- 0:00:46
856600 -- (-1988.676) (-1995.812) (-2008.223) [-1976.843] * (-1985.727) (-1993.511) [-1983.675] (-1989.855) -- 0:00:46
856700 -- (-1995.037) (-1999.841) (-1995.735) [-1978.390] * (-1985.199) (-1992.802) [-1983.010] (-1991.745) -- 0:00:46
856800 -- [-1997.641] (-1996.645) (-1994.475) (-1978.708) * (-1987.579) [-1999.238] (-1985.948) (-2002.307) -- 0:00:46
856900 -- (-1988.338) (-1994.592) (-2014.592) [-1981.812] * (-1983.170) (-1993.694) [-1979.787] (-1998.101) -- 0:00:46
857000 -- (-1990.372) (-1990.343) (-2009.913) [-1982.142] * (-1985.279) (-1987.001) [-1980.208] (-1984.547) -- 0:00:46
Average standard deviation of split frequencies: 0.002388
857100 -- (-1993.321) (-1991.205) (-2006.479) [-1985.123] * (-1984.983) (-1987.890) [-1977.790] (-1991.920) -- 0:00:46
857200 -- (-1999.459) [-1986.023] (-2009.770) (-1981.231) * (-1991.126) (-1990.336) [-1981.298] (-1991.133) -- 0:00:46
857300 -- (-1993.949) (-1988.343) (-1996.869) [-1982.895] * [-1984.940] (-1991.965) (-1976.897) (-1983.574) -- 0:00:46
857400 -- (-1996.889) [-1986.567] (-2000.359) (-1989.805) * [-1989.172] (-1997.559) (-1980.165) (-1987.379) -- 0:00:46
857500 -- (-1991.741) (-1991.909) (-1987.161) [-1988.679] * (-1994.972) (-1997.958) (-1990.715) [-1986.255] -- 0:00:46
857600 -- (-1992.229) (-1997.674) [-1979.218] (-1994.262) * (-1995.230) (-2001.445) [-1985.133] (-1989.323) -- 0:00:46
857700 -- (-1994.079) (-1993.005) [-1978.557] (-1994.035) * (-1993.443) [-1989.860] (-1991.969) (-1989.904) -- 0:00:46
857800 -- (-1994.347) (-1994.142) [-1977.000] (-1992.974) * (-1997.932) (-1991.170) (-1986.253) [-1988.476] -- 0:00:46
857900 -- (-1990.059) (-1992.949) (-1980.907) [-1994.045] * (-1994.765) [-1991.475] (-1990.182) (-1985.072) -- 0:00:46
858000 -- (-1988.635) (-1993.751) [-1982.401] (-2003.378) * (-1986.838) [-1991.288] (-1986.711) (-1995.685) -- 0:00:46
Average standard deviation of split frequencies: 0.002417
858100 -- (-1985.591) (-1990.899) [-1982.047] (-2002.245) * [-1990.687] (-1993.860) (-1992.615) (-1996.207) -- 0:00:46
858200 -- (-1984.505) (-1997.443) [-1982.380] (-1999.268) * (-1991.386) (-2003.947) (-1983.088) [-1993.644] -- 0:00:46
858300 -- [-1985.203] (-1997.842) (-1982.503) (-2002.085) * (-1989.992) (-2007.465) [-1982.365] (-1987.737) -- 0:00:46
858400 -- [-1986.652] (-1997.490) (-1982.687) (-2000.319) * (-1992.406) (-2011.016) [-1981.261] (-1990.668) -- 0:00:46
858500 -- [-1987.264] (-1996.386) (-1985.289) (-2000.900) * (-1997.729) (-1995.060) (-1980.851) [-1993.616] -- 0:00:46
858600 -- [-1987.557] (-1997.850) (-1985.630) (-1994.508) * (-1992.984) (-1990.984) [-1981.513] (-1996.689) -- 0:00:46
858700 -- [-1985.976] (-1993.120) (-1988.615) (-2001.854) * (-1994.331) (-1992.283) (-1988.293) [-1987.029] -- 0:00:46
858800 -- (-1986.309) (-1997.044) [-1987.049] (-1997.623) * (-1997.738) (-1995.899) (-1981.277) [-1988.055] -- 0:00:46
858900 -- [-1989.866] (-1997.263) (-1993.233) (-2005.441) * (-1998.218) (-1994.903) (-1984.366) [-1980.232] -- 0:00:46
859000 -- (-1988.099) [-1995.855] (-1994.887) (-2006.627) * (-1995.283) (-2000.776) [-1981.804] (-1990.345) -- 0:00:46
Average standard deviation of split frequencies: 0.002398
859100 -- (-1993.739) (-1998.926) [-1994.138] (-1998.910) * (-1990.286) (-1998.243) [-1986.079] (-1985.902) -- 0:00:46
859200 -- (-1993.279) [-1994.613] (-1985.970) (-1996.378) * (-1994.655) (-1993.032) (-1992.643) [-1983.685] -- 0:00:46
859300 -- [-1989.407] (-1992.880) (-1989.297) (-1997.196) * (-1988.276) [-1993.005] (-1986.566) (-1983.267) -- 0:00:46
859400 -- (-1987.923) (-1994.377) [-1985.361] (-2007.676) * [-1989.637] (-1998.858) (-1985.559) (-1991.739) -- 0:00:45
859500 -- (-1990.544) (-2000.101) [-1980.867] (-2004.790) * [-1987.349] (-1997.562) (-2006.153) (-1989.678) -- 0:00:45
859600 -- [-1988.507] (-2001.613) (-1980.607) (-2003.912) * (-1983.924) (-1998.835) (-1988.600) [-1984.604] -- 0:00:45
859700 -- [-1984.891] (-2001.990) (-1982.655) (-2001.115) * (-1980.405) (-1994.742) [-1987.663] (-1986.358) -- 0:00:45
859800 -- [-1985.022] (-1997.017) (-1987.898) (-1998.269) * [-1981.776] (-1994.470) (-1990.679) (-1986.546) -- 0:00:45
859900 -- [-1985.522] (-1989.008) (-1982.863) (-2003.058) * [-1984.369] (-1992.157) (-1991.166) (-1995.777) -- 0:00:45
860000 -- (-1988.658) (-1992.573) (-1983.236) [-1992.749] * [-1978.146] (-2001.641) (-1986.898) (-1995.046) -- 0:00:45
Average standard deviation of split frequencies: 0.002396
860100 -- [-1989.377] (-2001.344) (-1992.212) (-1997.968) * [-1984.521] (-1996.160) (-1996.008) (-1998.111) -- 0:00:45
860200 -- (-1983.828) (-1995.340) (-1992.818) [-1997.707] * (-1993.913) (-1998.129) [-1988.075] (-1994.396) -- 0:00:45
860300 -- [-1985.488] (-1995.099) (-1994.921) (-1992.702) * (-1989.953) (-2003.228) [-1989.879] (-2006.253) -- 0:00:45
860400 -- (-1989.496) (-1994.161) [-1988.843] (-1997.453) * [-1989.113] (-1996.467) (-1987.519) (-1992.882) -- 0:00:45
860500 -- (-2009.535) (-1998.182) [-1994.540] (-1996.173) * (-1992.414) (-1991.100) [-1983.382] (-2008.557) -- 0:00:45
860600 -- (-1998.267) [-1999.911] (-1987.653) (-2001.055) * (-1995.551) [-1989.653] (-1994.240) (-1989.633) -- 0:00:45
860700 -- (-1990.965) (-2001.130) [-1981.968] (-1984.743) * (-1993.209) (-1992.372) (-1984.425) [-1989.196] -- 0:00:45
860800 -- [-1991.689] (-1995.133) (-1991.102) (-1989.474) * (-1986.920) (-1992.715) (-1987.572) [-1985.289] -- 0:00:45
860900 -- [-1984.326] (-1996.563) (-1996.272) (-1987.030) * [-1986.523] (-1997.210) (-1988.889) (-1986.082) -- 0:00:45
861000 -- [-1988.741] (-1997.057) (-1988.747) (-1989.337) * [-1981.380] (-1999.663) (-1987.822) (-1985.825) -- 0:00:45
Average standard deviation of split frequencies: 0.002455
861100 -- (-1995.444) (-1994.511) [-1985.351] (-1990.876) * [-1982.850] (-1997.217) (-1985.467) (-1989.195) -- 0:00:45
861200 -- (-2000.074) [-1997.098] (-1990.589) (-1994.030) * [-1980.029] (-1996.680) (-1981.287) (-1993.541) -- 0:00:45
861300 -- (-2003.514) (-2000.235) [-1983.266] (-1990.178) * [-1978.687] (-1993.261) (-1986.809) (-1984.868) -- 0:00:45
861400 -- (-1998.770) (-1994.487) [-1982.586] (-1994.276) * [-1979.583] (-1997.137) (-1987.178) (-1983.569) -- 0:00:45
861500 -- (-2006.801) (-1999.234) [-1981.198] (-1996.650) * (-1985.094) (-1996.593) (-1987.160) [-1986.515] -- 0:00:45
861600 -- (-2010.535) (-1990.276) [-1985.513] (-1998.551) * (-1979.543) (-2006.635) (-1983.083) [-1986.915] -- 0:00:45
861700 -- (-2005.032) (-1992.360) [-1985.817] (-1992.709) * (-1985.000) (-2009.918) [-1988.212] (-1987.091) -- 0:00:45
861800 -- (-1996.805) (-1992.099) [-1983.625] (-1997.524) * [-1988.263] (-2005.938) (-1985.039) (-1994.992) -- 0:00:45
861900 -- (-1998.654) (-1987.750) [-1988.268] (-1989.663) * (-1991.406) (-1997.330) [-1981.272] (-1989.328) -- 0:00:45
862000 -- (-2001.160) (-1987.715) [-1981.720] (-1994.115) * (-1993.572) (-1994.740) [-1979.780] (-1988.799) -- 0:00:45
Average standard deviation of split frequencies: 0.002609
862100 -- (-2004.090) (-1991.021) [-1979.552] (-1988.075) * (-1991.866) (-1993.401) [-1981.613] (-1987.724) -- 0:00:45
862200 -- (-2004.278) (-1989.134) [-1981.642] (-1995.995) * (-1995.710) (-1995.965) (-1983.921) [-1984.116] -- 0:00:45
862300 -- (-2004.607) (-1987.132) [-1985.313] (-1999.686) * (-1994.387) (-2000.896) (-1979.363) [-1981.131] -- 0:00:45
862400 -- (-1999.947) (-1983.712) [-1982.718] (-1997.673) * (-1991.160) (-2002.488) [-1981.320] (-1980.617) -- 0:00:44
862500 -- (-2001.850) [-1991.970] (-1982.867) (-1993.713) * (-1979.919) (-1997.944) [-1984.333] (-1988.274) -- 0:00:44
862600 -- [-1990.730] (-1986.794) (-1982.433) (-1990.349) * (-1980.532) (-1999.535) [-1985.617] (-1994.068) -- 0:00:44
862700 -- (-1993.453) [-1989.490] (-1990.602) (-1990.104) * [-1979.608] (-2002.915) (-1987.926) (-1999.726) -- 0:00:44
862800 -- (-1995.499) [-1989.346] (-2001.263) (-1989.736) * (-1978.376) (-1996.069) [-1983.291] (-2000.253) -- 0:00:44
862900 -- (-1998.202) (-1990.966) (-2010.712) [-1987.330] * [-1982.586] (-1996.035) (-1985.562) (-1997.557) -- 0:00:44
863000 -- (-1999.461) [-1993.481] (-1992.914) (-1993.261) * [-1981.485] (-1990.534) (-1986.981) (-1995.694) -- 0:00:44
Average standard deviation of split frequencies: 0.002731
863100 -- (-1995.753) (-1990.180) [-1992.821] (-1986.079) * [-1980.868] (-1999.386) (-1983.801) (-1993.801) -- 0:00:44
863200 -- (-1991.555) [-1985.264] (-1990.052) (-1987.637) * [-1980.113] (-1994.327) (-1989.884) (-1995.160) -- 0:00:44
863300 -- (-1995.645) [-1987.213] (-1992.231) (-1986.814) * (-1983.145) [-1993.849] (-1992.541) (-1995.469) -- 0:00:44
863400 -- (-2001.563) [-1988.880] (-1987.755) (-1983.541) * (-1982.709) (-1991.505) [-1988.040] (-1990.819) -- 0:00:44
863500 -- (-1997.667) (-1990.275) (-1993.524) [-1988.237] * (-1981.700) (-2003.303) (-1992.577) [-1984.817] -- 0:00:44
863600 -- (-1996.901) (-1993.717) (-1999.746) [-1986.602] * [-1980.836] (-2012.653) (-1987.874) (-1991.958) -- 0:00:44
863700 -- (-1994.694) (-1987.809) (-1994.356) [-1992.014] * (-1981.764) (-1991.579) [-1984.380] (-1993.000) -- 0:00:44
863800 -- (-2002.018) (-1994.406) (-1994.282) [-1991.579] * [-1983.744] (-1993.333) (-1988.671) (-1991.288) -- 0:00:44
863900 -- (-1999.482) (-1995.876) (-1997.231) [-1989.767] * [-1989.455] (-1993.657) (-1995.939) (-1986.360) -- 0:00:44
864000 -- (-2008.465) (-1998.924) (-2001.860) [-1995.129] * [-1987.573] (-1992.481) (-2001.868) (-1989.927) -- 0:00:44
Average standard deviation of split frequencies: 0.002728
864100 -- (-2005.776) [-1991.558] (-1997.051) (-1992.928) * (-1988.237) (-1986.501) (-2000.973) [-1980.737] -- 0:00:44
864200 -- (-1992.087) [-1990.397] (-1989.417) (-1999.131) * (-1997.190) (-1986.606) (-1999.061) [-1983.814] -- 0:00:44
864300 -- (-1997.256) (-1997.653) [-1991.309] (-1992.650) * (-1998.494) [-1987.239] (-1996.054) (-1985.086) -- 0:00:44
864400 -- (-1995.913) (-1995.161) [-1987.947] (-1992.589) * (-1985.887) (-1990.818) (-1995.913) [-1979.815] -- 0:00:44
864500 -- (-2000.749) (-1987.692) (-1990.358) [-1987.285] * (-1993.564) (-2000.051) (-1994.776) [-1980.985] -- 0:00:44
864600 -- (-1998.406) (-1993.370) (-1990.075) [-1989.825] * (-1991.343) (-1994.754) (-1991.651) [-1982.560] -- 0:00:44
864700 -- (-2009.399) (-1995.961) [-1994.621] (-1990.012) * (-1995.700) (-1990.409) (-1994.210) [-1978.969] -- 0:00:44
864800 -- (-1999.136) [-1989.406] (-1988.128) (-1990.204) * (-1990.808) (-1989.564) (-1997.343) [-1980.452] -- 0:00:44
864900 -- (-1998.138) (-1992.788) [-1992.267] (-1997.636) * (-1992.719) (-1987.086) (-2006.699) [-1984.898] -- 0:00:44
865000 -- (-2000.756) (-1990.267) [-1981.975] (-1991.119) * [-1987.038] (-1993.629) (-2008.862) (-1986.057) -- 0:00:44
Average standard deviation of split frequencies: 0.002724
865100 -- (-2002.646) (-1988.908) (-1987.048) [-1981.217] * [-1990.522] (-1991.880) (-2003.505) (-1991.159) -- 0:00:44
865200 -- (-2021.386) [-1987.083] (-1998.908) (-1986.663) * [-1988.147] (-1989.231) (-2000.449) (-1988.227) -- 0:00:44
865300 -- (-1998.822) (-1990.985) (-1993.072) [-1983.515] * (-1991.408) [-1985.106] (-1995.694) (-1989.010) -- 0:00:44
865400 -- (-1992.337) (-1989.024) (-1994.092) [-1983.523] * [-1994.746] (-1989.204) (-1995.664) (-1987.826) -- 0:00:44
865500 -- [-1987.686] (-1988.759) (-1999.577) (-1985.636) * (-1998.100) (-1988.914) (-1997.423) [-1988.191] -- 0:00:43
865600 -- (-1989.747) [-1986.888] (-1992.108) (-1983.380) * (-2003.959) (-1992.062) (-1996.566) [-1986.772] -- 0:00:43
865700 -- (-1989.152) (-1987.445) (-1989.816) [-1979.515] * (-1999.927) (-1985.957) (-2000.105) [-1978.759] -- 0:00:43
865800 -- (-2002.527) (-1994.940) [-1981.501] (-1983.382) * (-2008.029) [-1984.845] (-1996.982) (-1977.929) -- 0:00:43
865900 -- (-1993.212) (-1988.634) (-1986.250) [-1982.791] * (-2002.906) (-1987.051) (-2001.236) [-1981.366] -- 0:00:43
866000 -- (-1989.929) (-1988.365) [-1984.362] (-1986.825) * (-1998.861) (-1990.771) (-2015.958) [-1984.028] -- 0:00:43
Average standard deviation of split frequencies: 0.002752
866100 -- (-1990.234) [-1990.409] (-1988.027) (-1984.685) * (-1997.658) (-1987.169) (-1994.328) [-1989.605] -- 0:00:43
866200 -- (-1986.043) (-1989.629) [-1981.094] (-1984.767) * (-2004.569) (-1985.634) (-1989.784) [-1986.263] -- 0:00:43
866300 -- (-1989.218) (-1991.257) (-1979.514) [-1987.321] * (-1999.553) (-1988.283) (-1993.390) [-1987.866] -- 0:00:43
866400 -- (-1989.719) (-1990.618) [-1979.885] (-1987.951) * (-2002.930) [-1986.630] (-1994.394) (-1990.728) -- 0:00:43
866500 -- [-1988.085] (-1995.109) (-1983.359) (-1984.729) * (-1992.954) [-1988.523] (-1997.412) (-1988.729) -- 0:00:43
866600 -- [-1989.935] (-1986.724) (-1985.785) (-1991.963) * (-1994.432) [-1991.117] (-1999.368) (-1998.623) -- 0:00:43
866700 -- (-1989.585) (-1989.890) [-1985.214] (-1988.156) * (-1995.752) [-1990.756] (-2009.842) (-1984.396) -- 0:00:43
866800 -- (-1991.782) (-1990.834) [-1984.204] (-1988.288) * (-1992.225) (-1991.137) (-1997.199) [-1984.689] -- 0:00:43
866900 -- (-1993.522) (-1997.423) [-1981.019] (-1992.232) * (-1994.749) (-1997.374) (-2004.441) [-1983.531] -- 0:00:43
867000 -- (-1988.182) (-2003.195) [-1983.438] (-1987.808) * (-1991.220) (-1994.039) (-2003.893) [-1987.154] -- 0:00:43
Average standard deviation of split frequencies: 0.002671
867100 -- [-1986.929] (-2016.091) (-1987.136) (-1985.163) * (-1991.918) (-1995.437) (-1990.758) [-1988.279] -- 0:00:43
867200 -- (-1988.209) (-2011.964) (-1986.387) [-1980.544] * [-1990.652] (-1994.553) (-1993.508) (-1991.054) -- 0:00:43
867300 -- (-1986.559) (-2014.343) [-1979.654] (-1983.610) * [-1990.922] (-1991.228) (-1998.385) (-1992.661) -- 0:00:43
867400 -- (-1988.078) (-1992.649) [-1980.997] (-1983.609) * (-1989.355) [-1988.722] (-2001.420) (-1987.047) -- 0:00:43
867500 -- (-1997.637) (-1991.136) (-1982.789) [-1985.850] * [-1986.609] (-1993.604) (-1993.556) (-1984.879) -- 0:00:43
867600 -- (-1992.449) (-1988.741) [-1988.016] (-1988.053) * (-1990.149) (-1994.557) (-1994.632) [-1989.622] -- 0:00:43
867700 -- (-1995.960) (-1991.884) (-1993.237) [-1995.771] * (-1987.814) (-1991.742) (-1996.813) [-1987.442] -- 0:00:43
867800 -- (-1994.140) (-1998.125) (-1989.970) [-1991.723] * (-1992.004) (-1992.860) (-2005.268) [-1989.384] -- 0:00:43
867900 -- (-1997.753) (-1996.798) [-1985.802] (-1987.946) * (-1992.255) [-1993.198] (-1997.508) (-1988.709) -- 0:00:43
868000 -- (-2000.994) (-2003.817) (-1983.525) [-1981.964] * (-1998.962) (-2001.012) [-1991.458] (-1985.009) -- 0:00:43
Average standard deviation of split frequencies: 0.002606
868100 -- (-1991.472) (-2000.274) (-1980.700) [-1980.059] * (-1990.850) [-1984.924] (-1990.762) (-1988.409) -- 0:00:43
868200 -- (-1994.576) (-1999.944) (-1986.779) [-1987.965] * (-1994.752) (-1986.377) (-1996.691) [-1988.478] -- 0:00:43
868300 -- (-1991.550) (-1995.062) [-1985.186] (-1982.103) * (-1991.766) (-1986.689) (-2002.967) [-1983.747] -- 0:00:43
868400 -- (-1987.922) (-1999.042) (-1985.086) [-1982.164] * (-1997.377) (-1986.552) (-2009.531) [-1986.490] -- 0:00:43
868500 -- (-1994.291) (-1995.456) (-1984.925) [-1981.372] * (-1994.626) (-1989.690) (-2003.140) [-1986.260] -- 0:00:43
868600 -- [-1993.340] (-1998.673) (-1985.175) (-1985.069) * (-1993.151) (-1997.928) (-2007.890) [-1986.129] -- 0:00:42
868700 -- (-2006.339) (-1994.859) (-1984.950) [-1984.298] * (-1996.411) (-1997.670) (-1997.657) [-1988.320] -- 0:00:42
868800 -- (-1995.676) (-1994.506) (-1979.451) [-1982.283] * (-1994.342) (-1997.835) (-1998.123) [-1990.210] -- 0:00:42
868900 -- (-1999.106) (-1992.124) [-1981.480] (-1981.698) * (-1990.969) (-1995.442) (-1996.546) [-1983.883] -- 0:00:42
869000 -- (-1992.899) (-2002.120) [-1984.066] (-1987.996) * (-1994.863) (-1996.216) (-1992.171) [-1977.991] -- 0:00:42
Average standard deviation of split frequencies: 0.002526
869100 -- (-1994.348) (-1999.668) [-1981.986] (-1986.012) * [-1991.585] (-1992.292) (-1988.355) (-1978.878) -- 0:00:42
869200 -- (-1993.565) (-2001.659) [-1985.250] (-1993.526) * (-1997.481) [-1986.062] (-1994.715) (-1980.101) -- 0:00:42
869300 -- (-1994.471) (-2001.791) [-1983.283] (-1994.470) * (-1988.251) [-1987.699] (-2001.320) (-1983.871) -- 0:00:42
869400 -- (-1986.119) (-2004.904) (-1988.576) [-1985.716] * (-1995.246) (-1987.261) (-1998.555) [-1982.461] -- 0:00:42
869500 -- (-1991.120) (-1997.735) [-1989.693] (-1984.561) * (-1994.694) (-1987.909) (-1998.212) [-1986.670] -- 0:00:42
869600 -- [-1987.563] (-2007.592) (-1991.874) (-1988.571) * (-1989.107) (-1986.710) (-2002.295) [-1982.776] -- 0:00:42
869700 -- (-1989.647) (-2004.379) (-1989.911) [-1982.896] * (-1993.356) (-1994.756) (-1993.836) [-1983.479] -- 0:00:42
869800 -- (-1991.729) (-1990.512) [-1981.642] (-1982.618) * (-1990.781) (-1996.631) (-1994.653) [-1981.972] -- 0:00:42
869900 -- (-1992.652) (-1992.438) [-1981.669] (-1981.503) * (-1987.759) (-2003.788) (-1990.695) [-1979.520] -- 0:00:42
870000 -- (-1996.350) (-1986.902) [-1978.463] (-1983.278) * (-1990.966) (-1999.680) (-1997.387) [-1985.592] -- 0:00:42
Average standard deviation of split frequencies: 0.002492
870100 -- (-1994.100) (-1990.398) (-1979.803) [-1984.121] * [-1985.648] (-1995.097) (-1998.489) (-1980.131) -- 0:00:42
870200 -- (-2011.584) (-1984.245) [-1977.955] (-1982.060) * [-1988.982] (-2009.180) (-1999.136) (-1990.106) -- 0:00:42
870300 -- (-2018.120) (-1980.689) (-1983.597) [-1982.838] * (-1993.821) (-2004.169) (-1997.776) [-1989.108] -- 0:00:42
870400 -- (-2002.362) (-1982.896) (-1988.869) [-1983.378] * (-1990.020) (-2011.332) [-1990.969] (-1995.341) -- 0:00:42
870500 -- (-1998.938) (-1985.393) [-1990.679] (-1986.703) * [-1985.630] (-1993.610) (-1999.043) (-1988.882) -- 0:00:42
870600 -- (-2002.469) (-1989.868) [-1983.208] (-1979.013) * [-1987.573] (-1998.131) (-1991.964) (-1986.332) -- 0:00:42
870700 -- (-2001.662) (-1991.426) [-1983.361] (-1981.865) * [-1987.027] (-2000.257) (-1992.253) (-1992.100) -- 0:00:42
870800 -- (-1994.669) (-1985.682) (-1986.276) [-1981.815] * [-1988.672] (-2001.052) (-1992.946) (-1985.308) -- 0:00:42
870900 -- (-1992.880) [-1988.425] (-1985.835) (-1984.082) * (-1993.055) (-1998.167) (-1995.210) [-1983.993] -- 0:00:42
871000 -- (-1998.062) [-1986.970] (-1993.280) (-1988.571) * (-1993.396) (-1993.795) [-1985.509] (-1987.283) -- 0:00:42
Average standard deviation of split frequencies: 0.002535
871100 -- (-1998.498) [-1986.908] (-1990.743) (-1990.405) * (-1993.783) (-1989.660) (-1990.037) [-1982.194] -- 0:00:42
871200 -- (-1993.709) [-1981.986] (-1990.287) (-1985.617) * (-1989.275) (-1990.941) [-1983.915] (-1982.985) -- 0:00:42
871300 -- (-1988.110) (-1987.127) (-1994.223) [-1987.006] * (-1987.702) (-1988.161) (-1993.768) [-1984.957] -- 0:00:42
871400 -- (-1989.840) [-1984.986] (-1993.584) (-1990.079) * (-1995.284) (-1989.041) (-1986.915) [-1984.278] -- 0:00:42
871500 -- (-1992.529) [-1985.612] (-1990.464) (-1984.888) * (-1987.174) (-1995.665) (-1993.970) [-1982.822] -- 0:00:42
871600 -- (-1996.766) (-1992.414) (-1994.229) [-1986.430] * (-1987.201) [-1992.928] (-1997.587) (-1983.303) -- 0:00:41
871700 -- [-1985.521] (-1989.268) (-1992.978) (-1985.874) * (-1992.371) [-1990.612] (-1993.091) (-1982.923) -- 0:00:41
871800 -- (-1988.874) (-1992.319) [-1986.623] (-1994.937) * (-1994.037) (-1988.993) (-1993.211) [-1982.116] -- 0:00:41
871900 -- (-1996.986) (-1989.531) [-1988.097] (-1995.001) * (-1991.436) (-1996.589) (-2000.773) [-1982.700] -- 0:00:41
872000 -- (-2002.353) (-1996.665) (-1987.538) [-1985.024] * (-1986.987) [-1993.777] (-2003.773) (-1989.161) -- 0:00:41
Average standard deviation of split frequencies: 0.002548
872100 -- (-2000.221) (-1993.291) (-1984.866) [-1988.091] * (-1988.976) (-1994.947) (-1993.194) [-1985.546] -- 0:00:41
872200 -- (-2006.881) (-1993.031) (-1982.867) [-1987.940] * [-1989.812] (-1992.484) (-1989.442) (-1985.438) -- 0:00:41
872300 -- (-1989.910) (-1988.377) [-1983.118] (-1993.479) * (-1997.319) (-1992.359) (-1997.360) [-1984.683] -- 0:00:41
872400 -- (-2004.419) (-1995.066) [-1983.619] (-1996.126) * (-1999.834) (-1994.632) (-2011.454) [-1982.625] -- 0:00:41
872500 -- (-2009.629) (-1983.062) [-1978.583] (-1994.218) * (-1997.280) [-1995.401] (-2001.240) (-1989.957) -- 0:00:41
872600 -- (-2008.856) (-1982.482) [-1983.294] (-1989.595) * [-1993.767] (-1993.578) (-1998.513) (-1993.172) -- 0:00:41
872700 -- (-1999.925) (-1980.109) [-1981.948] (-1995.269) * [-1985.307] (-1993.438) (-1998.829) (-1995.408) -- 0:00:41
872800 -- (-1999.423) [-1986.378] (-1981.133) (-1991.118) * [-1984.638] (-1989.986) (-1996.733) (-1991.761) -- 0:00:41
872900 -- (-1995.993) [-1983.562] (-1987.804) (-1982.691) * (-1987.727) (-1991.985) [-1997.254] (-1994.784) -- 0:00:41
873000 -- (-2003.419) [-1980.837] (-1985.137) (-1981.932) * (-1995.006) [-1992.335] (-1991.942) (-1997.214) -- 0:00:41
Average standard deviation of split frequencies: 0.002576
873100 -- (-2008.205) (-1987.751) (-1986.511) [-1982.071] * [-1991.570] (-1996.831) (-1992.690) (-1999.698) -- 0:00:41
873200 -- (-2001.999) (-1987.857) [-1981.390] (-1986.023) * (-1996.542) [-1996.796] (-1988.324) (-1993.775) -- 0:00:41
873300 -- (-1999.290) (-1992.877) [-1983.566] (-1982.403) * (-2000.382) (-1993.092) [-1992.606] (-1993.429) -- 0:00:41
873400 -- (-2006.304) (-1993.530) [-1982.343] (-1983.021) * (-2004.678) [-1990.639] (-1996.932) (-1988.331) -- 0:00:41
873500 -- (-2003.688) (-1992.177) [-1985.010] (-1980.487) * (-2005.221) (-1993.484) (-1999.217) [-1984.013] -- 0:00:41
873600 -- (-1994.518) [-1984.584] (-1987.920) (-1984.680) * [-2000.646] (-1992.211) (-2002.311) (-1983.080) -- 0:00:41
873700 -- (-2000.364) [-1982.643] (-1989.447) (-1988.086) * (-2000.514) (-1989.337) (-1994.327) [-1983.389] -- 0:00:41
873800 -- (-2000.065) [-1981.664] (-2001.273) (-1984.027) * (-2001.333) (-1993.411) (-1989.206) [-1985.177] -- 0:00:41
873900 -- [-1992.612] (-1984.710) (-1994.978) (-1989.614) * (-1992.031) [-1994.060] (-1993.152) (-1987.788) -- 0:00:41
874000 -- (-1999.714) [-1980.400] (-1990.975) (-1984.861) * (-1995.293) (-1994.153) (-1990.938) [-1988.396] -- 0:00:41
Average standard deviation of split frequencies: 0.002496
874100 -- (-1998.000) [-1981.102] (-1989.048) (-1990.629) * (-2015.021) (-1988.183) (-1996.682) [-1989.345] -- 0:00:41
874200 -- (-1990.481) (-1984.574) (-1986.369) [-1984.788] * (-1999.401) (-1987.854) [-1992.288] (-2001.975) -- 0:00:41
874300 -- (-1992.419) (-1995.561) [-1986.240] (-1983.043) * (-2002.229) [-1987.981] (-1992.391) (-2003.468) -- 0:00:41
874400 -- (-1991.918) (-1991.760) [-1986.228] (-1979.695) * (-2002.876) [-1991.480] (-1989.249) (-2009.694) -- 0:00:41
874500 -- (-2005.561) (-1995.124) [-1992.647] (-1989.604) * (-1993.680) [-1992.274] (-1998.762) (-2003.927) -- 0:00:41
874600 -- (-1998.528) (-1993.098) [-1987.887] (-1986.697) * [-1987.605] (-1995.460) (-2002.528) (-1992.961) -- 0:00:41
874700 -- (-1997.291) [-1985.893] (-1993.192) (-1986.719) * [-1990.080] (-1999.186) (-1999.142) (-1997.032) -- 0:00:40
874800 -- (-2002.571) (-1988.450) (-1990.923) [-1989.161] * (-1992.388) [-1993.171] (-1998.680) (-1990.844) -- 0:00:40
874900 -- (-2001.095) (-1989.548) (-1991.490) [-1980.197] * (-1998.681) [-1987.767] (-2001.947) (-1989.629) -- 0:00:40
875000 -- (-1994.477) (-1983.418) (-1996.020) [-1980.839] * [-2001.685] (-1995.487) (-2001.850) (-1993.975) -- 0:00:40
Average standard deviation of split frequencies: 0.002447
875100 -- (-1992.825) [-1984.293] (-1991.047) (-1982.973) * (-2000.759) [-1993.645] (-2005.884) (-1995.339) -- 0:00:40
875200 -- (-1987.343) [-1981.517] (-1985.997) (-1981.993) * [-1996.129] (-1992.419) (-2003.887) (-1991.880) -- 0:00:40
875300 -- (-1985.890) (-1994.132) [-1990.835] (-1983.362) * (-2004.221) [-1984.889] (-2013.497) (-2003.974) -- 0:00:40
875400 -- (-1986.554) (-1995.416) [-1986.174] (-1983.097) * (-2005.172) [-1990.639] (-2007.778) (-1991.957) -- 0:00:40
875500 -- (-1985.382) (-1995.113) [-1983.049] (-1990.994) * (-1999.043) [-1990.093] (-1994.984) (-1993.854) -- 0:00:40
875600 -- (-1989.090) (-1997.928) [-1984.412] (-1997.154) * (-2005.274) [-1990.903] (-1996.093) (-1992.350) -- 0:00:40
875700 -- (-1987.967) (-1991.295) (-1989.060) [-1988.363] * (-1992.882) (-1989.988) (-1994.176) [-1989.097] -- 0:00:40
875800 -- [-1990.533] (-1990.367) (-1989.494) (-1988.982) * (-1998.494) [-1988.501] (-1997.214) (-1989.176) -- 0:00:40
875900 -- (-1988.882) (-1993.503) [-1986.394] (-1993.785) * (-1994.649) (-1992.371) (-1996.487) [-1991.707] -- 0:00:40
876000 -- (-1988.012) [-1990.309] (-1987.041) (-2002.077) * (-1991.735) [-1987.957] (-1997.469) (-1995.339) -- 0:00:40
Average standard deviation of split frequencies: 0.002383
876100 -- (-1989.840) (-1986.571) [-1988.678] (-2002.598) * (-1989.083) [-1986.363] (-1991.007) (-1991.484) -- 0:00:40
876200 -- (-1992.875) (-1990.463) [-1984.515] (-1995.336) * (-1995.552) [-1985.903] (-1991.933) (-1999.559) -- 0:00:40
876300 -- (-1997.289) (-1991.880) (-1984.812) [-1988.380] * (-1990.039) [-1984.639] (-1995.295) (-2005.203) -- 0:00:40
876400 -- (-1997.421) (-1995.172) (-1991.136) [-1991.340] * (-1997.511) [-1982.253] (-1998.872) (-2001.850) -- 0:00:40
876500 -- (-2002.601) (-1992.234) [-1994.049] (-1983.123) * (-1992.762) [-1985.396] (-2000.103) (-2005.427) -- 0:00:40
876600 -- (-2007.278) (-1993.826) (-1990.576) [-1982.906] * (-1995.071) [-1986.968] (-1994.514) (-1993.950) -- 0:00:40
876700 -- (-1996.636) (-1998.976) (-1994.264) [-1980.578] * (-1993.927) [-1987.697] (-1989.579) (-2001.249) -- 0:00:40
876800 -- (-1996.256) (-2003.556) (-1997.063) [-1984.096] * (-1995.633) [-1988.619] (-1991.843) (-2004.027) -- 0:00:40
876900 -- (-2001.240) (-2002.025) (-1992.801) [-1983.457] * (-1991.499) [-1984.194] (-1994.482) (-1990.944) -- 0:00:40
877000 -- (-2001.469) (-2004.623) (-1993.946) [-1980.599] * (-1993.425) [-1984.042] (-2005.335) (-1987.963) -- 0:00:40
Average standard deviation of split frequencies: 0.002426
877100 -- (-2002.133) (-2000.492) (-1994.478) [-1980.314] * (-1991.206) [-1986.649] (-1992.758) (-1995.769) -- 0:00:40
877200 -- (-1998.217) (-1994.563) (-1998.847) [-1981.906] * (-1992.818) (-1995.405) (-1993.804) [-1992.781] -- 0:00:40
877300 -- (-1997.227) [-1986.457] (-1999.058) (-1985.665) * (-1995.404) [-1988.253] (-2003.810) (-1991.510) -- 0:00:40
877400 -- (-1989.392) (-1989.013) (-1994.353) [-1981.280] * (-1995.332) [-1987.887] (-1993.543) (-1989.270) -- 0:00:40
877500 -- (-1988.354) (-1983.790) (-2001.919) [-1980.841] * (-1994.920) (-1991.598) (-1996.034) [-1983.619] -- 0:00:40
877600 -- (-1997.296) (-1983.636) (-2003.098) [-1984.498] * (-1991.796) (-1994.371) (-1986.486) [-1984.089] -- 0:00:40
877700 -- (-1991.325) (-1987.598) (-1996.744) [-1982.648] * (-1994.019) (-1994.336) [-1982.732] (-1991.928) -- 0:00:39
877800 -- (-1994.073) (-1990.602) (-1987.497) [-1985.865] * (-1991.454) (-1988.720) [-1989.263] (-2002.936) -- 0:00:39
877900 -- (-2001.530) [-1982.873] (-1995.934) (-1989.343) * (-1994.887) [-1984.826] (-1986.785) (-1997.604) -- 0:00:39
878000 -- (-1998.067) [-1982.603] (-1993.300) (-1986.431) * (-1989.281) (-1983.648) [-1987.649] (-1994.217) -- 0:00:39
Average standard deviation of split frequencies: 0.002485
878100 -- (-1995.459) [-1984.112] (-1993.588) (-1985.488) * (-1990.275) (-1989.839) [-1985.685] (-1996.737) -- 0:00:39
878200 -- (-1995.030) (-1984.196) (-1989.925) [-1983.284] * (-1996.676) (-1989.457) [-1986.699] (-1996.194) -- 0:00:39
878300 -- (-1998.663) (-1983.022) (-1994.453) [-1985.961] * [-1988.462] (-1990.496) (-1985.890) (-2010.275) -- 0:00:39
878400 -- (-1995.209) (-1986.918) (-1990.214) [-1985.396] * [-1988.719] (-1990.196) (-1991.295) (-2003.043) -- 0:00:39
878500 -- [-1991.389] (-1985.652) (-1995.417) (-1984.287) * (-1987.363) [-1986.076] (-1989.386) (-1999.525) -- 0:00:39
878600 -- (-1997.660) (-1984.123) [-1988.635] (-1988.099) * (-1995.276) [-1983.898] (-1996.672) (-1991.589) -- 0:00:39
878700 -- (-1994.153) (-1990.515) [-1984.476] (-1986.127) * [-1992.430] (-1988.948) (-1998.937) (-1989.914) -- 0:00:39
878800 -- (-2000.974) (-1993.047) (-1991.006) [-1987.869] * (-1996.109) [-1989.940] (-1995.362) (-1993.631) -- 0:00:39
878900 -- (-1994.231) [-1984.660] (-1994.599) (-1989.058) * (-1996.479) [-1991.237] (-1999.671) (-1989.982) -- 0:00:39
879000 -- (-1991.264) (-1993.982) [-1987.794] (-2001.632) * (-1995.686) (-1989.327) (-1998.158) [-1989.183] -- 0:00:39
Average standard deviation of split frequencies: 0.002558
879100 -- (-1992.191) [-1983.628] (-1990.880) (-2007.810) * (-1996.540) [-1986.478] (-1995.055) (-1988.294) -- 0:00:39
879200 -- [-1993.855] (-1990.673) (-1988.826) (-2002.309) * (-1993.638) (-1988.978) [-1988.409] (-1998.046) -- 0:00:39
879300 -- (-1989.385) [-1988.510] (-1990.306) (-1992.281) * [-1987.782] (-1987.999) (-1993.485) (-1989.874) -- 0:00:39
879400 -- (-2004.528) [-1987.741] (-1991.263) (-1995.093) * (-1991.377) (-1998.477) (-1991.345) [-1984.878] -- 0:00:39
879500 -- (-2006.585) [-1983.546] (-1993.962) (-1983.444) * (-1985.196) (-1994.615) [-1990.680] (-1991.812) -- 0:00:39
879600 -- (-2011.688) (-1984.176) [-1993.995] (-1988.560) * [-1986.127] (-1995.107) (-1994.034) (-1989.997) -- 0:00:39
879700 -- (-2003.930) (-1986.960) (-1992.867) [-1984.571] * [-1986.410] (-1999.561) (-1990.978) (-1997.837) -- 0:00:39
879800 -- (-1996.820) [-1985.467] (-1983.890) (-1980.563) * [-1988.890] (-1998.069) (-1989.128) (-1999.514) -- 0:00:39
879900 -- (-2015.034) [-1984.632] (-1987.355) (-1985.794) * [-1988.565] (-1994.579) (-1998.078) (-1991.634) -- 0:00:39
880000 -- (-2009.760) (-1993.188) (-1986.342) [-1984.062] * [-1988.443] (-2004.964) (-1994.486) (-1991.393) -- 0:00:39
Average standard deviation of split frequencies: 0.002586
880100 -- (-2001.596) (-1982.840) (-1990.124) [-1991.626] * [-1985.580] (-2000.946) (-2003.267) (-1985.042) -- 0:00:39
880200 -- (-2001.662) (-1978.332) (-1995.945) [-1992.832] * (-1990.873) (-2002.110) (-2002.658) [-1986.170] -- 0:00:39
880300 -- (-2007.483) [-1979.056] (-1998.836) (-1991.904) * (-1990.870) (-2003.266) (-2009.611) [-1983.106] -- 0:00:39
880400 -- (-1993.225) [-1981.350] (-1988.196) (-1994.169) * (-1999.336) (-1993.566) (-2000.344) [-1983.768] -- 0:00:39
880500 -- (-1990.743) [-1983.039] (-1990.559) (-1997.571) * (-1996.427) (-1999.713) (-1997.902) [-1984.588] -- 0:00:39
880600 -- (-1990.866) [-1983.220] (-2000.650) (-1992.450) * (-1989.574) (-2003.827) (-2006.109) [-1987.511] -- 0:00:39
880700 -- (-1988.003) [-1985.391] (-2008.065) (-1990.629) * (-1990.713) (-1999.962) (-2002.679) [-1985.632] -- 0:00:39
880800 -- (-1991.627) [-1987.519] (-2004.038) (-1991.305) * (-1988.429) (-1992.492) (-2002.467) [-1986.663] -- 0:00:38
880900 -- (-1995.502) (-1983.994) (-2000.789) [-1986.162] * [-1988.585] (-1996.521) (-2007.557) (-1988.237) -- 0:00:38
881000 -- [-1983.993] (-1979.826) (-2004.550) (-1992.200) * (-1991.735) (-1995.773) (-2002.267) [-1983.369] -- 0:00:38
Average standard deviation of split frequencies: 0.002553
881100 -- [-1990.789] (-1983.794) (-1997.808) (-1993.082) * (-1989.719) (-1999.329) (-1999.201) [-1984.102] -- 0:00:38
881200 -- (-1993.968) [-1978.764] (-1993.734) (-1996.514) * [-1991.882] (-1998.964) (-1993.677) (-1986.421) -- 0:00:38
881300 -- (-2001.229) [-1981.171] (-1997.723) (-1991.702) * [-1987.558] (-1996.047) (-1998.460) (-1987.365) -- 0:00:38
881400 -- (-2000.163) [-1986.202] (-1998.311) (-1995.230) * (-1986.346) (-1991.068) [-1985.078] (-1987.136) -- 0:00:38
881500 -- (-1998.317) [-1987.371] (-2000.348) (-1988.863) * [-1985.583] (-1986.969) (-1986.378) (-2005.383) -- 0:00:38
881600 -- (-1994.015) [-1987.084] (-1996.466) (-1995.286) * (-1992.190) [-1991.535] (-1987.391) (-2001.990) -- 0:00:38
881700 -- (-1998.175) [-1980.693] (-2002.544) (-1987.422) * [-1985.779] (-1989.322) (-1991.757) (-1990.064) -- 0:00:38
881800 -- (-1992.878) [-1986.216] (-2018.179) (-1986.857) * [-1985.454] (-1988.015) (-1991.026) (-1988.185) -- 0:00:38
881900 -- (-1992.826) (-1982.390) (-2018.647) [-1988.026] * (-1989.313) (-1993.172) (-2001.468) [-1990.407] -- 0:00:38
882000 -- (-1992.072) [-1980.057] (-2004.047) (-1987.310) * (-1998.111) (-2000.093) (-2001.882) [-1990.252] -- 0:00:38
Average standard deviation of split frequencies: 0.002473
882100 -- (-1990.218) [-1979.996] (-2001.203) (-1995.625) * [-1991.363] (-2000.691) (-2002.936) (-1992.671) -- 0:00:38
882200 -- (-1989.952) (-1989.176) (-2003.793) [-2001.176] * (-1983.220) (-2003.601) [-1988.390] (-1991.415) -- 0:00:38
882300 -- (-1990.691) (-1996.733) (-1999.243) [-1990.145] * [-1986.475] (-2000.905) (-1997.299) (-1993.085) -- 0:00:38
882400 -- (-2001.324) (-1995.114) (-1990.226) [-1995.093] * [-1989.453] (-1997.573) (-1998.219) (-1994.027) -- 0:00:38
882500 -- [-1996.398] (-1990.586) (-1993.602) (-1986.326) * (-1989.702) [-1995.207] (-1995.019) (-1992.233) -- 0:00:38
882600 -- (-2000.637) (-1986.654) [-1990.752] (-1983.973) * [-1987.177] (-1994.804) (-1994.744) (-1992.772) -- 0:00:38
882700 -- (-1997.366) [-1979.832] (-1997.566) (-1985.289) * [-1988.301] (-1993.638) (-1994.748) (-1996.098) -- 0:00:38
882800 -- (-2008.026) (-1979.395) (-2006.238) [-1987.824] * (-1990.464) [-1984.609] (-2004.911) (-1991.480) -- 0:00:38
882900 -- (-1991.990) [-1981.687] (-1992.734) (-1990.429) * (-1991.205) (-1990.484) (-1997.152) [-1996.790] -- 0:00:38
883000 -- (-1991.188) (-1983.325) (-1988.532) [-1985.522] * [-1991.977] (-1991.524) (-2005.511) (-1994.015) -- 0:00:38
Average standard deviation of split frequencies: 0.002486
883100 -- (-1991.486) (-1983.707) (-1996.555) [-1982.552] * (-1985.991) (-1994.952) (-2006.850) [-1999.133] -- 0:00:38
883200 -- (-1997.576) (-1983.221) (-1999.845) [-1984.960] * [-1991.734] (-1995.820) (-2000.417) (-2004.567) -- 0:00:38
883300 -- (-2003.915) [-1982.054] (-1996.604) (-1983.282) * (-1986.890) [-1992.639] (-1996.568) (-2004.094) -- 0:00:38
883400 -- (-1999.492) (-1984.580) (-1998.386) [-1982.023] * (-1987.965) (-1995.611) [-2000.382] (-1998.029) -- 0:00:38
883500 -- (-2003.509) (-1989.388) (-1995.171) [-1983.518] * [-1986.521] (-1989.451) (-1995.409) (-1991.026) -- 0:00:38
883600 -- [-1993.368] (-1992.378) (-1995.765) (-1983.913) * [-1984.883] (-1993.607) (-1989.881) (-1997.197) -- 0:00:38
883700 -- (-1995.274) (-1993.031) [-1987.460] (-1989.659) * (-1984.372) [-1986.939] (-1995.817) (-1998.366) -- 0:00:38
883800 -- (-1990.891) (-1991.299) (-1985.491) [-1991.614] * [-1988.151] (-1989.108) (-1988.735) (-1992.339) -- 0:00:37
883900 -- (-1989.750) [-1985.954] (-1991.504) (-1989.692) * (-1993.919) (-1992.027) [-1985.608] (-1993.623) -- 0:00:37
884000 -- (-1997.033) (-1988.128) [-1988.739] (-1984.866) * (-1996.420) [-1985.152] (-1988.969) (-1993.680) -- 0:00:37
Average standard deviation of split frequencies: 0.002392
884100 -- (-1997.550) (-1984.849) [-1985.894] (-1984.729) * (-2004.537) (-1991.077) [-1982.586] (-1991.700) -- 0:00:38
884200 -- (-1998.771) (-1991.063) [-1983.989] (-1989.234) * (-1997.625) (-1999.394) [-1985.007] (-1990.826) -- 0:00:37
884300 -- (-1994.347) [-1989.069] (-1987.979) (-1996.423) * (-1993.987) (-1995.511) [-1986.132] (-1990.345) -- 0:00:37
884400 -- (-2002.033) (-1988.222) [-1986.545] (-1985.762) * (-2000.194) (-1987.812) [-1986.241] (-1999.495) -- 0:00:37
884500 -- (-1996.978) (-1992.434) [-1984.751] (-1994.603) * (-1996.603) [-1996.254] (-1985.436) (-2006.299) -- 0:00:37
884600 -- (-2007.702) [-1986.230] (-1987.984) (-1984.626) * (-1993.998) (-1990.807) [-1985.206] (-2000.714) -- 0:00:37
884700 -- (-1991.290) (-1987.542) (-1987.991) [-1986.352] * (-1991.068) (-1997.304) [-1988.484] (-2000.658) -- 0:00:37
884800 -- (-1989.902) (-1996.698) [-1985.023] (-1994.549) * [-1992.342] (-1992.875) (-1985.941) (-1990.355) -- 0:00:37
884900 -- (-1991.024) [-1991.788] (-1989.386) (-1988.376) * (-1988.650) (-1992.179) (-1985.919) [-1990.886] -- 0:00:37
885000 -- (-1989.512) (-1995.095) (-1988.409) [-1986.008] * [-1980.425] (-1999.521) (-1985.612) (-2006.695) -- 0:00:37
Average standard deviation of split frequencies: 0.002389
885100 -- (-1991.869) [-1990.873] (-1992.555) (-1989.749) * (-1991.474) (-2002.458) [-1988.107] (-2005.103) -- 0:00:37
885200 -- (-2000.350) (-1992.876) [-1990.650] (-1989.918) * (-1989.588) [-1992.841] (-1993.861) (-2002.253) -- 0:00:37
885300 -- (-1995.171) (-1998.041) (-1989.948) [-1988.534] * (-1989.457) [-1995.123] (-1992.727) (-2003.684) -- 0:00:37
885400 -- (-1992.782) (-1998.642) (-1992.044) [-1985.594] * [-1989.836] (-1990.613) (-1994.967) (-2000.545) -- 0:00:37
885500 -- (-1993.371) (-1990.555) (-1993.515) [-1983.700] * (-1989.763) (-1995.596) [-1987.012] (-1999.687) -- 0:00:37
885600 -- (-1998.637) (-1999.849) (-1989.105) [-1984.823] * (-1985.604) (-1992.159) [-1984.553] (-2002.918) -- 0:00:37
885700 -- (-1993.158) (-1997.915) [-1990.371] (-1983.871) * (-1985.302) (-1989.262) [-1981.200] (-1999.974) -- 0:00:37
885800 -- (-1995.133) (-2003.495) (-1989.529) [-1981.965] * (-1980.767) (-1990.721) [-1980.325] (-2009.351) -- 0:00:37
885900 -- (-1994.388) (-1994.990) (-1994.057) [-1980.860] * [-1983.201] (-1990.410) (-1984.083) (-1996.449) -- 0:00:37
886000 -- (-1991.370) (-1995.155) (-1991.672) [-1978.747] * (-1979.135) (-1990.698) [-1975.498] (-2000.258) -- 0:00:37
Average standard deviation of split frequencies: 0.002447
886100 -- [-1997.794] (-1996.823) (-2004.120) (-1979.797) * [-1979.175] (-1990.108) (-1979.945) (-2005.756) -- 0:00:37
886200 -- (-2006.813) (-1996.594) (-1999.260) [-1981.574] * [-1978.452] (-1993.148) (-1983.388) (-1995.480) -- 0:00:37
886300 -- (-1995.168) (-1991.618) (-1997.893) [-1988.450] * (-1980.557) [-1994.902] (-1985.487) (-1999.778) -- 0:00:37
886400 -- (-1989.058) (-1988.135) (-1997.135) [-1983.822] * (-1980.006) (-1991.814) (-1987.355) [-1993.739] -- 0:00:37
886500 -- [-1993.912] (-1985.757) (-1995.187) (-1987.068) * [-1980.784] (-1993.620) (-1996.881) (-1999.366) -- 0:00:37
886600 -- (-1993.711) [-1985.598] (-2001.305) (-1982.416) * (-1978.223) (-1994.832) [-1989.318] (-2003.796) -- 0:00:37
886700 -- (-1995.485) [-1984.260] (-2001.956) (-1987.243) * [-1980.200] (-1990.340) (-1987.665) (-1993.126) -- 0:00:37
886800 -- (-1999.841) (-1981.033) (-1996.528) [-1984.077] * [-1981.449] (-1993.836) (-1985.496) (-1997.398) -- 0:00:37
886900 -- [-1993.199] (-1987.597) (-1992.251) (-1991.511) * (-1986.285) (-1991.195) [-1986.087] (-1992.807) -- 0:00:36
887000 -- (-1992.033) (-1984.576) (-1988.543) [-1984.326] * (-1989.926) (-1991.558) [-1989.115] (-1996.539) -- 0:00:36
Average standard deviation of split frequencies: 0.002490
887100 -- (-1991.073) (-1985.846) (-1988.373) [-1981.056] * (-1997.295) [-1994.172] (-1988.909) (-1998.192) -- 0:00:37
887200 -- (-1993.030) [-1984.687] (-1992.836) (-1988.421) * (-1991.019) (-1990.807) [-1989.986] (-1998.933) -- 0:00:36
887300 -- (-1991.553) [-1984.029] (-1994.648) (-1998.277) * [-1992.206] (-1993.743) (-1996.194) (-1999.774) -- 0:00:36
887400 -- (-1990.556) [-1980.111] (-1991.079) (-1982.153) * [-1982.753] (-1999.917) (-1997.179) (-2003.278) -- 0:00:36
887500 -- (-1992.404) [-1983.119] (-1992.070) (-1987.704) * [-1981.775] (-1995.062) (-1996.461) (-2003.112) -- 0:00:36
887600 -- (-2001.378) [-1982.876] (-1992.129) (-1986.841) * [-1984.758] (-1996.864) (-2008.679) (-1997.087) -- 0:00:36
887700 -- (-2003.315) [-1977.936] (-1990.064) (-1986.599) * (-1982.773) [-1990.922] (-2014.516) (-1996.418) -- 0:00:36
887800 -- (-1990.995) [-1979.998] (-1994.927) (-1992.404) * [-1983.646] (-1996.510) (-2004.352) (-1995.029) -- 0:00:36
887900 -- (-1998.171) [-1986.077] (-2002.571) (-1994.361) * [-1986.571] (-2000.044) (-1999.133) (-2000.154) -- 0:00:36
888000 -- (-1993.936) (-1990.159) (-2004.470) [-1995.235] * [-1979.218] (-1990.271) (-1999.327) (-2003.666) -- 0:00:36
Average standard deviation of split frequencies: 0.002533
888100 -- (-1992.450) (-1984.364) [-1995.024] (-1995.783) * (-1983.939) [-1988.076] (-2004.252) (-1996.687) -- 0:00:36
888200 -- (-1992.501) [-1989.467] (-1996.739) (-2001.360) * [-1984.637] (-1986.128) (-1998.791) (-2000.080) -- 0:00:36
888300 -- (-1998.859) (-1998.800) [-1989.981] (-1996.569) * (-1986.787) [-1995.291] (-2007.431) (-1998.041) -- 0:00:36
888400 -- (-1997.945) (-1992.391) [-1988.128] (-1999.861) * (-1985.467) (-1997.968) [-1990.953] (-1998.898) -- 0:00:36
888500 -- (-1995.175) [-1983.503] (-1987.997) (-1993.802) * [-1981.221] (-1990.207) (-1990.933) (-2003.368) -- 0:00:36
888600 -- (-2006.382) (-1989.384) [-1989.259] (-1991.345) * (-1982.407) [-1990.896] (-1988.064) (-2005.914) -- 0:00:36
888700 -- (-1997.241) (-1993.494) (-1986.435) [-1993.754] * [-1985.077] (-1988.368) (-1988.998) (-1996.106) -- 0:00:36
888800 -- (-2000.025) [-1989.618] (-1989.609) (-1993.794) * (-1994.934) (-1990.372) [-1989.621] (-1997.222) -- 0:00:36
888900 -- (-1999.712) [-1986.121] (-1990.454) (-1987.840) * (-1988.077) (-1992.688) [-1994.809] (-1991.748) -- 0:00:36
889000 -- (-1998.388) (-1986.552) (-1987.496) [-1985.705] * (-1989.498) (-1998.774) (-1994.376) [-1988.544] -- 0:00:36
Average standard deviation of split frequencies: 0.002469
889100 -- (-1992.897) (-1987.850) (-1992.026) [-1982.981] * (-1990.598) [-1991.179] (-1990.492) (-2002.961) -- 0:00:36
889200 -- (-1998.706) [-1989.970] (-1993.913) (-1983.109) * (-1993.961) (-1995.558) [-1987.522] (-1999.686) -- 0:00:36
889300 -- (-1993.806) [-1984.329] (-1982.950) (-1991.825) * (-1989.063) (-1996.707) [-1991.855] (-1993.067) -- 0:00:36
889400 -- (-1994.785) (-1979.075) (-1984.853) [-1985.746] * (-1990.260) (-1993.764) [-1990.664] (-1991.929) -- 0:00:36
889500 -- (-2001.205) [-1980.448] (-1986.583) (-1988.210) * (-2004.417) [-1990.540] (-1980.661) (-1995.121) -- 0:00:36
889600 -- (-1994.299) [-1981.103] (-1986.131) (-1989.983) * (-2003.729) (-1989.685) [-1980.644] (-1998.615) -- 0:00:36
889700 -- (-2004.894) [-1984.478] (-1997.219) (-1993.309) * (-1989.546) (-1998.831) [-1984.673] (-2005.014) -- 0:00:36
889800 -- (-1995.437) [-1983.150] (-1988.962) (-1996.303) * [-1987.245] (-1992.053) (-1983.840) (-1993.676) -- 0:00:36
889900 -- (-1996.755) (-1983.971) [-1993.095] (-1990.774) * (-1988.446) (-1999.197) [-1982.730] (-1996.523) -- 0:00:36
890000 -- (-1993.951) (-1986.749) [-1990.229] (-1995.001) * (-1986.801) (-2010.484) [-1982.677] (-1994.067) -- 0:00:36
Average standard deviation of split frequencies: 0.002466
890100 -- (-1990.637) [-1981.279] (-1999.509) (-1999.730) * [-1989.656] (-2012.576) (-1989.170) (-1998.347) -- 0:00:36
890200 -- (-1998.488) [-1986.460] (-1996.123) (-1997.330) * [-1982.873] (-1998.656) (-1995.669) (-1990.183) -- 0:00:36
890300 -- (-1986.810) (-1995.709) [-1990.130] (-1985.437) * [-1984.207] (-1992.538) (-2002.512) (-1993.898) -- 0:00:35
890400 -- (-1989.374) (-2006.567) (-1995.608) [-1984.103] * [-1979.688] (-1993.050) (-2004.198) (-2002.589) -- 0:00:35
890500 -- (-1995.418) [-1986.948] (-1998.543) (-1985.113) * (-1984.964) (-1992.877) [-1991.044] (-2002.016) -- 0:00:35
890600 -- (-1993.695) (-1988.793) (-2001.773) [-1982.084] * [-1985.336] (-1992.919) (-1990.878) (-1998.758) -- 0:00:35
890700 -- (-1993.295) (-1980.993) (-2002.643) [-1981.343] * [-1980.205] (-1995.310) (-1997.590) (-1987.755) -- 0:00:35
890800 -- (-1994.301) [-1982.175] (-1997.548) (-1986.323) * [-1982.448] (-1999.967) (-1991.398) (-1988.269) -- 0:00:35
890900 -- (-1998.723) [-1987.118] (-2001.429) (-1993.813) * [-1986.728] (-1998.820) (-1993.130) (-1992.126) -- 0:00:35
891000 -- (-2003.811) (-1992.834) (-1987.720) [-1984.740] * [-1995.114] (-1994.878) (-1995.536) (-1989.828) -- 0:00:35
Average standard deviation of split frequencies: 0.002448
891100 -- (-2008.448) (-1993.580) (-1989.378) [-1986.786] * [-1997.920] (-1998.069) (-2003.056) (-1989.731) -- 0:00:35
891200 -- (-1998.616) (-1985.394) [-1987.908] (-1986.495) * (-1990.924) (-1995.221) (-1994.258) [-1985.738] -- 0:00:35
891300 -- (-1999.317) (-1995.070) (-1989.564) [-1987.268] * (-1994.777) (-2001.151) [-1995.777] (-1984.664) -- 0:00:35
891400 -- (-1989.206) [-1994.814] (-1988.705) (-1984.978) * (-1994.171) (-1991.450) (-1993.993) [-1989.834] -- 0:00:35
891500 -- (-1995.050) [-1985.937] (-1989.406) (-1990.364) * (-1989.263) [-1986.204] (-2006.092) (-1994.608) -- 0:00:35
891600 -- (-1995.732) (-1995.088) [-1992.677] (-1989.446) * (-1986.214) (-1990.816) (-1994.296) [-1991.176] -- 0:00:35
891700 -- [-1991.045] (-1993.834) (-1996.900) (-1998.952) * (-1986.779) (-2001.602) (-1995.789) [-1992.980] -- 0:00:35
891800 -- [-1992.105] (-1984.576) (-1996.569) (-1998.631) * [-1989.241] (-1997.062) (-1995.511) (-1994.360) -- 0:00:35
891900 -- (-1992.564) [-1983.255] (-1987.398) (-1991.386) * (-1993.922) (-1995.611) [-1986.437] (-1992.799) -- 0:00:35
892000 -- (-2003.248) [-1981.088] (-1995.773) (-1990.692) * (-1991.260) (-1983.767) [-1981.112] (-1998.690) -- 0:00:35
Average standard deviation of split frequencies: 0.002370
892100 -- (-1996.269) (-1983.749) (-1989.563) [-1992.712] * (-1993.671) (-1984.880) [-1981.232] (-2000.220) -- 0:00:35
892200 -- (-1997.236) [-1984.266] (-1998.140) (-1991.361) * (-1992.423) (-1982.277) [-1980.784] (-1995.404) -- 0:00:35
892300 -- (-2001.841) [-1986.885] (-2000.286) (-1992.081) * (-1987.968) (-1990.014) [-1984.656] (-1994.035) -- 0:00:35
892400 -- (-2005.920) [-1989.452] (-2002.241) (-1999.321) * (-1988.804) (-1992.999) [-1984.626] (-1994.859) -- 0:00:35
892500 -- (-2003.526) [-1984.608] (-1994.276) (-2002.624) * (-1987.167) [-1990.768] (-1996.163) (-1994.028) -- 0:00:35
892600 -- (-1999.186) [-1982.358] (-1999.778) (-1999.985) * (-1993.311) (-1990.979) [-1982.182] (-1989.064) -- 0:00:35
892700 -- (-1990.216) [-1982.399] (-1996.332) (-1990.444) * (-1996.471) (-1991.343) [-1983.451] (-1987.859) -- 0:00:35
892800 -- (-1992.326) [-1985.529] (-2004.854) (-1989.379) * (-1992.785) [-1982.312] (-1982.258) (-1992.621) -- 0:00:35
892900 -- (-1994.239) [-1983.235] (-2001.812) (-1991.798) * (-1987.286) (-1986.809) [-1978.418] (-1996.496) -- 0:00:35
893000 -- (-1996.673) [-1982.319] (-2001.136) (-1993.790) * [-1984.782] (-1991.280) (-1984.625) (-1989.311) -- 0:00:35
Average standard deviation of split frequencies: 0.002307
893100 -- (-2004.859) [-1982.208] (-1992.919) (-1995.986) * (-1988.987) (-1991.048) [-1989.882] (-1984.762) -- 0:00:35
893200 -- (-1995.770) [-1982.953] (-1999.286) (-1987.605) * (-1988.645) [-1990.293] (-1991.077) (-1994.375) -- 0:00:35
893300 -- (-2000.806) [-1984.507] (-1996.708) (-1993.508) * (-1988.810) [-1986.824] (-1984.015) (-2002.539) -- 0:00:34
893400 -- (-2005.424) (-1988.312) (-1998.107) [-1991.148] * (-1991.079) (-1985.637) [-1984.398] (-2005.119) -- 0:00:34
893500 -- (-2000.714) [-1986.794] (-1994.802) (-1992.854) * (-1989.689) (-1994.550) [-1980.300] (-2018.200) -- 0:00:34
893600 -- (-2009.402) [-1985.249] (-1994.472) (-1987.863) * (-1987.060) (-1997.853) [-1984.361] (-2016.854) -- 0:00:34
893700 -- (-2006.063) [-1981.109] (-1995.826) (-1989.653) * [-1984.303] (-2005.428) (-1985.304) (-2001.530) -- 0:00:34
893800 -- (-2008.120) (-1983.289) (-1996.779) [-1986.838] * (-1993.387) (-1999.557) [-1979.078] (-1998.617) -- 0:00:34
893900 -- (-2000.141) (-1985.722) (-2002.158) [-1987.848] * (-1988.824) (-1991.265) [-1985.104] (-1992.850) -- 0:00:34
894000 -- (-2000.693) [-1982.189] (-1997.671) (-1990.327) * (-1991.057) (-1992.776) [-1988.003] (-1999.490) -- 0:00:34
Average standard deviation of split frequencies: 0.002290
894100 -- (-2004.756) (-1981.383) (-1995.569) [-1989.160] * (-1997.968) [-1990.704] (-1984.868) (-1989.490) -- 0:00:34
894200 -- (-2000.339) [-1983.560] (-1990.975) (-1995.669) * [-1993.331] (-1992.593) (-1984.567) (-1996.091) -- 0:00:34
894300 -- (-1988.217) [-1991.341] (-2000.612) (-1998.430) * (-1986.741) [-1990.925] (-1986.213) (-2002.560) -- 0:00:34
894400 -- (-1988.459) [-1985.863] (-1997.182) (-1988.223) * [-1981.025] (-1991.909) (-1988.444) (-1996.940) -- 0:00:34
894500 -- (-1989.356) [-1986.372] (-2006.765) (-1991.019) * (-1984.992) [-1993.461] (-1991.983) (-1998.417) -- 0:00:34
894600 -- (-1993.996) (-1984.828) (-1985.787) [-1986.370] * [-1979.056] (-1995.440) (-1994.025) (-2003.238) -- 0:00:34
894700 -- (-1992.838) (-1989.297) (-1988.470) [-1981.794] * [-1979.505] (-1994.540) (-1994.070) (-1993.196) -- 0:00:34
894800 -- (-2003.862) (-1989.446) (-2004.136) [-1986.470] * [-1978.913] (-1993.062) (-1988.673) (-1995.030) -- 0:00:34
894900 -- (-2005.616) (-1992.937) (-1995.958) [-1992.959] * (-1981.956) (-2001.009) (-1985.526) [-1990.527] -- 0:00:34
895000 -- (-2012.223) [-1988.648] (-1996.674) (-1993.049) * (-1987.135) (-1998.255) [-1986.140] (-1991.913) -- 0:00:34
Average standard deviation of split frequencies: 0.002302
895100 -- (-2010.360) [-1982.786] (-1991.488) (-1992.449) * (-1991.060) (-1995.985) (-1985.201) [-1988.900] -- 0:00:34
895200 -- (-2006.145) [-1986.404] (-1992.262) (-1994.606) * [-1983.681] (-1991.942) (-1985.779) (-1984.742) -- 0:00:34
895300 -- (-2004.100) [-1983.630] (-1994.257) (-1990.986) * (-1989.717) (-1992.833) [-1985.194] (-2000.542) -- 0:00:34
895400 -- (-2012.249) (-1981.187) (-1991.619) [-1984.973] * [-1984.166] (-1992.359) (-1986.435) (-1992.573) -- 0:00:34
895500 -- (-2004.614) (-1988.595) (-1995.647) [-1987.466] * (-1990.373) (-1994.881) [-1986.543] (-1998.709) -- 0:00:34
895600 -- (-2000.148) (-1986.500) (-1995.689) [-1988.723] * (-1987.188) (-1995.851) [-1984.147] (-1992.828) -- 0:00:34
895700 -- (-1999.972) (-1986.422) [-1988.079] (-1990.268) * (-1987.579) (-1996.565) (-1987.968) [-1992.163] -- 0:00:34
895800 -- (-1996.524) [-1983.019] (-1996.489) (-1995.339) * (-1986.540) [-1985.916] (-1987.328) (-1993.928) -- 0:00:34
895900 -- [-1995.192] (-1984.306) (-1994.129) (-1987.275) * (-1992.176) [-1990.797] (-1987.890) (-1998.285) -- 0:00:34
896000 -- (-1996.698) (-1987.998) [-1984.683] (-1989.548) * (-1993.290) (-1991.948) [-1987.685] (-2001.388) -- 0:00:34
Average standard deviation of split frequencies: 0.002269
896100 -- [-1986.327] (-1988.600) (-1991.733) (-1994.921) * (-1994.197) (-1994.172) [-1983.054] (-1990.230) -- 0:00:34
896200 -- (-1995.398) [-1985.374] (-1991.950) (-1985.632) * (-1993.871) (-1992.444) (-1988.420) [-1987.268] -- 0:00:34
896300 -- (-1991.812) (-1985.532) [-1992.303] (-1993.800) * (-1986.268) (-1991.209) (-1986.778) [-1989.204] -- 0:00:34
896400 -- (-1987.047) (-1987.778) [-1995.421] (-2001.576) * (-1990.058) (-1994.130) [-1985.886] (-2001.305) -- 0:00:33
896500 -- [-1988.683] (-1988.011) (-1996.338) (-2002.273) * (-1994.048) [-1992.171] (-1985.192) (-1996.310) -- 0:00:33
896600 -- (-1991.274) (-1983.845) [-1987.300] (-1996.158) * [-1985.893] (-1994.091) (-1986.220) (-2002.720) -- 0:00:33
896700 -- (-1993.084) (-1984.016) [-1988.743] (-1997.935) * (-1986.810) [-1994.137] (-1985.294) (-1994.095) -- 0:00:33
896800 -- [-1991.022] (-1988.587) (-1992.998) (-1992.636) * (-1993.657) (-1996.782) [-1987.568] (-1996.483) -- 0:00:33
896900 -- (-1988.831) [-1986.331] (-1993.439) (-1991.217) * (-1988.939) (-1993.385) [-1982.445] (-1992.424) -- 0:00:33
897000 -- (-1992.557) (-1991.250) (-2000.839) [-1986.715] * [-1983.974] (-1996.978) (-1985.280) (-1998.273) -- 0:00:33
Average standard deviation of split frequencies: 0.002252
897100 -- (-1987.765) (-1987.658) (-2010.448) [-1982.481] * (-1981.162) (-2000.464) [-1984.416] (-1995.257) -- 0:00:33
897200 -- (-1988.237) (-1988.466) (-1995.127) [-1981.267] * (-1991.745) (-2010.570) [-1997.220] (-1996.913) -- 0:00:33
897300 -- (-1993.955) (-1985.514) (-2002.537) [-1985.678] * (-1982.432) (-2006.040) [-1984.693] (-1996.507) -- 0:00:33
897400 -- [-1990.118] (-1993.944) (-2001.687) (-1985.495) * [-1979.805] (-2003.118) (-1986.830) (-1999.751) -- 0:00:33
897500 -- (-1990.866) (-1983.898) (-1994.284) [-1983.564] * [-1987.833] (-2005.555) (-1986.442) (-1999.935) -- 0:00:33
897600 -- (-1987.952) (-1988.177) (-1994.883) [-1980.157] * [-1988.987] (-2001.315) (-1990.298) (-1998.486) -- 0:00:33
897700 -- (-1988.850) (-1987.874) (-1998.137) [-1983.444] * (-1989.122) (-1994.113) [-1988.482] (-2005.353) -- 0:00:33
897800 -- [-1992.592] (-1991.525) (-1997.166) (-1987.101) * [-1987.874] (-1989.358) (-1979.854) (-2007.965) -- 0:00:33
897900 -- (-1995.754) (-1993.547) [-1992.707] (-1984.491) * (-1983.580) (-1992.965) [-1980.763] (-1999.569) -- 0:00:33
898000 -- (-1993.953) (-1987.429) (-1991.764) [-1986.870] * (-1986.719) [-1992.221] (-1983.939) (-2003.425) -- 0:00:33
Average standard deviation of split frequencies: 0.002249
898100 -- (-1988.270) (-1993.600) (-1997.388) [-1991.852] * (-1991.856) [-1994.877] (-1984.537) (-2001.917) -- 0:00:33
898200 -- [-1989.820] (-1984.615) (-1992.415) (-1985.569) * (-1985.921) (-1991.731) [-1982.538] (-1992.926) -- 0:00:33
898300 -- (-1993.045) [-1983.465] (-1994.065) (-1991.521) * [-1983.001] (-1997.770) (-1984.716) (-1989.962) -- 0:00:33
898400 -- (-1990.458) [-1983.903] (-1999.882) (-1995.384) * [-1985.711] (-1995.034) (-1990.643) (-1993.236) -- 0:00:33
898500 -- (-1995.645) (-1979.770) (-1996.378) [-1992.722] * [-1978.485] (-1996.546) (-1990.282) (-1998.199) -- 0:00:33
898600 -- (-2002.028) [-1982.523] (-1998.449) (-1994.128) * (-1978.891) [-1996.941] (-1993.237) (-2003.885) -- 0:00:33
898700 -- (-2005.652) (-1982.552) (-1997.483) [-1985.441] * (-1983.883) (-1992.827) (-1988.650) [-1999.498] -- 0:00:33
898800 -- (-2003.228) [-1983.095] (-2000.216) (-1984.561) * [-1983.128] (-1999.131) (-1990.274) (-2001.426) -- 0:00:33
898900 -- (-1998.360) [-1982.184] (-2000.518) (-1985.650) * (-1983.322) [-1993.958] (-1993.166) (-2001.200) -- 0:00:33
899000 -- (-2003.637) [-1986.780] (-2002.670) (-1993.471) * (-1985.037) (-1988.225) [-1989.121] (-1999.617) -- 0:00:33
Average standard deviation of split frequencies: 0.002187
899100 -- (-2021.044) [-1986.936] (-2007.238) (-1984.886) * [-1986.034] (-1993.282) (-1987.817) (-1998.332) -- 0:00:33
899200 -- (-2012.962) (-1988.812) (-2004.447) [-1980.094] * (-1985.129) (-1999.710) [-1985.924] (-2007.187) -- 0:00:33
899300 -- (-2010.248) [-1984.136] (-1996.861) (-1979.994) * [-1983.541] (-1996.247) (-1982.835) (-1998.808) -- 0:00:33
899400 -- (-2010.503) (-1994.183) (-1998.234) [-1975.871] * [-1980.975] (-1989.526) (-1991.519) (-1995.431) -- 0:00:32
899500 -- (-1996.007) (-1996.605) (-1999.746) [-1982.285] * (-1984.582) [-1993.989] (-1986.221) (-1994.115) -- 0:00:32
899600 -- (-1998.492) [-1993.521] (-1999.205) (-1983.094) * [-1985.349] (-1991.443) (-1992.327) (-1995.662) -- 0:00:32
899700 -- (-1998.643) (-1984.909) (-1997.733) [-1980.913] * [-1986.250] (-1992.988) (-1990.452) (-1993.809) -- 0:00:32
899800 -- (-2002.169) (-1989.946) (-1999.047) [-1984.685] * [-1990.522] (-1997.948) (-1986.766) (-1992.856) -- 0:00:32
899900 -- (-1999.509) (-1990.095) (-1990.443) [-1982.259] * (-1994.295) (-1995.753) (-1986.503) [-1988.236] -- 0:00:32
900000 -- (-2006.888) (-1983.496) (-2002.233) [-1986.828] * [-1988.017] (-1991.388) (-1983.783) (-1986.092) -- 0:00:32
Average standard deviation of split frequencies: 0.002170
900100 -- (-2013.469) [-1987.268] (-1998.554) (-1991.242) * (-1986.873) (-1990.909) [-1975.597] (-1986.814) -- 0:00:32
900200 -- (-2013.543) [-1991.955] (-1989.572) (-1989.332) * (-1993.586) (-1992.865) [-1982.865] (-1992.612) -- 0:00:32
900300 -- (-2006.209) (-1992.363) (-1992.902) [-1984.795] * (-1982.774) (-1991.590) [-1979.726] (-1983.140) -- 0:00:32
900400 -- (-1999.448) (-1994.847) (-1988.629) [-1983.437] * [-1980.395] (-1991.478) (-1979.135) (-1987.114) -- 0:00:32
900500 -- (-1996.037) (-1995.148) [-1989.593] (-1987.265) * (-1982.404) (-2001.981) (-1981.732) [-1989.937] -- 0:00:32
900600 -- (-1986.651) (-1991.557) (-1996.086) [-1985.424] * [-1982.973] (-1991.225) (-1981.227) (-1989.894) -- 0:00:32
900700 -- (-1987.190) (-1996.068) [-1988.693] (-1983.384) * [-1983.752] (-1992.663) (-1986.443) (-1993.656) -- 0:00:32
900800 -- (-1994.649) (-2000.900) (-1988.340) [-1978.750] * (-1985.040) (-2001.628) [-1980.219] (-1995.973) -- 0:00:32
900900 -- (-1998.467) (-1993.699) (-1987.892) [-1980.916] * (-1986.822) (-1997.677) (-1985.356) [-1988.866] -- 0:00:32
901000 -- (-2005.414) (-1994.466) (-1989.073) [-1982.123] * [-1985.545] (-1998.122) (-1981.501) (-1993.430) -- 0:00:32
Average standard deviation of split frequencies: 0.002287
901100 -- (-1992.581) (-1999.996) (-1999.452) [-1983.886] * (-1987.634) (-1997.438) [-1982.793] (-1996.250) -- 0:00:32
901200 -- [-1993.277] (-1995.081) (-1993.163) (-1978.231) * [-1986.974] (-1993.978) (-1987.389) (-1993.279) -- 0:00:32
901300 -- (-1998.538) (-1992.202) (-1991.570) [-1980.121] * (-1992.298) (-2006.245) (-1985.166) [-1992.534] -- 0:00:32
901400 -- (-1995.143) (-1993.828) (-1997.309) [-1983.255] * (-1983.038) (-2001.544) [-1990.452] (-1991.954) -- 0:00:32
901500 -- (-1996.916) [-1984.294] (-1996.082) (-1986.010) * [-1981.031] (-2013.534) (-1989.338) (-1986.123) -- 0:00:32
901600 -- (-1997.602) [-1982.145] (-1990.924) (-1991.952) * [-1982.202] (-2007.243) (-1995.029) (-1986.162) -- 0:00:32
901700 -- (-2001.532) [-1984.409] (-1993.169) (-1991.775) * [-1983.864] (-1998.783) (-1997.883) (-1984.287) -- 0:00:32
901800 -- (-1997.978) [-1985.418] (-2000.407) (-1994.424) * [-1981.698] (-1998.723) (-1996.761) (-1982.121) -- 0:00:32
901900 -- (-1992.742) [-1982.393] (-1998.058) (-1993.677) * (-1986.918) (-2006.161) [-1983.328] (-1981.913) -- 0:00:32
902000 -- (-1999.277) [-1979.080] (-1993.691) (-1983.462) * (-1986.002) (-1997.506) [-1981.373] (-1992.339) -- 0:00:32
Average standard deviation of split frequencies: 0.002239
902100 -- (-2006.865) (-1984.201) (-1998.151) [-1983.296] * [-1981.428] (-1999.564) (-1981.320) (-1988.800) -- 0:00:32
902200 -- (-2000.293) (-1989.399) (-1995.288) [-1987.367] * [-1979.832] (-1997.229) (-1986.815) (-1987.767) -- 0:00:32
902300 -- [-2000.944] (-1991.333) (-1994.033) (-1993.256) * (-1977.364) (-2000.243) [-1986.358] (-1987.240) -- 0:00:32
902400 -- (-2001.884) (-1991.438) [-1988.163] (-1986.651) * [-1981.742] (-1994.165) (-1987.125) (-1995.806) -- 0:00:32
902500 -- (-1999.253) [-1986.343] (-1984.649) (-1987.798) * [-1983.516] (-1994.339) (-1995.878) (-1997.999) -- 0:00:31
902600 -- (-1997.363) [-1981.545] (-1987.488) (-1984.745) * [-1982.705] (-1987.407) (-1992.127) (-1994.342) -- 0:00:31
902700 -- (-1997.539) (-1982.456) (-1988.877) [-1986.167] * (-1990.117) (-1991.449) [-1984.454] (-1991.011) -- 0:00:31
902800 -- (-1998.496) [-1982.423] (-1992.261) (-1985.723) * (-1987.985) (-1992.161) (-2006.569) [-1989.965] -- 0:00:31
902900 -- (-2002.159) [-1976.616] (-1994.735) (-1985.834) * (-1989.108) (-1999.838) [-1993.393] (-1988.766) -- 0:00:31
903000 -- (-1996.582) [-1979.125] (-1991.225) (-1982.813) * (-1987.179) (-1997.983) [-1987.182] (-1993.865) -- 0:00:31
Average standard deviation of split frequencies: 0.002162
903100 -- (-2004.395) (-1979.737) (-2002.880) [-1987.835] * (-1993.220) (-1992.561) [-1986.894] (-1991.591) -- 0:00:31
903200 -- (-1999.077) [-1983.406] (-1996.383) (-1986.969) * (-1992.722) (-1992.259) (-1985.756) [-1989.670] -- 0:00:31
903300 -- (-1998.456) (-1992.155) (-1994.054) [-1987.538] * (-1989.314) (-1996.396) [-1975.593] (-1997.894) -- 0:00:31
903400 -- [-1987.391] (-1987.536) (-1994.925) (-1996.025) * (-1990.061) (-1999.595) [-1980.735] (-1990.016) -- 0:00:31
903500 -- (-1988.131) [-1983.733] (-1989.661) (-2000.809) * (-1994.292) (-1995.655) [-1982.250] (-1994.654) -- 0:00:31
903600 -- [-1987.713] (-1984.450) (-1990.296) (-1997.700) * (-1985.648) (-1998.318) [-1979.533] (-1987.524) -- 0:00:31
903700 -- [-1988.398] (-1987.204) (-1990.145) (-1988.155) * (-1987.501) (-1991.919) (-1984.445) [-1989.879] -- 0:00:31
903800 -- [-1990.968] (-1987.651) (-1990.533) (-1988.380) * [-1983.335] (-1987.136) (-1994.858) (-1988.689) -- 0:00:31
903900 -- [-1991.434] (-1986.789) (-1990.262) (-1986.045) * [-1980.105] (-1993.523) (-1997.152) (-1993.686) -- 0:00:31
904000 -- (-1990.137) (-2006.113) (-1987.769) [-1983.087] * (-1982.943) (-1995.364) (-1996.115) [-1987.762] -- 0:00:31
Average standard deviation of split frequencies: 0.002115
904100 -- (-1991.429) (-1993.195) (-1993.495) [-1983.329] * [-1984.919] (-2009.724) (-1994.670) (-1988.852) -- 0:00:31
904200 -- (-1992.648) (-1985.733) (-1996.835) [-1986.302] * [-1981.022] (-2003.589) (-1995.178) (-1991.655) -- 0:00:31
904300 -- [-1988.970] (-1986.941) (-2005.400) (-1984.685) * (-1985.357) (-1999.061) [-1986.009] (-1992.586) -- 0:00:31
904400 -- (-1988.129) [-1992.614] (-2005.898) (-1980.502) * (-1986.446) (-1995.532) [-1984.858] (-1996.642) -- 0:00:31
904500 -- [-1995.146] (-1991.356) (-1995.828) (-1992.481) * (-1993.273) (-1996.264) (-1984.462) [-1993.795] -- 0:00:31
904600 -- (-2000.733) [-1991.339] (-1992.021) (-2005.845) * (-1991.370) (-1994.411) [-1983.517] (-1993.916) -- 0:00:31
904700 -- (-1991.892) [-1984.461] (-1992.158) (-1996.648) * [-1986.913] (-1994.609) (-1984.544) (-1995.447) -- 0:00:31
904800 -- (-1994.255) [-1986.304] (-1987.427) (-1991.312) * (-1989.209) (-1998.849) [-1980.159] (-1999.957) -- 0:00:31
904900 -- (-1992.861) (-1982.661) [-1984.482] (-1982.922) * (-1997.792) (-2008.958) [-1980.612] (-1993.150) -- 0:00:31
905000 -- (-1994.028) (-1988.294) (-1987.342) [-1982.310] * (-1996.400) (-2006.379) (-1982.502) [-1989.489] -- 0:00:31
Average standard deviation of split frequencies: 0.002187
905100 -- (-1985.890) (-1992.258) (-1985.181) [-1979.391] * (-1988.555) (-2009.397) [-1983.294] (-1992.765) -- 0:00:31
905200 -- (-1985.560) (-1997.238) (-1988.288) [-1979.274] * [-1985.627] (-2003.420) (-1980.491) (-1995.737) -- 0:00:31
905300 -- (-1989.009) (-2000.299) (-1987.994) [-1981.077] * (-1983.447) (-1990.306) [-1979.400] (-1999.513) -- 0:00:31
905400 -- (-1983.935) (-1998.383) (-1990.544) [-1986.533] * (-1980.841) (-1991.403) (-1978.467) [-1996.850] -- 0:00:31
905500 -- (-1981.844) (-1997.799) [-1986.484] (-1987.933) * [-1976.151] (-1988.269) (-1978.389) (-1998.942) -- 0:00:30
905600 -- [-1982.927] (-2000.205) (-1988.226) (-1985.208) * [-1978.937] (-1989.867) (-1981.128) (-1996.297) -- 0:00:30
905700 -- [-1989.499] (-1998.954) (-1983.887) (-1988.087) * [-1980.332] (-1992.495) (-1982.363) (-1991.148) -- 0:00:30
905800 -- (-1991.615) (-1994.041) (-1987.860) [-1981.926] * (-1983.200) (-1988.843) [-1976.150] (-1998.800) -- 0:00:30
905900 -- [-1982.875] (-1991.557) (-1988.593) (-1980.555) * (-1979.379) (-1992.434) [-1982.267] (-2008.571) -- 0:00:30
906000 -- [-1986.545] (-1986.562) (-1986.941) (-1984.489) * [-1979.604] (-2001.764) (-1983.722) (-2003.504) -- 0:00:30
Average standard deviation of split frequencies: 0.002215
906100 -- (-1988.245) [-1982.451] (-1997.274) (-1989.047) * (-1981.231) (-1996.441) [-1983.217] (-2005.699) -- 0:00:30
906200 -- (-1988.362) [-1983.455] (-1996.616) (-1986.042) * [-1974.955] (-1996.796) (-1986.249) (-2001.489) -- 0:00:30
906300 -- (-1992.327) [-1984.091] (-2001.592) (-1985.302) * [-1980.351] (-1994.786) (-1985.838) (-1996.306) -- 0:00:30
906400 -- (-2000.004) (-1985.185) (-1999.554) [-1985.400] * [-1981.762] (-2002.746) (-1982.206) (-1996.399) -- 0:00:30
906500 -- (-1995.436) (-1983.378) (-1998.411) [-1982.498] * (-1988.087) (-1999.145) [-1983.747] (-1992.443) -- 0:00:30
906600 -- (-1984.958) [-1985.449] (-1994.727) (-1983.865) * (-1989.700) (-1992.444) [-1981.726] (-2001.583) -- 0:00:30
906700 -- (-1991.787) (-1992.490) (-1995.118) [-1982.205] * (-1977.892) (-1993.538) [-1982.866] (-1996.410) -- 0:00:30
906800 -- (-1991.900) [-1991.623] (-1992.288) (-1986.162) * [-1978.986] (-1996.119) (-1995.303) (-1992.223) -- 0:00:30
906900 -- (-1992.162) [-1987.063] (-1992.106) (-1990.658) * [-1978.961] (-1991.256) (-1995.836) (-1994.730) -- 0:00:30
907000 -- (-1990.517) [-1986.912] (-1987.754) (-1986.650) * [-1981.149] (-1993.682) (-1992.014) (-1992.742) -- 0:00:30
Average standard deviation of split frequencies: 0.002227
907100 -- (-1989.897) (-1999.352) (-1992.708) [-1988.289] * (-1981.131) [-1985.989] (-1988.901) (-1991.082) -- 0:00:30
907200 -- (-1996.189) (-2001.695) (-1992.245) [-1981.642] * [-1979.957] (-1985.382) (-1990.205) (-1999.884) -- 0:00:30
907300 -- (-1999.739) (-1994.551) (-1995.354) [-1986.186] * [-1985.146] (-1982.230) (-1993.041) (-1995.886) -- 0:00:30
907400 -- (-2007.011) (-1995.768) [-1989.922] (-1988.773) * [-1979.360] (-1987.852) (-1986.877) (-2006.602) -- 0:00:30
907500 -- (-2000.107) (-1999.180) [-1992.669] (-1986.915) * [-1981.763] (-1992.885) (-1993.463) (-1999.798) -- 0:00:30
907600 -- (-2012.524) (-1998.248) (-1999.156) [-1994.689] * [-1983.991] (-1993.120) (-1988.899) (-2002.712) -- 0:00:30
907700 -- (-2003.512) [-1991.386] (-1996.646) (-1991.106) * (-1985.935) (-1988.811) [-1985.170] (-1991.303) -- 0:00:30
907800 -- (-1996.951) (-1995.203) (-1998.652) [-1989.337] * (-1990.235) [-1991.496] (-1983.482) (-1996.944) -- 0:00:30
907900 -- (-1993.994) (-1996.397) (-1991.109) [-1987.762] * [-1978.505] (-1990.551) (-1979.374) (-1998.986) -- 0:00:30
908000 -- (-1995.676) (-1999.023) (-1990.605) [-1981.047] * [-1979.066] (-1998.249) (-1980.988) (-1998.205) -- 0:00:30
Average standard deviation of split frequencies: 0.002328
908100 -- (-1989.631) (-1994.739) (-1993.012) [-1979.712] * (-1988.497) (-1991.827) [-1986.843] (-2004.939) -- 0:00:30
908200 -- (-1991.355) (-1992.208) (-1992.004) [-1981.290] * (-1988.187) (-1992.204) [-1987.062] (-2004.455) -- 0:00:30
908300 -- (-1990.528) (-2000.616) (-1990.821) [-1983.572] * (-1992.499) [-1988.158] (-1991.140) (-1996.274) -- 0:00:30
908400 -- (-1993.243) (-2002.301) (-1989.772) [-1983.369] * [-1989.749] (-1988.581) (-1984.262) (-1997.479) -- 0:00:30
908500 -- (-1989.371) (-2005.059) (-1990.300) [-1980.850] * (-1992.830) (-1995.633) [-1981.268] (-1998.258) -- 0:00:30
908600 -- [-1980.080] (-1989.274) (-1985.517) (-1983.828) * (-1991.220) (-1989.465) [-1980.601] (-2003.935) -- 0:00:29
908700 -- [-1979.605] (-1993.873) (-1984.136) (-1984.364) * (-1994.001) (-1998.269) [-1981.796] (-2008.957) -- 0:00:29
908800 -- [-1981.794] (-1992.050) (-1988.390) (-1986.713) * (-1989.291) (-1993.541) [-1985.642] (-2000.787) -- 0:00:29
908900 -- [-1981.100] (-1994.897) (-1992.232) (-1994.099) * (-1988.604) [-1997.040] (-1990.504) (-2001.295) -- 0:00:29
909000 -- (-1983.852) (-1993.231) [-1989.775] (-1985.397) * (-1991.752) (-1995.692) (-1987.226) [-1991.106] -- 0:00:29
Average standard deviation of split frequencies: 0.002326
909100 -- [-1979.527] (-1994.645) (-1996.791) (-1988.694) * (-1989.246) [-1984.588] (-1987.323) (-1989.086) -- 0:00:29
909200 -- [-1980.739] (-1989.301) (-1993.788) (-1985.819) * [-1986.183] (-1989.829) (-1990.482) (-1987.871) -- 0:00:29
909300 -- [-1979.566] (-1990.858) (-1996.538) (-1987.166) * (-1986.044) (-1989.513) [-1982.441] (-1989.500) -- 0:00:29
909400 -- [-1982.902] (-1994.021) (-1995.839) (-1988.967) * (-1989.775) [-1991.980] (-1984.913) (-1996.602) -- 0:00:29
909500 -- [-1979.807] (-2000.484) (-1995.646) (-1989.135) * (-1983.720) (-1990.677) [-1989.270] (-1991.121) -- 0:00:29
909600 -- (-1975.817) (-1999.091) (-2003.932) [-1987.963] * [-1986.993] (-1993.241) (-1989.233) (-1993.929) -- 0:00:29
909700 -- [-1980.722] (-2000.554) (-1991.157) (-1994.582) * (-1990.454) (-1997.158) [-1989.953] (-1988.295) -- 0:00:29
909800 -- [-1979.412] (-2000.008) (-1989.843) (-1991.777) * (-1996.868) [-1993.208] (-1992.764) (-1990.703) -- 0:00:29
909900 -- [-1978.981] (-1991.177) (-1990.912) (-1994.407) * (-1991.061) (-1992.662) (-1997.064) [-1988.957] -- 0:00:29
910000 -- [-1981.355] (-1987.196) (-1992.559) (-2005.367) * (-1998.034) (-1990.244) (-1993.537) [-1992.583] -- 0:00:29
Average standard deviation of split frequencies: 0.002220
910100 -- [-1978.821] (-1983.573) (-1990.124) (-2004.628) * (-1995.037) [-1989.082] (-1992.209) (-1990.752) -- 0:00:29
910200 -- (-1982.775) [-1985.728] (-1987.880) (-2004.503) * (-1999.635) [-1989.240] (-1994.617) (-1984.677) -- 0:00:29
910300 -- [-1989.384] (-1994.372) (-1988.800) (-1992.602) * (-2000.852) (-1986.305) (-1996.312) [-1984.560] -- 0:00:29
910400 -- (-1992.632) (-1998.531) [-1994.952] (-1989.086) * (-1997.910) [-1989.349] (-1999.793) (-1983.736) -- 0:00:29
910500 -- [-1982.589] (-1990.552) (-1997.657) (-1988.041) * (-1992.525) (-1987.395) (-1999.476) [-1983.087] -- 0:00:29
910600 -- (-1984.332) (-1983.667) (-2011.412) [-1987.631] * [-1997.376] (-1989.199) (-1992.995) (-1984.645) -- 0:00:29
910700 -- [-1980.716] (-1987.929) (-2009.486) (-1989.253) * (-1995.259) (-1988.413) [-1987.730] (-1991.223) -- 0:00:29
910800 -- [-1981.620] (-1990.023) (-1997.903) (-1994.757) * (-1991.022) (-1985.054) [-1985.561] (-1995.330) -- 0:00:29
910900 -- (-1986.784) (-1985.988) (-1994.652) [-1987.796] * (-1994.879) [-1984.765] (-1986.797) (-2001.989) -- 0:00:29
911000 -- [-1985.438] (-1982.148) (-1995.530) (-2003.933) * (-1995.320) (-1987.655) (-1984.981) [-1993.814] -- 0:00:29
Average standard deviation of split frequencies: 0.002188
911100 -- (-1993.385) [-1986.415] (-1994.504) (-1989.754) * [-1992.352] (-1987.509) (-1985.865) (-1995.640) -- 0:00:29
911200 -- (-1996.277) (-1993.908) (-2006.930) [-1986.824] * [-1988.731] (-1992.704) (-1990.982) (-1993.112) -- 0:00:29
911300 -- (-1994.551) [-1991.361] (-1994.350) (-1992.188) * (-1988.926) (-1991.900) [-1986.031] (-1994.713) -- 0:00:29
911400 -- (-1985.592) [-1990.641] (-1999.595) (-1996.287) * (-1991.057) (-1988.100) [-1983.700] (-2002.304) -- 0:00:29
911500 -- (-1985.190) [-1983.223] (-1994.939) (-1996.819) * [-1990.348] (-1992.718) (-1990.828) (-1998.045) -- 0:00:29
911600 -- (-1986.312) (-1984.041) [-1993.220] (-1999.939) * [-1989.882] (-1994.689) (-1988.019) (-1993.924) -- 0:00:28
911700 -- (-1981.235) [-1980.968] (-1992.256) (-1998.396) * (-1990.333) (-1998.300) [-1987.007] (-2003.174) -- 0:00:28
911800 -- (-1984.859) [-1981.685] (-1995.288) (-1995.574) * [-1990.118] (-1998.519) (-1992.848) (-1990.816) -- 0:00:28
911900 -- (-1985.000) [-1983.796] (-2004.417) (-1999.899) * (-1991.415) (-2003.903) [-1989.525] (-1997.552) -- 0:00:28
912000 -- (-1989.623) [-1978.978] (-2003.850) (-1996.606) * [-1987.899] (-1997.123) (-1984.768) (-1996.496) -- 0:00:28
Average standard deviation of split frequencies: 0.002171
912100 -- (-1988.241) [-1978.799] (-2010.702) (-1997.714) * (-1993.541) (-1998.875) [-1981.758] (-2009.794) -- 0:00:28
912200 -- (-1985.464) [-1976.687] (-2008.297) (-1994.917) * (-1989.987) (-1994.358) [-1985.029] (-2006.365) -- 0:00:28
912300 -- [-1981.252] (-1978.448) (-1995.641) (-2000.012) * (-1986.474) (-1991.061) [-1983.144] (-2012.987) -- 0:00:28
912400 -- [-1980.863] (-1979.867) (-1990.885) (-2002.539) * (-1991.988) [-1990.417] (-1982.990) (-2012.064) -- 0:00:28
912500 -- [-1985.238] (-1987.904) (-1997.454) (-1997.857) * (-1989.966) (-1996.076) [-1986.490] (-2011.789) -- 0:00:28
912600 -- (-1986.833) [-1980.487] (-1994.902) (-1998.372) * [-1990.533] (-2006.831) (-1985.730) (-1993.745) -- 0:00:28
912700 -- [-1988.961] (-1983.060) (-1994.682) (-1995.875) * (-1990.776) (-2007.851) [-1982.688] (-1991.215) -- 0:00:28
912800 -- [-1984.617] (-1986.698) (-1996.270) (-1996.013) * (-1993.632) (-2009.034) [-1980.333] (-1992.015) -- 0:00:28
912900 -- (-1987.461) (-1987.254) (-1995.371) [-1996.263] * (-1988.807) (-2002.633) [-1991.940] (-1990.663) -- 0:00:28
913000 -- [-1985.766] (-1980.440) (-2001.570) (-1997.493) * [-1985.320] (-2010.024) (-1993.991) (-1986.468) -- 0:00:28
Average standard deviation of split frequencies: 0.002168
913100 -- [-1977.623] (-1980.099) (-1998.653) (-1996.269) * (-1986.839) (-1999.321) (-1985.099) [-1990.019] -- 0:00:28
913200 -- [-1978.858] (-1985.890) (-1993.564) (-1996.983) * (-1985.995) (-1994.671) (-1983.664) [-1987.287] -- 0:00:28
913300 -- [-1979.481] (-1981.767) (-1993.492) (-1988.680) * (-1998.946) (-2001.237) [-1980.372] (-1996.326) -- 0:00:28
913400 -- (-1981.837) [-1984.690] (-1995.864) (-2001.056) * (-1994.309) (-2005.403) (-1982.788) [-1994.436] -- 0:00:28
913500 -- (-1983.219) [-1983.659] (-1993.290) (-1993.821) * (-1986.836) (-2003.207) [-1982.489] (-1996.334) -- 0:00:28
913600 -- (-1983.097) [-1983.212] (-1992.342) (-1993.125) * (-1985.725) (-1997.544) [-1978.895] (-1991.298) -- 0:00:28
913700 -- (-1984.251) [-1991.287] (-1998.015) (-1994.555) * (-1985.098) (-1995.971) [-1984.617] (-1990.232) -- 0:00:28
913800 -- (-1981.513) (-1985.848) [-1992.248] (-2005.898) * (-1995.417) (-1997.506) (-1986.762) [-1990.972] -- 0:00:28
913900 -- [-1981.474] (-1991.539) (-1990.785) (-1995.499) * (-1998.347) (-1995.702) [-1981.768] (-1998.095) -- 0:00:28
914000 -- [-1981.346] (-1988.327) (-1989.413) (-1997.832) * (-1993.787) (-1991.925) [-1983.591] (-1994.887) -- 0:00:28
Average standard deviation of split frequencies: 0.002166
914100 -- [-1980.942] (-1989.680) (-1989.897) (-1996.179) * [-1988.321] (-1991.916) (-1987.404) (-1994.515) -- 0:00:28
914200 -- [-1981.567] (-1988.275) (-1994.474) (-1989.688) * (-1988.676) (-1987.567) [-1984.589] (-2000.383) -- 0:00:28
914300 -- (-1988.508) [-1983.262] (-1990.456) (-1994.611) * (-1991.295) (-1986.237) [-1987.124] (-1992.711) -- 0:00:28
914400 -- (-1992.470) (-1990.521) [-1993.815] (-1992.452) * (-1990.762) (-1981.999) [-1988.749] (-1989.419) -- 0:00:28
914500 -- [-1984.071] (-1987.875) (-1997.247) (-1991.959) * [-1985.458] (-1984.910) (-1990.779) (-1996.190) -- 0:00:28
914600 -- (-1984.724) (-1988.642) (-2000.250) [-1994.140] * [-1983.477] (-1984.344) (-1996.705) (-1992.016) -- 0:00:28
914700 -- [-1983.766] (-1993.974) (-1995.949) (-1989.327) * (-1990.730) [-1984.946] (-2008.053) (-1990.763) -- 0:00:27
914800 -- [-1984.141] (-1986.576) (-1994.131) (-1997.931) * (-1990.652) [-1987.492] (-2007.213) (-1992.957) -- 0:00:27
914900 -- (-1987.376) [-1991.458] (-1999.225) (-1991.864) * (-1993.159) [-1984.378] (-2012.508) (-1991.252) -- 0:00:27
915000 -- (-1985.527) [-1987.249] (-2002.745) (-1990.636) * [-1994.774] (-1987.671) (-2001.182) (-1987.611) -- 0:00:27
Average standard deviation of split frequencies: 0.002104
915100 -- (-1988.606) [-1996.783] (-2000.977) (-1991.769) * (-2000.475) [-1988.039] (-1992.442) (-2001.141) -- 0:00:27
915200 -- (-1983.174) (-1989.645) (-1993.514) [-1984.575] * (-2000.599) [-1986.964] (-1988.377) (-1991.437) -- 0:00:27
915300 -- (-1984.493) [-1987.669] (-1991.902) (-1985.375) * (-1994.848) (-1988.988) [-1989.329] (-1995.427) -- 0:00:27
915400 -- [-1978.885] (-1988.513) (-2002.641) (-1991.154) * [-1987.406] (-1994.733) (-1993.351) (-1999.425) -- 0:00:27
915500 -- [-1977.617] (-1991.083) (-1997.253) (-1992.218) * (-1994.250) (-2007.148) [-1993.678] (-1998.430) -- 0:00:27
915600 -- [-1981.387] (-1999.262) (-2003.251) (-1996.267) * (-1995.604) (-2004.148) (-1994.872) [-1992.317] -- 0:00:27
915700 -- [-1979.197] (-1996.274) (-2000.724) (-1990.495) * (-1988.988) (-2002.165) [-1993.560] (-1994.250) -- 0:00:27
915800 -- (-1984.111) (-1992.007) (-2003.901) [-1989.942] * (-1993.159) (-1994.423) [-1993.442] (-1990.142) -- 0:00:27
915900 -- (-1985.559) [-1988.785] (-2010.054) (-1994.725) * (-1999.286) [-1984.903] (-1996.315) (-1991.477) -- 0:00:27
916000 -- [-1982.807] (-1989.100) (-2003.636) (-1991.224) * (-2004.217) (-1987.295) (-1994.901) [-1984.128] -- 0:00:27
Average standard deviation of split frequencies: 0.002044
916100 -- [-1979.837] (-1985.285) (-2000.242) (-1992.349) * (-2004.344) [-1986.850] (-1999.789) (-1986.134) -- 0:00:27
916200 -- [-1982.549] (-1988.150) (-1994.072) (-1996.242) * (-1994.285) (-1987.665) (-2004.767) [-1982.428] -- 0:00:27
916300 -- (-1988.525) (-1992.899) [-1987.190] (-1993.403) * (-1993.465) [-1989.405] (-1991.515) (-1984.064) -- 0:00:27
916400 -- (-1995.367) (-1991.958) (-1984.604) [-1987.324] * (-2000.237) (-1991.588) (-1992.317) [-1987.954] -- 0:00:27
916500 -- (-1997.905) (-1999.329) (-1984.235) [-1993.950] * (-1991.406) (-1988.950) [-1988.554] (-1997.649) -- 0:00:27
916600 -- (-1989.281) (-1991.462) (-1982.386) [-1990.128] * [-1988.518] (-1990.756) (-1990.525) (-1992.106) -- 0:00:27
916700 -- (-1989.469) (-1991.484) [-1981.459] (-1988.050) * (-1984.672) (-1987.471) (-1991.422) [-2000.415] -- 0:00:27
916800 -- [-1991.376] (-1994.728) (-1986.625) (-1990.391) * [-1985.229] (-1989.476) (-1990.248) (-2001.914) -- 0:00:27
916900 -- (-1990.256) [-1995.049] (-1993.930) (-1991.415) * (-1995.427) (-1987.296) (-1990.533) [-1990.547] -- 0:00:27
917000 -- [-1991.317] (-1992.856) (-1989.648) (-1996.706) * (-2005.343) (-1987.020) [-1988.206] (-1990.311) -- 0:00:27
Average standard deviation of split frequencies: 0.002012
917100 -- (-1991.985) [-1997.487] (-1991.352) (-1995.738) * [-1993.474] (-1993.580) (-1994.264) (-1992.405) -- 0:00:27
917200 -- (-1990.234) (-2012.664) (-1994.362) [-1992.955] * [-1986.898] (-1990.706) (-1988.279) (-1988.198) -- 0:00:27
917300 -- [-1988.734] (-1998.523) (-1992.383) (-1992.321) * (-1988.760) (-2000.978) (-2000.823) [-1989.986] -- 0:00:27
917400 -- (-1989.694) (-2010.017) [-1991.432] (-1992.248) * (-1989.399) [-1991.810] (-2002.824) (-1990.043) -- 0:00:27
917500 -- (-1993.191) (-2014.421) (-1990.636) [-1989.895] * (-1987.980) (-1990.163) (-2007.636) [-1987.981] -- 0:00:27
917600 -- (-1988.713) (-2003.432) (-1993.494) [-1989.439] * (-1986.311) [-1987.823] (-1995.594) (-1986.948) -- 0:00:27
917700 -- (-1993.302) (-2012.010) [-1992.966] (-1988.548) * (-1987.302) (-1990.300) [-1995.064] (-1987.264) -- 0:00:26
917800 -- (-1994.283) (-1998.654) (-1989.904) [-1989.040] * (-1986.744) (-1991.986) (-1998.320) [-1986.623] -- 0:00:26
917900 -- (-1998.791) (-2002.480) [-1985.244] (-1997.502) * (-1998.166) [-1986.240] (-1993.780) (-1986.343) -- 0:00:26
918000 -- (-1996.604) (-1995.803) [-1983.989] (-1995.622) * [-1988.528] (-1997.030) (-1987.009) (-1989.912) -- 0:00:26
Average standard deviation of split frequencies: 0.002010
918100 -- (-2005.162) (-1997.534) [-1986.774] (-1989.249) * (-1995.647) (-1994.671) (-1990.090) [-1987.292] -- 0:00:26
918200 -- (-2002.288) [-1986.399] (-1988.939) (-1994.735) * [-1990.389] (-1989.713) (-2002.094) (-1991.483) -- 0:00:26
918300 -- (-1991.898) [-1988.629] (-1991.332) (-1992.957) * (-1987.190) [-1986.499] (-1993.886) (-1992.534) -- 0:00:26
918400 -- [-1986.314] (-1992.872) (-1987.663) (-1997.640) * (-1990.169) (-1987.179) (-1993.206) [-1990.454] -- 0:00:26
918500 -- (-1992.581) [-1995.391] (-1988.659) (-1997.066) * [-1987.309] (-1994.921) (-1993.109) (-1998.998) -- 0:00:26
918600 -- (-1988.510) (-1989.371) [-1987.731] (-2002.614) * [-1988.699] (-1997.111) (-1995.841) (-1998.090) -- 0:00:26
918700 -- (-1987.461) [-1984.756] (-1987.721) (-1992.865) * [-1986.125] (-1993.431) (-1988.407) (-1992.822) -- 0:00:26
918800 -- (-1995.373) (-1990.149) [-1985.354] (-1991.195) * [-1987.723] (-1998.477) (-1992.591) (-2011.636) -- 0:00:26
918900 -- (-1991.724) (-1984.678) (-1988.542) [-1986.938] * [-1987.700] (-1992.817) (-1998.081) (-1991.693) -- 0:00:26
919000 -- (-1982.505) [-1979.166] (-1989.908) (-1984.399) * [-1992.676] (-1990.738) (-1998.018) (-1996.937) -- 0:00:26
Average standard deviation of split frequencies: 0.002037
919100 -- (-1987.002) [-1979.903] (-1987.614) (-1984.712) * (-1993.543) [-1989.297] (-2012.134) (-1987.279) -- 0:00:26
919200 -- (-1985.462) [-1982.926] (-1989.546) (-1992.670) * (-1986.584) (-1987.186) (-2000.984) [-1990.136] -- 0:00:26
919300 -- (-1985.170) [-1990.236] (-1988.626) (-1985.754) * (-1990.129) [-1986.016] (-2001.961) (-1987.626) -- 0:00:26
919400 -- [-1987.023] (-1991.650) (-1984.849) (-1992.887) * (-1991.138) (-1988.435) (-2008.248) [-1984.986] -- 0:00:26
919500 -- (-1985.792) (-1992.138) (-1984.267) [-1988.420] * (-1994.472) (-1994.120) (-2001.012) [-1988.067] -- 0:00:26
919600 -- (-1985.620) (-1989.925) [-1984.806] (-1986.029) * (-1995.510) (-1987.973) (-1998.565) [-1987.251] -- 0:00:26
919700 -- (-1987.891) [-1986.110] (-1985.430) (-1989.030) * [-1990.888] (-1992.344) (-1991.427) (-1992.527) -- 0:00:26
919800 -- [-1986.069] (-1987.981) (-1990.439) (-1989.917) * (-1999.673) (-1994.308) (-1996.638) [-1991.693] -- 0:00:26
919900 -- (-1987.753) (-1981.126) (-2000.202) [-1988.586] * (-1998.791) (-1994.569) (-1996.906) [-1991.199] -- 0:00:26
920000 -- (-1988.449) [-1977.161] (-1991.191) (-2000.706) * (-1995.452) (-1994.889) [-1990.381] (-1994.407) -- 0:00:26
Average standard deviation of split frequencies: 0.002093
920100 -- [-1986.846] (-1975.062) (-1989.473) (-1998.863) * [-1989.763] (-1998.107) (-1993.505) (-1993.046) -- 0:00:26
920200 -- [-1982.633] (-1981.569) (-1997.049) (-1991.635) * (-1992.713) (-1993.056) [-1987.224] (-1991.482) -- 0:00:26
920300 -- [-1980.698] (-1982.825) (-1989.748) (-1993.407) * (-2002.971) (-1988.112) [-1988.871] (-1995.565) -- 0:00:26
920400 -- [-1980.212] (-1988.571) (-1990.275) (-1990.683) * (-1997.112) [-1988.965] (-1990.163) (-1990.853) -- 0:00:26
920500 -- (-1991.788) [-1982.036] (-1994.616) (-1986.045) * (-1995.659) [-1989.733] (-1990.928) (-1990.137) -- 0:00:26
920600 -- (-1998.589) (-1991.097) (-1993.724) [-1984.940] * (-1998.244) (-1986.540) [-1987.225] (-1989.980) -- 0:00:26
920700 -- (-1994.871) (-1987.192) (-1987.603) [-1985.406] * (-1995.783) (-1994.604) [-1988.050] (-1991.216) -- 0:00:26
920800 -- (-2002.307) [-1988.340] (-1988.763) (-1990.001) * (-1994.404) (-1993.432) (-1992.642) [-1992.400] -- 0:00:25
920900 -- (-1990.382) [-1984.251] (-2006.364) (-1990.954) * (-1992.919) (-1993.100) (-1998.270) [-1988.105] -- 0:00:25
921000 -- (-1983.071) [-1987.535] (-2006.663) (-1983.254) * (-2002.137) (-2001.718) (-1991.021) [-1987.507] -- 0:00:25
Average standard deviation of split frequencies: 0.002032
921100 -- [-1981.562] (-1985.809) (-2007.622) (-1989.195) * [-1990.967] (-1998.895) (-1997.320) (-1987.382) -- 0:00:25
921200 -- [-1989.072] (-1988.882) (-2013.474) (-1993.626) * [-1986.336] (-1995.546) (-1992.048) (-1996.858) -- 0:00:25
921300 -- (-1990.799) (-1987.431) (-2002.761) [-1996.386] * (-1985.519) (-1998.248) [-1995.556] (-1995.242) -- 0:00:25
921400 -- (-1984.390) (-1990.008) (-1998.373) [-1994.675] * (-1992.833) (-2001.385) [-1994.500] (-2000.742) -- 0:00:25
921500 -- [-1981.429] (-1990.514) (-1999.372) (-1996.875) * [-1985.792] (-1989.981) (-1994.456) (-1997.120) -- 0:00:25
921600 -- [-1985.579] (-1994.936) (-1998.552) (-1996.901) * (-1991.063) (-1988.988) [-1988.649] (-1998.454) -- 0:00:25
921700 -- [-1982.903] (-2002.062) (-1999.302) (-1990.467) * (-1993.524) (-1989.616) [-1991.269] (-2000.960) -- 0:00:25
921800 -- [-1985.917] (-2007.968) (-2002.296) (-1986.041) * (-2005.278) [-1988.562] (-2005.577) (-1996.496) -- 0:00:25
921900 -- [-1982.236] (-2006.729) (-1994.513) (-1985.486) * (-1999.982) [-1987.800] (-2002.218) (-2015.527) -- 0:00:25
922000 -- (-1986.253) (-1998.224) (-1993.933) [-1989.033] * (-1997.128) [-1991.758] (-2009.938) (-2011.654) -- 0:00:25
Average standard deviation of split frequencies: 0.002001
922100 -- [-1985.480] (-2000.331) (-1990.039) (-2000.716) * (-1994.358) [-1991.083] (-1995.073) (-2013.415) -- 0:00:25
922200 -- (-1982.784) (-1990.056) (-1995.060) [-1991.976] * [-1994.308] (-1988.525) (-1997.195) (-2007.344) -- 0:00:25
922300 -- (-1989.508) [-1987.195] (-1996.975) (-1998.555) * (-1996.920) [-1990.380] (-1998.392) (-2000.440) -- 0:00:25
922400 -- [-1988.773] (-1986.321) (-2001.747) (-1990.153) * (-1993.159) [-1983.862] (-2001.266) (-1998.513) -- 0:00:25
922500 -- (-1988.358) (-1986.795) (-2001.978) [-1990.958] * (-1994.586) [-1990.225] (-2005.105) (-1990.055) -- 0:00:25
922600 -- (-1991.397) [-1985.164] (-1999.454) (-1990.736) * (-1992.893) [-1983.743] (-2003.716) (-1992.013) -- 0:00:25
922700 -- [-1987.163] (-1987.156) (-2003.201) (-1991.178) * (-1995.952) (-1986.322) (-1999.585) [-1990.590] -- 0:00:25
922800 -- [-1980.240] (-1987.450) (-1995.875) (-1989.929) * (-1998.115) (-1989.668) (-2000.918) [-1987.905] -- 0:00:25
922900 -- (-1976.837) (-1990.643) (-1992.714) [-1986.766] * [-1997.632] (-1987.723) (-2006.168) (-1993.573) -- 0:00:25
923000 -- [-1980.040] (-1987.735) (-2007.148) (-1990.615) * [-1989.902] (-1989.616) (-2001.805) (-1992.510) -- 0:00:25
Average standard deviation of split frequencies: 0.002013
923100 -- [-1981.905] (-1993.808) (-2002.377) (-1999.515) * [-1988.503] (-1988.671) (-1992.949) (-1995.499) -- 0:00:25
923200 -- (-1981.280) (-1999.301) (-1995.415) [-1991.510] * [-1997.266] (-1988.307) (-1992.320) (-1997.042) -- 0:00:25
923300 -- [-1982.857] (-2007.060) (-1991.488) (-1987.736) * (-1990.356) [-1996.601] (-2005.745) (-1999.527) -- 0:00:25
923400 -- [-1981.529] (-2006.374) (-1992.815) (-1989.718) * [-1984.015] (-1993.806) (-2012.132) (-2009.003) -- 0:00:25
923500 -- [-1985.753] (-2011.805) (-1991.901) (-1983.560) * [-1984.238] (-1995.614) (-2007.480) (-1997.228) -- 0:00:25
923600 -- (-1986.637) (-2001.279) [-1995.281] (-1984.257) * [-1979.208] (-1993.136) (-1995.663) (-1991.531) -- 0:00:25
923700 -- [-1983.821] (-2006.175) (-1996.011) (-1987.799) * [-1981.143] (-1994.955) (-1999.289) (-1990.581) -- 0:00:25
923800 -- [-1984.403] (-2018.575) (-1996.093) (-1986.299) * [-1982.154] (-1988.181) (-1995.029) (-1990.405) -- 0:00:24
923900 -- [-1984.788] (-2022.448) (-2001.245) (-1988.775) * [-1977.025] (-1993.085) (-1995.491) (-1989.524) -- 0:00:24
924000 -- [-1989.934] (-2024.017) (-1996.459) (-1987.780) * [-1985.214] (-1993.564) (-1986.324) (-1988.893) -- 0:00:24
Average standard deviation of split frequencies: 0.002011
924100 -- [-1982.737] (-2017.086) (-1994.071) (-1987.676) * (-1986.802) (-1997.245) (-1985.209) [-1989.699] -- 0:00:24
924200 -- (-1985.536) (-2013.216) [-1988.218] (-1986.488) * (-1982.520) (-1998.863) [-1991.230] (-1998.007) -- 0:00:24
924300 -- [-1982.042] (-2013.217) (-1983.772) (-1990.725) * [-1981.923] (-1997.857) (-1997.338) (-1993.713) -- 0:00:24
924400 -- (-1985.689) (-2012.988) (-1989.030) [-1990.422] * [-1979.047] (-1990.352) (-1998.595) (-1996.941) -- 0:00:24
924500 -- (-1984.419) (-2001.123) [-1985.133] (-1995.752) * [-1976.143] (-1990.603) (-2011.486) (-1988.538) -- 0:00:24
924600 -- (-2000.851) (-2003.351) (-1990.471) [-1989.326] * [-1977.490] (-1990.478) (-2018.910) (-1988.215) -- 0:00:24
924700 -- (-1993.954) (-2000.798) [-1993.650] (-1991.865) * [-1983.009] (-1985.713) (-2016.447) (-1988.852) -- 0:00:24
924800 -- (-1994.470) (-1995.069) [-1986.474] (-1994.452) * [-1981.478] (-1984.626) (-2007.018) (-1986.205) -- 0:00:24
924900 -- [-1983.509] (-1997.304) (-1995.050) (-1992.648) * (-1981.002) [-1984.594] (-2007.606) (-1987.121) -- 0:00:24
925000 -- [-1987.265] (-1995.492) (-1993.269) (-1987.224) * (-1984.705) [-1981.709] (-2002.060) (-1986.343) -- 0:00:24
Average standard deviation of split frequencies: 0.002067
925100 -- (-1985.777) [-1995.263] (-1995.919) (-1997.254) * (-1992.593) [-1980.977] (-1999.885) (-1989.217) -- 0:00:24
925200 -- [-1988.073] (-1996.517) (-1996.561) (-2002.053) * [-1986.527] (-1986.348) (-2004.062) (-1992.666) -- 0:00:24
925300 -- [-1985.976] (-2000.540) (-1998.453) (-2002.665) * [-1982.623] (-1983.741) (-1999.781) (-1994.452) -- 0:00:24
925400 -- [-1992.834] (-2003.639) (-1992.057) (-1995.030) * [-1982.503] (-1987.333) (-1987.401) (-2003.454) -- 0:00:24
925500 -- [-1985.976] (-2002.334) (-1995.398) (-1997.951) * (-1985.115) [-1986.496] (-1992.575) (-1996.542) -- 0:00:24
925600 -- [-1984.257] (-2000.832) (-1998.757) (-1993.343) * [-1981.865] (-1986.105) (-1993.270) (-2002.497) -- 0:00:24
925700 -- [-1986.065] (-2007.816) (-1997.321) (-1985.386) * (-1987.709) [-1988.312] (-1998.910) (-1995.415) -- 0:00:24
925800 -- (-1986.783) (-1996.763) (-1996.916) [-1986.666] * (-1984.740) [-1988.687] (-1990.440) (-1991.638) -- 0:00:24
925900 -- [-1999.364] (-1999.327) (-2005.105) (-1986.539) * (-1988.161) [-1980.729] (-1989.613) (-1996.038) -- 0:00:24
926000 -- [-1983.960] (-1989.881) (-1997.347) (-1988.256) * (-1992.107) [-1980.238] (-1992.271) (-1997.072) -- 0:00:24
Average standard deviation of split frequencies: 0.002007
926100 -- (-1991.631) (-1996.079) (-2001.190) [-1987.182] * (-1985.777) [-1980.161] (-2001.350) (-1996.446) -- 0:00:24
926200 -- [-1991.478] (-1998.582) (-2000.296) (-1988.837) * (-1983.582) [-1982.523] (-1997.978) (-1996.252) -- 0:00:24
926300 -- [-1989.871] (-1994.873) (-1995.517) (-1986.857) * (-1986.367) [-1987.274] (-1993.272) (-2000.637) -- 0:00:24
926400 -- (-1998.543) (-1993.100) (-1997.162) [-1986.446] * (-1990.491) (-1987.543) [-1991.512] (-1995.284) -- 0:00:24
926500 -- (-1998.709) (-2000.182) (-1991.943) [-1985.486] * (-1983.093) [-1983.700] (-1997.649) (-1994.776) -- 0:00:24
926600 -- (-1999.905) (-2000.459) (-1986.530) [-1986.669] * [-1982.930] (-1985.267) (-1995.571) (-1997.352) -- 0:00:24
926700 -- (-2003.192) [-1998.749] (-1987.462) (-1987.017) * [-1981.671] (-1986.424) (-1997.750) (-1989.936) -- 0:00:24
926800 -- (-1996.259) [-1994.876] (-1984.587) (-1999.601) * [-1978.574] (-1996.417) (-1993.259) (-1994.991) -- 0:00:24
926900 -- (-2007.250) (-1991.412) (-1987.718) [-1989.482] * [-1981.038] (-1986.704) (-1993.335) (-1992.678) -- 0:00:23
927000 -- (-2003.850) (-1993.172) (-1988.366) [-1989.931] * [-1985.396] (-1984.057) (-1992.786) (-1993.322) -- 0:00:23
Average standard deviation of split frequencies: 0.002063
927100 -- (-2004.613) [-1995.399] (-1998.893) (-1992.508) * (-1986.166) (-1986.029) [-1988.064] (-1995.869) -- 0:00:23
927200 -- (-1994.146) [-1992.850] (-1987.556) (-1997.973) * (-1983.186) [-1982.354] (-1990.018) (-2002.520) -- 0:00:23
927300 -- (-1996.570) (-1990.512) [-1984.125] (-1996.825) * (-1982.879) [-1986.957] (-1995.782) (-1997.849) -- 0:00:23
927400 -- (-1995.326) (-1994.029) [-1989.038] (-2005.545) * [-1985.139] (-1984.978) (-2003.478) (-1992.562) -- 0:00:23
927500 -- (-1994.933) (-1995.459) [-1991.744] (-1998.503) * (-1986.617) (-1991.916) (-1998.358) [-1985.783] -- 0:00:23
927600 -- [-1986.132] (-2002.882) (-1993.064) (-1995.783) * (-1984.069) [-1985.340] (-1994.035) (-1987.655) -- 0:00:23
927700 -- [-1984.142] (-1991.818) (-1989.540) (-1999.408) * (-1984.269) (-1982.314) (-2001.972) [-1990.554] -- 0:00:23
927800 -- [-1986.322] (-1987.918) (-1989.775) (-2004.276) * (-1980.681) [-1981.409] (-1997.970) (-1995.799) -- 0:00:23
927900 -- (-1991.396) [-1983.888] (-1987.784) (-1996.515) * (-1985.248) [-1980.585] (-1999.215) (-1992.788) -- 0:00:23
928000 -- (-1989.468) [-1984.323] (-1993.953) (-2003.357) * (-1986.988) [-1979.644] (-1999.797) (-1991.902) -- 0:00:23
Average standard deviation of split frequencies: 0.002003
928100 -- [-1988.767] (-1985.649) (-1990.754) (-1991.940) * [-1983.928] (-1978.743) (-1989.663) (-1991.554) -- 0:00:23
928200 -- [-1989.230] (-1989.188) (-1986.826) (-1997.614) * [-1979.837] (-1986.514) (-1990.851) (-1992.614) -- 0:00:23
928300 -- (-1988.736) (-1987.382) [-1992.675] (-1989.608) * (-1983.820) (-1990.542) (-1987.581) [-1992.825] -- 0:00:23
928400 -- (-1994.822) (-1989.642) [-1990.011] (-1993.559) * (-1989.379) (-1991.654) (-1986.470) [-1988.808] -- 0:00:23
928500 -- (-1993.797) (-1992.444) (-1993.963) [-1990.333] * (-1985.568) (-1992.592) [-1989.089] (-1992.971) -- 0:00:23
928600 -- [-1986.197] (-1990.405) (-1988.682) (-1999.335) * [-1982.858] (-2003.912) (-1988.275) (-1993.959) -- 0:00:23
928700 -- [-1985.063] (-1998.859) (-1991.595) (-1998.847) * (-1983.088) (-1993.981) [-1986.905] (-1991.999) -- 0:00:23
928800 -- (-1988.130) [-1984.555] (-1994.058) (-1998.495) * (-1987.783) (-1996.481) (-1993.403) [-1989.971] -- 0:00:23
928900 -- [-1985.509] (-1985.543) (-1999.536) (-2000.556) * [-1981.190] (-1989.538) (-1992.732) (-1992.007) -- 0:00:23
929000 -- [-1985.055] (-1985.385) (-2003.160) (-1999.260) * (-1979.646) [-1982.402] (-2000.818) (-1988.998) -- 0:00:23
Average standard deviation of split frequencies: 0.002044
929100 -- [-1982.814] (-1989.286) (-1999.302) (-2000.964) * [-1979.931] (-1980.372) (-1995.569) (-1994.460) -- 0:00:23
929200 -- (-1991.120) [-1990.671] (-2006.543) (-1998.985) * [-1981.620] (-1988.098) (-1995.227) (-1993.907) -- 0:00:23
929300 -- (-1982.714) (-1995.965) (-1995.719) [-2002.298] * [-1984.397] (-1984.116) (-1991.743) (-1995.614) -- 0:00:23
929400 -- [-1984.559] (-1994.564) (-2005.898) (-1991.806) * [-1983.740] (-1985.771) (-1995.064) (-2000.747) -- 0:00:23
929500 -- (-1984.433) (-1994.880) (-1994.473) [-1991.644] * (-1981.822) [-1982.526] (-1998.441) (-2004.902) -- 0:00:23
929600 -- [-1983.068] (-1997.937) (-1996.551) (-1990.571) * [-1980.578] (-1979.162) (-1999.103) (-1992.569) -- 0:00:23
929700 -- (-1989.370) (-2006.687) (-1996.195) [-1987.469] * [-1979.472] (-1978.361) (-1997.363) (-1988.694) -- 0:00:23
929800 -- (-1991.277) (-2003.129) [-1986.967] (-1992.248) * (-1985.043) [-1980.238] (-1999.519) (-1988.231) -- 0:00:23
929900 -- (-1990.100) (-1999.922) (-1995.633) [-1988.740] * (-1984.520) [-1982.796] (-1999.294) (-1996.493) -- 0:00:22
930000 -- (-1991.150) (-1991.563) (-1995.194) [-1989.761] * [-1984.164] (-1988.302) (-1993.833) (-2000.497) -- 0:00:22
Average standard deviation of split frequencies: 0.001969
930100 -- (-1990.561) (-1991.825) (-1998.801) [-1985.316] * (-1990.936) [-1991.060] (-1994.875) (-1999.664) -- 0:00:22
930200 -- (-1996.197) (-1991.743) [-1990.722] (-1990.955) * (-1996.780) [-1984.226] (-2001.796) (-1993.706) -- 0:00:22
930300 -- [-1991.168] (-1997.999) (-1995.228) (-1990.842) * (-1993.084) (-1984.206) (-1998.244) [-1989.312] -- 0:00:22
930400 -- (-1999.413) [-1994.186] (-2001.606) (-1994.410) * [-1985.802] (-1994.147) (-1997.342) (-1992.435) -- 0:00:22
930500 -- (-1998.746) (-1987.813) (-1993.138) [-1988.184] * (-1989.159) [-1988.439] (-1993.604) (-1990.286) -- 0:00:22
930600 -- (-1998.866) (-1988.037) (-1993.710) [-1986.733] * (-1986.833) [-1989.029] (-1995.588) (-1994.786) -- 0:00:22
930700 -- (-1996.895) [-1986.709] (-1997.928) (-1993.844) * (-1980.922) [-1983.916] (-1997.147) (-2003.125) -- 0:00:22
930800 -- (-1994.451) (-1986.634) (-1994.306) [-1988.797] * [-1983.586] (-1983.816) (-1996.495) (-1999.721) -- 0:00:22
930900 -- (-1995.100) (-1994.749) (-2006.958) [-1991.667] * (-1987.753) [-1990.790] (-1999.899) (-1999.091) -- 0:00:22
931000 -- (-1998.980) [-1994.331] (-2005.490) (-1997.398) * (-1995.639) [-1994.846] (-2000.242) (-1995.150) -- 0:00:22
Average standard deviation of split frequencies: 0.002010
931100 -- [-1987.566] (-1991.905) (-2008.636) (-1995.765) * [-1994.126] (-1997.985) (-1994.733) (-1996.417) -- 0:00:22
931200 -- [-1984.647] (-1998.104) (-1999.110) (-1989.880) * (-1985.549) (-2000.325) [-1990.648] (-1995.112) -- 0:00:22
931300 -- (-1985.366) (-2000.797) [-1997.309] (-1992.877) * (-1991.881) (-2002.820) [-1983.607] (-1993.179) -- 0:00:22
931400 -- [-1984.415] (-1997.809) (-2000.744) (-1999.975) * [-1985.212] (-2000.818) (-1995.104) (-1990.441) -- 0:00:22
931500 -- (-1987.182) [-1992.082] (-1999.053) (-1991.854) * [-1987.275] (-2003.305) (-1993.221) (-1989.764) -- 0:00:22
931600 -- (-1999.747) [-1999.407] (-1999.288) (-1990.229) * (-1982.484) (-1995.694) [-1991.005] (-1990.062) -- 0:00:22
931700 -- (-1991.516) (-2003.605) (-1997.408) [-1991.589] * (-1983.578) (-1997.461) [-1985.432] (-1994.380) -- 0:00:22
931800 -- (-1978.722) (-2003.353) (-1998.698) [-1991.012] * [-1984.810] (-1992.946) (-1988.386) (-1992.996) -- 0:00:22
931900 -- (-1980.326) (-2006.702) (-1999.911) [-1993.929] * [-1984.495] (-1993.787) (-1986.082) (-1994.723) -- 0:00:22
932000 -- [-1986.014] (-2010.329) (-1994.833) (-1995.722) * [-1978.807] (-2000.677) (-1987.919) (-1991.561) -- 0:00:22
Average standard deviation of split frequencies: 0.001922
932100 -- [-1987.107] (-1991.915) (-1995.357) (-1993.570) * [-1979.374] (-2000.235) (-1985.894) (-1991.831) -- 0:00:22
932200 -- (-1992.479) (-2007.055) (-1991.189) [-1995.600] * [-1978.640] (-2002.985) (-2002.419) (-1996.556) -- 0:00:22
932300 -- (-1987.983) (-2000.009) (-2001.224) [-1997.193] * [-1978.370] (-1999.488) (-2002.550) (-1996.719) -- 0:00:22
932400 -- [-1982.135] (-1996.957) (-2005.020) (-2002.466) * [-1980.417] (-1996.436) (-2007.762) (-1988.016) -- 0:00:22
932500 -- [-1989.538] (-1990.740) (-1997.710) (-2016.398) * [-1983.960] (-2002.571) (-1998.500) (-1992.721) -- 0:00:22
932600 -- (-1990.379) [-1992.687] (-1992.078) (-2017.780) * [-1984.583] (-1993.910) (-2003.602) (-1994.977) -- 0:00:22
932700 -- [-1983.643] (-1989.908) (-1991.006) (-2013.247) * (-1987.428) (-2001.554) (-1996.491) [-1987.177] -- 0:00:22
932800 -- [-1983.811] (-1997.747) (-1992.513) (-2000.320) * (-1999.362) [-1991.908] (-1995.942) (-1990.335) -- 0:00:22
932900 -- (-1986.245) (-1998.876) [-1993.737] (-2005.415) * (-1996.220) [-1985.476] (-1992.913) (-1984.884) -- 0:00:22
933000 -- [-1983.549] (-1988.597) (-1989.230) (-1995.588) * (-1992.701) (-1985.071) (-1992.873) [-1991.181] -- 0:00:21
Average standard deviation of split frequencies: 0.001934
933100 -- (-1990.703) [-1991.669] (-1984.638) (-2001.200) * (-1998.074) (-1993.455) [-1987.721] (-1991.629) -- 0:00:21
933200 -- [-1984.366] (-1989.351) (-1991.734) (-2003.703) * (-1992.045) (-1999.232) [-1993.045] (-1990.792) -- 0:00:21
933300 -- [-1981.520] (-1993.558) (-1998.415) (-2001.445) * (-1999.873) (-1996.830) (-1993.098) [-1990.501] -- 0:00:21
933400 -- (-1984.275) (-2008.857) [-1995.306] (-1995.222) * [-1998.874] (-1999.739) (-2001.726) (-1987.236) -- 0:00:21
933500 -- [-1984.805] (-2006.943) (-1991.696) (-1999.065) * (-1996.800) (-1994.688) (-1995.281) [-1988.100] -- 0:00:21
933600 -- (-1981.071) [-1996.745] (-1999.514) (-1998.569) * (-1993.214) (-1990.767) (-1991.719) [-1986.259] -- 0:00:21
933700 -- [-1981.480] (-1995.567) (-1999.268) (-1992.437) * [-1978.998] (-1982.904) (-1990.089) (-1985.605) -- 0:00:21
933800 -- [-1981.334] (-1990.006) (-1997.420) (-1999.105) * (-1979.940) [-1982.267] (-1996.302) (-1991.848) -- 0:00:21
933900 -- [-1985.325] (-1996.251) (-1993.269) (-1990.071) * (-1983.313) [-1984.867] (-1996.407) (-1995.448) -- 0:00:21
934000 -- [-1985.382] (-1993.754) (-1994.381) (-1993.675) * (-1994.682) [-1979.418] (-1993.722) (-1996.601) -- 0:00:21
Average standard deviation of split frequencies: 0.001961
934100 -- (-1984.585) (-1994.841) [-1995.137] (-1993.197) * (-1992.631) [-1980.555] (-1998.310) (-1994.059) -- 0:00:21
934200 -- [-1986.401] (-1995.193) (-1993.713) (-1992.333) * (-1989.528) [-1979.661] (-2001.438) (-1993.438) -- 0:00:21
934300 -- (-1983.737) (-1993.090) [-1991.361] (-1987.933) * (-1987.872) (-1978.838) [-1996.031] (-1993.409) -- 0:00:21
934400 -- (-1982.023) [-1992.945] (-1998.132) (-1995.933) * (-1989.045) [-1978.457] (-1998.511) (-1996.150) -- 0:00:21
934500 -- [-1983.034] (-1996.871) (-1990.293) (-2000.518) * (-1985.648) [-1977.780] (-1991.982) (-1991.294) -- 0:00:21
934600 -- [-1980.758] (-1998.692) (-1989.081) (-2008.848) * (-1990.758) [-1976.985] (-1997.138) (-1997.096) -- 0:00:21
934700 -- (-1979.375) [-1991.953] (-1995.655) (-1997.120) * (-1989.044) [-1977.548] (-2004.357) (-1990.404) -- 0:00:21
934800 -- [-1980.423] (-1990.654) (-1997.391) (-1999.325) * (-1985.158) (-1992.795) [-1995.566] (-1990.325) -- 0:00:21
934900 -- [-1982.094] (-1988.112) (-1998.398) (-1992.225) * [-1983.329] (-1988.853) (-1998.681) (-1990.647) -- 0:00:21
935000 -- [-1979.234] (-1994.136) (-1991.744) (-1990.845) * (-1992.753) [-1983.159] (-1992.690) (-1993.147) -- 0:00:21
Average standard deviation of split frequencies: 0.001987
935100 -- (-1982.734) (-1991.658) [-1987.204] (-2001.514) * (-1984.120) [-1985.640] (-2001.317) (-1997.130) -- 0:00:21
935200 -- [-1985.703] (-1991.115) (-1990.688) (-1993.539) * (-1983.588) [-1981.979] (-2001.803) (-2008.211) -- 0:00:21
935300 -- (-1988.116) (-1986.059) [-1990.608] (-1986.620) * (-1985.236) [-1983.574] (-2008.640) (-2007.640) -- 0:00:21
935400 -- (-1985.615) [-1987.034] (-1989.871) (-1986.633) * (-1981.797) [-1979.622] (-1997.850) (-2002.724) -- 0:00:21
935500 -- (-1986.035) [-1991.336] (-1986.769) (-1991.467) * [-1992.076] (-1982.678) (-2003.034) (-2001.220) -- 0:00:21
935600 -- (-1987.873) (-1994.439) (-1989.557) [-1987.056] * (-1988.008) [-1983.933] (-2009.893) (-2000.853) -- 0:00:21
935700 -- (-1984.053) [-1993.508] (-1991.759) (-1991.829) * (-1988.996) [-1983.429] (-2004.864) (-2002.243) -- 0:00:21
935800 -- [-1986.370] (-1996.330) (-1994.513) (-1991.988) * (-1989.593) [-1982.037] (-2010.936) (-2009.738) -- 0:00:21
935900 -- [-1980.134] (-1990.074) (-1994.664) (-1992.915) * [-1984.761] (-1979.546) (-1997.057) (-2006.520) -- 0:00:21
936000 -- [-1977.881] (-1999.916) (-1995.109) (-1998.329) * (-1987.028) [-1979.087] (-1992.478) (-2004.190) -- 0:00:20
Average standard deviation of split frequencies: 0.001985
936100 -- [-1978.439] (-1989.877) (-1996.129) (-1996.999) * (-1985.215) [-1980.549] (-1993.691) (-2016.274) -- 0:00:20
936200 -- [-1983.227] (-1993.611) (-1992.728) (-1996.321) * (-1995.026) [-1985.336] (-1994.334) (-2009.470) -- 0:00:20
936300 -- [-1985.991] (-1998.161) (-1994.663) (-1991.968) * [-1988.875] (-1978.523) (-1998.430) (-2004.842) -- 0:00:20
936400 -- [-1978.183] (-1997.533) (-1991.033) (-1992.465) * [-1981.848] (-1982.893) (-1996.566) (-2000.885) -- 0:00:20
936500 -- [-1980.872] (-2003.160) (-1996.236) (-1993.121) * (-1984.845) [-1990.922] (-1998.882) (-1990.313) -- 0:00:20
936600 -- [-1981.773] (-1991.899) (-1987.232) (-1991.648) * [-1985.493] (-1991.257) (-1998.104) (-2000.179) -- 0:00:20
936700 -- [-1979.111] (-1991.663) (-1992.266) (-1996.762) * (-1982.429) (-1991.449) [-1993.981] (-2001.556) -- 0:00:20
936800 -- [-1981.284] (-1988.591) (-2002.548) (-1990.833) * [-1980.833] (-1994.743) (-1993.936) (-1998.047) -- 0:00:20
936900 -- [-1979.149] (-1999.921) (-2001.578) (-1992.911) * [-1980.377] (-2000.989) (-1994.928) (-1996.376) -- 0:00:20
937000 -- [-1984.869] (-1993.455) (-2001.282) (-1990.123) * [-1980.205] (-1997.040) (-1988.106) (-1994.438) -- 0:00:20
Average standard deviation of split frequencies: 0.001969
937100 -- [-1985.054] (-1995.594) (-2002.505) (-1989.061) * [-1981.437] (-1994.583) (-1990.107) (-1997.151) -- 0:00:20
937200 -- [-1982.208] (-1990.583) (-2005.887) (-1997.222) * (-1986.897) (-2000.911) [-1992.575] (-1994.110) -- 0:00:20
937300 -- (-1986.445) [-1987.571] (-2005.590) (-1995.160) * (-1989.855) (-1993.284) [-1990.275] (-1993.144) -- 0:00:20
937400 -- (-1987.306) (-1987.921) (-2001.008) [-1986.528] * (-1996.584) (-1993.722) [-1991.370] (-1989.645) -- 0:00:20
937500 -- [-1988.746] (-2007.183) (-1995.849) (-1986.686) * [-1993.327] (-2003.800) (-1995.315) (-1987.162) -- 0:00:20
937600 -- [-1988.177] (-1995.621) (-1990.840) (-1991.213) * (-1990.856) [-1991.472] (-1999.768) (-1987.515) -- 0:00:20
937700 -- [-1983.655] (-1989.379) (-1988.673) (-1987.516) * (-1996.179) (-1986.189) (-1996.822) [-1983.670] -- 0:00:20
937800 -- [-1985.547] (-1991.337) (-1988.689) (-1986.619) * (-1997.337) [-1985.674] (-1999.580) (-1988.472) -- 0:00:20
937900 -- [-1982.985] (-1993.571) (-1986.752) (-1987.591) * (-1992.455) (-1987.035) (-1999.097) [-1989.826] -- 0:00:20
938000 -- (-1986.143) (-1996.592) (-1995.028) [-1984.443] * (-1994.691) (-2002.006) (-1995.008) [-1990.139] -- 0:00:20
Average standard deviation of split frequencies: 0.001953
938100 -- [-1985.251] (-1992.543) (-1994.143) (-1990.324) * (-1989.420) (-1983.948) (-1995.438) [-1988.205] -- 0:00:20
938200 -- [-1976.419] (-2003.802) (-2000.976) (-1989.432) * (-1999.886) (-1988.060) (-2000.481) [-1982.254] -- 0:00:20
938300 -- [-1979.826] (-1995.945) (-2001.602) (-1991.557) * (-1995.161) (-1988.809) (-2009.066) [-1986.405] -- 0:00:20
938400 -- [-1986.634] (-1997.982) (-2000.829) (-1990.791) * (-1988.950) [-1987.128] (-2005.160) (-1988.609) -- 0:00:20
938500 -- [-1985.756] (-2007.686) (-1996.063) (-1992.552) * (-1993.958) [-1981.468] (-1998.027) (-1988.054) -- 0:00:20
938600 -- [-1982.066] (-2002.248) (-1996.506) (-1994.146) * [-1987.332] (-1986.211) (-2001.984) (-1992.580) -- 0:00:20
938700 -- [-1984.942] (-2012.856) (-1995.730) (-1996.139) * [-1986.612] (-1993.049) (-1997.390) (-2005.905) -- 0:00:20
938800 -- (-1989.932) (-2001.566) (-2006.448) [-1991.688] * [-1983.497] (-1995.310) (-1995.840) (-1999.971) -- 0:00:20
938900 -- [-1987.374] (-2001.209) (-2000.933) (-1992.563) * [-1986.188] (-2003.734) (-1992.197) (-1992.684) -- 0:00:20
939000 -- [-1986.273] (-1992.622) (-1997.697) (-1995.519) * (-1986.484) (-1996.740) (-1996.922) [-1984.995] -- 0:00:20
Average standard deviation of split frequencies: 0.001907
939100 -- [-1981.864] (-1994.223) (-1998.327) (-2000.293) * (-1983.759) (-1991.462) (-1997.278) [-1984.306] -- 0:00:19
939200 -- [-1981.863] (-1996.898) (-1991.553) (-2000.751) * (-1978.897) (-1990.829) (-1994.531) [-1983.765] -- 0:00:19
939300 -- [-1981.051] (-1986.434) (-1993.421) (-1997.954) * [-1980.707] (-1993.835) (-2004.466) (-1992.652) -- 0:00:19
939400 -- [-1981.258] (-1987.220) (-1993.697) (-1994.769) * [-1981.162] (-1989.547) (-1996.366) (-1992.513) -- 0:00:19
939500 -- [-1984.727] (-1990.379) (-2000.311) (-1995.844) * [-1983.789] (-1991.827) (-1990.340) (-1995.812) -- 0:00:19
939600 -- (-1982.233) [-1986.647] (-2001.264) (-1993.444) * (-1984.134) (-1991.912) (-1987.884) [-1995.992] -- 0:00:19
939700 -- (-1984.948) [-1985.156] (-1999.205) (-1993.456) * [-1988.801] (-1991.147) (-1988.388) (-2001.020) -- 0:00:19
939800 -- [-1983.781] (-1988.986) (-1991.116) (-1990.708) * (-1989.152) (-1991.840) [-1987.679] (-1996.891) -- 0:00:19
939900 -- [-1984.049] (-1994.006) (-1998.949) (-1992.889) * (-1992.876) [-1990.535] (-1992.822) (-1989.879) -- 0:00:19
940000 -- [-1982.930] (-1992.594) (-2000.773) (-2003.745) * [-1989.663] (-1982.826) (-1994.664) (-1989.517) -- 0:00:19
Average standard deviation of split frequencies: 0.001934
940100 -- [-1984.229] (-2005.722) (-2005.243) (-1999.220) * (-1988.640) [-1984.681] (-1994.096) (-1995.796) -- 0:00:19
940200 -- [-1984.262] (-2001.066) (-1999.911) (-2008.788) * (-1987.240) [-1985.065] (-1994.840) (-1992.577) -- 0:00:19
940300 -- [-1980.673] (-1998.306) (-1994.830) (-2003.317) * [-1982.189] (-1984.453) (-2000.914) (-1997.206) -- 0:00:19
940400 -- [-1979.148] (-1988.733) (-1998.959) (-2003.277) * [-1982.443] (-1993.202) (-1997.922) (-2002.637) -- 0:00:19
940500 -- [-1984.307] (-1989.310) (-1992.403) (-2003.285) * [-1979.803] (-1994.007) (-2003.951) (-2011.894) -- 0:00:19
940600 -- [-1982.259] (-1995.677) (-1997.970) (-1992.291) * [-1980.926] (-1984.724) (-1994.511) (-2010.057) -- 0:00:19
940700 -- [-1985.688] (-2007.264) (-1990.030) (-1991.140) * (-1981.631) (-1983.131) [-1991.487] (-2008.962) -- 0:00:19
940800 -- [-1979.935] (-1995.544) (-2002.752) (-1997.338) * (-1982.537) [-1984.513] (-1994.785) (-1998.562) -- 0:00:19
940900 -- [-1980.679] (-1992.536) (-1999.940) (-1999.069) * (-1986.404) [-1987.235] (-1993.515) (-1993.400) -- 0:00:19
941000 -- [-1981.287] (-1989.761) (-2002.670) (-1996.115) * [-1986.676] (-1987.164) (-1994.588) (-2005.365) -- 0:00:19
Average standard deviation of split frequencies: 0.001989
941100 -- (-1983.562) [-1990.254] (-1998.514) (-1996.468) * (-1987.331) [-1981.436] (-1988.419) (-1999.290) -- 0:00:19
941200 -- (-1994.751) (-1995.945) (-1994.818) [-1989.856] * (-1986.754) [-1980.344] (-1990.175) (-2001.498) -- 0:00:19
941300 -- (-1999.823) (-1995.333) (-1994.964) [-1990.278] * (-1992.167) (-1985.147) [-1987.780] (-2002.273) -- 0:00:19
941400 -- (-1998.379) [-1989.945] (-2007.829) (-1989.287) * (-1992.735) [-1980.415] (-1987.395) (-1998.297) -- 0:00:19
941500 -- (-1997.669) [-1989.996] (-1997.222) (-2000.778) * (-2000.234) [-1980.466] (-1993.902) (-2005.861) -- 0:00:19
941600 -- (-1999.357) (-1993.046) [-1991.641] (-1989.599) * (-2001.385) [-1980.658] (-1989.936) (-2001.723) -- 0:00:19
941700 -- (-1992.806) (-1993.033) [-1988.147] (-1990.512) * (-1997.248) [-1986.185] (-1986.795) (-2001.207) -- 0:00:19
941800 -- (-1990.252) (-1998.258) [-1990.734] (-1983.730) * (-1996.155) (-1985.149) (-1991.599) [-1995.819] -- 0:00:19
941900 -- (-1987.162) (-2005.212) [-1986.475] (-1990.183) * (-1990.716) (-1997.962) (-1988.548) [-1992.466] -- 0:00:19
942000 -- [-1990.944] (-1997.568) (-1992.620) (-1988.308) * (-1989.347) (-1997.291) [-1985.012] (-1991.924) -- 0:00:19
Average standard deviation of split frequencies: 0.002030
942100 -- (-1987.097) [-1986.610] (-2004.819) (-1991.323) * [-1991.917] (-1991.762) (-1992.133) (-1988.420) -- 0:00:18
942200 -- (-1989.006) (-1989.109) (-2000.688) [-1989.534] * (-1992.584) [-1994.128] (-1989.784) (-1989.233) -- 0:00:18
942300 -- (-1993.026) [-1986.899] (-2000.260) (-1985.408) * [-1980.087] (-1992.765) (-1987.821) (-1995.713) -- 0:00:18
942400 -- [-1996.967] (-1993.511) (-1995.098) (-1986.345) * [-1983.319] (-1986.429) (-1994.469) (-1987.572) -- 0:00:18
942500 -- (-1990.355) (-1994.124) (-1994.626) [-1988.129] * (-1982.467) [-1988.180] (-1999.064) (-1989.462) -- 0:00:18
942600 -- (-1994.913) [-1987.876] (-1999.582) (-1989.955) * [-1984.960] (-1985.008) (-2002.319) (-1993.644) -- 0:00:18
942700 -- [-1990.192] (-1993.833) (-1990.111) (-1989.519) * [-1985.499] (-1984.390) (-1993.364) (-1997.376) -- 0:00:18
942800 -- (-1993.082) (-1996.131) (-1996.244) [-1991.739] * [-1981.162] (-1987.320) (-1986.198) (-1994.042) -- 0:00:18
942900 -- [-1983.941] (-1991.836) (-1988.544) (-1990.617) * (-1985.304) [-1985.932] (-1987.798) (-1987.942) -- 0:00:18
943000 -- (-1994.311) [-1993.276] (-1989.489) (-1997.418) * [-1988.593] (-1999.696) (-1983.795) (-1991.862) -- 0:00:18
Average standard deviation of split frequencies: 0.002028
943100 -- (-1990.994) (-1999.166) [-1990.192] (-1995.846) * (-1992.222) (-2000.087) [-1982.122] (-1994.306) -- 0:00:18
943200 -- (-1991.482) (-1993.287) [-1996.252] (-1990.833) * (-1990.622) (-1997.184) [-1981.310] (-1994.438) -- 0:00:18
943300 -- (-1997.816) (-1995.700) [-1989.457] (-1988.470) * (-1988.934) (-1990.774) [-1982.823] (-1995.687) -- 0:00:18
943400 -- (-1999.650) (-2001.838) (-1988.661) [-1986.443] * (-1996.706) (-1984.763) [-1986.205] (-1994.861) -- 0:00:18
943500 -- (-1999.909) (-2006.355) (-1991.142) [-1986.285] * (-1984.233) [-1982.320] (-1986.967) (-1990.595) -- 0:00:18
943600 -- (-1997.297) (-2007.275) [-1993.374] (-1988.504) * (-1988.555) [-1991.270] (-2000.854) (-1999.763) -- 0:00:18
943700 -- [-1985.153] (-2012.775) (-1986.726) (-1988.796) * [-1985.015] (-1996.239) (-1987.819) (-2001.929) -- 0:00:18
943800 -- [-1986.523] (-2001.861) (-1987.958) (-1997.398) * [-1982.559] (-1991.797) (-1990.250) (-1997.504) -- 0:00:18
943900 -- [-1986.017] (-2002.693) (-1992.517) (-1996.848) * [-1984.744] (-1984.666) (-1987.204) (-1998.337) -- 0:00:18
944000 -- [-1987.755] (-1996.917) (-1997.340) (-1988.554) * [-1984.466] (-1982.828) (-1987.803) (-1994.005) -- 0:00:18
Average standard deviation of split frequencies: 0.002026
944100 -- [-1984.899] (-2002.235) (-2017.153) (-1988.533) * (-1985.561) [-1984.988] (-1988.935) (-1991.751) -- 0:00:18
944200 -- [-1990.152] (-2002.184) (-2005.842) (-1987.768) * (-1986.908) [-1987.025] (-1987.869) (-1996.309) -- 0:00:18
944300 -- (-1997.565) (-1998.886) (-2003.929) [-1988.188] * [-1987.128] (-1985.785) (-1982.826) (-1996.900) -- 0:00:18
944400 -- [-1994.972] (-1998.650) (-2000.868) (-1986.525) * (-1985.410) (-1987.798) [-1980.494] (-1992.003) -- 0:00:18
944500 -- [-1991.765] (-1992.672) (-2004.806) (-1987.733) * (-1987.287) (-1990.930) [-1985.395] (-1988.940) -- 0:00:18
944600 -- (-1991.882) (-1995.610) (-2002.237) [-1988.448] * (-1986.425) (-1992.432) (-1990.002) [-1990.326] -- 0:00:18
944700 -- (-1991.494) (-1992.664) (-2005.053) [-1990.659] * (-1988.088) (-1989.036) [-1982.796] (-2004.390) -- 0:00:18
944800 -- [-1985.349] (-1989.905) (-2003.349) (-1993.553) * (-1990.081) (-1984.180) [-1981.897] (-1995.233) -- 0:00:18
944900 -- [-1986.039] (-1990.928) (-2004.733) (-1991.147) * [-1986.684] (-1988.142) (-1984.909) (-1989.522) -- 0:00:18
945000 -- [-1986.138] (-1994.927) (-1998.463) (-1990.321) * (-1998.569) (-1983.825) [-1986.399] (-1989.052) -- 0:00:18
Average standard deviation of split frequencies: 0.002109
945100 -- [-1982.682] (-1992.191) (-1993.585) (-1985.314) * [-1993.610] (-1990.037) (-1985.757) (-1995.424) -- 0:00:18
945200 -- [-1982.218] (-1985.903) (-1993.953) (-1990.511) * (-1995.852) (-1985.970) [-1982.666] (-1995.911) -- 0:00:17
945300 -- (-1984.364) [-1990.457] (-1996.161) (-1989.661) * (-1985.857) (-1987.515) [-1984.692] (-1986.664) -- 0:00:17
945400 -- [-1986.597] (-1993.382) (-1994.573) (-1991.020) * (-1987.850) (-1996.763) [-1980.276] (-1992.044) -- 0:00:17
945500 -- [-1985.757] (-1996.093) (-1991.099) (-1992.482) * (-1987.113) (-1994.959) [-1981.646] (-1998.541) -- 0:00:17
945600 -- [-1983.134] (-1985.380) (-1993.817) (-1991.079) * (-1989.020) (-1995.887) [-1984.261] (-1998.639) -- 0:00:17
945700 -- (-1992.164) [-1983.774] (-2002.452) (-1998.005) * [-1985.389] (-1996.532) (-1983.018) (-1992.089) -- 0:00:17
945800 -- (-2002.102) (-1988.984) [-1997.335] (-1999.848) * (-1994.273) (-1998.430) [-1984.236] (-1991.157) -- 0:00:17
945900 -- (-1995.607) [-1990.699] (-1997.531) (-1996.062) * (-1995.654) (-2001.149) [-1985.408] (-1986.341) -- 0:00:17
946000 -- (-2010.975) [-1992.611] (-1994.318) (-2001.925) * [-1985.544] (-1997.290) (-1979.199) (-1989.566) -- 0:00:17
Average standard deviation of split frequencies: 0.002007
946100 -- (-2005.039) [-1990.348] (-1997.445) (-1996.577) * (-1985.427) (-1991.096) (-1987.385) [-1987.199] -- 0:00:17
946200 -- (-1990.004) [-1989.739] (-1992.807) (-1991.338) * (-1989.864) (-2000.547) [-1983.518] (-1988.941) -- 0:00:17
946300 -- (-1994.567) [-1989.224] (-1997.665) (-1994.664) * (-1992.134) (-1997.055) [-1989.384] (-1989.366) -- 0:00:17
946400 -- (-1993.697) [-1988.715] (-2001.687) (-1988.841) * (-1991.266) (-1993.612) [-1982.819] (-1987.835) -- 0:00:17
946500 -- (-1986.917) (-1990.937) [-1989.087] (-1991.728) * (-1998.069) (-1992.185) (-1986.754) [-1985.240] -- 0:00:17
946600 -- [-1989.684] (-1985.798) (-1999.384) (-1989.686) * (-2002.683) (-1994.867) (-1988.914) [-1985.859] -- 0:00:17
946700 -- (-1982.970) (-1991.577) (-2000.248) [-1985.528] * (-1996.347) (-1989.209) (-1983.726) [-1983.654] -- 0:00:17
946800 -- (-1985.321) (-1993.750) (-1995.541) [-1984.926] * (-2004.586) (-1990.475) [-1984.002] (-1987.965) -- 0:00:17
946900 -- [-1982.346] (-1995.636) (-1990.595) (-1986.047) * (-2004.105) (-1999.074) [-1987.467] (-1988.749) -- 0:00:17
947000 -- [-1986.755] (-1999.527) (-1989.341) (-1988.028) * (-1999.402) (-1996.492) [-1982.715] (-1992.047) -- 0:00:17
Average standard deviation of split frequencies: 0.002005
947100 -- [-1989.324] (-1997.835) (-1990.559) (-1989.735) * (-2004.666) (-1996.914) [-1982.256] (-1989.275) -- 0:00:17
947200 -- [-1993.131] (-1997.763) (-1991.396) (-1988.426) * (-1996.354) (-1996.704) [-1984.280] (-1992.566) -- 0:00:17
947300 -- [-1997.976] (-1996.307) (-1994.443) (-1997.119) * (-1992.831) (-2007.464) (-1983.695) [-1989.453] -- 0:00:17
947400 -- (-1993.226) (-1998.976) [-1988.462] (-1995.406) * (-1989.371) (-1998.519) [-1980.048] (-1993.659) -- 0:00:17
947500 -- [-1993.330] (-1999.882) (-1990.664) (-1983.978) * (-1984.459) (-2006.976) [-1981.890] (-1988.747) -- 0:00:17
947600 -- (-2000.910) (-1998.518) (-1996.854) [-1985.285] * (-1989.025) (-2003.075) [-1987.846] (-1993.936) -- 0:00:17
947700 -- (-2005.328) [-1990.917] (-1990.161) (-1991.077) * (-1992.958) (-2003.780) [-1982.126] (-1997.120) -- 0:00:17
947800 -- (-2001.307) [-1987.604] (-1992.634) (-2002.314) * (-1992.673) (-2004.784) [-1984.427] (-1998.935) -- 0:00:17
947900 -- (-1989.293) (-1989.815) [-1991.675] (-2006.204) * (-1988.203) (-2006.439) [-1980.671] (-1997.884) -- 0:00:17
948000 -- (-1986.507) (-1992.408) [-1987.827] (-2011.859) * (-1985.763) (-1996.046) [-1992.253] (-2002.142) -- 0:00:17
Average standard deviation of split frequencies: 0.001989
948100 -- [-1984.673] (-1997.995) (-1995.126) (-1999.317) * [-1986.750] (-1998.629) (-1993.690) (-2000.054) -- 0:00:17
948200 -- [-1993.720] (-1998.582) (-1997.489) (-1991.082) * [-1985.225] (-1986.174) (-1993.664) (-1999.176) -- 0:00:16
948300 -- [-1994.376] (-1999.773) (-1996.931) (-1995.295) * (-2001.001) (-1993.106) [-1985.782] (-1998.179) -- 0:00:16
948400 -- [-1987.097] (-1993.297) (-1998.704) (-2012.793) * (-1994.213) (-1989.349) [-1982.515] (-2005.673) -- 0:00:16
948500 -- (-1990.810) [-1992.772] (-2004.196) (-1998.733) * (-1995.534) (-1994.828) [-1981.102] (-2004.061) -- 0:00:16
948600 -- (-1991.575) [-1988.867] (-2005.993) (-1992.702) * (-1990.133) (-2003.903) [-1982.871] (-2000.690) -- 0:00:16
948700 -- [-1992.688] (-1992.689) (-2002.891) (-1986.671) * [-1992.100] (-2010.587) (-1981.721) (-1998.766) -- 0:00:16
948800 -- (-1986.610) (-1992.714) (-2001.857) [-1990.351] * (-1990.315) (-2011.528) [-1985.532] (-1996.115) -- 0:00:16
948900 -- [-1983.131] (-1995.281) (-1993.762) (-1994.532) * (-1994.619) (-2006.805) [-1984.779] (-2002.959) -- 0:00:16
949000 -- (-1984.067) [-1993.007] (-1994.020) (-1994.298) * (-1999.009) (-2002.043) [-1989.957] (-1990.726) -- 0:00:16
Average standard deviation of split frequencies: 0.002001
949100 -- [-1981.731] (-1995.025) (-1988.331) (-2007.628) * (-1997.425) (-1993.256) [-1989.370] (-1992.384) -- 0:00:16
949200 -- [-1982.488] (-1996.051) (-1987.137) (-2000.572) * (-1994.367) (-1999.088) (-1985.418) [-1985.821] -- 0:00:16
949300 -- [-1983.491] (-1996.606) (-1987.119) (-1997.877) * (-1993.979) (-1995.023) [-1978.916] (-1995.001) -- 0:00:16
949400 -- (-1983.363) (-2006.880) (-1983.164) [-1989.863] * (-2001.874) (-1994.762) [-1983.434] (-1985.026) -- 0:00:16
949500 -- [-1982.123] (-2008.624) (-1989.292) (-1990.736) * (-1994.979) (-1996.189) [-1985.817] (-1989.915) -- 0:00:16
949600 -- [-1982.083] (-1999.764) (-1986.864) (-1995.794) * (-1991.628) (-1995.579) [-1983.219] (-1991.306) -- 0:00:16
949700 -- (-1983.645) (-1996.108) [-1989.227] (-1996.260) * (-1987.895) (-1997.493) [-1983.796] (-1985.979) -- 0:00:16
949800 -- (-1995.493) (-1999.046) (-1991.100) [-1997.906] * (-1987.434) (-1995.861) (-1999.352) [-1987.697] -- 0:00:16
949900 -- (-1989.289) (-2002.978) (-1993.247) [-1985.337] * (-1995.626) (-1992.909) [-1978.317] (-1992.065) -- 0:00:16
950000 -- [-1985.590] (-1992.278) (-1993.151) (-1990.526) * (-1981.944) (-1993.521) [-1980.449] (-1997.047) -- 0:00:16
Average standard deviation of split frequencies: 0.002027
950100 -- [-1980.018] (-1989.497) (-1997.282) (-1998.470) * [-1987.025] (-1998.086) (-1988.324) (-1993.969) -- 0:00:16
950200 -- [-1981.895] (-1998.407) (-1994.934) (-1999.350) * (-1988.444) (-1996.840) [-1984.232] (-1991.173) -- 0:00:16
950300 -- [-1985.003] (-1988.835) (-1998.608) (-2005.522) * [-1991.988] (-1990.249) (-1979.015) (-1993.395) -- 0:00:16
950400 -- [-1980.254] (-1985.201) (-1997.755) (-2003.916) * (-1994.998) (-1995.783) [-1981.710] (-1993.537) -- 0:00:16
950500 -- [-1985.246] (-1985.986) (-2002.478) (-2006.571) * (-1990.792) (-1996.016) [-1983.434] (-1996.843) -- 0:00:16
950600 -- (-1983.264) [-1986.775] (-1991.398) (-2000.501) * (-1995.009) (-1992.298) [-1982.590] (-1997.885) -- 0:00:16
950700 -- (-1981.617) (-1990.439) [-1989.422] (-1997.224) * (-1998.548) (-2000.054) [-1981.299] (-1994.896) -- 0:00:16
950800 -- [-1981.686] (-1998.750) (-1993.256) (-1995.349) * (-1996.151) [-1988.397] (-1984.107) (-2002.434) -- 0:00:16
950900 -- [-1983.509] (-2001.134) (-1996.240) (-1996.792) * (-1994.521) (-1998.273) [-1983.956] (-2000.970) -- 0:00:16
951000 -- [-1985.450] (-2001.537) (-1989.318) (-1997.829) * (-1996.186) (-1993.243) [-1986.773] (-2003.995) -- 0:00:16
Average standard deviation of split frequencies: 0.001954
951100 -- [-1984.092] (-1987.495) (-1991.778) (-1996.467) * (-1995.545) (-1992.881) [-1985.996] (-2001.230) -- 0:00:16
951200 -- [-1983.312] (-1990.908) (-1994.152) (-1993.399) * (-1999.819) [-1995.298] (-1985.947) (-1999.060) -- 0:00:16
951300 -- (-1993.278) (-1991.178) [-1993.379] (-1990.844) * (-1996.867) (-1997.538) [-1985.657] (-1998.438) -- 0:00:15
951400 -- (-1988.885) (-1992.251) [-1993.442] (-1995.775) * (-2003.291) (-1991.649) [-1984.747] (-2001.433) -- 0:00:15
951500 -- [-1986.494] (-1997.422) (-1993.458) (-1994.483) * (-2002.487) (-1995.959) [-1984.664] (-2001.519) -- 0:00:15
951600 -- (-1999.268) (-1999.723) (-1986.575) [-1994.858] * (-1994.231) (-2001.162) (-1984.030) [-1992.963] -- 0:00:15
951700 -- [-1993.421] (-1999.244) (-1996.204) (-1998.690) * (-1993.183) (-1995.846) [-1987.456] (-1998.112) -- 0:00:15
951800 -- [-1987.825] (-1997.183) (-1992.295) (-2000.683) * (-1987.656) (-1995.129) [-1982.917] (-2006.111) -- 0:00:15
951900 -- [-1989.225] (-2000.498) (-1999.805) (-1998.353) * (-1988.870) (-1992.330) [-1986.469] (-1997.608) -- 0:00:15
952000 -- (-1987.421) [-1994.460] (-1997.275) (-2002.266) * (-1996.563) (-1991.594) [-1984.538] (-2004.727) -- 0:00:15
Average standard deviation of split frequencies: 0.002108
952100 -- [-1993.131] (-1994.272) (-1998.706) (-1997.527) * (-1988.504) (-1993.005) [-1992.129] (-2004.948) -- 0:00:15
952200 -- (-1992.905) (-1995.832) (-1991.097) [-1994.115] * (-1992.664) (-1991.682) [-1983.689] (-2005.368) -- 0:00:15
952300 -- (-1995.063) (-1999.026) [-1991.125] (-1990.153) * [-1997.945] (-1992.174) (-1987.992) (-1998.449) -- 0:00:15
952400 -- (-1993.942) (-1994.788) [-1986.439] (-1989.687) * (-1992.219) [-1991.224] (-1986.731) (-1994.992) -- 0:00:15
952500 -- (-1987.441) (-1992.930) [-1987.360] (-1991.662) * [-1990.734] (-1993.162) (-1987.602) (-1998.470) -- 0:00:15
952600 -- (-1987.124) (-1999.647) [-1988.050] (-1991.258) * (-1995.004) (-2006.468) [-1980.049] (-2003.658) -- 0:00:15
952700 -- [-1989.153] (-1999.313) (-1993.429) (-1993.458) * (-1995.163) (-1998.881) [-1981.809] (-1991.780) -- 0:00:15
952800 -- (-1989.634) (-1994.423) [-1991.741] (-1989.318) * (-2000.020) (-2003.454) [-1983.411] (-1992.793) -- 0:00:15
952900 -- (-1995.007) (-1993.732) (-1992.083) [-1991.854] * (-1997.487) (-2006.877) [-1986.252] (-2000.302) -- 0:00:15
953000 -- (-1995.473) [-1985.926] (-2000.052) (-1987.294) * (-1992.943) (-2007.992) [-1991.036] (-2006.526) -- 0:00:15
Average standard deviation of split frequencies: 0.002077
953100 -- (-1989.356) (-1997.368) (-2003.748) [-1993.675] * (-1993.910) (-2014.508) [-1988.283] (-2000.945) -- 0:00:15
953200 -- [-1986.365] (-1995.943) (-2017.599) (-1990.898) * (-1986.389) (-2017.786) (-1998.564) [-1998.837] -- 0:00:15
953300 -- [-1987.147] (-1987.558) (-2009.130) (-1993.643) * [-1984.903] (-2003.193) (-2000.295) (-1994.476) -- 0:00:15
953400 -- (-1988.711) [-1985.729] (-2001.322) (-1998.533) * [-1985.595] (-2012.430) (-1990.575) (-1995.686) -- 0:00:15
953500 -- (-1989.208) [-1986.150] (-1994.053) (-1996.970) * [-1988.541] (-2019.673) (-1990.382) (-1992.825) -- 0:00:15
953600 -- (-1988.780) (-1988.142) (-2001.701) [-1991.336] * [-1985.825] (-2017.690) (-1988.511) (-1992.912) -- 0:00:15
953700 -- (-1995.462) (-1990.850) (-2002.163) [-1987.768] * [-1982.288] (-2000.442) (-1987.938) (-1989.295) -- 0:00:15
953800 -- (-1998.762) (-1994.044) (-1998.037) [-1992.449] * [-1985.856] (-2004.252) (-1988.243) (-1989.115) -- 0:00:15
953900 -- (-1997.934) (-1990.956) [-1993.158] (-1990.795) * [-1990.870] (-2007.400) (-1993.639) (-1993.478) -- 0:00:15
954000 -- (-1993.129) (-1992.765) [-1987.771] (-1997.750) * (-1985.409) (-1994.683) [-1984.008] (-1990.067) -- 0:00:15
Average standard deviation of split frequencies: 0.002019
954100 -- (-1994.820) [-1989.537] (-1990.406) (-1987.298) * [-1985.460] (-1990.041) (-1983.841) (-2005.181) -- 0:00:15
954200 -- (-1999.922) (-1993.188) (-1992.675) [-1987.570] * (-1995.234) (-1990.703) [-1985.910] (-2002.303) -- 0:00:15
954300 -- [-1995.666] (-1994.822) (-1993.494) (-1995.162) * (-1995.679) (-1991.184) (-1982.143) [-1999.143] -- 0:00:14
954400 -- (-1999.485) (-1994.422) [-1990.124] (-1998.985) * (-2001.219) [-1989.963] (-1987.488) (-1998.676) -- 0:00:14
954500 -- (-1999.547) [-2001.229] (-1987.963) (-1996.933) * (-1998.053) (-1986.312) (-1989.739) [-1989.715] -- 0:00:14
954600 -- (-2004.935) (-2003.438) [-1987.664] (-1999.451) * (-1995.460) (-1992.332) (-1989.631) [-1983.943] -- 0:00:14
954700 -- (-1998.571) [-1997.058] (-1990.070) (-1997.493) * (-1995.578) (-1990.501) (-1990.119) [-1985.914] -- 0:00:14
954800 -- (-2000.930) (-1996.852) [-1986.416] (-1996.046) * (-1999.542) [-1983.651] (-1993.493) (-1987.305) -- 0:00:14
954900 -- (-2000.175) (-1993.470) [-1989.605] (-1997.623) * (-1996.461) (-1994.405) (-1997.596) [-1989.540] -- 0:00:14
955000 -- (-1986.900) (-1998.840) [-1989.024] (-1997.795) * (-2006.276) (-1999.164) [-1996.165] (-1988.755) -- 0:00:14
Average standard deviation of split frequencies: 0.002073
955100 -- [-1986.384] (-1992.585) (-1993.559) (-1998.981) * (-2000.475) (-1990.988) (-1990.142) [-1986.690] -- 0:00:14
955200 -- (-1993.036) [-1991.419] (-1990.648) (-1991.338) * (-1991.992) [-1989.631] (-1987.762) (-1997.029) -- 0:00:14
955300 -- (-1999.624) [-1993.423] (-1993.056) (-1990.252) * (-1994.667) [-1994.004] (-1986.900) (-1996.524) -- 0:00:14
955400 -- (-2003.602) (-2000.754) (-1993.199) [-1986.118] * (-1991.578) (-1991.150) (-1985.615) [-1994.170] -- 0:00:14
955500 -- (-2001.601) (-2018.271) (-1986.897) [-1987.082] * (-1994.616) (-1987.054) [-1986.165] (-1991.253) -- 0:00:14
955600 -- (-2004.318) (-2006.929) [-1988.858] (-1996.781) * [-1995.514] (-1985.808) (-1990.292) (-1990.892) -- 0:00:14
955700 -- (-1998.451) (-1998.108) [-1986.023] (-1997.364) * (-1991.288) (-1997.822) (-1984.868) [-1982.716] -- 0:00:14
955800 -- (-2008.462) (-2001.463) [-1986.379] (-1993.686) * (-1988.971) (-1997.175) (-1985.876) [-1984.525] -- 0:00:14
955900 -- (-2000.055) (-1997.015) (-1985.998) [-1984.299] * (-1996.545) (-1993.319) [-1990.229] (-1989.218) -- 0:00:14
956000 -- (-1994.720) (-2002.619) [-1990.307] (-1990.978) * (-1989.205) (-2000.092) [-1985.202] (-1992.197) -- 0:00:14
Average standard deviation of split frequencies: 0.001958
956100 -- (-1992.120) (-1996.489) [-1986.692] (-1990.466) * (-1993.495) (-1993.648) [-1984.910] (-1983.569) -- 0:00:14
956200 -- [-1986.557] (-1996.698) (-1995.066) (-1984.929) * (-1999.209) (-1994.672) (-1983.738) [-1982.083] -- 0:00:14
956300 -- [-1986.574] (-2008.030) (-1989.379) (-1985.531) * (-1998.651) (-2000.186) (-1980.825) [-1982.480] -- 0:00:14
956400 -- (-1987.343) (-2006.254) (-1991.938) [-1987.033] * (-2000.524) (-1996.970) [-1983.257] (-1985.100) -- 0:00:14
956500 -- (-1991.164) (-2014.068) [-1987.906] (-1986.166) * (-1993.065) (-1993.708) (-1983.748) [-1981.600] -- 0:00:14
956600 -- (-1992.205) (-2006.853) [-1985.417] (-1989.077) * (-1989.140) (-1989.179) [-1979.871] (-1981.485) -- 0:00:14
956700 -- (-1995.142) (-1995.378) [-1985.988] (-1991.024) * (-1991.634) (-1992.929) (-1985.777) [-1982.553] -- 0:00:14
956800 -- (-1993.978) (-1993.425) (-1986.629) [-1993.173] * (-1997.002) (-1998.040) (-1984.831) [-1978.890] -- 0:00:14
956900 -- (-1994.260) [-1990.768] (-1987.082) (-1998.950) * (-2001.220) (-1995.997) (-1981.343) [-1979.766] -- 0:00:14
957000 -- (-1997.995) [-1986.738] (-1986.656) (-1993.316) * (-1990.669) (-1994.482) [-1984.192] (-1982.320) -- 0:00:14
Average standard deviation of split frequencies: 0.001928
957100 -- (-1999.859) [-1989.826] (-1994.113) (-1990.013) * (-1994.043) (-1994.788) [-1979.613] (-1985.013) -- 0:00:14
957200 -- (-1998.678) [-1984.555] (-2000.600) (-1989.902) * (-1987.625) (-2000.865) [-1979.743] (-1995.304) -- 0:00:14
957300 -- (-1996.172) [-1985.317] (-1993.079) (-1990.730) * (-1986.170) (-1998.339) [-1978.399] (-1987.281) -- 0:00:14
957400 -- (-1999.948) (-1988.973) [-1988.980] (-2003.210) * [-1989.899] (-1990.163) (-1984.813) (-1989.676) -- 0:00:13
957500 -- (-2010.200) [-1988.686] (-1993.803) (-1996.517) * (-1988.573) [-1987.451] (-1981.101) (-2001.406) -- 0:00:13
957600 -- (-2001.897) (-1988.096) [-1989.791] (-1997.830) * [-1988.625] (-1992.260) (-1984.834) (-1994.928) -- 0:00:13
957700 -- (-1998.268) [-1989.706] (-1992.929) (-1999.039) * (-1986.244) (-1984.936) [-1981.133] (-1991.293) -- 0:00:13
957800 -- (-1999.624) (-1994.220) [-1992.058] (-1994.315) * (-1997.041) (-1995.081) [-1983.315] (-1991.278) -- 0:00:13
957900 -- (-1996.554) (-2000.506) [-1988.071] (-1992.660) * [-1990.349] (-1992.603) (-1983.688) (-1995.688) -- 0:00:13
958000 -- [-1991.804] (-1995.401) (-1987.485) (-2002.271) * (-1992.247) (-1998.891) [-1981.665] (-1991.112) -- 0:00:13
Average standard deviation of split frequencies: 0.001940
958100 -- [-1992.297] (-2000.274) (-1988.397) (-2005.059) * (-1988.156) (-2008.362) [-1983.599] (-1993.675) -- 0:00:13
958200 -- (-1997.632) (-2009.494) [-1983.030] (-1998.815) * (-1992.360) (-2002.947) [-1985.721] (-1987.900) -- 0:00:13
958300 -- (-2001.467) (-2002.458) [-1983.736] (-1996.300) * (-1996.710) (-1997.412) [-1987.069] (-1990.432) -- 0:00:13
958400 -- (-2005.192) (-2004.866) [-1987.711] (-1988.615) * (-1993.849) (-1996.847) [-1983.637] (-1985.075) -- 0:00:13
958500 -- (-1994.568) (-2013.408) [-1984.648] (-1986.038) * (-1993.379) (-1988.894) [-1983.814] (-1985.108) -- 0:00:13
958600 -- (-1993.145) (-1999.668) (-1987.256) [-1986.269] * (-1990.083) (-1997.131) [-1985.545] (-1998.374) -- 0:00:13
958700 -- (-1996.600) (-1996.075) (-1988.193) [-1988.945] * (-1993.126) (-1988.701) [-1992.718] (-2008.121) -- 0:00:13
958800 -- (-1983.012) (-1988.176) [-1984.660] (-1989.419) * [-1990.127] (-1986.426) (-1990.218) (-2004.110) -- 0:00:13
958900 -- (-1984.569) (-1988.466) (-1988.821) [-1988.577] * (-1997.556) (-1994.352) [-1984.793] (-1994.657) -- 0:00:13
959000 -- [-1985.092] (-1988.963) (-1993.158) (-1993.789) * (-1993.524) (-1989.327) [-1983.233] (-1989.559) -- 0:00:13
Average standard deviation of split frequencies: 0.001882
959100 -- [-1985.109] (-1988.391) (-1986.749) (-1994.806) * (-1991.175) (-1987.724) [-1983.758] (-1993.244) -- 0:00:13
959200 -- (-1989.785) (-1989.669) [-1989.869] (-1996.110) * (-1998.021) (-1985.022) (-1986.570) [-1990.789] -- 0:00:13
959300 -- (-1992.376) (-1989.385) [-1990.738] (-1996.863) * (-1994.992) [-1984.420] (-1996.268) (-1989.295) -- 0:00:13
959400 -- (-1994.665) (-1987.035) [-1989.587] (-2000.212) * (-1991.468) (-1988.807) [-1985.810] (-2000.989) -- 0:00:13
959500 -- (-1999.584) (-1992.183) [-1987.429] (-2001.956) * [-1990.180] (-1995.431) (-2001.421) (-2000.229) -- 0:00:13
959600 -- (-1992.736) (-1991.111) [-1986.027] (-1999.543) * (-1988.950) (-1998.816) [-1987.524] (-1992.967) -- 0:00:13
959700 -- (-1992.752) (-1990.206) [-1984.304] (-1999.476) * [-1990.511] (-1994.688) (-1988.621) (-1996.443) -- 0:00:13
959800 -- (-1994.829) (-1998.846) [-1983.118] (-1999.714) * (-1994.818) (-2012.856) [-1982.611] (-2003.000) -- 0:00:13
959900 -- (-1993.914) (-2001.021) [-1982.225] (-1987.555) * (-1993.873) (-2000.257) [-1984.837] (-1994.606) -- 0:00:13
960000 -- (-1989.374) (-1996.783) (-1989.277) [-1985.279] * (-1995.796) (-1997.719) [-1987.258] (-1985.173) -- 0:00:13
Average standard deviation of split frequencies: 0.001936
960100 -- (-1994.026) (-1999.042) [-1987.515] (-1991.002) * (-2000.818) (-2000.270) (-1984.270) [-1983.916] -- 0:00:13
960200 -- (-2006.757) (-1996.832) [-1988.287] (-1996.949) * (-2001.195) (-1998.699) (-1983.743) [-1983.636] -- 0:00:13
960300 -- (-2017.816) (-1994.736) (-1983.958) [-1994.934] * (-1996.970) (-1994.607) [-1983.892] (-1987.168) -- 0:00:13
960400 -- (-2020.459) (-1990.887) [-1983.286] (-1993.879) * (-1993.501) (-1997.409) (-1987.007) [-1983.511] -- 0:00:12
960500 -- (-2004.404) (-1988.368) [-1985.367] (-1994.547) * (-2004.291) (-1996.717) (-1989.629) [-1986.773] -- 0:00:12
960600 -- (-2002.158) (-1993.976) (-1984.969) [-1994.268] * (-1999.472) (-1996.243) (-1989.565) [-1982.955] -- 0:00:12
960700 -- (-1996.490) (-1998.454) [-1983.630] (-1993.744) * (-1988.535) (-1993.855) (-1984.602) [-1982.155] -- 0:00:12
960800 -- (-1995.645) (-1997.709) [-1980.865] (-1993.709) * (-1989.929) (-1994.563) (-1984.006) [-1980.187] -- 0:00:12
960900 -- (-1993.980) (-1997.546) [-1991.820] (-1989.355) * (-2000.349) (-1992.894) [-1982.898] (-1984.900) -- 0:00:12
961000 -- (-1992.666) (-1997.427) (-1987.524) [-1989.767] * (-1993.710) [-1986.935] (-1989.807) (-1989.133) -- 0:00:12
Average standard deviation of split frequencies: 0.001920
961100 -- (-1988.084) (-1995.026) [-1986.764] (-1991.532) * (-2003.634) (-1983.539) [-1986.956] (-1996.442) -- 0:00:12
961200 -- (-1995.271) (-2001.929) [-1981.809] (-1989.835) * (-2009.039) (-1992.618) [-1981.232] (-1993.958) -- 0:00:12
961300 -- (-1990.690) (-1994.330) [-1989.411] (-1989.305) * (-1999.654) (-1990.858) [-1983.075] (-1990.262) -- 0:00:12
961400 -- (-2000.115) (-2005.157) [-1994.084] (-1993.246) * (-2007.921) (-2002.852) (-1985.635) [-1990.597] -- 0:00:12
961500 -- [-1996.903] (-1994.359) (-1994.989) (-1997.587) * (-2000.929) (-1994.742) [-1981.122] (-1985.558) -- 0:00:12
961600 -- (-1989.667) (-2000.386) (-1988.379) [-1989.863] * (-1998.109) (-1992.547) (-1978.552) [-1987.526] -- 0:00:12
961700 -- (-1992.290) (-2004.767) [-1982.259] (-1988.092) * (-1993.626) (-2000.109) (-1988.184) [-1983.511] -- 0:00:12
961800 -- [-1990.173] (-1993.500) (-1983.999) (-1996.048) * (-1988.281) (-2002.346) (-1981.583) [-1989.961] -- 0:00:12
961900 -- (-1988.296) (-1987.791) [-1979.300] (-2001.402) * [-1984.810] (-1994.177) (-1992.053) (-2002.739) -- 0:00:12
962000 -- (-1996.053) (-1984.061) [-1979.870] (-1991.118) * [-1983.615] (-1994.947) (-1987.633) (-1986.292) -- 0:00:12
Average standard deviation of split frequencies: 0.001988
962100 -- (-1997.377) [-1982.129] (-1981.244) (-1992.521) * [-1982.345] (-1991.161) (-1985.024) (-1984.907) -- 0:00:12
962200 -- (-1989.891) (-1988.935) [-1979.962] (-1997.863) * (-1980.195) (-1991.957) (-1990.514) [-1991.491] -- 0:00:12
962300 -- (-1992.755) (-1990.616) [-1983.361] (-1997.076) * [-1982.956] (-1992.489) (-1989.651) (-1995.675) -- 0:00:12
962400 -- (-1993.476) (-1994.522) [-1982.587] (-1991.158) * (-1987.821) (-1990.991) [-1980.119] (-2003.930) -- 0:00:12
962500 -- (-1998.108) (-1994.247) (-1985.786) [-1988.309] * (-1986.277) (-1991.404) [-1993.462] (-1991.542) -- 0:00:12
962600 -- (-2003.610) (-1990.098) [-1985.183] (-2004.014) * [-1982.842] (-1998.504) (-1995.086) (-1995.424) -- 0:00:12
962700 -- (-1996.338) [-1990.724] (-1983.132) (-1990.372) * (-1982.584) (-1995.779) (-1996.166) [-1989.053] -- 0:00:12
962800 -- (-1997.784) (-1988.380) [-1986.248] (-1990.090) * [-1984.059] (-1991.234) (-1999.125) (-1984.771) -- 0:00:12
962900 -- (-2004.326) (-1985.100) (-1986.181) [-1993.624] * (-1985.770) (-1999.244) (-1987.628) [-1983.186] -- 0:00:12
963000 -- (-2004.923) (-1994.043) [-1990.589] (-1985.532) * [-1981.430] (-1999.438) (-1988.744) (-1982.853) -- 0:00:12
Average standard deviation of split frequencies: 0.001986
963100 -- (-1998.238) (-2004.298) [-1986.176] (-1985.891) * (-1985.021) (-1988.963) (-1989.240) [-1981.405] -- 0:00:12
963200 -- (-1999.752) (-2000.149) (-1979.683) [-1990.703] * (-1987.132) (-1996.105) [-1987.514] (-1984.792) -- 0:00:12
963300 -- (-2004.504) [-1991.952] (-1981.745) (-1995.400) * [-1982.849] (-1996.621) (-1991.397) (-1984.090) -- 0:00:12
963400 -- (-1999.399) (-1989.971) [-1983.313] (-1990.962) * (-1987.291) (-1997.937) [-1986.508] (-1981.171) -- 0:00:12
963500 -- (-1997.811) (-1992.106) [-1980.719] (-1993.137) * (-1983.331) (-1998.789) [-1984.699] (-1985.505) -- 0:00:11
963600 -- (-1994.288) (-1985.788) [-1981.156] (-1993.706) * [-1980.978] (-2002.127) (-1980.018) (-1991.923) -- 0:00:11
963700 -- (-1996.342) [-1985.482] (-1984.761) (-2001.300) * [-1979.740] (-2005.723) (-1983.879) (-1990.178) -- 0:00:11
963800 -- (-1990.356) (-1989.609) [-1982.366] (-2001.218) * [-1979.429] (-1996.743) (-1982.608) (-1989.510) -- 0:00:11
963900 -- [-1986.562] (-1990.914) (-1988.002) (-1994.755) * (-1978.211) (-1998.941) [-1985.474] (-1989.128) -- 0:00:11
964000 -- [-1987.378] (-1989.977) (-2002.755) (-1995.095) * (-1987.784) (-1994.982) [-1983.090] (-1983.781) -- 0:00:11
Average standard deviation of split frequencies: 0.002068
964100 -- [-1984.501] (-2001.808) (-1999.861) (-1990.962) * (-1981.051) (-1993.903) (-1983.061) [-1981.395] -- 0:00:11
964200 -- (-1987.974) (-1994.624) (-1998.445) [-1985.990] * (-1983.592) (-1997.008) [-1987.037] (-1986.593) -- 0:00:11
964300 -- [-1988.445] (-1995.690) (-2002.681) (-1990.916) * (-1988.278) (-2004.764) (-1989.768) [-1983.690] -- 0:00:11
964400 -- (-1993.900) (-1996.468) (-1999.711) [-1990.372] * (-1992.791) (-1994.161) (-1989.528) [-1983.532] -- 0:00:11
964500 -- (-1993.925) (-1993.612) (-2003.588) [-1985.408] * (-1987.048) (-1993.856) (-1986.732) [-1989.816] -- 0:00:11
964600 -- (-1991.393) [-1986.289] (-2001.508) (-1989.856) * [-1982.217] (-1998.958) (-1987.191) (-1988.254) -- 0:00:11
964700 -- (-1993.219) (-1997.113) (-1996.091) [-1993.083] * [-1984.413] (-1991.534) (-1985.682) (-1989.776) -- 0:00:11
964800 -- (-2001.588) (-2002.270) (-2000.687) [-1998.880] * [-1985.225] (-1994.168) (-1981.784) (-1989.016) -- 0:00:11
964900 -- (-2000.054) (-1995.811) (-1992.330) [-1988.949] * (-1996.191) (-1995.229) [-1978.842] (-1989.684) -- 0:00:11
965000 -- (-1995.195) (-1993.793) (-1993.955) [-1988.944] * (-2004.605) (-1993.300) [-1985.421] (-1991.865) -- 0:00:11
Average standard deviation of split frequencies: 0.001912
965100 -- (-1990.780) (-1995.025) (-1992.074) [-1988.929] * (-1988.637) (-1996.087) [-1984.101] (-1993.285) -- 0:00:11
965200 -- [-1992.980] (-1992.425) (-1997.590) (-1992.762) * [-1985.686] (-1995.397) (-1982.471) (-1985.114) -- 0:00:11
965300 -- [-1988.556] (-1994.012) (-1999.726) (-1995.635) * (-1985.798) (-1996.650) (-1993.249) [-1985.709] -- 0:00:11
965400 -- [-1987.437] (-1993.784) (-2002.420) (-1990.374) * [-1983.738] (-1990.058) (-1992.369) (-1991.034) -- 0:00:11
965500 -- (-1992.362) (-1997.655) [-1997.190] (-1994.155) * [-1984.132] (-1996.898) (-1983.022) (-1998.437) -- 0:00:11
965600 -- [-1987.793] (-1991.284) (-2006.184) (-1991.811) * [-1979.402] (-1993.764) (-1987.470) (-1996.087) -- 0:00:11
965700 -- (-1998.176) [-1993.946] (-2011.095) (-1991.694) * [-1980.738] (-1994.669) (-1983.449) (-1993.982) -- 0:00:11
965800 -- (-1995.109) [-1989.709] (-2006.807) (-1990.798) * [-1981.176] (-1994.561) (-1986.914) (-2001.232) -- 0:00:11
965900 -- [-1991.685] (-1987.700) (-2005.870) (-1992.667) * (-1981.235) [-1986.168] (-1995.225) (-2003.751) -- 0:00:11
966000 -- (-2010.267) [-1986.255] (-1991.551) (-2004.287) * (-1983.819) (-1993.141) (-2003.940) [-1998.055] -- 0:00:11
Average standard deviation of split frequencies: 0.001854
966100 -- (-1995.874) [-1988.502] (-1990.541) (-1998.107) * [-1982.286] (-1986.305) (-1990.450) (-1995.774) -- 0:00:11
966200 -- (-1998.381) [-1985.738] (-1986.742) (-1991.029) * (-1983.429) (-1988.863) [-1986.105] (-2003.394) -- 0:00:11
966300 -- (-2006.076) (-1986.579) [-1983.729] (-1992.600) * (-1986.253) (-2005.410) [-1984.502] (-1995.014) -- 0:00:11
966400 -- (-1997.459) (-1989.681) (-1989.369) [-1990.402] * [-1981.487] (-1999.984) (-1989.272) (-1997.132) -- 0:00:11
966500 -- (-2005.835) [-1982.788] (-1995.148) (-1990.767) * (-1976.696) (-1996.264) [-1983.386] (-1990.288) -- 0:00:10
966600 -- (-2010.373) [-1984.369] (-1985.699) (-1991.882) * [-1978.222] (-1995.060) (-1987.768) (-1988.412) -- 0:00:10
966700 -- (-2007.689) (-1991.096) [-1985.750] (-1995.701) * [-1979.846] (-1993.890) (-1987.919) (-1986.393) -- 0:00:10
966800 -- (-2009.245) (-1990.237) [-1986.896] (-1994.544) * (-1982.372) (-2003.394) (-1980.220) [-1983.334] -- 0:00:10
966900 -- (-2006.554) (-1987.190) [-1990.458] (-1997.944) * (-1980.985) (-2004.448) [-1981.505] (-1991.805) -- 0:00:10
967000 -- (-1996.720) [-1986.562] (-1993.491) (-1992.658) * (-1990.265) (-2012.372) [-1979.636] (-1986.630) -- 0:00:10
Average standard deviation of split frequencies: 0.001936
967100 -- (-2000.196) [-1986.167] (-1996.255) (-1986.874) * (-1986.532) (-2008.985) (-1985.386) [-1986.221] -- 0:00:10
967200 -- (-2003.434) (-1984.988) [-1987.939] (-1989.380) * (-1985.983) (-2013.506) [-1982.358] (-1996.980) -- 0:00:10
967300 -- (-2003.501) (-1986.401) (-1988.957) [-1987.351] * [-1989.683] (-2014.603) (-1979.708) (-1997.559) -- 0:00:10
967400 -- (-1998.895) (-1993.685) [-1989.129] (-1988.119) * [-1986.937] (-2004.847) (-1983.447) (-1997.295) -- 0:00:10
967500 -- (-1998.473) [-1986.862] (-1993.564) (-1989.478) * [-1986.873] (-2001.914) (-1993.938) (-1989.220) -- 0:00:10
967600 -- (-1995.232) (-1985.520) (-1990.735) [-1985.254] * [-1985.288] (-1998.039) (-1985.411) (-1995.177) -- 0:00:10
967700 -- (-1998.142) [-1987.319] (-1997.034) (-1982.166) * [-1982.546] (-1991.366) (-1986.023) (-1998.422) -- 0:00:10
967800 -- [-1987.797] (-1992.058) (-2004.009) (-1983.239) * [-1985.790] (-1993.563) (-1989.421) (-2007.507) -- 0:00:10
967900 -- (-1991.143) (-1991.626) (-1999.290) [-1987.488] * (-1983.551) (-1994.796) [-1993.801] (-2013.625) -- 0:00:10
968000 -- (-1989.162) (-1991.199) (-1999.865) [-1984.219] * [-1978.698] (-1992.145) (-1996.214) (-2002.211) -- 0:00:10
Average standard deviation of split frequencies: 0.001906
968100 -- [-1995.542] (-1996.893) (-1997.427) (-1987.366) * [-1978.246] (-1989.127) (-1998.379) (-1997.573) -- 0:00:10
968200 -- [-1990.383] (-1998.769) (-1999.523) (-1987.049) * (-1981.418) (-1989.069) [-1985.541] (-1999.943) -- 0:00:10
968300 -- (-1997.032) (-1996.563) (-1997.369) [-1985.763] * (-1981.130) (-1991.272) (-1995.857) [-1988.900] -- 0:00:10
968400 -- (-1997.411) (-2006.427) (-1991.582) [-1982.901] * (-1991.190) (-1986.932) (-1990.115) [-1985.325] -- 0:00:10
968500 -- (-1993.758) (-1994.855) (-1990.396) [-1986.138] * (-1991.503) [-1986.461] (-1990.115) (-1989.869) -- 0:00:10
968600 -- (-1994.552) [-1988.306] (-1984.954) (-1985.397) * [-1988.062] (-1989.286) (-1987.413) (-1997.095) -- 0:00:10
968700 -- (-1986.589) (-1987.785) (-1984.666) [-1989.231] * (-1998.497) (-1990.992) [-1985.810] (-1988.393) -- 0:00:10
968800 -- (-1990.100) [-1987.081] (-1990.180) (-1994.400) * (-1995.853) (-1989.688) (-1981.446) [-1984.154] -- 0:00:10
968900 -- (-1993.949) [-1988.316] (-1985.249) (-1991.495) * (-1989.912) (-1990.469) [-1982.805] (-1984.464) -- 0:00:10
969000 -- (-2006.087) (-1989.903) [-1984.495] (-1993.823) * (-1987.194) (-2001.517) [-1979.524] (-1982.832) -- 0:00:10
Average standard deviation of split frequencies: 0.001918
969100 -- (-2002.318) (-1986.167) [-1984.701] (-1993.085) * (-1992.813) (-2006.145) [-1981.082] (-1986.992) -- 0:00:10
969200 -- (-2000.986) (-1991.793) (-1984.559) [-1993.058] * (-1990.980) (-2010.355) [-1982.967] (-1988.235) -- 0:00:10
969300 -- (-1993.701) (-1989.727) [-1989.231] (-1992.250) * (-1992.138) (-2009.417) (-1988.978) [-1988.636] -- 0:00:10
969400 -- (-1997.914) (-1992.878) [-1984.995] (-1994.232) * (-1987.545) (-2001.722) [-1987.151] (-1980.007) -- 0:00:10
969500 -- (-1996.479) (-1989.510) [-1985.122] (-1996.654) * (-1988.108) (-2003.047) (-1992.133) [-1982.147] -- 0:00:10
969600 -- (-1990.620) (-1987.717) [-1981.935] (-1996.757) * (-1989.941) [-1996.496] (-1989.454) (-1990.260) -- 0:00:09
969700 -- (-1992.932) (-1991.293) [-1985.039] (-1996.052) * (-1987.722) (-2005.966) (-1992.634) [-1991.917] -- 0:00:09
969800 -- [-1993.262] (-1993.669) (-1983.935) (-1997.477) * [-1983.552] (-2004.637) (-1989.632) (-1995.577) -- 0:00:09
969900 -- (-2001.288) (-1993.231) [-1985.677] (-1993.220) * [-1982.860] (-2005.941) (-1995.176) (-1989.844) -- 0:00:09
970000 -- (-2002.562) (-1995.623) [-1983.946] (-1994.833) * (-1990.474) (-2001.661) (-1999.230) [-1987.724] -- 0:00:09
Average standard deviation of split frequencies: 0.001874
970100 -- (-1998.277) (-1995.596) [-1985.368] (-1989.995) * (-1989.733) (-1992.203) (-1995.667) [-1989.871] -- 0:00:09
970200 -- (-1990.792) (-1999.401) [-1986.267] (-1997.009) * [-1985.167] (-2003.257) (-1989.155) (-1985.269) -- 0:00:09
970300 -- (-1994.317) (-2012.229) [-1988.135] (-1988.191) * [-1980.083] (-2000.389) (-1984.734) (-1990.648) -- 0:00:09
970400 -- (-2008.691) (-1999.844) (-1990.140) [-1982.441] * [-1981.050] (-1991.285) (-1984.884) (-1998.441) -- 0:00:09
970500 -- [-1999.778] (-1996.147) (-1990.473) (-1990.429) * [-1983.514] (-1992.832) (-1989.985) (-1991.187) -- 0:00:09
970600 -- (-2000.201) (-1991.699) [-1986.355] (-1987.724) * [-1983.810] (-1996.049) (-1986.012) (-1990.592) -- 0:00:09
970700 -- (-1992.046) (-1993.178) [-1980.080] (-1985.906) * [-1982.176] (-1994.730) (-1991.689) (-1987.313) -- 0:00:09
970800 -- (-1999.095) (-2000.738) [-1986.913] (-1987.810) * (-1980.969) (-1992.854) (-1989.430) [-1983.504] -- 0:00:09
970900 -- (-2002.215) (-2001.902) (-1990.059) [-1988.776] * [-1985.544] (-1992.453) (-1993.014) (-1984.047) -- 0:00:09
971000 -- (-1996.989) (-1994.276) [-1981.921] (-1986.989) * (-1987.484) (-1992.383) (-1990.538) [-1983.555] -- 0:00:09
Average standard deviation of split frequencies: 0.001844
971100 -- (-1995.302) (-2000.553) (-1986.160) [-1985.881] * (-1991.637) (-1992.742) [-1986.270] (-1990.761) -- 0:00:09
971200 -- [-1992.482] (-2000.709) (-1998.878) (-1988.833) * [-1986.626] (-1990.906) (-1982.587) (-1989.257) -- 0:00:09
971300 -- (-2002.461) (-1996.578) [-1986.305] (-1990.791) * (-1991.716) (-1997.266) (-1984.706) [-1987.693] -- 0:00:09
971400 -- (-1996.249) (-1996.801) (-1986.014) [-1989.080] * (-1992.003) (-2000.929) [-1981.307] (-1984.870) -- 0:00:09
971500 -- (-1995.418) (-1995.090) [-1982.422] (-1997.029) * (-1990.077) (-1993.980) [-1979.744] (-1987.148) -- 0:00:09
971600 -- (-1992.907) [-1986.831] (-1986.812) (-1992.580) * (-1985.032) (-2002.729) [-1981.870] (-1983.810) -- 0:00:09
971700 -- (-1997.550) (-2000.287) (-1987.584) [-1995.859] * (-1989.067) (-1996.339) [-1977.707] (-1994.131) -- 0:00:09
971800 -- (-2000.483) (-2000.854) [-1984.471] (-1989.882) * [-1987.973] (-1991.702) (-1980.578) (-1992.577) -- 0:00:09
971900 -- (-1993.323) (-1990.357) [-1988.100] (-1991.578) * (-2001.790) (-1991.473) [-1979.403] (-1998.544) -- 0:00:09
972000 -- (-1997.775) (-1998.560) [-1988.074] (-1993.500) * (-1995.198) (-1990.972) [-1980.472] (-1994.956) -- 0:00:09
Average standard deviation of split frequencies: 0.001898
972100 -- (-1997.141) (-2009.395) [-1991.995] (-1998.695) * (-1990.711) (-1993.614) [-1983.993] (-1989.550) -- 0:00:09
972200 -- (-2002.014) (-2001.820) [-1989.417] (-1992.405) * [-1985.162] (-1999.355) (-1984.972) (-1986.039) -- 0:00:09
972300 -- (-1998.070) (-1998.242) [-1986.250] (-1992.091) * (-1991.444) (-1990.601) (-1988.022) [-1983.597] -- 0:00:09
972400 -- (-1995.060) (-1997.781) [-1982.792] (-1992.830) * (-1984.054) (-1994.030) (-1984.856) [-1986.422] -- 0:00:09
972500 -- (-1993.136) (-1995.679) [-1983.144] (-1997.929) * (-1991.450) (-1988.641) (-1982.355) [-1981.304] -- 0:00:09
972600 -- (-1996.095) [-1991.981] (-1984.548) (-1990.831) * (-1993.831) (-1988.388) [-1979.469] (-1983.885) -- 0:00:08
972700 -- (-1997.972) (-1994.874) [-1986.389] (-1986.491) * (-1993.212) (-1992.481) (-1987.530) [-1984.943] -- 0:00:08
972800 -- (-1996.406) (-1996.122) (-1990.093) [-1987.603] * (-1997.216) (-1996.663) [-1980.792] (-1986.296) -- 0:00:08
972900 -- (-2000.042) (-1997.248) (-1990.381) [-1985.610] * (-1996.462) (-1994.464) [-1980.086] (-1991.343) -- 0:00:08
973000 -- (-1998.771) (-1989.398) (-1985.029) [-1984.818] * (-2000.753) (-1990.647) [-1977.089] (-1999.534) -- 0:00:08
Average standard deviation of split frequencies: 0.002062
973100 -- (-2000.686) [-1988.441] (-1989.719) (-1985.586) * (-2000.302) (-1993.222) [-1977.429] (-1999.066) -- 0:00:08
973200 -- (-2006.664) [-1983.013] (-1991.866) (-1987.173) * (-1998.317) (-1996.653) [-1980.697] (-2007.797) -- 0:00:08
973300 -- (-1999.627) [-1987.569] (-1993.517) (-1986.833) * (-1989.581) (-1991.395) [-1978.405] (-1995.971) -- 0:00:08
973400 -- (-1999.893) (-1991.508) [-1993.214] (-1990.983) * (-1990.186) (-1993.248) [-1980.163] (-1995.620) -- 0:00:08
973500 -- (-1997.102) [-1991.569] (-1999.516) (-1990.970) * (-1988.641) (-2002.082) [-1983.485] (-1996.926) -- 0:00:08
973600 -- (-1998.596) [-1989.283] (-2000.134) (-1994.461) * [-1987.827] (-1993.605) (-1987.465) (-1996.399) -- 0:00:08
973700 -- (-1997.259) [-1988.329] (-1997.371) (-1999.658) * [-1980.750] (-2002.533) (-1990.855) (-1999.713) -- 0:00:08
973800 -- (-1996.580) [-1992.606] (-1999.665) (-2004.972) * [-1983.963] (-2010.233) (-1985.107) (-1995.454) -- 0:00:08
973900 -- [-1997.212] (-1992.888) (-1993.015) (-2004.698) * [-1985.332] (-2000.228) (-1989.253) (-1991.349) -- 0:00:08
974000 -- (-1998.947) [-1984.237] (-1991.706) (-2004.259) * [-1980.520] (-1992.195) (-1982.885) (-2001.839) -- 0:00:08
Average standard deviation of split frequencies: 0.002088
974100 -- (-1994.470) (-1985.809) [-1987.756] (-1999.203) * [-1986.741] (-1992.509) (-1990.576) (-2000.151) -- 0:00:08
974200 -- (-1995.402) (-1988.121) (-1997.242) [-1994.818] * (-1987.820) (-1988.935) [-1985.319] (-1999.670) -- 0:00:08
974300 -- (-2001.940) [-1983.812] (-1990.388) (-1997.236) * (-1987.868) (-1989.375) [-1982.834] (-2009.374) -- 0:00:08
974400 -- (-1997.088) [-1983.382] (-1988.568) (-2000.854) * [-1984.809] (-1994.847) (-1984.184) (-2010.988) -- 0:00:08
974500 -- (-1996.977) [-1983.900] (-1993.300) (-1998.418) * [-1984.529] (-1992.770) (-1983.926) (-2008.806) -- 0:00:08
974600 -- (-1997.235) [-1986.742] (-2001.167) (-2010.333) * [-1990.193] (-1988.356) (-1984.380) (-2001.340) -- 0:00:08
974700 -- (-1995.314) [-1987.818] (-1999.439) (-2002.120) * [-1984.211] (-1989.095) (-1989.129) (-2001.673) -- 0:00:08
974800 -- (-1994.428) (-1989.697) (-1991.345) [-1994.999] * [-1984.304] (-1989.085) (-1991.946) (-1999.703) -- 0:00:08
974900 -- [-1989.185] (-1985.944) (-1994.508) (-1993.166) * [-1982.118] (-1986.950) (-1989.439) (-1996.694) -- 0:00:08
975000 -- [-1989.943] (-1986.844) (-1992.961) (-1998.832) * (-1987.187) (-1988.926) [-1983.575] (-1993.017) -- 0:00:08
Average standard deviation of split frequencies: 0.001989
975100 -- (-1987.960) (-1987.975) [-1993.269] (-1999.404) * (-1991.145) (-1988.619) [-1982.952] (-1993.623) -- 0:00:08
975200 -- (-1990.683) (-1994.076) [-1986.732] (-1998.315) * (-1989.514) (-2005.517) [-1977.128] (-2000.766) -- 0:00:08
975300 -- (-1990.510) [-1985.960] (-1984.636) (-2005.881) * (-1986.871) (-2005.324) [-1976.924] (-2008.126) -- 0:00:08
975400 -- (-1985.470) [-1988.423] (-1983.726) (-1998.409) * (-1990.357) (-1997.786) [-1979.996] (-1995.459) -- 0:00:08
975500 -- [-1982.197] (-1992.344) (-1982.646) (-2000.646) * (-1987.724) (-1999.616) [-1980.933] (-1992.208) -- 0:00:08
975600 -- [-1979.940] (-1996.596) (-1987.934) (-1995.837) * (-1986.877) (-1998.744) [-1979.613] (-2001.269) -- 0:00:08
975700 -- [-1977.119] (-1998.980) (-1990.375) (-1997.991) * (-1985.073) [-1989.250] (-1979.242) (-2004.755) -- 0:00:07
975800 -- [-1982.616] (-1993.544) (-1996.356) (-2012.004) * [-1981.053] (-1994.894) (-1978.594) (-2004.522) -- 0:00:07
975900 -- [-1986.746] (-1998.589) (-2000.243) (-1995.262) * (-1992.064) (-1988.018) (-1982.755) [-1995.378] -- 0:00:07
976000 -- (-1981.074) [-1987.750] (-1992.531) (-1997.542) * (-1992.664) [-1983.705] (-1986.844) (-1994.354) -- 0:00:07
Average standard deviation of split frequencies: 0.002125
976100 -- [-1978.337] (-1994.109) (-2001.153) (-1996.693) * (-1993.645) (-1983.770) [-1978.989] (-2000.655) -- 0:00:07
976200 -- [-1979.329] (-1994.387) (-1995.679) (-1996.462) * (-1985.310) (-1986.890) [-1988.719] (-2004.462) -- 0:00:07
976300 -- [-1981.362] (-1999.773) (-1991.087) (-1986.257) * (-1983.388) (-1986.945) [-1983.159] (-1998.311) -- 0:00:07
976400 -- (-1990.420) (-1992.598) (-1990.679) [-1991.189] * (-1982.972) (-1987.299) [-1979.731] (-1990.810) -- 0:00:07
976500 -- [-1985.798] (-1984.757) (-1991.085) (-1987.961) * [-1978.310] (-2001.249) (-1987.195) (-1986.388) -- 0:00:07
976600 -- (-1983.033) (-1989.569) [-1987.881] (-1998.473) * (-1987.799) (-1993.380) [-1980.259] (-1983.915) -- 0:00:07
976700 -- [-1982.701] (-1992.159) (-1997.638) (-1994.051) * (-1984.167) (-1994.238) (-1987.685) [-1979.720] -- 0:00:07
976800 -- (-1989.077) (-1984.670) [-1991.624] (-2001.004) * [-1981.114] (-1991.256) (-1989.353) (-1981.370) -- 0:00:07
976900 -- [-1984.758] (-1987.840) (-1990.565) (-2002.427) * (-1987.742) (-2000.500) (-1984.478) [-1980.007] -- 0:00:07
977000 -- (-1985.237) (-1991.387) [-1982.179] (-1998.758) * (-1986.683) (-1992.714) (-1990.200) [-1981.143] -- 0:00:07
Average standard deviation of split frequencies: 0.002178
977100 -- (-1987.583) (-1995.136) [-1976.340] (-1993.750) * (-2000.849) (-1997.316) [-1984.488] (-1983.242) -- 0:00:07
977200 -- (-1984.700) (-2001.693) [-1977.473] (-1991.558) * (-2002.675) (-1998.985) (-1987.821) [-1989.048] -- 0:00:07
977300 -- (-1989.175) (-1994.922) [-1977.339] (-1993.175) * (-1993.364) (-1991.418) (-1995.872) [-1982.584] -- 0:00:07
977400 -- [-1982.230] (-1998.863) (-1982.514) (-2001.069) * [-1993.395] (-1995.282) (-1985.614) (-1987.652) -- 0:00:07
977500 -- (-1981.236) (-1999.022) [-1982.508] (-1994.501) * (-1986.536) (-1993.857) [-1982.228] (-1984.617) -- 0:00:07
977600 -- [-1977.843] (-1991.919) (-1988.662) (-1991.220) * (-1986.888) (-1994.649) [-1979.331] (-1981.041) -- 0:00:07
977700 -- (-1981.250) (-1990.644) [-1982.620] (-1989.518) * (-1983.391) (-1992.639) [-1978.760] (-1981.071) -- 0:00:07
977800 -- [-1984.684] (-1995.506) (-1988.460) (-1993.596) * (-1981.125) (-1990.845) (-1978.945) [-1982.916] -- 0:00:07
977900 -- [-1986.530] (-1996.672) (-1986.749) (-2000.955) * [-1978.852] (-1993.457) (-1980.594) (-1982.184) -- 0:00:07
978000 -- [-1987.266] (-1991.191) (-1987.209) (-2007.522) * (-1980.772) (-1994.304) (-1978.707) [-1984.223] -- 0:00:07
Average standard deviation of split frequencies: 0.002217
978100 -- [-1987.017] (-1993.554) (-1981.009) (-2003.275) * (-1981.962) (-1995.656) [-1982.273] (-1988.616) -- 0:00:07
978200 -- (-1994.584) (-1992.347) [-1980.177] (-1999.937) * [-1983.398] (-1996.969) (-1988.230) (-1988.782) -- 0:00:07
978300 -- [-1985.725] (-1988.791) (-1981.542) (-1998.755) * [-1983.718] (-2001.064) (-1988.188) (-1988.537) -- 0:00:07
978400 -- (-1991.878) (-1992.982) [-1983.166] (-2002.203) * (-1983.620) (-1997.717) [-1984.143] (-1989.813) -- 0:00:07
978500 -- (-2006.297) (-2000.448) [-1982.057] (-2005.937) * (-1983.371) (-1996.924) [-1983.388] (-1990.488) -- 0:00:07
978600 -- (-1989.811) (-1998.223) [-1982.064] (-1993.579) * (-1990.661) (-2010.119) [-1981.190] (-1994.075) -- 0:00:07
978700 -- (-1982.142) (-2001.495) [-1982.706] (-1990.357) * (-1996.034) (-2012.439) [-1981.938] (-1991.183) -- 0:00:06
978800 -- [-1980.033] (-1997.747) (-1984.319) (-1993.211) * [-1994.765] (-2009.120) (-1983.820) (-1988.734) -- 0:00:06
978900 -- [-1983.343] (-1995.400) (-1988.030) (-1995.517) * (-1988.278) (-2004.191) [-1981.994] (-1987.170) -- 0:00:06
979000 -- [-1986.422] (-1991.134) (-1993.717) (-2005.839) * (-1983.829) (-2001.100) [-1981.781] (-1987.190) -- 0:00:06
Average standard deviation of split frequencies: 0.002160
979100 -- (-1987.781) (-1996.895) [-1992.170] (-1997.198) * (-1990.923) (-2003.963) [-1982.895] (-1984.852) -- 0:00:06
979200 -- (-1980.350) (-1991.389) [-1987.785] (-2002.215) * (-2000.985) (-1997.973) [-1982.038] (-1996.243) -- 0:00:06
979300 -- (-1987.936) (-1993.072) [-1985.811] (-2006.609) * [-1986.401] (-2001.730) (-1983.251) (-1990.478) -- 0:00:06
979400 -- [-1981.595] (-1993.793) (-1982.017) (-2002.998) * (-1983.032) (-2010.382) [-1985.662] (-1994.626) -- 0:00:06
979500 -- (-1984.622) (-1992.244) [-1979.118] (-1997.515) * [-1984.041] (-1999.740) (-1981.813) (-1987.262) -- 0:00:06
979600 -- (-1984.905) (-1999.115) [-1982.343] (-1992.195) * [-1980.045] (-1999.071) (-1984.807) (-1986.499) -- 0:00:06
979700 -- [-1987.145] (-1995.176) (-1982.646) (-1996.565) * [-1982.073] (-1998.804) (-1986.264) (-1986.859) -- 0:00:06
979800 -- (-1986.179) (-1999.884) [-1985.771] (-1995.922) * (-1987.522) (-1997.041) [-1977.401] (-1998.064) -- 0:00:06
979900 -- (-1994.666) (-1997.272) [-1981.761] (-1998.094) * (-1980.761) (-1996.047) [-1980.191] (-1995.688) -- 0:00:06
980000 -- (-1994.443) (-1995.732) [-1983.506] (-1999.641) * (-1981.289) (-1995.243) [-1980.979] (-1979.340) -- 0:00:06
Average standard deviation of split frequencies: 0.002116
980100 -- (-1994.434) (-1997.393) [-1980.967] (-2000.543) * (-1979.934) (-1994.883) [-1982.337] (-1979.340) -- 0:00:06
980200 -- [-1996.330] (-1996.365) (-1986.478) (-1994.470) * (-1983.946) (-1991.444) (-1983.189) [-1985.497] -- 0:00:06
980300 -- (-1989.814) (-2001.765) [-1992.293] (-1997.452) * (-1979.860) (-1987.500) [-1986.311] (-1984.998) -- 0:00:06
980400 -- (-1991.105) (-2001.072) [-1991.061] (-1991.617) * (-1983.893) [-1988.124] (-1988.175) (-1984.612) -- 0:00:06
980500 -- (-1995.530) (-2000.930) (-1986.498) [-1991.763] * (-1990.546) (-1994.550) (-1994.356) [-1981.569] -- 0:00:06
980600 -- (-1995.062) (-2003.835) [-1982.739] (-1994.754) * (-1989.868) (-1998.057) (-1987.611) [-1983.311] -- 0:00:06
980700 -- (-2001.392) (-1998.110) [-1983.606] (-1990.482) * [-1987.999] (-1992.143) (-1993.948) (-1983.288) -- 0:00:06
980800 -- (-2004.611) (-2013.269) [-1979.870] (-1991.155) * (-1985.144) (-1992.996) (-1987.486) [-1985.767] -- 0:00:06
980900 -- (-2003.626) (-2009.961) [-1980.502] (-1990.192) * (-1984.322) (-1993.802) [-1988.993] (-1991.624) -- 0:00:06
981000 -- (-2000.338) (-2004.938) [-1983.490] (-1989.219) * [-1982.778] (-1988.332) (-1989.571) (-1991.865) -- 0:00:06
Average standard deviation of split frequencies: 0.002073
981100 -- (-1987.338) (-1994.794) [-1979.614] (-1987.350) * [-1984.926] (-1988.618) (-1999.781) (-1994.875) -- 0:00:06
981200 -- (-1986.083) [-1992.654] (-1990.243) (-1994.596) * [-1981.383] (-1986.808) (-2000.803) (-1991.843) -- 0:00:06
981300 -- (-1987.099) (-1991.318) (-1986.352) [-1985.265] * [-1980.462] (-1984.211) (-1994.478) (-1997.750) -- 0:00:06
981400 -- (-1986.062) [-1988.156] (-1994.513) (-1996.321) * [-1979.271] (-1989.117) (-1989.779) (-2004.869) -- 0:00:06
981500 -- (-1993.038) [-1983.172] (-1985.600) (-1989.496) * [-1981.035] (-1989.404) (-1985.261) (-1995.309) -- 0:00:06
981600 -- [-1987.634] (-1990.219) (-1994.642) (-1992.753) * (-1985.201) (-2002.337) [-1982.933] (-1999.505) -- 0:00:06
981700 -- [-1987.913] (-1991.460) (-1997.281) (-1990.530) * [-1983.017] (-1998.071) (-1987.750) (-1999.419) -- 0:00:06
981800 -- [-1989.501] (-1996.232) (-2000.327) (-1987.156) * [-1984.049] (-1990.386) (-1989.747) (-2002.269) -- 0:00:05
981900 -- [-1986.730] (-1990.330) (-1991.129) (-1985.953) * [-1987.325] (-1991.944) (-1994.180) (-2006.933) -- 0:00:05
982000 -- (-1985.001) [-1988.173] (-1995.830) (-1987.031) * (-1985.885) [-1986.322] (-1992.607) (-2008.055) -- 0:00:05
Average standard deviation of split frequencies: 0.002180
982100 -- (-1992.319) (-1987.035) [-1989.808] (-1990.250) * (-1984.315) (-1994.788) [-1988.069] (-1988.705) -- 0:00:05
982200 -- (-1986.373) [-1986.784] (-1991.050) (-1992.869) * [-1981.145] (-1986.714) (-1993.024) (-1985.775) -- 0:00:05
982300 -- (-1992.715) [-1988.333] (-1990.893) (-1992.581) * (-1984.756) [-1986.002] (-1987.774) (-1989.695) -- 0:00:05
982400 -- (-1993.153) [-1988.144] (-1989.417) (-1991.487) * [-1982.757] (-1984.100) (-1985.829) (-1995.890) -- 0:00:05
982500 -- [-1991.229] (-1986.842) (-1989.377) (-1992.045) * (-1987.082) (-1993.245) [-1981.371] (-1993.643) -- 0:00:05
982600 -- (-1992.626) (-1991.573) [-1982.064] (-1999.362) * [-1987.352] (-2000.750) (-1986.966) (-1992.560) -- 0:00:05
982700 -- (-1994.451) [-1989.612] (-1981.498) (-1997.084) * [-1985.794] (-2000.987) (-1988.969) (-1993.794) -- 0:00:05
982800 -- (-2001.852) (-1987.164) [-1986.642] (-2004.247) * (-1983.206) (-1995.915) [-1983.291] (-1988.757) -- 0:00:05
982900 -- (-1999.974) (-1989.548) [-1981.299] (-1999.022) * [-1981.989] (-1994.155) (-1977.888) (-1987.003) -- 0:00:05
983000 -- (-1998.810) (-1993.218) [-1981.408] (-2001.059) * [-1987.082] (-1995.961) (-1976.888) (-1985.407) -- 0:00:05
Average standard deviation of split frequencies: 0.002151
983100 -- (-2001.429) (-1989.614) [-1979.004] (-1999.715) * (-1980.385) (-1994.676) [-1980.221] (-1997.793) -- 0:00:05
983200 -- (-2006.097) (-1989.014) [-1980.676] (-1997.564) * (-1980.445) (-1992.880) [-1984.058] (-1988.268) -- 0:00:05
983300 -- (-2000.118) (-1991.702) [-1982.870] (-1994.768) * [-1980.930] (-1994.220) (-1978.158) (-1984.882) -- 0:00:05
983400 -- (-1997.579) (-1995.030) (-1987.552) [-1990.293] * (-1991.447) (-1991.321) [-1979.683] (-1990.942) -- 0:00:05
983500 -- (-1996.700) (-1994.608) [-1983.240] (-1992.489) * (-1991.091) (-1991.696) [-1976.556] (-1994.091) -- 0:00:05
983600 -- (-2006.351) [-1988.948] (-1985.926) (-1994.796) * (-1997.438) (-1996.353) [-1981.169] (-1985.005) -- 0:00:05
983700 -- (-1999.224) (-1989.093) [-1986.789] (-1997.827) * (-1995.550) (-1993.594) [-1976.116] (-1992.274) -- 0:00:05
983800 -- (-1994.659) (-1991.190) [-1985.248] (-1993.094) * (-1993.500) (-1991.046) [-1979.015] (-1980.671) -- 0:00:05
983900 -- (-1996.501) [-1995.561] (-1981.212) (-1995.156) * (-1988.526) (-1995.999) (-1982.992) [-1977.227] -- 0:00:05
984000 -- (-2001.456) (-1996.468) [-1976.796] (-1996.409) * (-1997.320) (-1993.928) [-1985.158] (-1982.240) -- 0:00:05
Average standard deviation of split frequencies: 0.002217
984100 -- (-2005.431) (-1992.228) [-1983.887] (-2001.135) * (-1997.323) (-2004.532) [-1981.150] (-1981.440) -- 0:00:05
984200 -- (-2000.852) (-1989.005) [-1986.570] (-1997.957) * (-1997.246) (-2000.657) (-1981.729) [-1979.811] -- 0:00:05
984300 -- (-1987.126) [-1988.212] (-1987.456) (-2009.725) * (-1991.319) (-1997.102) (-1981.143) [-1977.150] -- 0:00:05
984400 -- (-1996.127) (-1990.170) [-1987.124] (-2001.499) * (-1992.363) (-1995.528) (-1984.109) [-1979.295] -- 0:00:05
984500 -- (-1993.002) (-1993.571) [-1983.594] (-1991.760) * (-1986.385) (-1994.669) [-1982.476] (-1985.319) -- 0:00:05
984600 -- (-1990.131) (-1995.821) [-1984.144] (-1988.886) * (-1984.564) (-1991.848) (-1989.682) [-1977.289] -- 0:00:05
984700 -- (-2002.503) (-1989.162) [-1982.527] (-1992.286) * [-1979.797] (-1987.430) (-1998.165) (-1984.502) -- 0:00:05
984800 -- (-2002.589) (-1991.478) [-1984.257] (-1995.975) * [-1980.663] (-1990.043) (-1995.433) (-1984.347) -- 0:00:05
984900 -- (-2017.861) [-1992.174] (-1983.506) (-1998.821) * [-1982.506] (-1996.242) (-1989.921) (-1987.448) -- 0:00:04
985000 -- (-2022.655) (-1990.851) [-1982.507] (-1987.460) * [-1982.808] (-1999.353) (-1991.987) (-1990.985) -- 0:00:04
Average standard deviation of split frequencies: 0.002310
985100 -- (-2014.987) (-1989.576) [-1983.969] (-1988.105) * (-1980.079) (-2001.075) (-1999.703) [-1978.687] -- 0:00:04
985200 -- (-2006.672) (-1989.157) [-1983.412] (-1992.104) * (-1984.833) (-2004.049) (-1987.412) [-1982.605] -- 0:00:04
985300 -- (-1997.548) (-1996.128) [-1980.511] (-1990.040) * (-1988.105) (-1991.565) [-1989.887] (-1986.650) -- 0:00:04
985400 -- (-1998.580) (-1991.832) [-1983.191] (-1991.910) * [-1992.749] (-1994.203) (-1987.332) (-1986.988) -- 0:00:04
985500 -- (-2005.354) (-1996.627) [-1984.622] (-1997.370) * (-1987.781) (-1985.050) [-1992.661] (-1987.788) -- 0:00:04
985600 -- (-2001.834) (-1996.086) [-1987.061] (-2000.522) * [-1981.930] (-1990.616) (-1996.577) (-1988.716) -- 0:00:04
985700 -- (-1996.480) (-1993.555) [-1982.291] (-1994.753) * (-1982.971) (-1998.967) (-1992.461) [-1984.871] -- 0:00:04
985800 -- (-1996.147) (-1996.659) [-1980.424] (-1990.309) * [-1982.521] (-1998.580) (-2004.907) (-1984.229) -- 0:00:04
985900 -- (-2007.511) (-1996.749) [-1982.182] (-1992.540) * [-1985.980] (-1998.925) (-2001.749) (-1980.926) -- 0:00:04
986000 -- (-1998.949) (-1988.943) [-1991.743] (-1997.594) * [-1980.267] (-1993.113) (-1998.966) (-1986.192) -- 0:00:04
Average standard deviation of split frequencies: 0.002336
986100 -- (-1998.972) (-1987.273) [-1984.744] (-2002.642) * (-1984.286) (-1998.356) (-1994.027) [-1988.466] -- 0:00:04
986200 -- (-2002.864) (-1986.706) [-1979.564] (-2002.736) * (-1981.145) (-1992.159) (-1992.171) [-1986.144] -- 0:00:04
986300 -- (-1997.216) (-1987.867) [-1984.341] (-1989.722) * (-1985.708) [-1984.856] (-1991.098) (-1990.089) -- 0:00:04
986400 -- (-1998.163) (-1985.808) (-1994.344) [-1992.817] * [-1989.014] (-1987.460) (-1998.633) (-1991.399) -- 0:00:04
986500 -- (-1990.477) (-1988.724) [-1993.793] (-1989.483) * [-1984.442] (-1992.971) (-1995.711) (-1985.944) -- 0:00:04
986600 -- (-2001.992) [-1985.172] (-1988.794) (-1990.039) * [-1984.553] (-1993.588) (-1984.886) (-1993.549) -- 0:00:04
986700 -- (-2000.069) [-1984.330] (-1993.948) (-1994.090) * [-1983.568] (-1989.226) (-1989.306) (-1983.043) -- 0:00:04
986800 -- [-1998.310] (-1989.141) (-1985.844) (-1991.289) * [-1983.371] (-1987.344) (-1988.389) (-1987.306) -- 0:00:04
986900 -- (-2004.142) (-1993.796) [-1986.453] (-1993.626) * [-1983.359] (-1986.376) (-1987.495) (-1978.831) -- 0:00:04
987000 -- (-2001.651) (-1992.800) [-1987.194] (-1994.756) * [-1983.661] (-1993.035) (-1990.811) (-1987.277) -- 0:00:04
Average standard deviation of split frequencies: 0.002319
987100 -- (-2004.844) (-1993.205) (-1990.536) [-1986.210] * (-1987.997) (-1992.873) (-1986.552) [-1980.176] -- 0:00:04
987200 -- (-1997.929) (-1991.051) [-1986.454] (-1993.464) * (-1983.960) (-1984.016) (-1985.501) [-1983.038] -- 0:00:04
987300 -- (-2000.330) [-1988.941] (-1989.629) (-1994.890) * (-1989.806) (-1989.084) (-1989.589) [-1984.251] -- 0:00:04
987400 -- (-1995.321) (-1985.677) (-1990.622) [-1988.378] * (-1989.734) (-1993.426) (-1991.969) [-1980.067] -- 0:00:04
987500 -- (-1992.867) [-1988.239] (-1998.384) (-1998.459) * (-1989.513) (-2008.071) (-1992.654) [-1981.578] -- 0:00:04
987600 -- (-1993.282) (-1995.019) [-1992.648] (-1995.000) * (-1995.517) (-1992.299) (-1992.407) [-1981.343] -- 0:00:04
987700 -- (-1996.077) (-1990.835) [-1988.552] (-1991.301) * (-1992.810) (-2005.480) (-1991.862) [-1980.606] -- 0:00:04
987800 -- (-2000.301) (-1990.143) [-1986.160] (-1988.120) * (-1989.422) (-2000.246) [-1988.614] (-1984.526) -- 0:00:04
987900 -- [-1987.790] (-1986.480) (-1986.641) (-1985.351) * (-1992.532) (-2002.323) [-1985.450] (-1985.090) -- 0:00:03
988000 -- (-1991.215) [-1986.033] (-1990.272) (-1987.219) * (-2001.573) (-2001.945) [-1987.905] (-1989.580) -- 0:00:03
Average standard deviation of split frequencies: 0.002344
988100 -- (-1990.435) (-1988.183) (-1998.628) [-1983.542] * (-1994.638) (-1992.824) [-1990.751] (-1988.809) -- 0:00:03
988200 -- (-1991.992) (-1991.849) (-1999.068) [-1986.483] * (-1998.026) (-1992.159) (-1990.779) [-1988.675] -- 0:00:03
988300 -- [-1988.482] (-1998.020) (-1998.336) (-1985.144) * [-1984.042] (-1989.869) (-1994.557) (-1987.485) -- 0:00:03
988400 -- (-1989.078) (-1999.057) [-1990.908] (-1990.222) * [-1988.606] (-1998.075) (-1993.012) (-1989.991) -- 0:00:03
988500 -- (-1999.590) (-1995.372) (-1988.584) [-1986.695] * (-1991.403) (-2000.112) (-1991.943) [-1989.485] -- 0:00:03
988600 -- (-1989.086) (-1994.584) (-1987.282) [-1988.533] * (-1987.514) [-1995.179] (-1993.503) (-1990.922) -- 0:00:03
988700 -- (-1993.151) (-1993.482) [-1983.704] (-1992.478) * (-1989.349) (-1990.908) (-1999.639) [-1990.753] -- 0:00:03
988800 -- (-1990.756) (-1998.639) [-1984.358] (-1990.586) * (-1992.747) (-1991.931) (-1996.881) [-1994.666] -- 0:00:03
988900 -- (-1990.875) (-1993.850) [-1982.813] (-1988.400) * (-1993.581) [-1992.476] (-1993.311) (-2000.120) -- 0:00:03
989000 -- [-1984.069] (-1994.409) (-1981.455) (-1986.028) * [-1986.180] (-1991.193) (-1987.524) (-1996.761) -- 0:00:03
Average standard deviation of split frequencies: 0.002369
989100 -- [-1987.586] (-1997.195) (-1985.945) (-1989.562) * [-1985.194] (-1994.899) (-1987.775) (-1989.549) -- 0:00:03
989200 -- (-1998.685) (-1997.983) (-1996.368) [-1993.313] * (-1983.987) (-1991.544) [-1985.501] (-1988.441) -- 0:00:03
989300 -- [-1995.233] (-2002.829) (-1998.209) (-1987.192) * (-1989.021) (-1991.748) [-1984.780] (-1989.679) -- 0:00:03
989400 -- (-1995.606) (-2004.899) (-1988.744) [-1990.946] * (-1993.994) (-1995.520) [-1987.528] (-1984.058) -- 0:00:03
989500 -- (-1990.510) (-2008.209) [-1985.441] (-1993.005) * (-2001.319) [-1988.182] (-2000.297) (-1983.583) -- 0:00:03
989600 -- [-1981.336] (-1999.683) (-1995.568) (-1986.267) * (-1989.906) (-1984.255) (-1996.640) [-1980.568] -- 0:00:03
989700 -- (-1989.507) (-1997.873) (-1994.562) [-1984.961] * [-1986.502] (-1993.211) (-1984.798) (-1981.121) -- 0:00:03
989800 -- [-1989.712] (-2003.198) (-1997.024) (-1989.790) * (-1996.111) (-2001.721) (-1983.735) [-1977.329] -- 0:00:03
989900 -- [-1985.395] (-2000.126) (-1990.284) (-1989.522) * (-2003.917) (-2001.876) (-1986.506) [-1976.100] -- 0:00:03
990000 -- (-1985.876) [-1996.021] (-1988.586) (-1988.126) * (-1995.906) (-2004.204) (-1988.449) [-1977.560] -- 0:00:03
Average standard deviation of split frequencies: 0.002367
990100 -- (-1991.953) (-2000.887) [-1983.360] (-1989.951) * (-1993.549) (-1996.429) (-1988.431) [-1979.972] -- 0:00:03
990200 -- (-1989.085) (-1996.766) [-1983.832] (-1990.728) * (-1990.338) (-1990.293) (-1980.077) [-1980.094] -- 0:00:03
990300 -- (-2003.091) [-1988.134] (-1982.926) (-1994.286) * [-1989.396] (-1994.084) (-1982.478) (-1983.589) -- 0:00:03
990400 -- (-2000.631) (-1988.480) [-1983.981] (-1991.252) * (-1986.738) (-1999.853) [-1983.509] (-1986.249) -- 0:00:03
990500 -- (-1997.741) (-1989.532) [-1984.204] (-1997.293) * (-1981.268) (-1992.448) (-1989.562) [-1979.874] -- 0:00:03
990600 -- (-1998.861) (-1994.239) [-1985.672] (-1994.462) * [-1982.581] (-1988.143) (-1994.020) (-1979.132) -- 0:00:03
990700 -- (-1989.491) [-1990.182] (-1986.954) (-1989.535) * [-1987.111] (-1987.261) (-2002.404) (-1980.942) -- 0:00:03
990800 -- [-1985.787] (-1991.373) (-1991.312) (-1998.703) * (-1983.864) (-1992.746) (-1990.115) [-1979.110] -- 0:00:03
990900 -- (-1986.620) (-1987.902) [-1988.162] (-1993.400) * (-1984.077) (-1991.352) (-1989.911) [-1983.516] -- 0:00:02
991000 -- [-1984.108] (-1985.902) (-1989.473) (-1992.936) * (-1987.355) (-1990.495) [-1989.159] (-1981.394) -- 0:00:02
Average standard deviation of split frequencies: 0.002337
991100 -- (-1984.919) [-1982.933] (-1991.050) (-1990.217) * (-1986.961) (-1984.549) (-1993.213) [-1981.958] -- 0:00:02
991200 -- [-1986.457] (-1986.154) (-1988.129) (-1999.505) * [-1981.684] (-1991.139) (-1989.190) (-1981.568) -- 0:00:02
991300 -- (-1990.548) (-1993.988) [-1984.366] (-1999.118) * (-1985.756) (-1984.122) (-1979.919) [-1979.956] -- 0:00:02
991400 -- [-1994.696] (-1995.353) (-1990.381) (-1998.957) * (-1991.254) (-1985.134) [-1988.248] (-1984.180) -- 0:00:02
991500 -- (-1982.809) (-1990.814) (-1982.547) [-1988.561] * (-1987.323) (-1991.943) [-1986.414] (-1985.455) -- 0:00:02
991600 -- (-1982.764) (-1991.888) [-1987.512] (-1988.633) * (-1998.984) (-1986.423) (-1989.129) [-1986.130] -- 0:00:02
991700 -- (-1985.204) (-1996.461) [-1980.898] (-1989.997) * (-1990.408) (-1988.701) (-1981.670) [-1985.244] -- 0:00:02
991800 -- [-1985.720] (-1989.600) (-1987.751) (-1991.204) * (-1996.018) (-1991.676) [-1978.563] (-1988.336) -- 0:00:02
991900 -- [-1983.049] (-1997.001) (-1991.936) (-2003.097) * (-1995.122) (-1988.123) [-1978.043] (-1991.711) -- 0:00:02
992000 -- (-1986.164) (-1990.645) [-1981.186] (-1993.339) * (-2000.951) (-1989.025) (-1987.490) [-1980.492] -- 0:00:02
Average standard deviation of split frequencies: 0.002376
992100 -- [-1980.617] (-1995.079) (-1980.345) (-2003.547) * (-2000.764) (-1987.768) (-1993.017) [-1981.199] -- 0:00:02
992200 -- [-1983.670] (-2001.008) (-1983.168) (-2009.127) * (-1995.333) (-1993.871) (-1994.194) [-1986.122] -- 0:00:02
992300 -- [-1985.163] (-2002.192) (-1985.270) (-1998.632) * (-1990.634) (-1993.467) (-1995.353) [-1979.323] -- 0:00:02
992400 -- (-1988.224) (-1999.148) [-1984.618] (-2000.370) * (-1989.979) (-1997.355) (-1988.151) [-1977.256] -- 0:00:02
992500 -- [-1985.861] (-1996.610) (-1984.111) (-2010.226) * [-1987.184] (-1996.607) (-1990.039) (-1977.933) -- 0:00:02
992600 -- [-1992.643] (-2000.124) (-1983.573) (-2004.015) * (-1994.838) (-1992.697) (-1983.034) [-1977.725] -- 0:00:02
992700 -- (-2003.771) (-2002.072) [-1983.574] (-2012.528) * (-1986.764) (-1990.183) (-1984.991) [-1983.784] -- 0:00:02
992800 -- (-1992.474) [-1993.745] (-1991.262) (-2011.128) * (-1992.307) (-1994.521) [-1981.033] (-1984.393) -- 0:00:02
992900 -- (-1997.449) [-1988.701] (-1987.417) (-2009.721) * (-1989.587) [-1987.840] (-1983.306) (-1984.264) -- 0:00:02
993000 -- (-2001.992) [-1989.414] (-1995.189) (-2008.359) * [-1983.218] (-1992.800) (-1986.877) (-1988.531) -- 0:00:02
Average standard deviation of split frequencies: 0.002319
993100 -- (-2001.860) [-1994.133] (-1993.773) (-2001.095) * (-1988.051) (-2009.228) [-1979.211] (-1986.895) -- 0:00:02
993200 -- (-1989.060) (-1995.318) (-1996.054) [-1992.734] * (-1986.970) (-2000.982) (-1982.019) [-1984.839] -- 0:00:02
993300 -- [-1987.976] (-1998.116) (-1996.863) (-1992.624) * (-1988.235) (-2007.525) (-1982.050) [-1982.662] -- 0:00:02
993400 -- [-1987.069] (-1998.809) (-1998.383) (-1994.412) * (-1985.777) (-2004.699) (-1995.686) [-1979.951] -- 0:00:02
993500 -- [-1982.627] (-1997.804) (-1998.258) (-2003.919) * (-1988.454) (-2003.009) [-1984.513] (-1979.542) -- 0:00:02
993600 -- [-1980.764] (-1991.171) (-1994.306) (-2002.646) * (-1988.286) (-1996.696) (-1986.870) [-1982.220] -- 0:00:02
993700 -- [-1991.434] (-1992.776) (-1997.138) (-1997.283) * (-1991.071) (-1988.892) (-1992.342) [-1981.860] -- 0:00:02
993800 -- (-2001.367) (-1993.913) (-1993.677) [-1989.936] * (-1983.820) (-1994.015) (-1990.174) [-1987.353] -- 0:00:02
993900 -- (-2003.414) (-1994.525) [-1985.699] (-1990.228) * (-1988.746) (-1997.493) [-1982.798] (-1992.691) -- 0:00:02
994000 -- (-1995.230) (-1994.591) [-1988.994] (-1991.077) * (-1992.711) (-1993.886) [-1979.859] (-1985.879) -- 0:00:01
Average standard deviation of split frequencies: 0.002317
994100 -- (-1988.133) (-1993.109) [-1988.717] (-1998.668) * (-1992.582) (-1997.994) [-1977.414] (-1986.652) -- 0:00:01
994200 -- (-1986.998) [-1994.295] (-1990.718) (-1998.420) * (-1983.619) (-1993.463) [-1986.435] (-1984.433) -- 0:00:01
994300 -- [-1981.433] (-1992.049) (-1993.739) (-1995.578) * (-1992.214) (-1992.645) (-1992.954) [-1995.625] -- 0:00:01
994400 -- (-1987.978) [-1989.426] (-1991.888) (-2005.401) * (-1992.240) [-1992.811] (-1985.989) (-2006.550) -- 0:00:01
994500 -- (-1987.450) [-1987.302] (-1998.118) (-2012.247) * (-2005.490) [-1982.783] (-1990.402) (-2000.480) -- 0:00:01
994600 -- [-1987.876] (-1990.920) (-1988.800) (-2008.268) * (-2000.288) [-1985.206] (-1992.979) (-1997.396) -- 0:00:01
994700 -- (-1998.937) [-1983.071] (-1998.704) (-2002.267) * (-2000.376) (-1986.849) [-1984.230] (-1997.096) -- 0:00:01
994800 -- (-1993.985) [-1981.703] (-1996.127) (-2002.188) * (-1997.747) [-1984.102] (-1983.013) (-1990.464) -- 0:00:01
994900 -- (-1993.445) [-1983.184] (-1992.795) (-2001.665) * (-1993.373) (-1983.120) [-1978.103] (-1999.444) -- 0:00:01
995000 -- (-2004.539) [-1987.176] (-1992.714) (-1994.470) * (-1986.284) [-1982.830] (-1984.434) (-1993.307) -- 0:00:01
Average standard deviation of split frequencies: 0.002314
995100 -- (-1995.535) [-1985.239] (-1990.428) (-2001.399) * (-1987.609) (-1983.910) (-1985.410) [-1990.983] -- 0:00:01
995200 -- (-2006.328) (-1989.877) (-1993.148) [-1987.989] * (-1991.543) [-1980.866] (-1990.446) (-1995.386) -- 0:00:01
995300 -- (-1994.331) (-1988.445) (-2008.336) [-1983.853] * (-1992.682) [-1981.411] (-1986.097) (-2009.663) -- 0:00:01
995400 -- (-1988.652) (-1987.697) (-2001.440) [-1987.513] * (-1991.300) (-1983.371) [-1980.419] (-2002.476) -- 0:00:01
995500 -- (-1993.181) (-1985.210) (-1993.263) [-1985.472] * (-1992.702) [-1978.446] (-1985.663) (-1999.965) -- 0:00:01
995600 -- (-1996.393) (-1989.240) (-1985.942) [-1983.467] * (-1992.214) (-1981.747) [-1980.798] (-1992.293) -- 0:00:01
995700 -- (-2002.823) (-1994.343) (-1994.306) [-1980.194] * [-1989.848] (-1977.397) (-1983.667) (-2000.670) -- 0:00:01
995800 -- (-1999.372) (-1986.896) (-1998.689) [-1978.425] * (-1997.361) [-1980.286] (-1989.678) (-2006.653) -- 0:00:01
995900 -- (-1997.358) (-1994.226) (-2004.864) [-1983.041] * (-1995.331) [-1979.055] (-1994.542) (-1993.685) -- 0:00:01
996000 -- (-2000.290) (-1995.786) (-1998.832) [-1990.829] * (-1993.928) [-1983.409] (-1990.243) (-1992.692) -- 0:00:01
Average standard deviation of split frequencies: 0.002420
996100 -- (-2013.419) (-1991.771) (-1995.701) [-1979.286] * (-1996.690) (-1990.142) [-1987.976] (-1996.134) -- 0:00:01
996200 -- (-1995.189) (-1984.618) (-1998.217) [-1978.754] * (-1989.486) [-1988.861] (-1982.947) (-1992.567) -- 0:00:01
996300 -- (-1991.058) (-1989.240) (-2003.950) [-1983.936] * (-1992.816) (-1992.289) (-1987.384) [-1985.674] -- 0:00:01
996400 -- (-1988.374) (-1990.505) (-2004.629) [-1981.805] * (-1997.842) (-1989.995) (-1987.660) [-1983.493] -- 0:00:01
996500 -- (-1991.662) (-1992.353) (-2002.279) [-1982.818] * (-1995.434) [-1986.486] (-1988.693) (-1981.477) -- 0:00:01
996600 -- (-1990.602) (-1993.752) (-1993.660) [-1987.262] * (-1993.437) (-1991.866) (-1989.390) [-1980.531] -- 0:00:01
996700 -- (-1990.152) (-1996.773) (-1987.294) [-1981.927] * (-1990.473) (-1993.031) (-1983.992) [-1982.047] -- 0:00:01
996800 -- (-2002.061) [-1989.660] (-1988.823) (-1990.661) * (-1993.411) (-2007.137) [-1986.025] (-1980.610) -- 0:00:01
996900 -- (-1999.052) [-1990.134] (-1990.653) (-1985.265) * (-1994.373) (-2007.281) (-1984.228) [-1982.894] -- 0:00:01
997000 -- (-1992.956) (-1995.075) (-1997.239) [-1984.987] * (-1990.321) (-2011.405) (-1985.593) [-1986.136] -- 0:00:00
Average standard deviation of split frequencies: 0.002431
997100 -- (-1993.924) [-1989.248] (-1995.939) (-1989.171) * (-1988.259) (-2008.430) (-1978.159) [-1983.595] -- 0:00:00
997200 -- [-1987.029] (-1988.225) (-1996.618) (-1987.590) * (-1987.498) (-2009.005) [-1979.905] (-1984.973) -- 0:00:00
997300 -- (-1993.173) [-1988.236] (-1994.305) (-1989.570) * (-1986.414) (-2000.940) [-1981.212] (-1995.969) -- 0:00:00
997400 -- (-1997.568) [-1992.513] (-2000.258) (-1999.331) * (-1987.444) (-1990.488) [-1981.296] (-1995.457) -- 0:00:00
997500 -- (-1999.502) [-1989.633] (-2004.816) (-1997.519) * (-1989.684) [-1986.686] (-1985.443) (-1993.935) -- 0:00:00
997600 -- (-1997.999) (-1989.872) (-2002.057) [-1996.270] * (-1990.692) (-1986.776) (-1985.217) [-1984.804] -- 0:00:00
997700 -- [-1992.100] (-1996.491) (-1999.424) (-1994.326) * (-1989.136) (-1989.153) (-1984.825) [-1984.680] -- 0:00:00
997800 -- (-1995.065) (-1998.097) [-1993.674] (-1993.388) * (-1994.985) (-1991.805) (-1984.688) [-1981.029] -- 0:00:00
997900 -- (-1987.115) (-1996.780) [-1990.025] (-1996.253) * (-1996.771) (-1990.731) (-1986.689) [-1977.727] -- 0:00:00
998000 -- (-1988.789) (-2002.212) [-2000.708] (-1998.953) * (-2002.862) (-1989.829) (-1983.798) [-1977.672] -- 0:00:00
Average standard deviation of split frequencies: 0.002577
998100 -- [-1984.033] (-1990.175) (-1993.803) (-1991.031) * (-1988.345) (-1991.181) (-1990.168) [-1983.069] -- 0:00:00
998200 -- (-1987.829) (-1990.928) (-2002.826) [-1987.049] * (-1984.961) (-1994.249) (-1988.324) [-1992.594] -- 0:00:00
998300 -- [-1986.959] (-1991.494) (-2003.184) (-1990.688) * (-1984.436) [-1997.507] (-1992.601) (-2000.758) -- 0:00:00
998400 -- [-1984.793] (-1998.621) (-2000.016) (-1991.911) * [-1985.787] (-1991.556) (-1991.270) (-1990.262) -- 0:00:00
998500 -- (-1992.042) (-1990.441) (-1999.372) [-1986.713] * (-1983.508) [-1988.501] (-1994.663) (-2000.320) -- 0:00:00
998600 -- (-1988.262) (-1991.241) (-1993.388) [-1984.164] * [-1987.286] (-1984.542) (-1987.455) (-1995.272) -- 0:00:00
998700 -- (-1989.111) (-1989.160) (-1989.599) [-1981.219] * (-1986.418) (-1984.415) [-1984.640] (-1987.361) -- 0:00:00
998800 -- (-1992.322) (-2000.168) (-1990.309) [-1979.669] * [-1988.296] (-1987.913) (-1983.286) (-1985.249) -- 0:00:00
998900 -- [-1991.468] (-2000.924) (-1994.777) (-1981.211) * (-1985.889) (-1986.915) (-1979.467) [-1981.518] -- 0:00:00
999000 -- (-1985.881) (-2000.824) (-1996.355) [-1979.557] * (-1989.861) (-1996.601) [-1980.973] (-1981.002) -- 0:00:00
Average standard deviation of split frequencies: 0.002548
999100 -- [-1988.309] (-1994.284) (-2001.202) (-1988.749) * (-1991.929) (-1990.346) [-1985.920] (-1986.904) -- 0:00:00
999200 -- (-1993.198) (-1988.591) (-2007.781) [-1984.525] * (-1990.489) (-2000.676) [-1984.620] (-1993.754) -- 0:00:00
999300 -- [-1994.082] (-1984.417) (-2004.242) (-1985.713) * (-1993.833) (-2010.787) (-1984.523) [-1994.070] -- 0:00:00
999400 -- (-1991.292) (-1993.662) (-2002.783) [-1984.846] * (-2003.232) (-2006.131) (-1986.033) [-1994.003] -- 0:00:00
999500 -- [-1990.107] (-1990.647) (-1998.704) (-1991.648) * (-2004.631) (-2000.267) [-1987.554] (-2000.493) -- 0:00:00
999600 -- [-1990.379] (-1993.343) (-1996.650) (-1994.220) * (-2002.800) (-2001.022) [-1981.892] (-1988.946) -- 0:00:00
999700 -- (-1992.978) [-1993.407] (-1992.472) (-1995.307) * (-2007.900) (-1993.936) [-1982.393] (-1992.491) -- 0:00:00
999800 -- (-1993.155) [-1992.714] (-1998.089) (-1998.098) * (-2002.444) (-1990.642) [-1985.659] (-1989.542) -- 0:00:00
999900 -- (-1991.781) [-1989.732] (-2000.069) (-2001.884) * (-2004.229) (-2002.298) [-1984.008] (-1993.835) -- 0:00:00
1000000 -- [-1991.253] (-1994.087) (-2007.827) (-1995.489) * (-2009.866) (-2005.868) [-1980.825] (-1999.653) -- 0:00:00
Average standard deviation of split frequencies: 0.002491
Analysis completed in 329 seconds
Analysis used 329.01 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1973.33
Likelihood of best state for "cold" chain of run 2 was -1974.02
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. Chain accepted changes to
57.31 % param. 1 (revmat) with Dirichlet proposal
21.73 % param. 2 (state frequencies) with Dirichlet proposal
82.69 % param. 3 (gamma shape) with multiplier
90.54 % param. 4 (gamma shape) with multiplier
70.36 % param. 5 (prop. invar. sites) with sliding window
12.47 % param. 6 (topology and branch lengths) with extending TBR
25.42 % param. 6 (topology and branch lengths) with LOCAL
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. Chain accepted changes to
57.72 % param. 1 (revmat) with Dirichlet proposal
21.66 % param. 2 (state frequencies) with Dirichlet proposal
82.96 % param. 3 (gamma shape) with multiplier
90.54 % param. 4 (gamma shape) with multiplier
70.18 % param. 5 (prop. invar. sites) with sliding window
12.46 % param. 6 (topology and branch lengths) with extending TBR
25.30 % param. 6 (topology and branch lengths) with LOCAL
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.57 0.30 0.15
2 | 166417 0.64 0.39
3 | 166662 166998 0.69
4 | 166514 166549 166860
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.57 0.30 0.15
2 | 167128 0.64 0.39
3 | 166316 166540 0.69
4 | 166215 166914 166887
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.83
3 -- 0.71
4 -- 0.62
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.20 is the temperature and ID is the chain number)
Setting sump burnin to 2500
Summarizing parameters in files /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing output to screen but not to file ('Printtofile = No')
UNIX line termination
Longest line length = 176
Found 10001 parameter lines in file "/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p"
Of the 10001 lines, 7501 of them will be summarized (starting at line 2503)
(Only the last set of lines will be read, in case multiple
parameter blocks are present in the same file.)
7501 rows and 16 columns in each row
Expecting the same layout in all subsequent files
Successfully read 7501 lines from last parameter block of file 1
Successfully read 7501 lines from last parameter block of file 2
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1983.04
| 2 |
| |
| 221 2 1 2 1 11 2 |
|1 2 1 1 2 2 2 2|
| 2 1 1 1 2 1 2 * 2 |
| 1 21 2 21 11 2 2 2 121 2 2 2 1 |
|2 2 * *1*12 11 * 21 1 1 |
| 1 2 2 1 12 22 2 2 1 1 2 |
| 2 2 1 2 2 1 1 |
| 1 * 2 1 1 1 2 2 1|
| 1 1 2 1 2 1 |
| 2 2 2 12 11 2 1 1 |
| 1 1 2 2 1 |
| 2 1 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1988.93
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1980.50 -1997.15
2 -1980.38 -1998.75
--------------------------------------
TOTAL -1980.44 -1998.24
--------------------------------------
Model parameter summaries over the runs sampled in files
"/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Summaries are based on a total of 15002 samples from 2 runs)
(Each run produced 10001 samples of which 7501 samples were included)
95% Cred. Interval
----------------------
Parameter Mean Variance Lower Upper Median PSRF *
---------------------------------------------------------------------------------------------
TL{all} 0.265317 0.000885 0.212000 0.329000 0.263000 1.000
r(A<->C){all} 0.101350 0.000840 0.051181 0.164004 0.098791 1.000
r(A<->G){all} 0.168862 0.001157 0.109084 0.242242 0.166530 1.000
r(A<->T){all} 0.210862 0.002079 0.129527 0.306510 0.208112 1.000
r(C<->G){all} 0.094341 0.000483 0.056313 0.141940 0.092704 1.000
r(C<->T){all} 0.340278 0.002551 0.245988 0.442625 0.338700 1.000
r(G<->T){all} 0.084306 0.000597 0.042649 0.137257 0.082479 1.002
pi(A){all} 0.216659 0.000197 0.189988 0.244904 0.216516 1.000
pi(C){all} 0.261869 0.000218 0.233643 0.291465 0.261522 1.000
pi(G){all} 0.316085 0.000245 0.286490 0.346889 0.315873 1.000
pi(T){all} 0.205388 0.000185 0.179485 0.232576 0.205199 1.000
alpha{1,2} 28.084679 2735.050281 0.173688 179.276444 0.846342 1.003
alpha{3} 100.482318 3261.914324 7.034359 194.807984 99.861952 1.000
pinvar{all} 0.694802 0.009037 0.471945 0.815786 0.712470 1.003
---------------------------------------------------------------------------------------------
* Convergence diagnostic (PSRF = Potential scale reduction factor [Gelman
and Rubin, 1992], uncorrected) should approach 1 as runs converge. The
values may be unreliable if you have a small number of samples. PSRF should
only be used as a rough guide to convergence since all the assumptions
that allow one to interpret it as a scale reduction factor are not met in
the phylogenetic context.
Setting sumt burnin to 2500
Summarizing trees in files "/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
UNIX line termination
Examining first file ...
Found one tree block in file "/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 10001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 20002 trees in 2 files (sampling 15002 of them)
(Each file contained 10001 trees of which 7501 were sampled)
General explanation:
A taxon bibartition is specified by removing a branch, thereby dividing the
species into those to the left and those to the right of the branch. Here,
taxa to one side of the removed branch are denoted "." and those to the
other side are denoted "*". The output includes the bipartition number
(ID; sorted from highest to lowest probability), bipartition (e.g., ...**..),
number of times the bipartition was observed (#obs), the posterior probabil-
ity of the bipartition, and, if branch lengths were recorded on the trees in
the file, the average (Mean(v)) and variance (Var(v)) of the lengths. Each
"." or "*" in the bipartition represents a taxon that is to the left or
right of the removed branch. A list of the taxa in the bipartition is given
before the list of bipartitions. If you summarize several independent analy-
ses, convergence diagnostics are presented for both the posterior probabil-
ities of bipartitions (bipartition or split frequencies) and branch lengths
(if recorded on the trees in the files). In the former case, the diagnostic is
the standard deviation of the partition frequencies (Stdev(s)), in the second
case it is the potential scale reduction factor (PSRF) of Gelman and Rubin
(1992). Stdev(s) is expected to approach 0 and PSRF is expected to approach 1
as runs converge onto the posterior probability distribution. Note that these
values may be unreliable if the partition is not present in all runs (the
last column indicates the number of runs that sampled the partition if more
than one run is summarized). The PSRF is also sensitive to small sample
sizes and it should only be considered a rough guide to convergence since
some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in the phylogenetic context.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
Summary statistics for taxon bipartitions:
ID -- Partition #obs Probab. Stdev(s) Mean(v) Var(v) PSRF Nruns
----------------------------------------------------------------------------
1 -- ......*. 15002 1.000000 0.000000 0.037842 0.000088 1.000 2
2 -- .......* 15002 1.000000 0.000000 0.034736 0.000072 1.000 2
3 -- ...*.... 15002 1.000000 0.000000 0.015735 0.000034 1.000 2
4 -- .****.** 15002 1.000000 0.000000 0.017335 0.000034 1.000 2
5 -- .******* 15002 1.000000 0.000000 0.028873 0.000058 1.000 2
6 -- .*...... 15002 1.000000 0.000000 0.040243 0.000092 1.000 2
7 -- ..*..... 15002 1.000000 0.000000 0.024509 0.000051 1.000 2
8 -- .....*.. 15002 1.000000 0.000000 0.013615 0.000028 1.000 2
9 -- ....*... 15002 1.000000 0.000000 0.021023 0.000042 1.000 2
10 -- .**..... 14930 0.995201 0.000189 0.011195 0.000026 1.000 2
11 -- ....*..* 14508 0.967071 0.003959 0.008054 0.000019 1.001 2
12 -- ...*..*. 14326 0.954939 0.000000 0.009387 0.000020 1.000 2
13 -- ...**.** 9896 0.659645 0.008107 0.003303 0.000006 1.000 2
14 -- .**.*..* 2466 0.164378 0.001131 0.003365 0.000009 1.000 2
15 -- .***..*. 2081 0.138715 0.004054 0.002765 0.000006 1.000 2
----------------------------------------------------------------------------
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C6 (6)
|
+ /------------------ C2 (2)
| /----------------100----------------+
| | \------------------ C3 (3)
| |
\-------100-------+ /------------------ C4 (4)
| /--------95-------+
| | \------------------ C7 (7)
\--------66-------+
| /------------------ C5 (5)
\--------97-------+
\------------------ C8 (8)
Phylogram:
/------------------------------ C1 (1)
|
|-------------- C6 (6)
|
+ /------------------------------------------ C2 (2)
| /-----------+
| | \-------------------------- C3 (3)
| |
\-----------------+ /----------------- C4 (4)
| /--------+
| | \---------------------------------------- C7 (7)
\---+
| /---------------------- C5 (5)
\-------+
\------------------------------------ C8 (8)
|----------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (70 trees sampled):
90 % credible set contains 3 trees
95 % credible set contains 7 trees
99 % credible set contains 22 trees
Exiting MrBayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.5, December 2011
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 8 ls = 831
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Sites with gaps or missing data are removed.
33 ambiguity characters in seq. 1
33 ambiguity characters in seq. 2
33 ambiguity characters in seq. 3
33 ambiguity characters in seq. 4
33 ambiguity characters in seq. 5
33 ambiguity characters in seq. 6
90 ambiguity characters in seq. 7
33 ambiguity characters in seq. 8
30 sites are removed. 1 2 3 4 5 6 7 8 9 10 11 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277
Sequences read..
Counting site patterns.. 0:00
121 patterns at 247 / 247 sites (100.0%), 0:00
Counting codons..
224 bytes for distance
118096 bytes for conP
10648 bytes for fhK
5000000 bytes for space
Model 1: NearlyNeutral
TREE # 1
(1, 6, ((2, 3), ((4, 7), (5, 8)))); MP score: 127
354288 bytes for conP, adjusted
0.060115 0.039293 0.024179 0.014839 0.091505 0.059248 0.000685 0.007506 0.041500 0.083756 0.019426 0.045097 0.079790 0.300000 0.842478 0.405362
ntime & nrate & np: 13 2 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
np = 16
lnL0 = -1922.120398
Iterating by ming2
Initial: fx= 1922.120398
x= 0.06011 0.03929 0.02418 0.01484 0.09150 0.05925 0.00069 0.00751 0.04150 0.08376 0.01943 0.04510 0.07979 0.30000 0.84248 0.40536
1 h-m-p 0.0000 0.0017 1092.7392 YYYCC 1919.874968 4 0.0000 26 | 0/16
2 h-m-p 0.0000 0.0002 316.4055 +CYC 1914.714726 2 0.0002 49 | 0/16
3 h-m-p 0.0002 0.0019 249.6006 +YCYCCC 1886.295084 5 0.0014 77 | 0/16
4 h-m-p 0.0000 0.0001 1691.5717 +YYYCCC 1874.687334 5 0.0001 104 | 0/16
5 h-m-p 0.0000 0.0002 1838.9931 +CYCCC 1850.394451 4 0.0002 131 | 0/16
6 h-m-p 0.0000 0.0002 256.4567 ++ 1845.954957 m 0.0002 150 | 1/16
7 h-m-p 0.0001 0.0003 325.5792 YCCCC 1844.193386 4 0.0001 176 | 1/16
8 h-m-p 0.0004 0.0019 89.4546 YCYC 1843.648602 3 0.0002 199 | 1/16
9 h-m-p 0.0007 0.0033 22.8267 YC 1843.556653 1 0.0003 219 | 1/16
10 h-m-p 0.0003 0.0082 27.8891 YCCC 1843.413067 3 0.0005 243 | 1/16
11 h-m-p 0.0009 0.0119 14.8027 CCC 1843.207764 2 0.0011 266 | 1/16
12 h-m-p 0.0029 0.0145 5.1765 CYCCC 1842.183475 4 0.0045 292 | 1/16
13 h-m-p 0.0005 0.0024 44.5655 CYCC 1841.499840 3 0.0005 316 | 1/16
14 h-m-p 0.0010 0.0063 19.8701 YCC 1841.392375 2 0.0005 338 | 1/16
15 h-m-p 0.0033 0.0229 3.0891 -YC 1841.390368 1 0.0003 359 | 1/16
16 h-m-p 0.0034 0.4253 0.3139 +CC 1841.369182 1 0.0148 381 | 1/16
17 h-m-p 0.0016 0.1075 2.8155 ++YCCC 1839.149683 3 0.0562 422 | 1/16
18 h-m-p 1.5667 7.8334 0.0832 YCCCC 1837.460334 4 2.7723 448 | 1/16
19 h-m-p 1.1750 5.8752 0.0666 CCC 1837.018585 2 1.1995 486 | 1/16
20 h-m-p 1.6000 8.0000 0.0362 YCC 1836.911717 2 1.1884 523 | 1/16
21 h-m-p 1.1243 8.0000 0.0382 YCC 1836.845836 2 1.7923 560 | 1/16
22 h-m-p 1.6000 8.0000 0.0123 YC 1836.838014 1 0.9642 595 | 1/16
23 h-m-p 1.6000 8.0000 0.0015 CC 1836.837280 1 1.3085 631 | 1/16
24 h-m-p 1.6000 8.0000 0.0005 C 1836.837049 0 1.9363 665 | 1/16
25 h-m-p 1.6000 8.0000 0.0002 C 1836.836987 0 1.5562 699 | 1/16
26 h-m-p 1.1763 8.0000 0.0002 C 1836.836980 0 1.3483 733 | 1/16
27 h-m-p 1.6000 8.0000 0.0001 Y 1836.836979 0 1.1889 767 | 1/16
28 h-m-p 1.6000 8.0000 0.0000 C 1836.836979 0 1.2888 801 | 1/16
29 h-m-p 1.6000 8.0000 0.0000 C 1836.836979 0 1.6074 835 | 1/16
30 h-m-p 1.2331 8.0000 0.0000 Y 1836.836979 0 0.5755 869 | 1/16
31 h-m-p 1.1275 8.0000 0.0000 Y 1836.836979 0 0.2819 903 | 1/16
32 h-m-p 0.4221 8.0000 0.0000 ----C 1836.836979 0 0.0004 941
Out..
lnL = -1836.836979
942 lfun, 3768 EigenQcodon, 24492 P(t)
Time used: 0:06
Model 2: PositiveSelection
TREE # 1
(1, 6, ((2, 3), ((4, 7), (5, 8)))); MP score: 127
0.060115 0.039293 0.024179 0.014839 0.091505 0.059248 0.000685 0.007506 0.041500 0.083756 0.019426 0.045097 0.079790 1.688810 1.721302 0.311817 0.493629 1.300000
ntime & nrate & np: 13 3 18
Bounds (np=18):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
np = 18
lnL0 = -1871.115588
Iterating by ming2
Initial: fx= 1871.115588
x= 0.06011 0.03929 0.02418 0.01484 0.09150 0.05925 0.00069 0.00751 0.04150 0.08376 0.01943 0.04510 0.07979 1.68881 1.72130 0.31182 0.49363 1.30000
1 h-m-p 0.0000 0.0017 1212.8049 YYCCCCC 1869.002390 6 0.0000 33 | 0/18
2 h-m-p 0.0000 0.0002 300.1820 YCCCC 1866.685507 4 0.0001 61 | 0/18
3 h-m-p 0.0003 0.0020 82.0029 CCC 1865.562274 2 0.0004 86 | 0/18
4 h-m-p 0.0002 0.0025 126.0757 +YCYCCC 1857.888012 5 0.0018 117 | 0/18
5 h-m-p 0.0000 0.0001 4615.2744 ++ 1844.332866 m 0.0001 138 | 0/18
6 h-m-p -0.0000 -0.0000 349.1871
h-m-p: -1.76272420e-20 -8.81362099e-20 3.49187086e+02 1844.332866
.. | 0/18
7 h-m-p 0.0000 0.0002 415.6718 +YCCC 1839.049950 3 0.0001 183 | 0/18
8 h-m-p 0.0002 0.0008 207.4679 CCCC 1836.343344 3 0.0002 210 | 0/18
9 h-m-p 0.0001 0.0003 300.4748 +YYCCC 1831.824694 4 0.0002 238 | 0/18
10 h-m-p 0.0000 0.0000 169.4568 ++ 1831.200766 m 0.0000 259 | 1/18
11 h-m-p 0.0001 0.0024 65.1324 +YCCC 1830.701882 3 0.0003 286 | 1/18
12 h-m-p 0.0005 0.0023 36.0190 YCCC 1830.547836 3 0.0003 312 | 1/18
13 h-m-p 0.0003 0.0127 32.0349 +YCCC 1830.201507 3 0.0010 339 | 1/18
14 h-m-p 0.0002 0.0030 187.4194 +CCCCC 1828.261837 4 0.0009 369 | 1/18
15 h-m-p 0.0002 0.0011 284.6818 YCCC 1826.989248 3 0.0004 395 | 1/18
16 h-m-p 0.0004 0.0019 88.4420 YCCC 1826.522418 3 0.0006 421 | 1/18
17 h-m-p 0.0005 0.0054 110.2601 YCCC 1825.716765 3 0.0009 447 | 1/18
18 h-m-p 0.0006 0.0079 163.4111 +CCC 1822.074112 2 0.0034 473 | 1/18
19 h-m-p 0.0004 0.0020 1031.2322 +YCCCC 1813.594380 4 0.0012 502 | 1/18
20 h-m-p 0.0003 0.0016 192.3216 YCC 1813.328823 2 0.0002 526 | 1/18
21 h-m-p 0.0017 0.0178 23.2351 CCC 1813.263003 2 0.0006 551 | 1/18
22 h-m-p 0.0037 1.3556 3.5375 ++CC 1812.863462 1 0.0597 576 | 0/18
23 h-m-p 0.0049 0.1035 43.0051 CCC 1812.806021 2 0.0016 601 | 0/18
24 h-m-p 0.0166 0.0832 2.1164 ++ 1812.344595 m 0.0832 622 | 1/18
25 h-m-p 0.1435 0.9851 1.2235 +CYCCC 1810.458486 4 0.6424 651 | 1/18
26 h-m-p 0.3043 2.9937 2.5830 YYC 1809.548947 2 0.2625 674 | 1/18
27 h-m-p 0.6746 8.0000 1.0051 YCCC 1809.186654 3 0.3288 700 | 1/18
28 h-m-p 0.3139 6.4324 1.0529 +CCCC 1808.253229 3 1.3843 728 | 1/18
29 h-m-p 1.6000 8.0000 0.4276 CCC 1807.872819 2 1.5825 753 | 1/18
30 h-m-p 1.6000 8.0000 0.4048 CCC 1807.717474 2 1.7112 795 | 1/18
31 h-m-p 1.6000 8.0000 0.0771 YC 1807.696723 1 0.9177 834 | 1/18
32 h-m-p 1.2357 8.0000 0.0573 CC 1807.692517 1 1.0417 874 | 1/18
33 h-m-p 1.6000 8.0000 0.0047 C 1807.692093 0 1.5862 912 | 1/18
34 h-m-p 1.6000 8.0000 0.0025 C 1807.692075 0 1.3371 950 | 1/18
35 h-m-p 1.6000 8.0000 0.0005 C 1807.692074 0 1.3469 988 | 1/18
36 h-m-p 1.6000 8.0000 0.0001 C 1807.692074 0 1.7895 1026 | 1/18
37 h-m-p 1.6000 8.0000 0.0000 C 1807.692074 0 1.9739 1064 | 1/18
38 h-m-p 1.6000 8.0000 0.0000 C 1807.692074 0 1.8830 1102 | 1/18
39 h-m-p 1.6000 8.0000 0.0000 ------C 1807.692074 0 0.0001 1146
Out..
lnL = -1807.692074
1147 lfun, 6882 EigenQcodon, 44733 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1816.119277 S = -1672.360973 -136.675160
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 121 patterns 0:16
did 20 / 121 patterns 0:16
did 30 / 121 patterns 0:17
did 40 / 121 patterns 0:17
did 50 / 121 patterns 0:17
did 60 / 121 patterns 0:17
did 70 / 121 patterns 0:17
did 80 / 121 patterns 0:17
did 90 / 121 patterns 0:17
did 100 / 121 patterns 0:17
did 110 / 121 patterns 0:17
did 120 / 121 patterns 0:17
did 121 / 121 patterns 0:17
Time used: 0:17
Model 7: beta
TREE # 1
(1, 6, ((2, 3), ((4, 7), (5, 8)))); MP score: 127
0.060115 0.039293 0.024179 0.014839 0.091505 0.059248 0.000685 0.007506 0.041500 0.083756 0.019426 0.045097 0.079790 2.133144 0.633447 1.766224
ntime & nrate & np: 13 1 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
np = 16
lnL0 = -1869.425793
Iterating by ming2
Initial: fx= 1869.425793
x= 0.06011 0.03929 0.02418 0.01484 0.09150 0.05925 0.00069 0.00751 0.04150 0.08376 0.01943 0.04510 0.07979 2.13314 0.63345 1.76622
1 h-m-p 0.0000 0.0016 1144.3333 YYYCCCC 1867.267793 6 0.0000 30 | 0/16
2 h-m-p 0.0000 0.0002 285.9688 YCCCC 1865.138022 4 0.0001 56 | 0/16
3 h-m-p 0.0003 0.0020 59.3375 YC 1864.809272 1 0.0002 76 | 0/16
4 h-m-p 0.0005 0.0045 25.3357 YC 1864.712516 1 0.0004 96 | 0/16
5 h-m-p 0.0003 0.0079 27.6592 CCC 1864.655185 2 0.0003 119 | 0/16
6 h-m-p 0.0002 0.0173 36.1163 ++YCC 1864.162074 2 0.0023 143 | 0/16
7 h-m-p 0.0003 0.0048 248.1403 +YYC 1862.615691 2 0.0011 165 | 0/16
8 h-m-p 0.0002 0.0009 409.7352 CCCC 1862.069633 3 0.0002 190 | 0/16
9 h-m-p 0.0006 0.0030 106.6033 CCC 1861.940166 2 0.0002 213 | 0/16
10 h-m-p 0.0008 0.0116 28.5180 CCC 1861.849935 2 0.0007 236 | 0/16
11 h-m-p 0.0005 0.0217 36.5857 +CCC 1861.565765 2 0.0020 260 | 0/16
12 h-m-p 0.0002 0.0045 348.1299 ++YYYYYCC 1853.962705 6 0.0034 288 | 0/16
13 h-m-p 0.0000 0.0001 3013.0780 CCCCC 1853.479725 4 0.0000 315 | 0/16
14 h-m-p 0.0049 0.0247 10.3378 YYYC 1853.280233 3 0.0047 337 | 0/16
15 h-m-p 0.0001 0.0011 424.6025 +YCYYCYCYCC 1845.711128 10 0.0010 372 | 0/16
16 h-m-p 0.0001 0.0007 79.6730 -CC 1845.707823 1 0.0000 394 | 0/16
17 h-m-p 0.0016 0.3003 0.5292 ++CCC 1845.470420 2 0.0349 419 | 0/16
18 h-m-p 0.0040 0.3666 4.6077 ++CYCCC 1841.207837 4 0.0574 463 | 0/16
19 h-m-p 0.7520 4.2371 0.3517 CCCC 1839.331059 3 0.8986 488 | 0/16
20 h-m-p 0.1874 0.9370 0.1822 +CCC 1837.539748 2 0.6729 528 | 0/16
21 h-m-p 0.2051 1.0254 0.0640 ++ 1836.982622 m 1.0254 563 | 1/16
22 h-m-p 0.8992 8.0000 0.0723 YCYY 1836.910351 3 0.6741 603 | 0/16
23 h-m-p 0.0001 0.0011 740.9254 YYYC 1836.899547 3 0.0000 640 | 0/16
24 h-m-p 0.5010 5.4275 0.0244 YC 1836.889369 1 1.0066 660 | 0/16
25 h-m-p 1.6000 8.0000 0.0005 C 1836.888886 0 1.4981 695 | 0/16
26 h-m-p 1.6000 8.0000 0.0003 C 1836.888759 0 2.0891 730 | 0/16
27 h-m-p 1.6000 8.0000 0.0003 C 1836.888743 0 1.3956 765 | 0/16
28 h-m-p 1.6000 8.0000 0.0000 Y 1836.888740 0 2.6835 800 | 0/16
29 h-m-p 1.6000 8.0000 0.0001 ++ 1836.888729 m 8.0000 835 | 0/16
30 h-m-p 0.8988 4.4941 0.0002 +Y 1836.888721 0 2.9630 871 | 0/16
31 h-m-p 0.4534 2.2671 0.0002 +C 1836.888719 0 1.5790 907 | 0/16
32 h-m-p 0.1173 0.5865 0.0002 ++ 1836.888719 m 0.5865 942 | 1/16
33 h-m-p 0.1331 8.0000 0.0007 C 1836.888718 0 0.1545 977 | 1/16
34 h-m-p 1.6000 8.0000 0.0000 Y 1836.888718 0 1.0704 1011 | 1/16
35 h-m-p 1.6000 8.0000 0.0000 C 1836.888718 0 0.6390 1045 | 1/16
36 h-m-p 1.1842 8.0000 0.0000 -----Y 1836.888718 0 0.0003 1084
Out..
lnL = -1836.888718
1085 lfun, 21700 EigenQcodon, 141050 P(t)
Time used: 0:51
Model 8: beta&w>1
TREE # 1
(1, 6, ((2, 3), ((4, 7), (5, 8)))); MP score: 127
0.060115 0.039293 0.024179 0.014839 0.091505 0.059248 0.000685 0.007506 0.041500 0.083756 0.019426 0.045097 0.079790 1.681665 0.900000 0.705643 1.246019 1.300000
ntime & nrate & np: 13 2 18
Bounds (np=18):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
np = 18
lnL0 = -1855.453021
Iterating by ming2
Initial: fx= 1855.453021
x= 0.06011 0.03929 0.02418 0.01484 0.09150 0.05925 0.00069 0.00751 0.04150 0.08376 0.01943 0.04510 0.07979 1.68166 0.90000 0.70564 1.24602 1.30000
1 h-m-p 0.0000 0.0021 1179.0874 YYYCCCC 1853.261748 6 0.0000 32 | 0/18
2 h-m-p 0.0000 0.0002 291.9229 YCCCC 1850.872829 4 0.0001 60 | 0/18
3 h-m-p 0.0003 0.0020 75.7939 CYC 1849.979828 2 0.0003 84 | 0/18
4 h-m-p 0.0003 0.0029 79.5933 YC 1848.555478 1 0.0008 106 | 0/18
5 h-m-p 0.0003 0.0013 222.8503 CC 1847.227751 1 0.0003 129 | 0/18
6 h-m-p 0.0003 0.0031 263.6116 +YYYC 1842.133311 3 0.0010 154 | 0/18
7 h-m-p 0.0005 0.0024 274.3271 CCCC 1838.936059 3 0.0007 181 | 0/18
8 h-m-p 0.0003 0.0016 281.6104 +CYCCC 1831.316171 4 0.0013 210 | 0/18
9 h-m-p 0.0000 0.0000 3636.2030 ++ 1829.579688 m 0.0000 231 | 1/18
10 h-m-p 0.0002 0.0022 241.5681 +CCCC 1828.777756 3 0.0008 259 | 1/18
11 h-m-p 0.0015 0.0074 95.5475 YCCC 1828.396601 3 0.0007 285 | 1/18
12 h-m-p 0.0023 0.0115 15.1354 CCCCC 1826.799883 4 0.0032 314 | 1/18
13 h-m-p 0.0006 0.0048 78.4007 YCCCC 1822.778982 4 0.0011 342 | 1/18
14 h-m-p 0.0004 0.0019 85.9392 CCCCC 1821.534434 4 0.0004 371 | 1/18
15 h-m-p 0.0018 0.0090 18.1477 CCC 1821.440692 2 0.0006 396 | 1/18
16 h-m-p 0.0013 0.0645 8.7954 ++YCCC 1821.028715 3 0.0136 424 | 1/18
17 h-m-p 0.0002 0.0031 657.8214 ++Y
a 0.000728 0.002912 0.003070 0.001831
f 1819.008299 1817.411653 1829.746178 1820.449548
7.280777e-04 1819.008299
8.451565e-04 1818.901071
9.622352e-04 1818.853967
1.079314e-03 1818.867385
1.196393e-03 1818.941908
1.313472e-03 1819.078291
1.430550e-03 1819.277460
1.547629e-03 1819.540505
1.664708e-03 1819.868675
1.781787e-03 1820.263372
1.898865e-03 1820.726133
2.015944e-03 1821.258596
2.133023e-03 1821.862418
2.250102e-03 1822.539029
2.367181e-03 1823.288847
2.484259e-03 1824.108085
2.601338e-03 1824.970905
2.718417e-03 1825.662595
2.835496e-03 1822.924205
2.952574e-03 1817.359646
3.069653e-03 1829.746178
Linesearch2 a4: multiple optima?
Y
a 0.001831 0.002912 0.003070 0.002393
f 1820.449548 1817.411653 1829.746178 1823.464464
1.831011e-03 1820.449548
1.892943e-03 1820.701063
1.954875e-03 1820.972059
2.016807e-03 1821.262783
2.078739e-03 1821.573481
2.140671e-03 1821.904383
2.202603e-03 1822.255689
2.264535e-03 1822.627526
2.326468e-03 1823.019878
2.388400e-03 1823.432430
2.450332e-03 1823.864205
2.512264e-03 1824.312646
2.574196e-03 1824.770990
2.636128e-03 1825.219554
2.698060e-03 1825.590900
2.759992e-03 1825.598455
2.821925e-03 1823.869658
2.883857e-03 1818.460633
2.945789e-03 1817.345049
3.007721e-03 1817.461618
3.069653e-03 1829.746178
Linesearch2 a4: multiple optima?
Y
a 0.002393 0.002912 0.003070 0.002696
f 1823.464464 1817.411653 1829.746178 1825.583807
2.393088e-03 1823.464464
2.426917e-03 1823.698810
2.460745e-03 1823.938547
2.494573e-03 1824.183116
2.528401e-03 1824.431570
2.562230e-03 1824.682265
2.596058e-03 1824.932253
2.629886e-03 1825.175995
2.663714e-03 1825.402507
2.697542e-03 1825.588579
2.731371e-03 1825.681693
2.765199e-03 1825.555689
2.799027e-03 1824.905662
2.832855e-03 1823.128984
2.866684e-03 1819.960814
2.900512e-03 1817.641209
2.934340e-03 1817.328907
2.968168e-03 1817.397402
3.001997e-03 1817.478024
3.035825e-03 1816.665036
3.069653e-03 1829.746178
Linesearch2 a4: multiple optima?
YCYYYC 1817.328092 8 0.0029 519 | 1/18
18 h-m-p 0.0070 0.0351 2.5630 +YYY
a 0.017857 0.023309 0.028089 0.025150
f 1817.164789 1816.299114 1816.390283 1816.415090
1.785699e-02 1817.164789
1.836860e-02 1817.156228
1.888022e-02 1817.143052
1.939184e-02 1817.120225
1.990346e-02 1817.077053
2.041508e-02 1816.992049
2.092670e-02 1816.829829
2.143832e-02 1816.564914
2.194993e-02 1816.268953
2.246155e-02 1816.133613
2.297317e-02 1816.213945
2.348479e-02 1816.335465
2.399641e-02 1816.396645
2.450803e-02 1816.414390
2.501965e-02 1816.415720
2.553127e-02 1816.412412
2.604288e-02 1816.408040
2.655450e-02 1816.403472
2.706612e-02 1816.398883
2.757774e-02 1816.394345
Linesearch2 a4: multiple optima?
CYCYC 1816.133403 7 0.0225 570 | 1/18
19 h-m-p 0.0859 1.7470 0.6709 Y
a 0.000000 0.085887 0.343549 0.064118
f 1816.133403 1815.990040 1819.049027 1816.259091
0.000000e+00 1816.133403
1.717745e-02 1816.818304
3.435489e-02 1816.647629
5.153234e-02 1816.420981
6.870979e-02 1816.201171
8.588723e-02 1815.990040
1.030647e-01 1815.787763
1.202421e-01 1815.595154
1.374196e-01 1815.415088
1.545970e-01 1815.254908
1.717745e-01 1815.131210
1.889519e-01 1815.079531
2.061294e-01 1815.161838
2.233068e-01 1815.443866
2.404843e-01 1815.938314
2.576617e-01 1816.578721
2.748391e-01 1817.258804
2.920166e-01 1817.885104
3.091940e-01 1818.401294
3.263715e-01 1818.787522
Linesearch2 a4: multiple optima?
YCCYCCCC 1815.079495 8 0.1885 624 | 0/18
20 h-m-p 0.0000 0.0001 12104.4710 YCCC 1813.192303 3 0.0000 667 | 0/18
21 h-m-p 0.3499 1.7494 0.1971 ++ 1811.545579 m 1.7494 688 | 1/18
22 h-m-p 0.2016 1.0080 1.1350 YCCYCYCC 1811.298358 7 0.0600 738 | 1/18
23 h-m-p 0.2070 6.6864 0.3291 CC 1811.206476 1 0.2089 761 | 0/18
24 h-m-p 0.0000 0.0000 280393.2415 YCCC 1811.138981 3 0.0000 804 | 0/18
25 h-m-p 0.0998 0.5328 0.5610 ++ 1810.804736 m 0.5328 825 | 1/18
26 h-m-p 0.8362 6.3073 0.3575 CCC 1810.456139 2 0.9927 868 | 0/18
27 h-m-p 0.0000 0.0000 49974.4883 -C 1810.451267 0 0.0000 907 | 0/18
28 h-m-p 0.0432 8.0000 0.5500 ++YCCC 1809.568037 3 1.5137 935 | 0/18
29 h-m-p 0.5181 2.5903 0.3047 +YC 1809.087350 1 1.6238 976 | 0/18
30 h-m-p 0.2906 1.4531 0.0199 ++ 1808.991361 m 1.4531 1015 | 0/18
31 h-m-p -0.0000 -0.0000 0.0233
h-m-p: -0.00000000e+00 -0.00000000e+00 2.32865381e-02 1808.991361
.. | 0/18
32 h-m-p 0.0000 0.0015 33.6910 +CYC 1808.963804 2 0.0001 1094 | 0/18
33 h-m-p 0.0001 0.0011 30.0215 YC 1808.933502 1 0.0001 1116 | 0/18
34 h-m-p 0.0008 0.0286 3.7627 YC 1808.931124 1 0.0003 1138 | 0/18
35 h-m-p 0.0006 0.1000 2.2946 YC 1808.930531 1 0.0003 1160 | 0/18
36 h-m-p 0.0006 0.0732 1.1327 +CYYCC 1808.789167 4 0.0038 1188 | 0/18
37 h-m-p 0.0000 0.0001 677.6730 ----Y 1808.789165 0 0.0000 1213 | 0/18
38 h-m-p 0.0001 0.0614 1.6200 C 1808.789074 0 0.0002 1234 | 0/18
39 h-m-p 0.0008 0.1996 0.3211 Y 1808.789049 0 0.0005 1255 | 0/18
40 h-m-p 0.0011 0.5389 0.6953 C 1808.788928 0 0.0015 1294 | 0/18
41 h-m-p 0.0003 0.1240 3.0035 +C 1808.788494 0 0.0013 1334 | 0/18
42 h-m-p 0.0010 0.1374 3.6702 C 1808.788083 0 0.0009 1355 | 0/18
43 h-m-p 0.0007 0.1758 4.6865 C 1808.787614 0 0.0009 1376 | 0/18
44 h-m-p 0.0008 0.0421 5.4759 +YC 1808.786368 1 0.0021 1399 | 0/18
45 h-m-p 0.0007 0.0078 17.3778 CC 1808.784608 1 0.0010 1422 | 0/18
46 h-m-p 0.0044 0.0267 3.8449 -C 1808.784498 0 0.0003 1444 | 0/18
47 h-m-p 0.0023 0.1789 0.4827 Y 1808.784452 0 0.0011 1465 | 0/18
48 h-m-p 0.0027 1.3365 0.2056 C 1808.784416 0 0.0024 1504 | 0/18
49 h-m-p 0.0160 8.0000 0.4850 ++C 1808.775589 0 0.2540 1545 | 0/18
50 h-m-p 1.6000 8.0000 0.0505 CC 1808.756435 1 1.9222 1586 | 0/18
51 h-m-p 1.4134 8.0000 0.0687 ++ 1808.424092 m 8.0000 1625 | 0/18
52 h-m-p 0.0596 0.4511 9.2152 CCCC 1808.175052 3 0.0785 1670 | 0/18
53 h-m-p 1.5809 8.0000 0.4578 YCCC 1808.025764 3 0.6772 1696 | 0/18
54 h-m-p 0.6929 3.4647 0.1835 CYC 1807.795215 2 1.2537 1738 | 0/18
55 h-m-p 1.6000 8.0000 0.0078 CCC 1807.706424 2 1.8114 1781 | 0/18
56 h-m-p 0.2776 8.0000 0.0507 +CC 1807.698657 1 1.4943 1823 | 0/18
57 h-m-p 1.6000 8.0000 0.0187 YC 1807.697464 1 1.1113 1863 | 0/18
58 h-m-p 1.6000 8.0000 0.0021 C 1807.697128 0 1.4826 1902 | 0/18
59 h-m-p 1.3025 8.0000 0.0024 ++ 1807.696650 m 8.0000 1941 | 0/18
60 h-m-p 1.6000 8.0000 0.0021 +C 1807.694763 0 6.0382 1981 | 0/18
61 h-m-p 1.0132 5.0661 0.0062 +YC 1807.693104 1 2.6412 2022 | 0/18
62 h-m-p 0.6403 3.2017 0.0053 +YC 1807.692794 1 1.8023 2063 | 0/18
63 h-m-p 0.3539 1.7694 0.0017 ++ 1807.692725 m 1.7694 2102 | 1/18
64 h-m-p 1.1752 5.8759 0.0018 ----------------.. | 1/18
65 h-m-p 0.0008 0.4127 0.1562 Y 1807.692720 0 0.0004 2193 | 1/18
66 h-m-p 0.0127 6.3356 0.3421 ---C 1807.692719 0 0.0001 2234 | 1/18
67 h-m-p 0.0006 0.3124 0.3563 Y 1807.692711 0 0.0005 2272 | 1/18
68 h-m-p 0.0009 0.4639 0.2362 Y 1807.692708 0 0.0004 2310 | 1/18
69 h-m-p 0.0068 3.4221 0.0427 -C 1807.692708 0 0.0004 2349 | 1/18
70 h-m-p 0.0041 2.0439 0.0293 -C 1807.692707 0 0.0003 2388 | 1/18
71 h-m-p 0.0160 8.0000 0.0083 -Y 1807.692707 0 0.0005 2427 | 1/18
72 h-m-p 0.0160 8.0000 0.0058 -Y 1807.692707 0 0.0007 2466 | 1/18
73 h-m-p 0.0160 8.0000 0.0039 -C 1807.692707 0 0.0010 2505 | 1/18
74 h-m-p 0.0160 8.0000 0.0027 -C 1807.692707 0 0.0013 2544 | 1/18
75 h-m-p 0.0160 8.0000 0.0059 -C 1807.692707 0 0.0009 2583 | 1/18
76 h-m-p 0.0160 8.0000 0.0192 Y 1807.692707 0 0.0023 2621 | 1/18
77 h-m-p 0.0160 8.0000 0.1279 C 1807.692706 0 0.0048 2659 | 1/18
78 h-m-p 0.0079 3.9648 1.0302 -Y 1807.692704 0 0.0009 2698 | 1/18
79 h-m-p 0.0160 8.0000 0.0595 -Y 1807.692704 0 0.0007 2720 | 1/18
80 h-m-p 0.0247 8.0000 0.0017 +Y 1807.692704 0 0.0652 2759 | 1/18
81 h-m-p 0.0160 8.0000 0.3073 -C 1807.692704 0 0.0010 2798 | 1/18
82 h-m-p 0.3506 8.0000 0.0009 +C 1807.692703 0 1.4359 2837 | 1/18
83 h-m-p 1.6000 8.0000 0.0001 C 1807.692703 0 1.6000 2875 | 1/18
84 h-m-p 0.9704 8.0000 0.0001 +Y 1807.692703 0 2.4317 2914 | 1/18
85 h-m-p 1.6000 8.0000 0.0001 Y 1807.692703 0 1.0223 2952 | 1/18
86 h-m-p 1.6000 8.0000 0.0000 C 1807.692703 0 0.5235 2990 | 1/18
87 h-m-p 1.0115 8.0000 0.0000 ------------C 1807.692703 0 0.0000 3040
Out..
lnL = -1807.692703
3041 lfun, 66902 EigenQcodon, 434863 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1816.765509 S = -1672.391440 -138.241395
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 121 patterns 2:36
did 20 / 121 patterns 2:37
did 30 / 121 patterns 2:37
did 40 / 121 patterns 2:37
did 50 / 121 patterns 2:37
did 60 / 121 patterns 2:37
did 70 / 121 patterns 2:38
did 80 / 121 patterns 2:38
did 90 / 121 patterns 2:38
did 100 / 121 patterns 2:38
did 110 / 121 patterns 2:38
did 120 / 121 patterns 2:38
did 121 / 121 patterns 2:38
Time used: 2:39
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=8, Len=277
Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3 MVCLKLPGGSSLAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGT
Aotus_nancymaae_Aotidae_Haplorrhini_XP_012296108.1_LOC105708938 MVCLRLPGGSYVAALTVTLMVLSSPLALVGDTRPRFLELVKHECHFFNGT
Cebus_capucinus_imitator_Cebidae_Haplorrhini_XP_017378231.1_LOC108300090 MVCLRLPGGFCMAALTVTLMVLSSPLALAGDTRPRFLEQAKSECHFFNGT
Cercocebus_atys_Cercopithecidae_Haplorrhini_XP_011895433.1_LOC105576724 MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTRPRFLEQVKSECHFFNGT
Colobus_angolensis_palliatus_Cercopithecidae_Haplorrhini_XP_011784781.1_LOC105502761 MVCLKLPGGSYMAALTVTLMVLSSPLALAGDTQPRFLEQFKSECHFFNGT
Pan_paniscus_Hominidae_Haplorrhini_XP_003829806.1_ MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTRSRFLELVKSECHFFNGT
Papio_anubis_Cercopithecidae_Haplorrhini_XP_009198027.2_LOC101001669 -----------MAALTVTLMVLSSPLALAGDTRPHFLEQGKSECHFFNGT
Piliocolobus_tephrosceles_Cercopithecidae_Haplorrhini_XP_023057332.1_LOC111535153 MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTRPRFLEYSTSECHFFNGT
:************ **:.***:.:*** . ********
Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3 ERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQK
Aotus_nancymaae_Aotidae_Haplorrhini_XP_012296108.1_LOC105708938 ERVRYLDRYIHNQEEVVRFDSDVGEYRAVTELGRPDAEYWNSQKDYVEQK
Cebus_capucinus_imitator_Cebidae_Haplorrhini_XP_017378231.1_LOC108300090 ERVRYLQRYFYNQEEYVRFDSDVGEYRAVTELGRPSAEYWNSQKELLEQK
Cercocebus_atys_Cercopithecidae_Haplorrhini_XP_011895433.1_LOC105576724 ERVRFLERHFYNQEEFVRFDSDVGEYRAVSELGRPVAESWNSQKDLLEQK
Colobus_angolensis_palliatus_Cercopithecidae_Haplorrhini_XP_011784781.1_LOC105502761 ERVRYLQRYFYNQEEYVRYDSDVGEYRAVTELGRPDAKYWNSQKDILEQR
Pan_paniscus_Hominidae_Haplorrhini_XP_003829806.1_ ERVRFLERYFYNQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDYVEQK
Papio_anubis_Cercopithecidae_Haplorrhini_XP_009198027.2_LOC101001669 ERVRFLERHFYNQEEYLRFDSDVGEYRAVSELGRPTAESWNSQKDYLEQK
Piliocolobus_tephrosceles_Cercopithecidae_Haplorrhini_XP_023057332.1_LOC111535153 ERVRYLDRYFYNQEETLRFDSDVGEYRAVTELGRPDAEYWNSQKDILEDQ
****:*:*:::**** :*:**********:***** *: *****: :*::
Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3 RGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSG
Aotus_nancymaae_Aotidae_Haplorrhini_XP_012296108.1_LOC105708938 RGQVDNYCRHNYGVFESFTVQRRVQPKMTVYPAKTQPLQHHNLLVCSVSG
Cebus_capucinus_imitator_Cebidae_Haplorrhini_XP_017378231.1_LOC108300090 RGQVDNYCRHNYRVGESFTVQRRVQPKVTVYPAKTQPLQHHSLLVCSVSG
Cercocebus_atys_Cercopithecidae_Haplorrhini_XP_011895433.1_LOC105576724 RGQVDNYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHTLLVCSVSG
Colobus_angolensis_palliatus_Cercopithecidae_Haplorrhini_XP_011784781.1_LOC105502761 RARVDNYCRHNYGVGESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNG
Pan_paniscus_Hominidae_Haplorrhini_XP_003829806.1_ RGQVDNYCRHNYRVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVNG
Papio_anubis_Cercopithecidae_Haplorrhini_XP_009198027.2_LOC101001669 RGQVDNYCRHNYGVGESFTVQRRVQPKVTVYPAKTQPLQHHTLLVCSVNG
Piliocolobus_tephrosceles_Cercopithecidae_Haplorrhini_XP_023057332.1_LOC111535153 RASVDNYCRYNYGVGESFTVQRRVQPKVTVYPAKTQPLQHHNLLVCSVNG
*. ******:** * *********:*::****:********.******.*
Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3 FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY
Aotus_nancymaae_Aotidae_Haplorrhini_XP_012296108.1_LOC105708938 FYPGSIEVRWFRNNQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
Cebus_capucinus_imitator_Cebidae_Haplorrhini_XP_017378231.1_LOC108300090 FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
Cercocebus_atys_Cercopithecidae_Haplorrhini_XP_011895433.1_LOC105576724 FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY
Colobus_angolensis_palliatus_Cercopithecidae_Haplorrhini_XP_011784781.1_LOC105502761 FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
Pan_paniscus_Hominidae_Haplorrhini_XP_003829806.1_ FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY
Papio_anubis_Cercopithecidae_Haplorrhini_XP_009198027.2_LOC101001669 FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
Piliocolobus_tephrosceles_Cercopithecidae_Haplorrhini_XP_023057332.1_LOC111535153 FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
*************.******************************:*****
Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3 TCQVEHPSVTSALTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
Aotus_nancymaae_Aotidae_Haplorrhini_XP_012296108.1_LOC105708938 TCQVEHPSVTTPITVQWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
Cebus_capucinus_imitator_Cebidae_Haplorrhini_XP_017378231.1_LOC108300090 TCQVEHPSVMSPLTVQWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
Cercocebus_atys_Cercopithecidae_Haplorrhini_XP_011895433.1_LOC105576724 TCQVEHPSVTSPLTVQWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
Colobus_angolensis_palliatus_Cercopithecidae_Haplorrhini_XP_011784781.1_LOC105502761 TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
Pan_paniscus_Hominidae_Haplorrhini_XP_003829806.1_ TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
Papio_anubis_Cercopithecidae_Haplorrhini_XP_009198027.2_LOC101001669 TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
Piliocolobus_tephrosceles_Cercopithecidae_Haplorrhini_XP_023057332.1_LOC111535153 TCQVEHPSVTSPLTVEWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
********* :.:**:***:******************************
Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3 RNQKGHSGLQPTGFLS-----------
Aotus_nancymaae_Aotidae_Haplorrhini_XP_012296108.1_LOC105708938 RNQKGGSGLQPTGLLS-----------
Cebus_capucinus_imitator_Cebidae_Haplorrhini_XP_017378231.1_LOC108300090 RNQKGRSGLQPTGLLS-----------
Cercocebus_atys_Cercopithecidae_Haplorrhini_XP_011895433.1_LOC105576724 RNQKGHSGLQPTGLLS-----------
Colobus_angolensis_palliatus_Cercopithecidae_Haplorrhini_XP_011784781.1_LOC105502761 RNQKGHSGLHPTGLLS-----------
Pan_paniscus_Hominidae_Haplorrhini_XP_003829806.1_ RNQKGHSGLQPTGFLS-----------
Papio_anubis_Cercopithecidae_Haplorrhini_XP_009198027.2_LOC101001669 RNQKGLLSooooooooooooooooooo
Piliocolobus_tephrosceles_Cercopithecidae_Haplorrhini_XP_023057332.1_LOC111535153 RNQKGHTGLQPTGLLS-----------
***** .
>Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3 ATGGTGTGTCTGAAGCTCCCTGGAGGCTCCAGCTTGGCAGCGTTGACAGT GACACTGATGGTGCTGAGCTCCCGACTGGCTTTCGCTGGGGACACCCGAC CACGTTTCTTGGAGCTGCGTAAGTCTGAGTGTCATTTCTTCAATGGGACG GAGCGGGTGCGGTACCTGGACAGATACTTCCATAACCAGGAGGAGTTCCT GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC GGCCTGTCGCCGAGTCCTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAG CGGGGCCGGGTGGACAATTACTGCAGACACAACTACGGGGTTGGTGAGAG CTTCACAGTGCAGCGGCGAGTCCATCCTCAGGTGACTGTGTATCCTGCAA AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAGTGGT TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA GAAGGCTGGGGTGGTGTCCACGGGCCTGATCCAGAATGGAGACTGGACCT TCCAGACCCTGGTGATGCTAGAAACAGTTCCTCGGAGTGGAGAGGTTTAC ACTTGCCAAGTGGAGCACCCAAGCGTAACGAGCGCTCTCACAGTGGAATG GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTGTTCATCTACTTC AGGAATCAGAAAGGACACTCTGGACTTCAGCCAACAGGATTCCTGAGC-- ------------------------------- >Aotus_nancymaae_Aotidae_Haplorrhini_XP_012296108.1_LOC105708938 ATGGTGTGTCTGAGGCTCCCTGGAGGCTCCTACGTGGCAGCGCTGACAGT GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGTTGGGGACACCCGAC CACGTTTCTTGGAGCTGGTTAAGCATGAGTGTCATTTCTTCAACGGGACG GAGCGGGTGCGGTACCTGGACAGATACATCCATAACCAGGAGGAGGTCGT GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC GGCCTGACGCCGAGTACTGGAACAGCCAGAAGGACTACGTGGAGCAGAAG CGGGGCCAGGTGGACAACTACTGCAGACACAACTACGGGGTTTTTGAGAG CTTCACAGTGCAGCGGAGAGTCCAACCTAAGATGACTGTGTATCCTGCAA AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAGTGGT TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACAACCAGGAAGA GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCT TCCAGACCCTGGTGATGCTGGAAACCGTTCCTCAGAGTGGAGAGGTTTAC ACCTGCCAAGTGGAGCACCCAAGTGTGACGACCCCTATCACAGTGCAATG GAGAGCACAGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCAGGGCTGTTCATCTACTTC AGGAATCAGAAAGGAGGCTCTGGACTTCAGCCAACAGGACTCCTGAGC-- ------------------------------- >Cebus_capucinus_imitator_Cebidae_Haplorrhini_XP_017378231.1_LOC108300090 ATGGTGTGTCTGAGGCTCCCTGGAGGCTTCTGCATGGCAGCGCTGACAGT GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC CACGTTTCTTGGAGCAGGCTAAGTCTGAGTGTCATTTCTTCAACGGGACG GAGCGGGTGCGGTACCTGCAGAGATACTTCTATAACCAGGAGGAGTATGT GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC GGCCTAGCGCAGAGTACTGGAACAGCCAGAAGGAACTCCTGGAGCAGAAG CGGGGCCAGGTGGACAACTACTGCAGACACAACTACCGGGTTGGCGAGAG CTTCACAGTGCAGCGGAGAGTCCAACCTAAGGTGACTGTGTATCCTGCAA AGACCCAGCCCCTGCAGCACCACAGCCTCCTGGTCTGCTCTGTGAGTGGG TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCT TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCAGAGTGGAGAGGTTTAC ACCTGCCAAGTGGAGCACCCAAGCGTGATGAGCCCTCTCACAGTGCAATG GAGAGCACAGTCTGAATCTGCACAGAGTAAGATGCTGAGTGGAGTCGGGG GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCAGGGCTGTTCATCTACTTC AGGAATCAGAAAGGACGCTCTGGACTTCAGCCAACAGGACTCCTGAGC-- ------------------------------- >Cercocebus_atys_Cercopithecidae_Haplorrhini_XP_011895433.1_LOC105576724 ATGGTGTGTCTGAAGCTCCCTGGAGGCTCCTGCATGGCAGCTCTGACAGT GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC CACGTTTCTTGGAGCAGGTTAAGTCTGAGTGTCATTTCTTCAACGGGACG GAGCGGGTGCGGTTCCTGGAGAGACACTTCTATAACCAGGAGGAGTTCGT GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGTCGGAGCTGGGGC GGCCTGTCGCCGAGTCCTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAG CGGGGCCAGGTGGACAACTACTGCAGATACAACTACGGGGTTGTGGAGAG CTTCACAGTGCAGCGGCGAGTCCAACCTAAGGTGACTGTGTATCCTTCAA AGACCCAGCCTCTGCAGCACCACACCCTCCTGGTCTGCTCTGTGAGTGGT TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCT TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCGGAGTGGAGAGGTTTAC ACCTGCCAAGTGGAGCACCCAAGCGTGACGAGCCCTCTCACAGTGCAATG GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTGTTCATCTACTTC AGGAATCAGAAAGGACACTCTGGACTTCAGCCAACAGGACTCCTGAGC-- ------------------------------- >Colobus_angolensis_palliatus_Cercopithecidae_Haplorrhini_XP_011784781.1_LOC105502761 ATGGTGTGTCTGAAGCTCCCTGGAGGCTCCTATATGGCAGCTCTGACAGT GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACTCAAC CACGTTTCTTGGAGCAGTTTAAGTCTGAGTGTCACTTCTTCAACGGGACG GAGCGGGTGCGGTACCTGCAGAGATACTTCTATAACCAGGAGGAGTACGT GCGCTACGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC GGCCTGACGCCAAGTACTGGAACAGCCAGAAGGACATCCTGGAGCAGAGG CGGGCCCGGGTGGACAACTACTGCAGACACAACTACGGGGTTGGTGAGAG CTTCACAGTGCAGCGGCGAGTCCAACCTAAGGTGACTGTGTATCCTTCAA AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAATGGT TTCTACCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCT TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCAGAGTGGAGAGGTTTAC ACCTGCCAAGTGGAGCACCCAAGCGTGACGAGCCCTCTCACAGTGGAATG GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCTGGGCTGTTCATCTACTTC AGGAATCAGAAAGGACACTCTGGACTTCACCCAACAGGACTCCTGAGC-- ------------------------------- >Pan_paniscus_Hominidae_Haplorrhini_XP_003829806.1_ ATGGTGTGTTTGAAGCTCCCTGGAGGCTCCTGCATGGCAGCGCTGACAGT GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAT CACGTTTCTTGGAGCTGGTTAAGTCTGAGTGTCATTTCTTCAATGGGACG GAGCGGGTGCGGTTCCTGGAGAGATACTTCTATAACCAGGAGGAGTACGT GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC GGCCTGATGCCGAGTACTGGAACAGCCAGAAGGACTACGTGGAGCAGAAG CGGGGCCAGGTGGACAATTACTGCAGACACAACTACAGGGTTGGTGAGAG CTTCACAGTGCAGCGGCGAGTCCATCCTCAGGTGACTGTGTATCCTGCAA AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAATGGT TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAATGGCCAGGAAGA GAAGGCTGGGGTGGTGTCCACGGGCCTGATCCAGAATGGAGACTGGACCT TCCAGACCCTGGTGATGCTAGAAACAGTTCCTCGGAGTGGAGAGGTTTAC ACCTGCCAAGTGGAGCACCCAAGCGTAACGAGCCCTCTCACAGTGGAATG GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTGTTCATCTACTTC AGGAATCAGAAAGGACACTCTGGACTTCAGCCAACAGGATTCCTGAGC-- ------------------------------- >Papio_anubis_Cercopithecidae_Haplorrhini_XP_009198027.2_LOC101001669 ---------------------------------ATGGCAGCTCTGACAGT GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC CACATTTCTTGGAGCAGGGTAAGTCTGAGTGTCATTTCTTCAATGGGACG GAGCGGGTGCGGTTCCTGGAGAGACACTTCTATAACCAGGAGGAGTACCT GCGCTTCGACAGCGACGTAGGGGAGTACCGGGCGGTGTCGGAGCTGGGGC GGCCTACCGCCGAGTCCTGGAACAGCCAGAAGGACTACCTGGAGCAGAAG CGGGGCCAGGTGGACAACTACTGCAGACACAACTACGGGGTTGGTGAGAG CTTCACAGTGCAGCGGCGAGTCCAACCTAAGGTGACTGTGTATCCTGCAA AGACCCAGCCCCTGCAGCACCACACCCTCCTGGTCTGCTCTGTGAACGGT TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAATGGCCAGGAAGA GAAGGCTGGGGTGGTCTCCACAGGCCTGATCCAGAATGGAGACTGGACCT TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCAGAGTGGAGAGGTTTAC ACCTGCCAAGTGGAGCACCCAAGCGTGACCAGCCCTCTCACAGTGGAATG GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG GTTTTGTGCTGGGCCTGCTCTTCCTTGGGGCTGGGCTGTTCATCTACTTC AGGAATCAGAAAGGACTCCTGAGC-------------------------- ------------------------------- >Piliocolobus_tephrosceles_Cercopithecidae_Haplorrhini_XP_023057332.1_LOC111535153 ATGGTGTGTCTGAAGCTCCCTGGAGGCTCCTGCATGGCAGCTCTGACAGT GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC CACGTTTCTTGGAGTATTCTACATCTGAGTGTCACTTCTTCAACGGGACG GAGCGGGTGCGGTACCTGGATAGATACTTCTACAACCAGGAGGAGACCCT GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC GGCCTGACGCCGAGTACTGGAACAGCCAGAAGGACATCCTGGAAGACCAG CGGGCCTCGGTGGACAATTACTGCAGATACAACTACGGGGTTGGTGAGAG CTTCACAGTGCAGCGGCGAGTCCAACCTAAGGTGACTGTGTATCCTGCAA AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAATGGT TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCT TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCAGAGTGGAGAGGTTTAC ACCTGCCAAGTGGAGCACCCAAGCGTGACCAGCCCTCTCACAGTGGAATG GAGAGCACAGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTGTTCATCTACTTC AGGAATCAGAAAGGACACACTGGACTTCAGCCAACAGGACTCCTGAGC-- -------------------------------
>Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3 MVCLKLPGGSSLAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGT ERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQK RGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSG FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY TCQVEHPSVTSALTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF RNQKGHSGLQPTGFLS >Aotus_nancymaae_Aotidae_Haplorrhini_XP_012296108.1_LOC105708938 MVCLRLPGGSYVAALTVTLMVLSSPLALVGDTRPRFLELVKHECHFFNGT ERVRYLDRYIHNQEEVVRFDSDVGEYRAVTELGRPDAEYWNSQKDYVEQK RGQVDNYCRHNYGVFESFTVQRRVQPKMTVYPAKTQPLQHHNLLVCSVSG FYPGSIEVRWFRNNQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY TCQVEHPSVTTPITVQWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF RNQKGGSGLQPTGLLS >Cebus_capucinus_imitator_Cebidae_Haplorrhini_XP_017378231.1_LOC108300090 MVCLRLPGGFCMAALTVTLMVLSSPLALAGDTRPRFLEQAKSECHFFNGT ERVRYLQRYFYNQEEYVRFDSDVGEYRAVTELGRPSAEYWNSQKELLEQK RGQVDNYCRHNYRVGESFTVQRRVQPKVTVYPAKTQPLQHHSLLVCSVSG FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY TCQVEHPSVMSPLTVQWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF RNQKGRSGLQPTGLLS >Cercocebus_atys_Cercopithecidae_Haplorrhini_XP_011895433.1_LOC105576724 MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTRPRFLEQVKSECHFFNGT ERVRFLERHFYNQEEFVRFDSDVGEYRAVSELGRPVAESWNSQKDLLEQK RGQVDNYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHTLLVCSVSG FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY TCQVEHPSVTSPLTVQWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF RNQKGHSGLQPTGLLS >Colobus_angolensis_palliatus_Cercopithecidae_Haplorrhini_XP_011784781.1_LOC105502761 MVCLKLPGGSYMAALTVTLMVLSSPLALAGDTQPRFLEQFKSECHFFNGT ERVRYLQRYFYNQEEYVRYDSDVGEYRAVTELGRPDAKYWNSQKDILEQR RARVDNYCRHNYGVGESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNG FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF RNQKGHSGLHPTGLLS >Pan_paniscus_Hominidae_Haplorrhini_XP_003829806.1_ MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTRSRFLELVKSECHFFNGT ERVRFLERYFYNQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDYVEQK RGQVDNYCRHNYRVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVNG FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF RNQKGHSGLQPTGFLS >Papio_anubis_Cercopithecidae_Haplorrhini_XP_009198027.2_LOC101001669 -----------MAALTVTLMVLSSPLALAGDTRPHFLEQGKSECHFFNGT ERVRFLERHFYNQEEYLRFDSDVGEYRAVSELGRPTAESWNSQKDYLEQK RGQVDNYCRHNYGVGESFTVQRRVQPKVTVYPAKTQPLQHHTLLVCSVNG FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF RNQKGLLS-------- >Piliocolobus_tephrosceles_Cercopithecidae_Haplorrhini_XP_023057332.1_LOC111535153 MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTRPRFLEYSTSECHFFNGT ERVRYLDRYFYNQEETLRFDSDVGEYRAVTELGRPDAEYWNSQKDILEDQ RASVDNYCRYNYGVGESFTVQRRVQPKVTVYPAKTQPLQHHNLLVCSVNG FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY TCQVEHPSVTSPLTVEWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF RNQKGHTGLQPTGLLS
#NEXUS
[ID: 3608949311]
begin trees;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3:0.028873,Pan_paniscus_Hominidae_Haplorrhini_XP_003829806.1_:0.013615,((Aotus_nancymaae_Aotidae_Haplorrhini_XP_012296108.1_LOC105708938:0.040243,Cebus_capucinus_imitator_Cebidae_Haplorrhini_XP_017378231.1_LOC108300090:0.024509)1.00:0.011195,((Cercocebus_atys_Cercopithecidae_Haplorrhini_XP_011895433.1_LOC105576724:0.015735,Papio_anubis_Cercopithecidae_Haplorrhini_XP_009198027.2_LOC101001669:0.037842)0.95:0.009387,(Colobus_angolensis_palliatus_Cercopithecidae_Haplorrhini_XP_011784781.1_LOC105502761:0.021023,Piliocolobus_tephrosceles_Cercopithecidae_Haplorrhini_XP_023057332.1_LOC111535153:0.034736)0.97:0.008054)0.66:0.003303)1.00:0.017335);
[Note: This tree contains information only on the topology
and branch lengths (mean of the posterior probability density).]
tree con_50_majrule = (Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3:0.028873,Pan_paniscus_Hominidae_Haplorrhini_XP_003829806.1_:0.013615,((Aotus_nancymaae_Aotidae_Haplorrhini_XP_012296108.1_LOC105708938:0.040243,Cebus_capucinus_imitator_Cebidae_Haplorrhini_XP_017378231.1_LOC108300090:0.024509):0.011195,((Cercocebus_atys_Cercopithecidae_Haplorrhini_XP_011895433.1_LOC105576724:0.015735,Papio_anubis_Cercopithecidae_Haplorrhini_XP_009198027.2_LOC101001669:0.037842):0.009387,(Colobus_angolensis_palliatus_Cercopithecidae_Haplorrhini_XP_011784781.1_LOC105502761:0.021023,Piliocolobus_tephrosceles_Cercopithecidae_Haplorrhini_XP_023057332.1_LOC111535153:0.034736):0.008054):0.003303):0.017335);
end;
Estimated marginal likelihoods for runs sampled in files
"/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1980.50 -1997.15
2 -1980.38 -1998.75
--------------------------------------
TOTAL -1980.44 -1998.24
--------------------------------------
Model parameter summaries over the runs sampled in files
"/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Summaries are based on a total of 15002 samples from 2 runs)
(Each run produced 10001 samples of which 7501 samples were included)
95% Cred. Interval
----------------------
Parameter Mean Variance Lower Upper Median PSRF *
---------------------------------------------------------------------------------------------
TL{all} 0.265317 0.000885 0.212000 0.329000 0.263000 1.000
r(A<->C){all} 0.101350 0.000840 0.051181 0.164004 0.098791 1.000
r(A<->G){all} 0.168862 0.001157 0.109084 0.242242 0.166530 1.000
r(A<->T){all} 0.210862 0.002079 0.129527 0.306510 0.208112 1.000
r(C<->G){all} 0.094341 0.000483 0.056313 0.141940 0.092704 1.000
r(C<->T){all} 0.340278 0.002551 0.245988 0.442625 0.338700 1.000
r(G<->T){all} 0.084306 0.000597 0.042649 0.137257 0.082479 1.002
pi(A){all} 0.216659 0.000197 0.189988 0.244904 0.216516 1.000
pi(C){all} 0.261869 0.000218 0.233643 0.291465 0.261522 1.000
pi(G){all} 0.316085 0.000245 0.286490 0.346889 0.315873 1.000
pi(T){all} 0.205388 0.000185 0.179485 0.232576 0.205199 1.000
alpha{1,2} 28.084679 2735.050281 0.173688 179.276444 0.846342 1.003
alpha{3} 100.482318 3261.914324 7.034359 194.807984 99.861952 1.000
pinvar{all} 0.694802 0.009037 0.471945 0.815786 0.712470 1.003
---------------------------------------------------------------------------------------------
* Convergence diagnostic (PSRF = Potential scale reduction factor [Gelman
and Rubin, 1992], uncorrected) should approach 1 as runs converge. The
values may be unreliable if you have a small number of samples. PSRF should
only be used as a rough guide to convergence since all the assumptions
that allow one to interpret it as a scale reduction factor are not met in
the phylogenetic context.
CODONML (in paml version 4.5, December 2011) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches
Codon frequency model: F3x4
Site-class models:
ns = 8 ls = 247
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------
Phe TTT 1 2 1 1 2 1 | Ser TCT 5 4 5 5 5 5 | Tyr TAT 2 2 4 3 2 3 | Cys TGT 1 1 1 1 1 1
TTC 14 11 12 14 11 13 | TCC 3 2 2 3 2 2 | TAC 7 9 8 6 11 9 | TGC 3 3 3 3 3 3
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 2 2 2 2 2 | TCG 0 0 0 1 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 4 5 5 6 5 5 | His CAT 3 3 1 1 0 2 | Arg CGT 2 1 1 1 1 1
CTC 4 2 4 4 3 3 | CCC 1 1 1 0 1 1 | CAC 5 4 4 5 6 5 | CGC 1 1 2 1 1 1
CTA 1 0 0 0 0 1 | CCA 3 4 4 4 4 3 | Gln CAA 1 3 3 3 3 1 | CGA 3 1 1 2 1 2
CTG 16 16 16 16 16 15 | CCG 0 0 0 0 0 0 | CAG 12 14 16 13 14 13 | CGG 10 7 8 9 9 9
--------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 2 1 1 1 2 1 | Asn AAT 4 2 2 2 3 6 | Ser AGT 3 4 4 3 2 2
ATC 2 4 2 2 3 2 | ACC 4 7 5 6 4 5 | AAC 5 8 6 6 7 4 | AGC 8 6 9 8 8 8
ATA 0 0 0 0 0 0 | ACA 5 5 6 6 6 5 | Lys AAA 1 1 1 1 1 1 | Arg AGA 3 4 4 3 3 3
Met ATG 3 4 5 4 4 4 | ACG 4 3 2 2 3 4 | AAG 6 7 7 7 7 6 | AGG 2 2 2 2 3 3
--------------------------------------------------------------------------------------------------------------
Val GTT 3 5 3 4 3 4 | Ala GCT 4 2 4 4 5 3 | Asp GAT 0 0 0 0 0 1 | Gly GGT 2 1 0 1 2 2
GTC 5 5 4 5 4 4 | GCC 2 1 0 2 2 2 | GAC 7 8 5 6 7 6 | GGC 6 6 7 6 5 6
GTA 1 0 0 0 0 1 | GCA 4 5 6 3 3 4 | Glu GAA 5 4 5 4 5 5 | GGA 5 5 5 5 5 5
GTG 16 19 18 19 18 18 | GCG 2 2 2 1 1 2 | GAG 13 13 13 14 12 14 | GGG 9 9 9 9 9 8
--------------------------------------------------------------------------------------------------------------
--------------------------------------------------------------
Phe TTT 1 1 | Ser TCT 4 5 | Tyr TAT 3 3 | Cys TGT 1 1
TTC 13 12 | TCC 3 2 | TAC 7 10 | TGC 3 3
Leu TTA 0 0 | TCA 0 0 | *** TAA 0 0 | *** TGA 0 0
TTG 2 2 | TCG 1 1 | TAG 0 0 | Trp TGG 4 4
--------------------------------------------------------------
Leu CTT 1 1 | Pro CCT 5 5 | His CAT 2 0 | Arg CGT 0 1
CTC 4 3 | CCC 1 1 | CAC 5 5 | CGC 1 1
CTA 0 0 | CCA 4 4 | Gln CAA 2 2 | CGA 2 2
CTG 18 17 | CCG 0 0 | CAG 14 13 | CGG 8 7
--------------------------------------------------------------
Ile ATT 1 1 | Thr ACT 1 2 | Asn AAT 4 4 | Ser AGT 2 2
ATC 2 3 | ACC 8 7 | AAC 5 6 | AGC 9 8
ATA 0 0 | ACA 6 7 | Lys AAA 1 1 | Arg AGA 3 3
Met ATG 4 4 | ACG 1 2 | AAG 7 5 | AGG 2 2
--------------------------------------------------------------
Val GTT 3 3 | Ala GCT 5 4 | Asp GAT 0 1 | Gly GGT 4 2
GTC 5 4 | GCC 1 3 | GAC 6 8 | GGC 5 5
GTA 1 0 | GCA 4 4 | Glu GAA 5 6 | GGA 4 5
GTG 15 17 | GCG 1 1 | GAG 14 12 | GGG 9 9
--------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3
position 1: T:0.17409 C:0.27126 A:0.21457 G:0.34008
position 2: T:0.28745 C:0.17409 A:0.28745 G:0.25101
position 3: T:0.15385 C:0.31174 A:0.12955 G:0.40486
Average T:0.20513 C:0.25236 A:0.21053 G:0.33198
#2: Aotus_nancymaae_Aotidae_Haplorrhini_XP_012296108.1_LOC105708938
position 1: T:0.16194 C:0.25506 A:0.23887 G:0.34413
position 2: T:0.29150 C:0.17004 A:0.31579 G:0.22267
position 3: T:0.14170 C:0.31579 A:0.12955 G:0.41296
Average T:0.19838 C:0.24696 A:0.22807 G:0.32659
#3: Cebus_capucinus_imitator_Cebidae_Haplorrhini_XP_017378231.1_LOC108300090
position 1: T:0.17004 C:0.27126 A:0.23077 G:0.32794
position 2: T:0.27935 C:0.17409 A:0.30364 G:0.24291
position 3: T:0.13765 C:0.29960 A:0.14170 G:0.42105
Average T:0.19568 C:0.24831 A:0.22537 G:0.33063
#4: Cercocebus_atys_Cercopithecidae_Haplorrhini_XP_011895433.1_LOC105576724
position 1: T:0.17814 C:0.26721 A:0.21862 G:0.33603
position 2: T:0.29555 C:0.18219 A:0.28745 G:0.23482
position 3: T:0.14170 C:0.31174 A:0.12955 G:0.41700
Average T:0.20513 C:0.25371 A:0.21188 G:0.32928
#5: Colobus_angolensis_palliatus_Cercopithecidae_Haplorrhini_XP_011784781.1_LOC105502761
position 1: T:0.17814 C:0.26316 A:0.23077 G:0.32794
position 2: T:0.27530 C:0.17814 A:0.31579 G:0.23077
position 3: T:0.14170 C:0.31579 A:0.12955 G:0.41296
Average T:0.19838 C:0.25236 A:0.22537 G:0.32389
#6: Pan_paniscus_Hominidae_Haplorrhini_XP_003829806.1_
position 1: T:0.17814 C:0.25506 A:0.22267 G:0.34413
position 2: T:0.28340 C:0.17409 A:0.30769 G:0.23482
position 3: T:0.15789 C:0.29960 A:0.12955 G:0.41296
Average T:0.20648 C:0.24291 A:0.21997 G:0.33063
#7: Papio_anubis_Cercopithecidae_Haplorrhini_XP_009198027.2_LOC101001669
position 1: T:0.17004 C:0.27126 A:0.22672 G:0.33198
position 2: T:0.28340 C:0.18219 A:0.30364 G:0.23077
position 3: T:0.14980 C:0.31579 A:0.12955 G:0.40486
Average T:0.20108 C:0.25641 A:0.21997 G:0.32254
#8: Piliocolobus_tephrosceles_Cercopithecidae_Haplorrhini_XP_023057332.1_LOC111535153
position 1: T:0.17814 C:0.25101 A:0.23077 G:0.34008
position 2: T:0.27530 C:0.19433 A:0.30769 G:0.22267
position 3: T:0.14575 C:0.32794 A:0.13765 G:0.38866
Average T:0.19973 C:0.25776 A:0.22537 G:0.31714
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 10 | Ser S TCT 38 | Tyr Y TAT 22 | Cys C TGT 8
TTC 100 | TCC 19 | TAC 67 | TGC 24
Leu L TTA 0 | TCA 3 | *** * TAA 0 | *** * TGA 0
TTG 17 | TCG 3 | TAG 0 | Trp W TGG 32
------------------------------------------------------------------------------
Leu L CTT 8 | Pro P CCT 40 | His H CAT 12 | Arg R CGT 8
CTC 27 | CCC 7 | CAC 39 | CGC 9
CTA 2 | CCA 30 | Gln Q CAA 18 | CGA 14
CTG 130 | CCG 0 | CAG 109 | CGG 67
------------------------------------------------------------------------------
Ile I ATT 8 | Thr T ACT 11 | Asn N AAT 27 | Ser S AGT 22
ATC 20 | ACC 46 | AAC 47 | AGC 64
ATA 0 | ACA 46 | Lys K AAA 8 | Arg R AGA 26
Met M ATG 32 | ACG 21 | AAG 52 | AGG 18
------------------------------------------------------------------------------
Val V GTT 28 | Ala A GCT 31 | Asp D GAT 2 | Gly G GGT 14
GTC 36 | GCC 13 | GAC 53 | GGC 46
GTA 3 | GCA 33 | Glu E GAA 39 | GGA 39
GTG 140 | GCG 12 | GAG 105 | GGG 71
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.17358 C:0.26316 A:0.22672 G:0.33654
position 2: T:0.28391 C:0.17864 A:0.30364 G:0.23381
position 3: T:0.14626 C:0.31225 A:0.13209 G:0.40941
Average T:0.20125 C:0.25135 A:0.22082 G:0.32659
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3
Aotus_nancymaae_Aotidae_Haplorrhini_XP_012296108.1_LOC105708938 0.9509 (0.0596 0.0627)
Cebus_capucinus_imitator_Cebidae_Haplorrhini_XP_017378231.1_LOC108300090 0.5963 (0.0481 0.0807) 1.3412 (0.0536 0.0399)
Cercocebus_atys_Cercopithecidae_Haplorrhini_XP_011895433.1_LOC105576724 0.6919 (0.0388 0.0560) 1.5501 (0.0567 0.0366) 0.6819 (0.0348 0.0510)
Colobus_angolensis_palliatus_Cercopithecidae_Haplorrhini_XP_011784781.1_LOC105502761 0.6761 (0.0462 0.0684) 1.3847 (0.0633 0.0457) 0.5762 (0.0366 0.0635) 1.1509 (0.0386 0.0335)
Pan_paniscus_Hominidae_Haplorrhini_XP_003829806.1_ 1.6694 (0.0368 0.0220) 0.7868 (0.0498 0.0633) 0.4176 (0.0366 0.0877) 0.6164 (0.0349 0.0566) 0.5033 (0.0348 0.0691)
Papio_anubis_Cercopithecidae_Haplorrhini_XP_009198027.2_LOC101001669 0.5630 (0.0508 0.0902) 0.8547 (0.0679 0.0794) 0.4426 (0.0420 0.0948) 0.5069 (0.0336 0.0664) 0.6978 (0.0467 0.0670) 0.4734 (0.0373 0.0788)
Piliocolobus_tephrosceles_Cercopithecidae_Haplorrhini_XP_023057332.1_LOC111535153 0.6686 (0.0525 0.0786) 0.9170 (0.0677 0.0739) 0.6488 (0.0508 0.0783) 1.2016 (0.0539 0.0449) 0.8187 (0.0395 0.0482) 0.6883 (0.0505 0.0733) 0.7434 (0.0571 0.0767)
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 6, ((2, 3), ((4, 7), (5, 8)))); MP score: 127
lnL(ntime: 13 np: 16): -1836.836979 +0.000000
9..1 9..6 9..10 10..11 11..2 11..3 10..12 12..13 13..4 13..7 12..14 14..5 14..8
0.069512 0.036420 0.039466 0.022508 0.103093 0.060314 0.004626 0.024189 0.040305 0.095015 0.023202 0.041966 0.095543 1.688810 0.686503 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.65616
(1: 0.069512, 6: 0.036420, ((2: 0.103093, 3: 0.060314): 0.022508, ((4: 0.040305, 7: 0.095015): 0.024189, (5: 0.041966, 8: 0.095543): 0.023202): 0.004626): 0.039466);
(Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3: 0.069512, Pan_paniscus_Hominidae_Haplorrhini_XP_003829806.1_: 0.036420, ((Aotus_nancymaae_Aotidae_Haplorrhini_XP_012296108.1_LOC105708938: 0.103093, Cebus_capucinus_imitator_Cebidae_Haplorrhini_XP_017378231.1_LOC108300090: 0.060314): 0.022508, ((Cercocebus_atys_Cercopithecidae_Haplorrhini_XP_011895433.1_LOC105576724: 0.040305, Papio_anubis_Cercopithecidae_Haplorrhini_XP_009198027.2_LOC101001669: 0.095015): 0.024189, (Colobus_angolensis_palliatus_Cercopithecidae_Haplorrhini_XP_011784781.1_LOC105502761: 0.041966, Piliocolobus_tephrosceles_Cercopithecidae_Haplorrhini_XP_023057332.1_LOC111535153: 0.095543): 0.023202): 0.004626): 0.039466);
Detailed output identifying parameters
kappa (ts/tv) = 1.68881
dN/dS (w) for site classes (K=2)
p: 0.68650 0.31350
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.070 577.0 164.0 0.3135 0.0156 0.0498 9.0 8.2
9..6 0.036 577.0 164.0 0.3135 0.0082 0.0261 4.7 4.3
9..10 0.039 577.0 164.0 0.3135 0.0089 0.0283 5.1 4.6
10..11 0.023 577.0 164.0 0.3135 0.0051 0.0161 2.9 2.6
11..2 0.103 577.0 164.0 0.3135 0.0231 0.0738 13.4 12.1
11..3 0.060 577.0 164.0 0.3135 0.0135 0.0432 7.8 7.1
10..12 0.005 577.0 164.0 0.3135 0.0010 0.0033 0.6 0.5
12..13 0.024 577.0 164.0 0.3135 0.0054 0.0173 3.1 2.8
13..4 0.040 577.0 164.0 0.3135 0.0090 0.0289 5.2 4.7
13..7 0.095 577.0 164.0 0.3135 0.0213 0.0680 12.3 11.2
12..14 0.023 577.0 164.0 0.3135 0.0052 0.0166 3.0 2.7
14..5 0.042 577.0 164.0 0.3135 0.0094 0.0301 5.4 4.9
14..8 0.096 577.0 164.0 0.3135 0.0214 0.0684 12.4 11.2
Time used: 0:06
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 6, ((2, 3), ((4, 7), (5, 8)))); MP score: 127
lnL(ntime: 13 np: 18): -1807.692074 +0.000000
9..1 9..6 9..10 10..11 11..2 11..3 10..12 12..13 13..4 13..7 12..14 14..5 14..8
0.078080 0.042365 0.045430 0.024979 0.122577 0.067286 0.005544 0.028131 0.043531 0.110891 0.025014 0.047514 0.111508 2.133144 0.643271 0.278778 0.000001 8.181557
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.75285
(1: 0.078080, 6: 0.042365, ((2: 0.122577, 3: 0.067286): 0.024979, ((4: 0.043531, 7: 0.110891): 0.028131, (5: 0.047514, 8: 0.111508): 0.025014): 0.005544): 0.045430);
(Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3: 0.078080, Pan_paniscus_Hominidae_Haplorrhini_XP_003829806.1_: 0.042365, ((Aotus_nancymaae_Aotidae_Haplorrhini_XP_012296108.1_LOC105708938: 0.122577, Cebus_capucinus_imitator_Cebidae_Haplorrhini_XP_017378231.1_LOC108300090: 0.067286): 0.024979, ((Cercocebus_atys_Cercopithecidae_Haplorrhini_XP_011895433.1_LOC105576724: 0.043531, Papio_anubis_Cercopithecidae_Haplorrhini_XP_009198027.2_LOC101001669: 0.110891): 0.028131, (Colobus_angolensis_palliatus_Cercopithecidae_Haplorrhini_XP_011784781.1_LOC105502761: 0.047514, Piliocolobus_tephrosceles_Cercopithecidae_Haplorrhini_XP_023057332.1_LOC111535153: 0.111508): 0.025014): 0.005544): 0.045430);
Detailed output identifying parameters
kappa (ts/tv) = 2.13314
dN/dS (w) for site classes (K=3)
p: 0.64327 0.27878 0.07795
w: 0.00000 1.00000 8.18156
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.078 572.1 168.9 0.9165 0.0255 0.0278 14.6 4.7
9..6 0.042 572.1 168.9 0.9165 0.0138 0.0151 7.9 2.5
9..10 0.045 572.1 168.9 0.9165 0.0148 0.0162 8.5 2.7
10..11 0.025 572.1 168.9 0.9165 0.0082 0.0089 4.7 1.5
11..2 0.123 572.1 168.9 0.9165 0.0400 0.0437 22.9 7.4
11..3 0.067 572.1 168.9 0.9165 0.0220 0.0240 12.6 4.0
10..12 0.006 572.1 168.9 0.9165 0.0018 0.0020 1.0 0.3
12..13 0.028 572.1 168.9 0.9165 0.0092 0.0100 5.3 1.7
13..4 0.044 572.1 168.9 0.9165 0.0142 0.0155 8.1 2.6
13..7 0.111 572.1 168.9 0.9165 0.0362 0.0395 20.7 6.7
12..14 0.025 572.1 168.9 0.9165 0.0082 0.0089 4.7 1.5
14..5 0.048 572.1 168.9 0.9165 0.0155 0.0169 8.9 2.9
14..8 0.112 572.1 168.9 0.9165 0.0364 0.0397 20.8 6.7
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3)
Pr(w>1) post mean +- SE for w
28 L 0.954* 7.852
29 R 1.000** 8.181
31 S 0.803 6.768
46 D 0.973* 7.987
50 H 0.682 5.897
55 F 1.000** 8.179
56 L 0.549 4.940
75 V 0.999** 8.175
85 L 1.000** 8.181
92 R 0.931 7.686
104 G 0.953* 7.841
122 A 0.773 6.548
138 S 0.925 7.641
205 E 0.585 5.201
245 H 0.720 6.169
246 S 0.963* 7.915
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3)
Pr(w>1) post mean +- SE for w
28 L 0.957* 7.475 +- 2.185
29 R 1.000** 7.800 +- 1.733
31 S 0.823 6.506 +- 3.010
46 D 0.974* 7.601 +- 2.024
50 H 0.717 5.702 +- 3.311
55 F 1.000** 7.799 +- 1.736
56 L 0.609 4.832 +- 3.349
75 V 0.999** 7.794 +- 1.744
85 L 1.000** 7.800 +- 1.733
92 R 0.935 7.304 +- 2.363
104 G 0.957* 7.489 +- 2.189
122 A 0.796 6.305 +- 3.109
138 S 0.931 7.297 +- 2.396
205 E 0.635 5.080 +- 3.402
245 H 0.747 5.870 +- 3.203
246 S 0.966* 7.559 +- 2.107
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.922 0.074 0.003 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.000 0.000 0.003 0.050 0.129 0.157 0.182 0.194 0.166 0.117
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.003
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.003 0.079 0.024
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.076 0.443 0.012
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.028 0.154 0.108 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.003 0.040 0.024 0.003 0.000
sum of density on p0-p1 = 1.000000
Time used: 0:17
Model 7: beta (10 categories)
TREE # 1: (1, 6, ((2, 3), ((4, 7), (5, 8)))); MP score: 127
lnL(ntime: 13 np: 16): -1836.888718 +0.000000
9..1 9..6 9..10 10..11 11..2 11..3 10..12 12..13 13..4 13..7 12..14 14..5 14..8
0.068745 0.036008 0.039032 0.022255 0.101992 0.059661 0.004571 0.023910 0.039859 0.093972 0.022946 0.041503 0.094520 1.681665 0.005000 0.011678
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.64897
(1: 0.068745, 6: 0.036008, ((2: 0.101992, 3: 0.059661): 0.022255, ((4: 0.039859, 7: 0.093972): 0.023910, (5: 0.041503, 8: 0.094520): 0.022946): 0.004571): 0.039032);
(Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3: 0.068745, Pan_paniscus_Hominidae_Haplorrhini_XP_003829806.1_: 0.036008, ((Aotus_nancymaae_Aotidae_Haplorrhini_XP_012296108.1_LOC105708938: 0.101992, Cebus_capucinus_imitator_Cebidae_Haplorrhini_XP_017378231.1_LOC108300090: 0.059661): 0.022255, ((Cercocebus_atys_Cercopithecidae_Haplorrhini_XP_011895433.1_LOC105576724: 0.039859, Papio_anubis_Cercopithecidae_Haplorrhini_XP_009198027.2_LOC101001669: 0.093972): 0.023910, (Colobus_angolensis_palliatus_Cercopithecidae_Haplorrhini_XP_011784781.1_LOC105502761: 0.041503, Piliocolobus_tephrosceles_Cercopithecidae_Haplorrhini_XP_023057332.1_LOC111535153: 0.094520): 0.022946): 0.004571): 0.039032);
Detailed output identifying parameters
kappa (ts/tv) = 1.68166
Parameters in M7 (beta):
p= 0.00500 q= 0.01168
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.069 577.0 164.0 0.3000 0.0151 0.0504 8.7 8.3
9..6 0.036 577.0 164.0 0.3000 0.0079 0.0264 4.6 4.3
9..10 0.039 577.0 164.0 0.3000 0.0086 0.0286 5.0 4.7
10..11 0.022 577.0 164.0 0.3000 0.0049 0.0163 2.8 2.7
11..2 0.102 577.0 164.0 0.3000 0.0224 0.0747 12.9 12.3
11..3 0.060 577.0 164.0 0.3000 0.0131 0.0437 7.6 7.2
10..12 0.005 577.0 164.0 0.3000 0.0010 0.0033 0.6 0.5
12..13 0.024 577.0 164.0 0.3000 0.0053 0.0175 3.0 2.9
13..4 0.040 577.0 164.0 0.3000 0.0088 0.0292 5.1 4.8
13..7 0.094 577.0 164.0 0.3000 0.0207 0.0689 11.9 11.3
12..14 0.023 577.0 164.0 0.3000 0.0050 0.0168 2.9 2.8
14..5 0.042 577.0 164.0 0.3000 0.0091 0.0304 5.3 5.0
14..8 0.095 577.0 164.0 0.3000 0.0208 0.0693 12.0 11.4
Time used: 0:51
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 6, ((2, 3), ((4, 7), (5, 8)))); MP score: 127
lnL(ntime: 13 np: 18): -1807.692703 +0.000000
9..1 9..6 9..10 10..11 11..2 11..3 10..12 12..13 13..4 13..7 12..14 14..5 14..8
0.078047 0.042329 0.045398 0.024948 0.122503 0.067274 0.005540 0.028109 0.043506 0.110830 0.025011 0.047484 0.111432 2.132411 0.921670 0.005000 0.011779 8.141492
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.75241
(1: 0.078047, 6: 0.042329, ((2: 0.122503, 3: 0.067274): 0.024948, ((4: 0.043506, 7: 0.110830): 0.028109, (5: 0.047484, 8: 0.111432): 0.025011): 0.005540): 0.045398);
(Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3: 0.078047, Pan_paniscus_Hominidae_Haplorrhini_XP_003829806.1_: 0.042329, ((Aotus_nancymaae_Aotidae_Haplorrhini_XP_012296108.1_LOC105708938: 0.122503, Cebus_capucinus_imitator_Cebidae_Haplorrhini_XP_017378231.1_LOC108300090: 0.067274): 0.024948, ((Cercocebus_atys_Cercopithecidae_Haplorrhini_XP_011895433.1_LOC105576724: 0.043506, Papio_anubis_Cercopithecidae_Haplorrhini_XP_009198027.2_LOC101001669: 0.110830): 0.028109, (Colobus_angolensis_palliatus_Cercopithecidae_Haplorrhini_XP_011784781.1_LOC105502761: 0.047484, Piliocolobus_tephrosceles_Cercopithecidae_Haplorrhini_XP_023057332.1_LOC111535153: 0.111432): 0.025011): 0.005540): 0.045398);
Detailed output identifying parameters
kappa (ts/tv) = 2.13241
Parameters in M8 (beta&w>1):
p0= 0.92167 p= 0.00500 q= 0.01178
(p1= 0.07833) w= 8.14149
dN/dS (w) for site classes (K=11)
p: 0.09217 0.09217 0.09217 0.09217 0.09217 0.09217 0.09217 0.09217 0.09217 0.09217 0.07833
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000 1.00000 1.00000 8.14149
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.078 572.1 168.9 0.9142 0.0255 0.0279 14.6 4.7
9..6 0.042 572.1 168.9 0.9142 0.0138 0.0151 7.9 2.6
9..10 0.045 572.1 168.9 0.9142 0.0148 0.0162 8.5 2.7
10..11 0.025 572.1 168.9 0.9142 0.0081 0.0089 4.7 1.5
11..2 0.123 572.1 168.9 0.9142 0.0400 0.0437 22.9 7.4
11..3 0.067 572.1 168.9 0.9142 0.0220 0.0240 12.6 4.1
10..12 0.006 572.1 168.9 0.9142 0.0018 0.0020 1.0 0.3
12..13 0.028 572.1 168.9 0.9142 0.0092 0.0100 5.2 1.7
13..4 0.044 572.1 168.9 0.9142 0.0142 0.0155 8.1 2.6
13..7 0.111 572.1 168.9 0.9142 0.0362 0.0396 20.7 6.7
12..14 0.025 572.1 168.9 0.9142 0.0082 0.0089 4.7 1.5
14..5 0.047 572.1 168.9 0.9142 0.0155 0.0170 8.9 2.9
14..8 0.111 572.1 168.9 0.9142 0.0364 0.0398 20.8 6.7
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3)
Pr(w>1) post mean +- SE for w
28 L 0.955* 7.817
29 R 1.000** 8.141
31 S 0.805 6.746
46 D 0.973* 7.950
50 H 0.684 5.888
55 F 1.000** 8.139
56 L 0.553 4.948
75 V 0.999** 8.135
85 L 1.000** 8.141
92 R 0.932 7.654
104 G 0.953* 7.805
122 A 0.774 6.530
138 S 0.925 7.608
205 E 0.588 5.202
245 H 0.723 6.162
246 S 0.963* 7.878
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3)
Pr(w>1) post mean +- SE for w
14 R 0.607 3.608 +- 2.669
18 A 0.521 3.120 +- 2.659
22 R 0.648 3.846 +- 2.652
23 P 0.604 3.590 +- 2.670
24 R 0.529 3.168 +- 2.663
28 L 0.992** 5.888 +- 1.485
29 R 1.000** 5.940 +- 1.431
31 S 0.939 5.562 +- 1.817
44 Y 0.749 4.364 +- 2.329
46 D 0.996** 5.914 +- 1.457
50 H 0.903 5.322 +- 1.965
55 F 1.000** 5.940 +- 1.431
56 L 0.898 5.246 +- 1.910
75 V 1.000** 5.939 +- 1.432
78 S 0.781 4.551 +- 2.275
85 L 1.000** 5.940 +- 1.431
86 L 0.735 4.283 +- 2.352
88 Q 0.590 3.478 +- 2.465
89 K 0.523 3.121 +- 2.458
92 R 0.988* 5.861 +- 1.508
99 H 0.630 3.693 +- 2.452
102 G 0.549 3.261 +- 2.470
104 G 0.989* 5.872 +- 1.515
122 A 0.930 5.502 +- 1.859
131 N 0.645 3.773 +- 2.441
138 S 0.983* 5.833 +- 1.552
153 G 0.668 3.903 +- 2.424
184 R 0.678 3.966 +- 2.425
201 A 0.569 3.394 +- 2.672
205 E 0.872 5.120 +- 2.066
209 R 0.725 4.225 +- 2.361
245 H 0.940 5.531 +- 1.756
246 S 0.990* 5.879 +- 1.512
247 G 0.704 4.159 +- 2.574
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.009 0.866 0.124
p : 0.541 0.338 0.092 0.021 0.005 0.001 0.000 0.000 0.000 0.000
q : 0.001 0.084 0.110 0.114 0.104 0.104 0.110 0.117 0.124 0.131
ws: 0.000 0.000 0.012 0.236 0.397 0.188 0.067 0.042 0.034 0.023
Time used: 2:39
Model 8: beta&w>1 -1807.692703
Model 7: beta -1836.888718
Model 1: NearlyNeutral -1836.836979
Model 2: PositiveSelection -1807.692074
Model 2 vs 1 58.28980999999976
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3)
Pr(w>1) post mean +- SE for w
28 L 0.954* 7.852
29 R 1.000** 8.181
31 S 0.803 6.768
46 D 0.973* 7.987
50 H 0.682 5.897
55 F 1.000** 8.179
56 L 0.549 4.940
75 V 0.999** 8.175
85 L 1.000** 8.181
92 R 0.931 7.686
104 G 0.953* 7.841
122 A 0.773 6.548
138 S 0.925 7.641
205 E 0.585 5.201
245 H 0.720 6.169
246 S 0.963* 7.915
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3)
Pr(w>1) post mean +- SE for w
28 L 0.957* 7.475 +- 2.185
29 R 1.000** 7.800 +- 1.733
31 S 0.823 6.506 +- 3.010
46 D 0.974* 7.601 +- 2.024
50 H 0.717 5.702 +- 3.311
55 F 1.000** 7.799 +- 1.736
56 L 0.609 4.832 +- 3.349
75 V 0.999** 7.794 +- 1.744
85 L 1.000** 7.800 +- 1.733
92 R 0.935 7.304 +- 2.363
104 G 0.957* 7.489 +- 2.189
122 A 0.796 6.305 +- 3.109
138 S 0.931 7.297 +- 2.396
205 E 0.635 5.080 +- 3.402
245 H 0.747 5.870 +- 3.203
246 S 0.966* 7.559 +- 2.107
Model 8 vs 7 58.39202999999998
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3)
Pr(w>1) post mean +- SE for w
28 L 0.955* 7.817
29 R 1.000** 8.141
31 S 0.805 6.746
46 D 0.973* 7.950
50 H 0.684 5.888
55 F 1.000** 8.139
56 L 0.553 4.948
75 V 0.999** 8.135
85 L 1.000** 8.141
92 R 0.932 7.654
104 G 0.953* 7.805
122 A 0.774 6.530
138 S 0.925 7.608
205 E 0.588 5.202
245 H 0.723 6.162
246 S 0.963* 7.878
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3)
Pr(w>1) post mean +- SE for w
14 R 0.607 3.608 +- 2.669
18 A 0.521 3.120 +- 2.659
22 R 0.648 3.846 +- 2.652
23 P 0.604 3.590 +- 2.670
24 R 0.529 3.168 +- 2.663
28 L 0.992** 5.888 +- 1.485
29 R 1.000** 5.940 +- 1.431
31 S 0.939 5.562 +- 1.817
44 Y 0.749 4.364 +- 2.329
46 D 0.996** 5.914 +- 1.457
50 H 0.903 5.322 +- 1.965
55 F 1.000** 5.940 +- 1.431
56 L 0.898 5.246 +- 1.910
75 V 1.000** 5.939 +- 1.432
78 S 0.781 4.551 +- 2.275
85 L 1.000** 5.940 +- 1.431
86 L 0.735 4.283 +- 2.352
88 Q 0.590 3.478 +- 2.465
89 K 0.523 3.121 +- 2.458
92 R 0.988* 5.861 +- 1.508
99 H 0.630 3.693 +- 2.452
102 G 0.549 3.261 +- 2.470
104 G 0.989* 5.872 +- 1.515
122 A 0.930 5.502 +- 1.859
131 N 0.645 3.773 +- 2.441
138 S 0.983* 5.833 +- 1.552
153 G 0.668 3.903 +- 2.424
184 R 0.678 3.966 +- 2.425
201 A 0.569 3.394 +- 2.672
205 E 0.872 5.120 +- 2.066
209 R 0.725 4.225 +- 2.361
245 H 0.940 5.531 +- 1.756
246 S 0.990* 5.879 +- 1.512
247 G 0.704 4.159 +- 2.574
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
