--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Apr 12 00:46:37 WEST 2018
codeml.models=1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=
tcoffee.dir=
tcoffee.minScore=3
input.fasta=
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -1980.50          -1997.15
2       -1980.38          -1998.75
--------------------------------------
TOTAL     -1980.44          -1998.24
--------------------------------------


Model parameter summaries over the runs sampled in files
"/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Summaries are based on a total of 15002 samples from 2 runs)
(Each run produced 10001 samples of which 7501 samples were included)

95% Cred. Interval
----------------------
Parameter          Mean        Variance       Lower         Upper         Median       PSRF *
---------------------------------------------------------------------------------------------
TL{all}           0.265317      0.000885      0.212000      0.329000      0.263000      1.000
r(A<->C){all}     0.101350      0.000840      0.051181      0.164004      0.098791      1.000
r(A<->G){all}     0.168862      0.001157      0.109084      0.242242      0.166530      1.000
r(A<->T){all}     0.210862      0.002079      0.129527      0.306510      0.208112      1.000
r(C<->G){all}     0.094341      0.000483      0.056313      0.141940      0.092704      1.000
r(C<->T){all}     0.340278      0.002551      0.245988      0.442625      0.338700      1.000
r(G<->T){all}     0.084306      0.000597      0.042649      0.137257      0.082479      1.002
pi(A){all}        0.216659      0.000197      0.189988      0.244904      0.216516      1.000
pi(C){all}        0.261869      0.000218      0.233643      0.291465      0.261522      1.000
pi(G){all}        0.316085      0.000245      0.286490      0.346889      0.315873      1.000
pi(T){all}        0.205388      0.000185      0.179485      0.232576      0.205199      1.000
alpha{1,2}       28.084679   2735.050281      0.173688    179.276444      0.846342      1.003
alpha{3}        100.482318   3261.914324      7.034359    194.807984     99.861952      1.000
pinvar{all}       0.694802      0.009037      0.471945      0.815786      0.712470      1.003
---------------------------------------------------------------------------------------------
* Convergence diagnostic (PSRF = Potential scale reduction factor [Gelman
and Rubin, 1992], uncorrected) should approach 1 as runs converge. The
values may be unreliable if you have a small number of samples. PSRF should
only be used as a rough guide to convergence since all the assumptions
that allow one to interpret it as a scale reduction factor are not met in
the phylogenetic context.



 --- CODEML SUMMARY

Model 8: beta&w>1	-1807.692703
Model 7: beta	-1836.888718
Model 1: NearlyNeutral	-1836.836979
Model 2: PositiveSelection	-1807.692074


Model 2 vs 1	58.28980999999976

Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3)

            Pr(w>1)     post mean +- SE for w

    28 L      0.954*        7.852
    29 R      1.000**       8.181
    31 S      0.803         6.768
    46 D      0.973*        7.987
    50 H      0.682         5.897
    55 F      1.000**       8.179
    56 L      0.549         4.940
    75 V      0.999**       8.175
    85 L      1.000**       8.181
    92 R      0.931         7.686
   104 G      0.953*        7.841
   122 A      0.773         6.548
   138 S      0.925         7.641
   205 E      0.585         5.201
   245 H      0.720         6.169
   246 S      0.963*        7.915

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3)

            Pr(w>1)     post mean +- SE for w

    28 L      0.957*        7.475 +- 2.185
    29 R      1.000**       7.800 +- 1.733
    31 S      0.823         6.506 +- 3.010
    46 D      0.974*        7.601 +- 2.024
    50 H      0.717         5.702 +- 3.311
    55 F      1.000**       7.799 +- 1.736
    56 L      0.609         4.832 +- 3.349
    75 V      0.999**       7.794 +- 1.744
    85 L      1.000**       7.800 +- 1.733
    92 R      0.935         7.304 +- 2.363
   104 G      0.957*        7.489 +- 2.189
   122 A      0.796         6.305 +- 3.109
   138 S      0.931         7.297 +- 2.396
   205 E      0.635         5.080 +- 3.402
   245 H      0.747         5.870 +- 3.203
   246 S      0.966*        7.559 +- 2.107


Model 8 vs 7	58.39202999999998

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3)

            Pr(w>1)     post mean +- SE for w

    28 L      0.955*        7.817
    29 R      1.000**       8.141
    31 S      0.805         6.746
    46 D      0.973*        7.950
    50 H      0.684         5.888
    55 F      1.000**       8.139
    56 L      0.553         4.948
    75 V      0.999**       8.135
    85 L      1.000**       8.141
    92 R      0.932         7.654
   104 G      0.953*        7.805
   122 A      0.774         6.530
   138 S      0.925         7.608
   205 E      0.588         5.202
   245 H      0.723         6.162
   246 S      0.963*        7.878

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3)

            Pr(w>1)     post mean +- SE for w

    14 R      0.607         3.608 +- 2.669
    18 A      0.521         3.120 +- 2.659
    22 R      0.648         3.846 +- 2.652
    23 P      0.604         3.590 +- 2.670
    24 R      0.529         3.168 +- 2.663
    28 L      0.992**       5.888 +- 1.485
    29 R      1.000**       5.940 +- 1.431
    31 S      0.939         5.562 +- 1.817
    44 Y      0.749         4.364 +- 2.329
    46 D      0.996**       5.914 +- 1.457
    50 H      0.903         5.322 +- 1.965
    55 F      1.000**       5.940 +- 1.431
    56 L      0.898         5.246 +- 1.910
    75 V      1.000**       5.939 +- 1.432
    78 S      0.781         4.551 +- 2.275
    85 L      1.000**       5.940 +- 1.431
    86 L      0.735         4.283 +- 2.352
    88 Q      0.590         3.478 +- 2.465
    89 K      0.523         3.121 +- 2.458
    92 R      0.988*        5.861 +- 1.508
    99 H      0.630         3.693 +- 2.452
   102 G      0.549         3.261 +- 2.470
   104 G      0.989*        5.872 +- 1.515
   122 A      0.930         5.502 +- 1.859
   131 N      0.645         3.773 +- 2.441
   138 S      0.983*        5.833 +- 1.552
   153 G      0.668         3.903 +- 2.424
   184 R      0.678         3.966 +- 2.425
   201 A      0.569         3.394 +- 2.672
   205 E      0.872         5.120 +- 2.066
   209 R      0.725         4.225 +- 2.361
   245 H      0.940         5.531 +- 1.756
   246 S      0.990*        5.879 +- 1.512
   247 G      0.704         4.159 +- 2.574

>C1
MVCLKLPGGSSLAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGT
ERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQK
RGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY
TCQVEHPSVTSALTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGHSGLQPTGFLS
>C2
MVCLRLPGGSYVAALTVTLMVLSSPLALVGDTRPRFLELVKHECHFFNGT
ERVRYLDRYIHNQEEVVRFDSDVGEYRAVTELGRPDAEYWNSQKDYVEQK
RGQVDNYCRHNYGVFESFTVQRRVQPKMTVYPAKTQPLQHHNLLVCSVSG
FYPGSIEVRWFRNNQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
TCQVEHPSVTTPITVQWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGGSGLQPTGLLS
>C3
MVCLRLPGGFCMAALTVTLMVLSSPLALAGDTRPRFLEQAKSECHFFNGT
ERVRYLQRYFYNQEEYVRFDSDVGEYRAVTELGRPSAEYWNSQKELLEQK
RGQVDNYCRHNYRVGESFTVQRRVQPKVTVYPAKTQPLQHHSLLVCSVSG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
TCQVEHPSVMSPLTVQWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGRSGLQPTGLLS
>C4
MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTRPRFLEQVKSECHFFNGT
ERVRFLERHFYNQEEFVRFDSDVGEYRAVSELGRPVAESWNSQKDLLEQK
RGQVDNYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHTLLVCSVSG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY
TCQVEHPSVTSPLTVQWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGHSGLQPTGLLS
>C5
MVCLKLPGGSYMAALTVTLMVLSSPLALAGDTQPRFLEQFKSECHFFNGT
ERVRYLQRYFYNQEEYVRYDSDVGEYRAVTELGRPDAKYWNSQKDILEQR
RARVDNYCRHNYGVGESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGHSGLHPTGLLS
>C6
MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTRSRFLELVKSECHFFNGT
ERVRFLERYFYNQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDYVEQK
RGQVDNYCRHNYRVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVNG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY
TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGHSGLQPTGFLS
>C7
MAALTVTLMVLSSPLALAGDTRPHFLEQGKSECHFFNGTERVRFLERHFY
NQEEYLRFDSDVGEYRAVSELGRPTAESWNSQKDYLEQKRGQVDNYCRHN
YGVGESFTVQRRVQPKVTVYPAKTQPLQHHTLLVCSVNGFYPGSIEVRWF
RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVYTCQVEHPSVTS
PLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGLLSooo
oooooooooooooooo
>C8
MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTRPRFLEYSTSECHFFNGT
ERVRYLDRYFYNQEETLRFDSDVGEYRAVTELGRPDAEYWNSQKDILEDQ
RASVDNYCRYNYGVGESFTVQRRVQPKVTVYPAKTQPLQHHNLLVCSVNG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
TCQVEHPSVTSPLTVEWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGHTGLQPTGLLS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=8, Len=277 

C1              MVCLKLPGGSSLAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGT
C2              MVCLRLPGGSYVAALTVTLMVLSSPLALVGDTRPRFLELVKHECHFFNGT
C3              MVCLRLPGGFCMAALTVTLMVLSSPLALAGDTRPRFLEQAKSECHFFNGT
C4              MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTRPRFLEQVKSECHFFNGT
C5              MVCLKLPGGSYMAALTVTLMVLSSPLALAGDTQPRFLEQFKSECHFFNGT
C6              MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTRSRFLELVKSECHFFNGT
C7              -----------MAALTVTLMVLSSPLALAGDTRPHFLEQGKSECHFFNGT
C8              MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTRPRFLEYSTSECHFFNGT
                           :************ **:.***:.:***  . ********

C1              ERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQK
C2              ERVRYLDRYIHNQEEVVRFDSDVGEYRAVTELGRPDAEYWNSQKDYVEQK
C3              ERVRYLQRYFYNQEEYVRFDSDVGEYRAVTELGRPSAEYWNSQKELLEQK
C4              ERVRFLERHFYNQEEFVRFDSDVGEYRAVSELGRPVAESWNSQKDLLEQK
C5              ERVRYLQRYFYNQEEYVRYDSDVGEYRAVTELGRPDAKYWNSQKDILEQR
C6              ERVRFLERYFYNQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDYVEQK
C7              ERVRFLERHFYNQEEYLRFDSDVGEYRAVSELGRPTAESWNSQKDYLEQK
C8              ERVRYLDRYFYNQEETLRFDSDVGEYRAVTELGRPDAEYWNSQKDILEDQ
                ****:*:*:::**** :*:**********:***** *: *****: :*::

C1              RGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSG
C2              RGQVDNYCRHNYGVFESFTVQRRVQPKMTVYPAKTQPLQHHNLLVCSVSG
C3              RGQVDNYCRHNYRVGESFTVQRRVQPKVTVYPAKTQPLQHHSLLVCSVSG
C4              RGQVDNYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHTLLVCSVSG
C5              RARVDNYCRHNYGVGESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNG
C6              RGQVDNYCRHNYRVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVNG
C7              RGQVDNYCRHNYGVGESFTVQRRVQPKVTVYPAKTQPLQHHTLLVCSVNG
C8              RASVDNYCRYNYGVGESFTVQRRVQPKVTVYPAKTQPLQHHNLLVCSVNG
                *. ******:** * *********:*::****:********.******.*

C1              FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY
C2              FYPGSIEVRWFRNNQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
C3              FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
C4              FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY
C5              FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
C6              FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY
C7              FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
C8              FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
                *************.******************************:*****

C1              TCQVEHPSVTSALTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
C2              TCQVEHPSVTTPITVQWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
C3              TCQVEHPSVMSPLTVQWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
C4              TCQVEHPSVTSPLTVQWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
C5              TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
C6              TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
C7              TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
C8              TCQVEHPSVTSPLTVEWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
                ********* :.:**:***:******************************

C1              RNQKGHSGLQPTGFLS-----------
C2              RNQKGGSGLQPTGLLS-----------
C3              RNQKGRSGLQPTGLLS-----------
C4              RNQKGHSGLQPTGLLS-----------
C5              RNQKGHSGLHPTGLLS-----------
C6              RNQKGHSGLQPTGFLS-----------
C7              RNQKGLLSooooooooooooooooooo
C8              RNQKGHTGLQPTGLLS-----------
                *****  .                   




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length  266 type PROTEIN Struct Unchecked

	Multi Core Mode: 8 processors:
] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length  266 type PROTEIN Struct Unchecked

	Multi Core Mode: 8 processors:

	--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length  266 type PROTEIN Struct Unchecked

	Multi Core Mode: 8 processors:

	--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length  266 type PROTEIN Struct Unchecked

	Multi Core Mode: 8 processors:

	--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length  266 type PROTEIN Struct Unchecked

	Multi Core Mode: 8 processors:

	--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length  266 type PROTEIN Struct Unchecked

	Multi Core Mode: 8 processors:

	--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length  266 type PROTEIN Struct Unchecked

	Multi Core Mode: 8 processors:

	--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length  266 type PROTEIN Struct Unchecked

	Multi Core Mode: 8 processors:

	--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length  266 type PROTEIN Struct Unchecked

	Multi Core Mode: 8 processors:

	--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length  266 type PROTEIN Struct Unchecked

	Multi Core Mode: 8 processors:

	--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15224]

Library Relaxation: Multi_proc [8]
 
		[Relax Library][TOT=    1][100 %][ELAPSED TIME:    0 sec.]] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length  266 type PROTEIN Struct Unchecked

	Multi Core Mode: 8 processors:

	--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15224]

Library Relaxation: Multi_proc [8]
 ] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length  266 type PROTEIN Struct Unchecked

	Multi Core Mode: 8 processors:

	--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15224]

Library Relaxation: Multi_proc [8]
 ] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length  266 type PROTEIN Struct Unchecked

	Multi Core Mode: 8 processors:

	--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15224]

Library Relaxation: Multi_proc [8]
 ] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length  266 type PROTEIN Struct Unchecked

	Multi Core Mode: 8 processors:

	--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15224]

Library Relaxation: Multi_proc [8]
 ] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length  266 type PROTEIN Struct Unchecked

	Multi Core Mode: 8 processors:

	--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15224]

Library Relaxation: Multi_proc [8]
 ] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length  266 type PROTEIN Struct Unchecked

	Multi Core Mode: 8 processors:

	--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15224]

Library Relaxation: Multi_proc [8]
 ] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length  266 type PROTEIN Struct Unchecked

	Multi Core Mode: 8 processors:

	--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15224]

Library Relaxation: Multi_proc [8]
 ] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length  266 type PROTEIN Struct Unchecked
  Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length  266 type PROTEIN Struct Unchecked

	Multi Core Mode: 8 processors:

	--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15224]

Library Relaxation: Multi_proc [8]
 
Relaxation Summary: [15224]--->[15148]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.612 Mb, Max= 31.087 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
LAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGTERVRYLDRYFH
NQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHN
YGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWF
RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTS
ALTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQP
TGFLS
>C2
VAALTVTLMVLSSPLALVGDTRPRFLELVKHECHFFNGTERVRYLDRYIH
NQEEVVRFDSDVGEYRAVTELGRPDAEYWNSQKDYVEQKRGQVDNYCRHN
YGVFESFTVQRRVQPKMTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWF
RNNQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVYTCQVEHPSVTT
PITVQWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGGSGLQP
TGLLS
>C3
MAALTVTLMVLSSPLALAGDTRPRFLEQAKSECHFFNGTERVRYLQRYFY
NQEEYVRFDSDVGEYRAVTELGRPSAEYWNSQKELLEQKRGQVDNYCRHN
YRVGESFTVQRRVQPKVTVYPAKTQPLQHHSLLVCSVSGFYPGSIEVRWF
RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVYTCQVEHPSVMS
PLTVQWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGRSGLQP
TGLLS
>C4
MAALTVTLMVLSSPLALAGDTRPRFLEQVKSECHFFNGTERVRFLERHFY
NQEEFVRFDSDVGEYRAVSELGRPVAESWNSQKDLLEQKRGQVDNYCRYN
YGVVESFTVQRRVQPKVTVYPSKTQPLQHHTLLVCSVSGFYPGSIEVRWF
RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTS
PLTVQWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQP
TGLLS
>C5
MAALTVTLMVLSSPLALAGDTQPRFLEQFKSECHFFNGTERVRYLQRYFY
NQEEYVRYDSDVGEYRAVTELGRPDAKYWNSQKDILEQRRARVDNYCRHN
YGVGESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWF
RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVYTCQVEHPSVTS
PLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLHP
TGLLS
>C6
MAALTVTLMVLSSPLALAGDTRSRFLELVKSECHFFNGTERVRFLERYFY
NQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDYVEQKRGQVDNYCRHN
YRVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWF
RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTS
PLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQP
TGFLS
>C7
MAALTVTLMVLSSPLALAGDTRPHFLEQGKSECHFFNGTERVRFLERHFY
NQEEYLRFDSDVGEYRAVSELGRPTAESWNSQKDYLEQKRGQVDNYCRHN
YGVGESFTVQRRVQPKVTVYPAKTQPLQHHTLLVCSVNGFYPGSIEVRWF
RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVYTCQVEHPSVTS
PLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGLLSooo
ooooo
>C8
MAALTVTLMVLSSPLALAGDTRPRFLEYSTSECHFFNGTERVRYLDRYFY
NQEETLRFDSDVGEYRAVTELGRPDAEYWNSQKDILEDQRASVDNYCRYN
YGVGESFTVQRRVQPKVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWF
RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVYTCQVEHPSVTS
PLTVEWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHTGLQP
TGLLS
CLUSTAL W (1.83) multiple sequence alignment

C1              LAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGTERVRYLDRYFH
C2              VAALTVTLMVLSSPLALVGDTRPRFLELVKHECHFFNGTERVRYLDRYIH
C3              MAALTVTLMVLSSPLALAGDTRPRFLEQAKSECHFFNGTERVRYLQRYFY
C4              MAALTVTLMVLSSPLALAGDTRPRFLEQVKSECHFFNGTERVRFLERHFY
C5              MAALTVTLMVLSSPLALAGDTQPRFLEQFKSECHFFNGTERVRYLQRYFY
C6              MAALTVTLMVLSSPLALAGDTRSRFLELVKSECHFFNGTERVRFLERYFY
C7              MAALTVTLMVLSSPLALAGDTRPHFLEQGKSECHFFNGTERVRFLERHFY
C8              MAALTVTLMVLSSPLALAGDTRPRFLEYSTSECHFFNGTERVRYLDRYFY
                :************ **:.***:.:***  . ************:*:*:::

C1              NQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHN
C2              NQEEVVRFDSDVGEYRAVTELGRPDAEYWNSQKDYVEQKRGQVDNYCRHN
C3              NQEEYVRFDSDVGEYRAVTELGRPSAEYWNSQKELLEQKRGQVDNYCRHN
C4              NQEEFVRFDSDVGEYRAVSELGRPVAESWNSQKDLLEQKRGQVDNYCRYN
C5              NQEEYVRYDSDVGEYRAVTELGRPDAKYWNSQKDILEQRRARVDNYCRHN
C6              NQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDYVEQKRGQVDNYCRHN
C7              NQEEYLRFDSDVGEYRAVSELGRPTAESWNSQKDYLEQKRGQVDNYCRHN
C8              NQEETLRFDSDVGEYRAVTELGRPDAEYWNSQKDILEDQRASVDNYCRYN
                **** :*:**********:***** *: *****: :*::*. ******:*

C1              YGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWF
C2              YGVFESFTVQRRVQPKMTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWF
C3              YRVGESFTVQRRVQPKVTVYPAKTQPLQHHSLLVCSVSGFYPGSIEVRWF
C4              YGVVESFTVQRRVQPKVTVYPSKTQPLQHHTLLVCSVSGFYPGSIEVRWF
C5              YGVGESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWF
C6              YRVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWF
C7              YGVGESFTVQRRVQPKVTVYPAKTQPLQHHTLLVCSVNGFYPGSIEVRWF
C8              YGVGESFTVQRRVQPKVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWF
                * * *********:*::****:********.******.************

C1              RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTS
C2              RNNQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVYTCQVEHPSVTT
C3              RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVYTCQVEHPSVMS
C4              RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTS
C5              RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVYTCQVEHPSVTS
C6              RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTS
C7              RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVYTCQVEHPSVTS
C8              RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVYTCQVEHPSVTS
                **.******************************:************** :

C1              ALTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYNQKGH
C2              PITVQWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYNQKGG
C3              PLTVQWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYNQKGR
C4              PLTVQWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYNQKGH
C5              PLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYNQKGH
C6              PLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYNQKGH
C7              PLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYNQKGL
C8              PLTVEWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYNQKGH
                .:**:***:********************************* 



>C1
LAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGTERVRYLDRYFH
NQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHN
YGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWF
RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTS
ALTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYNQKGH
>C2
VAALTVTLMVLSSPLALVGDTRPRFLELVKHECHFFNGTERVRYLDRYIH
NQEEVVRFDSDVGEYRAVTELGRPDAEYWNSQKDYVEQKRGQVDNYCRHN
YGVFESFTVQRRVQPKMTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWF
RNNQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVYTCQVEHPSVTT
PITVQWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYNQKGG
>C3
MAALTVTLMVLSSPLALAGDTRPRFLEQAKSECHFFNGTERVRYLQRYFY
NQEEYVRFDSDVGEYRAVTELGRPSAEYWNSQKELLEQKRGQVDNYCRHN
YRVGESFTVQRRVQPKVTVYPAKTQPLQHHSLLVCSVSGFYPGSIEVRWF
RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVYTCQVEHPSVMS
PLTVQWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYNQKGR
>C4
MAALTVTLMVLSSPLALAGDTRPRFLEQVKSECHFFNGTERVRFLERHFY
NQEEFVRFDSDVGEYRAVSELGRPVAESWNSQKDLLEQKRGQVDNYCRYN
YGVVESFTVQRRVQPKVTVYPSKTQPLQHHTLLVCSVSGFYPGSIEVRWF
RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTS
PLTVQWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYNQKGH
>C5
MAALTVTLMVLSSPLALAGDTQPRFLEQFKSECHFFNGTERVRYLQRYFY
NQEEYVRYDSDVGEYRAVTELGRPDAKYWNSQKDILEQRRARVDNYCRHN
YGVGESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWF
RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVYTCQVEHPSVTS
PLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYNQKGH
>C6
MAALTVTLMVLSSPLALAGDTRSRFLELVKSECHFFNGTERVRFLERYFY
NQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDYVEQKRGQVDNYCRHN
YRVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWF
RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTS
PLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYNQKGH
>C7
MAALTVTLMVLSSPLALAGDTRPHFLEQGKSECHFFNGTERVRFLERHFY
NQEEYLRFDSDVGEYRAVSELGRPTAESWNSQKDYLEQKRGQVDNYCRHN
YGVGESFTVQRRVQPKVTVYPAKTQPLQHHTLLVCSVNGFYPGSIEVRWF
RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVYTCQVEHPSVTS
PLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYNQKGL
>C8
MAALTVTLMVLSSPLALAGDTRPRFLEYSTSECHFFNGTERVRYLDRYFY
NQEETLRFDSDVGEYRAVTELGRPDAEYWNSQKDILEDQRASVDNYCRYN
YGVGESFTVQRRVQPKVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWF
RNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVYTCQVEHPSVTS
PLTVEWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYNQKGH
input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln I:255 S:98 BS:243
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# PW_SEQ_DISTANCES 
BOT	    0    1	 89.10 C1	 C2	 89.10
TOP	    1    0	 89.10 C2	 C1	 89.10
BOT	    0    2	 89.85 C1	 C3	 89.85
TOP	    2    0	 89.85 C3	 C1	 89.85
BOT	    0    3	 91.73 C1	 C4	 91.73
TOP	    3    0	 91.73 C4	 C1	 91.73
BOT	    0    4	 90.23 C1	 C5	 90.23
TOP	    4    0	 90.23 C5	 C1	 90.23
BOT	    0    5	 92.86 C1	 C6	 92.86
TOP	    5    0	 92.86 C6	 C1	 92.86
BOT	    0    6	 87.45 C1	 C7	 87.45
TOP	    6    0	 87.45 C7	 C1	 87.45
BOT	    0    7	 90.60 C1	 C8	 90.60
TOP	    7    0	 90.60 C8	 C1	 90.60
BOT	    1    2	 90.98 C2	 C3	 90.98
TOP	    2    1	 90.98 C3	 C2	 90.98
BOT	    1    3	 89.47 C2	 C4	 89.47
TOP	    3    1	 89.47 C4	 C2	 89.47
BOT	    1    4	 89.10 C2	 C5	 89.10
TOP	    4    1	 89.10 C5	 C2	 89.10
BOT	    1    5	 90.60 C2	 C6	 90.60
TOP	    5    1	 90.60 C6	 C2	 90.60
BOT	    1    6	 85.49 C2	 C7	 85.49
TOP	    6    1	 85.49 C7	 C2	 85.49
BOT	    1    7	 89.47 C2	 C8	 89.47
TOP	    7    1	 89.47 C8	 C2	 89.47
BOT	    2    3	 92.48 C3	 C4	 92.48
TOP	    3    2	 92.48 C4	 C3	 92.48
BOT	    2    4	 91.73 C3	 C5	 91.73
TOP	    4    2	 91.73 C5	 C3	 91.73
BOT	    2    5	 92.11 C3	 C6	 92.11
TOP	    5    2	 92.11 C6	 C3	 92.11
BOT	    2    6	 89.02 C3	 C7	 89.02
TOP	    6    2	 89.02 C7	 C3	 89.02
BOT	    2    7	 91.35 C3	 C8	 91.35
TOP	    7    2	 91.35 C8	 C3	 91.35
BOT	    3    4	 91.35 C4	 C5	 91.35
TOP	    4    3	 91.35 C5	 C4	 91.35
BOT	    3    5	 92.86 C4	 C6	 92.86
TOP	    5    3	 92.86 C6	 C4	 92.86
BOT	    3    6	 90.98 C4	 C7	 90.98
TOP	    6    3	 90.98 C7	 C4	 90.98
BOT	    3    7	 90.98 C4	 C8	 90.98
TOP	    7    3	 90.98 C8	 C4	 90.98
BOT	    4    5	 92.11 C5	 C6	 92.11
TOP	    5    4	 92.11 C6	 C5	 92.11
BOT	    4    6	 88.63 C5	 C7	 88.63
TOP	    6    4	 88.63 C7	 C5	 88.63
BOT	    4    7	 93.23 C5	 C8	 93.23
TOP	    7    4	 93.23 C8	 C5	 93.23
BOT	    5    6	 89.80 C6	 C7	 89.80
TOP	    6    5	 89.80 C7	 C6	 89.80
BOT	    5    7	 91.73 C6	 C8	 91.73
TOP	    7    5	 91.73 C8	 C6	 91.73
BOT	    6    7	 88.24 C7	 C8	 88.24
TOP	    7    6	 88.24 C8	 C7	 88.24
AVG	 0	 C1	  *	 90.26
AVG	 1	 C2	  *	 89.17
AVG	 2	 C3	  *	 91.07
AVG	 3	 C4	  *	 91.41
AVG	 4	 C5	  *	 90.91
AVG	 5	 C6	  *	 91.72
AVG	 6	 C7	  *	 88.52
AVG	 7	 C8	  *	 90.80
TOT	 TOT	  *	 90.48
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGTGTGTCTGAAGCTCCCTGGAGGCTCCAGCTTGGCAGCGTTGACAGT
C2              ATGGTGTGTCTGAGGCTCCCTGGAGGCTCCTACGTGGCAGCGCTGACAGT
C3              ATGGTGTGTCTGAGGCTCCCTGGAGGCTTCTGCATGGCAGCGCTGACAGT
C4              ATGGTGTGTCTGAAGCTCCCTGGAGGCTCCTGCATGGCAGCTCTGACAGT
C5              ATGGTGTGTCTGAAGCTCCCTGGAGGCTCCTATATGGCAGCTCTGACAGT
C6              ATGGTGTGTTTGAAGCTCCCTGGAGGCTCCTGCATGGCAGCGCTGACAGT
C7              ---------------------------------ATGGCAGCTCTGACAGT
C8              ATGGTGTGTCTGAAGCTCCCTGGAGGCTCCTGCATGGCAGCTCTGACAGT
                                                  *******  *******

C1              GACACTGATGGTGCTGAGCTCCCGACTGGCTTTCGCTGGGGACACCCGAC
C2              GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGTTGGGGACACCCGAC
C3              GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC
C4              GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC
C5              GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACTCAAC
C6              GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAT
C7              GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC
C8              GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC
                *********************** ********* * ********* *.* 

C1              CACGTTTCTTGGAGCTGCGTAAGTCTGAGTGTCATTTCTTCAATGGGACG
C2              CACGTTTCTTGGAGCTGGTTAAGCATGAGTGTCATTTCTTCAACGGGACG
C3              CACGTTTCTTGGAGCAGGCTAAGTCTGAGTGTCATTTCTTCAACGGGACG
C4              CACGTTTCTTGGAGCAGGTTAAGTCTGAGTGTCATTTCTTCAACGGGACG
C5              CACGTTTCTTGGAGCAGTTTAAGTCTGAGTGTCACTTCTTCAACGGGACG
C6              CACGTTTCTTGGAGCTGGTTAAGTCTGAGTGTCATTTCTTCAATGGGACG
C7              CACATTTCTTGGAGCAGGGTAAGTCTGAGTGTCATTTCTTCAATGGGACG
C8              CACGTTTCTTGGAGTATTCTACATCTGAGTGTCACTTCTTCAACGGGACG
                ***.********** :   **.. .********* ******** ******

C1              GAGCGGGTGCGGTACCTGGACAGATACTTCCATAACCAGGAGGAGTTCCT
C2              GAGCGGGTGCGGTACCTGGACAGATACATCCATAACCAGGAGGAGGTCGT
C3              GAGCGGGTGCGGTACCTGCAGAGATACTTCTATAACCAGGAGGAGTATGT
C4              GAGCGGGTGCGGTTCCTGGAGAGACACTTCTATAACCAGGAGGAGTTCGT
C5              GAGCGGGTGCGGTACCTGCAGAGATACTTCTATAACCAGGAGGAGTACGT
C6              GAGCGGGTGCGGTTCCTGGAGAGATACTTCTATAACCAGGAGGAGTACGT
C7              GAGCGGGTGCGGTTCCTGGAGAGACACTTCTATAACCAGGAGGAGTACCT
C8              GAGCGGGTGCGGTACCTGGATAGATACTTCTACAACCAGGAGGAGACCCT
                *************:**** * *** **:** * ************    *

C1              GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
C2              GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
C3              GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
C4              GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGTCGGAGCTGGGGC
C5              GCGCTACGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
C6              GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
C7              GCGCTTCGACAGCGACGTAGGGGAGTACCGGGCGGTGTCGGAGCTGGGGC
C8              GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
                *****:************.******************:************

C1              GGCCTGTCGCCGAGTCCTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAG
C2              GGCCTGACGCCGAGTACTGGAACAGCCAGAAGGACTACGTGGAGCAGAAG
C3              GGCCTAGCGCAGAGTACTGGAACAGCCAGAAGGAACTCCTGGAGCAGAAG
C4              GGCCTGTCGCCGAGTCCTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAG
C5              GGCCTGACGCCAAGTACTGGAACAGCCAGAAGGACATCCTGGAGCAGAGG
C6              GGCCTGATGCCGAGTACTGGAACAGCCAGAAGGACTACGTGGAGCAGAAG
C7              GGCCTACCGCCGAGTCCTGGAACAGCCAGAAGGACTACCTGGAGCAGAAG
C8              GGCCTGACGCCGAGTACTGGAACAGCCAGAAGGACATCCTGGAAGACCAG
                *****.  **..***.******************. :* ****. * ..*

C1              CGGGGCCGGGTGGACAATTACTGCAGACACAACTACGGGGTTGGTGAGAG
C2              CGGGGCCAGGTGGACAACTACTGCAGACACAACTACGGGGTTTTTGAGAG
C3              CGGGGCCAGGTGGACAACTACTGCAGACACAACTACCGGGTTGGCGAGAG
C4              CGGGGCCAGGTGGACAACTACTGCAGATACAACTACGGGGTTGTGGAGAG
C5              CGGGCCCGGGTGGACAACTACTGCAGACACAACTACGGGGTTGGTGAGAG
C6              CGGGGCCAGGTGGACAATTACTGCAGACACAACTACAGGGTTGGTGAGAG
C7              CGGGGCCAGGTGGACAACTACTGCAGACACAACTACGGGGTTGGTGAGAG
C8              CGGGCCTCGGTGGACAATTACTGCAGATACAACTACGGGGTTGGTGAGAG
                **** *  ********* ********* ******** *****   *****

C1              CTTCACAGTGCAGCGGCGAGTCCATCCTCAGGTGACTGTGTATCCTGCAA
C2              CTTCACAGTGCAGCGGAGAGTCCAACCTAAGATGACTGTGTATCCTGCAA
C3              CTTCACAGTGCAGCGGAGAGTCCAACCTAAGGTGACTGTGTATCCTGCAA
C4              CTTCACAGTGCAGCGGCGAGTCCAACCTAAGGTGACTGTGTATCCTTCAA
C5              CTTCACAGTGCAGCGGCGAGTCCAACCTAAGGTGACTGTGTATCCTTCAA
C6              CTTCACAGTGCAGCGGCGAGTCCATCCTCAGGTGACTGTGTATCCTGCAA
C7              CTTCACAGTGCAGCGGCGAGTCCAACCTAAGGTGACTGTGTATCCTGCAA
C8              CTTCACAGTGCAGCGGCGAGTCCAACCTAAGGTGACTGTGTATCCTGCAA
                ****************.*******:***.**.************** ***

C1              AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAGTGGT
C2              AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAGTGGT
C3              AGACCCAGCCCCTGCAGCACCACAGCCTCCTGGTCTGCTCTGTGAGTGGG
C4              AGACCCAGCCTCTGCAGCACCACACCCTCCTGGTCTGCTCTGTGAGTGGT
C5              AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAATGGT
C6              AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAATGGT
C7              AGACCCAGCCCCTGCAGCACCACACCCTCCTGGTCTGCTCTGTGAACGGT
C8              AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAATGGT
                ********** ************* ********************. ** 

C1              TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
C2              TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACAACCAGGAAGA
C3              TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
C4              TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
C5              TTCTACCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
C6              TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAATGGCCAGGAAGA
C7              TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAATGGCCAGGAAGA
C8              TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
                ***** ******************************** ..*********

C1              GAAGGCTGGGGTGGTGTCCACGGGCCTGATCCAGAATGGAGACTGGACCT
C2              GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCT
C3              GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCT
C4              GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCT
C5              GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCT
C6              GAAGGCTGGGGTGGTGTCCACGGGCCTGATCCAGAATGGAGACTGGACCT
C7              GAAGGCTGGGGTGGTCTCCACAGGCCTGATCCAGAATGGAGACTGGACCT
C8              GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCT
                *************** *****.****************************

C1              TCCAGACCCTGGTGATGCTAGAAACAGTTCCTCGGAGTGGAGAGGTTTAC
C2              TCCAGACCCTGGTGATGCTGGAAACCGTTCCTCAGAGTGGAGAGGTTTAC
C3              TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCAGAGTGGAGAGGTTTAC
C4              TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCGGAGTGGAGAGGTTTAC
C5              TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCAGAGTGGAGAGGTTTAC
C6              TCCAGACCCTGGTGATGCTAGAAACAGTTCCTCGGAGTGGAGAGGTTTAC
C7              TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCAGAGTGGAGAGGTTTAC
C8              TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCAGAGTGGAGAGGTTTAC
                *******************.*****.*******.****************

C1              ACTTGCCAAGTGGAGCACCCAAGCGTAACGAGCGCTCTCACAGTGGAATG
C2              ACCTGCCAAGTGGAGCACCCAAGTGTGACGACCCCTATCACAGTGCAATG
C3              ACCTGCCAAGTGGAGCACCCAAGCGTGATGAGCCCTCTCACAGTGCAATG
C4              ACCTGCCAAGTGGAGCACCCAAGCGTGACGAGCCCTCTCACAGTGCAATG
C5              ACCTGCCAAGTGGAGCACCCAAGCGTGACGAGCCCTCTCACAGTGGAATG
C6              ACCTGCCAAGTGGAGCACCCAAGCGTAACGAGCCCTCTCACAGTGGAATG
C7              ACCTGCCAAGTGGAGCACCCAAGCGTGACCAGCCCTCTCACAGTGGAATG
C8              ACCTGCCAAGTGGAGCACCCAAGCGTGACCAGCCCTCTCACAGTGGAATG
                ** ******************** **.*  * * **.******** ****

C1              GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
C2              GAGAGCACAGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
C3              GAGAGCACAGTCTGAATCTGCACAGAGTAAGATGCTGAGTGGAGTCGGGG
C4              GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
C5              GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
C6              GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
C7              GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
C8              GAGAGCACAGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
                ********.****************** **********************

C1              GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTGTTCATCTACTTC
C2              GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCAGGGCTGTTCATCTACTTC
C3              GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCAGGGCTGTTCATCTACTTC
C4              GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTGTTCATCTACTTC
C5              GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCTGGGCTGTTCATCTACTTC
C6              GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTGTTCATCTACTTC
C7              GTTTTGTGCTGGGCCTGCTCTTCCTTGGGGCTGGGCTGTTCATCTACTTC
C8              GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTGTTCATCTACTTC
                * ***************************** ******************

C1              AGGAATCAGAAAGGACACTCTGGACTTCAGCCAACAGGATTCCTGAGC--
C2              AGGAATCAGAAAGGAGGCTCTGGACTTCAGCCAACAGGACTCCTGAGC--
C3              AGGAATCAGAAAGGACGCTCTGGACTTCAGCCAACAGGACTCCTGAGC--
C4              AGGAATCAGAAAGGACACTCTGGACTTCAGCCAACAGGACTCCTGAGC--
C5              AGGAATCAGAAAGGACACTCTGGACTTCACCCAACAGGACTCCTGAGC--
C6              AGGAATCAGAAAGGACACTCTGGACTTCAGCCAACAGGATTCCTGAGC--
C7              AGGAATCAGAAAGGACTCCTGAGC--------------------------
C8              AGGAATCAGAAAGGACACACTGGACTTCAGCCAACAGGACTCCTGAGC--
                ***************  *   .*.                          

C1              -------------------------------
C2              -------------------------------
C3              -------------------------------
C4              -------------------------------
C5              -------------------------------
C6              -------------------------------
C7              -------------------------------
C8              -------------------------------
                                               



>C1
ATGGTGTGTCTGAAGCTCCCTGGAGGCTCCAGCTTGGCAGCGTTGACAGT
GACACTGATGGTGCTGAGCTCCCGACTGGCTTTCGCTGGGGACACCCGAC
CACGTTTCTTGGAGCTGCGTAAGTCTGAGTGTCATTTCTTCAATGGGACG
GAGCGGGTGCGGTACCTGGACAGATACTTCCATAACCAGGAGGAGTTCCT
GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
GGCCTGTCGCCGAGTCCTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAG
CGGGGCCGGGTGGACAATTACTGCAGACACAACTACGGGGTTGGTGAGAG
CTTCACAGTGCAGCGGCGAGTCCATCCTCAGGTGACTGTGTATCCTGCAA
AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAGTGGT
TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
GAAGGCTGGGGTGGTGTCCACGGGCCTGATCCAGAATGGAGACTGGACCT
TCCAGACCCTGGTGATGCTAGAAACAGTTCCTCGGAGTGGAGAGGTTTAC
ACTTGCCAAGTGGAGCACCCAAGCGTAACGAGCGCTCTCACAGTGGAATG
GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTGTTCATCTACTTC
AGGAATCAGAAAGGACACTCTGGACTTCAGCCAACAGGATTCCTGAGC--
-------------------------------
>C2
ATGGTGTGTCTGAGGCTCCCTGGAGGCTCCTACGTGGCAGCGCTGACAGT
GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGTTGGGGACACCCGAC
CACGTTTCTTGGAGCTGGTTAAGCATGAGTGTCATTTCTTCAACGGGACG
GAGCGGGTGCGGTACCTGGACAGATACATCCATAACCAGGAGGAGGTCGT
GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
GGCCTGACGCCGAGTACTGGAACAGCCAGAAGGACTACGTGGAGCAGAAG
CGGGGCCAGGTGGACAACTACTGCAGACACAACTACGGGGTTTTTGAGAG
CTTCACAGTGCAGCGGAGAGTCCAACCTAAGATGACTGTGTATCCTGCAA
AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAGTGGT
TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACAACCAGGAAGA
GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCT
TCCAGACCCTGGTGATGCTGGAAACCGTTCCTCAGAGTGGAGAGGTTTAC
ACCTGCCAAGTGGAGCACCCAAGTGTGACGACCCCTATCACAGTGCAATG
GAGAGCACAGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCAGGGCTGTTCATCTACTTC
AGGAATCAGAAAGGAGGCTCTGGACTTCAGCCAACAGGACTCCTGAGC--
-------------------------------
>C3
ATGGTGTGTCTGAGGCTCCCTGGAGGCTTCTGCATGGCAGCGCTGACAGT
GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC
CACGTTTCTTGGAGCAGGCTAAGTCTGAGTGTCATTTCTTCAACGGGACG
GAGCGGGTGCGGTACCTGCAGAGATACTTCTATAACCAGGAGGAGTATGT
GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
GGCCTAGCGCAGAGTACTGGAACAGCCAGAAGGAACTCCTGGAGCAGAAG
CGGGGCCAGGTGGACAACTACTGCAGACACAACTACCGGGTTGGCGAGAG
CTTCACAGTGCAGCGGAGAGTCCAACCTAAGGTGACTGTGTATCCTGCAA
AGACCCAGCCCCTGCAGCACCACAGCCTCCTGGTCTGCTCTGTGAGTGGG
TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCT
TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCAGAGTGGAGAGGTTTAC
ACCTGCCAAGTGGAGCACCCAAGCGTGATGAGCCCTCTCACAGTGCAATG
GAGAGCACAGTCTGAATCTGCACAGAGTAAGATGCTGAGTGGAGTCGGGG
GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCAGGGCTGTTCATCTACTTC
AGGAATCAGAAAGGACGCTCTGGACTTCAGCCAACAGGACTCCTGAGC--
-------------------------------
>C4
ATGGTGTGTCTGAAGCTCCCTGGAGGCTCCTGCATGGCAGCTCTGACAGT
GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC
CACGTTTCTTGGAGCAGGTTAAGTCTGAGTGTCATTTCTTCAACGGGACG
GAGCGGGTGCGGTTCCTGGAGAGACACTTCTATAACCAGGAGGAGTTCGT
GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGTCGGAGCTGGGGC
GGCCTGTCGCCGAGTCCTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAG
CGGGGCCAGGTGGACAACTACTGCAGATACAACTACGGGGTTGTGGAGAG
CTTCACAGTGCAGCGGCGAGTCCAACCTAAGGTGACTGTGTATCCTTCAA
AGACCCAGCCTCTGCAGCACCACACCCTCCTGGTCTGCTCTGTGAGTGGT
TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCT
TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCGGAGTGGAGAGGTTTAC
ACCTGCCAAGTGGAGCACCCAAGCGTGACGAGCCCTCTCACAGTGCAATG
GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTGTTCATCTACTTC
AGGAATCAGAAAGGACACTCTGGACTTCAGCCAACAGGACTCCTGAGC--
-------------------------------
>C5
ATGGTGTGTCTGAAGCTCCCTGGAGGCTCCTATATGGCAGCTCTGACAGT
GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACTCAAC
CACGTTTCTTGGAGCAGTTTAAGTCTGAGTGTCACTTCTTCAACGGGACG
GAGCGGGTGCGGTACCTGCAGAGATACTTCTATAACCAGGAGGAGTACGT
GCGCTACGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
GGCCTGACGCCAAGTACTGGAACAGCCAGAAGGACATCCTGGAGCAGAGG
CGGGCCCGGGTGGACAACTACTGCAGACACAACTACGGGGTTGGTGAGAG
CTTCACAGTGCAGCGGCGAGTCCAACCTAAGGTGACTGTGTATCCTTCAA
AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAATGGT
TTCTACCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCT
TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCAGAGTGGAGAGGTTTAC
ACCTGCCAAGTGGAGCACCCAAGCGTGACGAGCCCTCTCACAGTGGAATG
GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCTGGGCTGTTCATCTACTTC
AGGAATCAGAAAGGACACTCTGGACTTCACCCAACAGGACTCCTGAGC--
-------------------------------
>C6
ATGGTGTGTTTGAAGCTCCCTGGAGGCTCCTGCATGGCAGCGCTGACAGT
GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAT
CACGTTTCTTGGAGCTGGTTAAGTCTGAGTGTCATTTCTTCAATGGGACG
GAGCGGGTGCGGTTCCTGGAGAGATACTTCTATAACCAGGAGGAGTACGT
GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
GGCCTGATGCCGAGTACTGGAACAGCCAGAAGGACTACGTGGAGCAGAAG
CGGGGCCAGGTGGACAATTACTGCAGACACAACTACAGGGTTGGTGAGAG
CTTCACAGTGCAGCGGCGAGTCCATCCTCAGGTGACTGTGTATCCTGCAA
AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAATGGT
TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAATGGCCAGGAAGA
GAAGGCTGGGGTGGTGTCCACGGGCCTGATCCAGAATGGAGACTGGACCT
TCCAGACCCTGGTGATGCTAGAAACAGTTCCTCGGAGTGGAGAGGTTTAC
ACCTGCCAAGTGGAGCACCCAAGCGTAACGAGCCCTCTCACAGTGGAATG
GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTGTTCATCTACTTC
AGGAATCAGAAAGGACACTCTGGACTTCAGCCAACAGGATTCCTGAGC--
-------------------------------
>C7
---------------------------------ATGGCAGCTCTGACAGT
GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC
CACATTTCTTGGAGCAGGGTAAGTCTGAGTGTCATTTCTTCAATGGGACG
GAGCGGGTGCGGTTCCTGGAGAGACACTTCTATAACCAGGAGGAGTACCT
GCGCTTCGACAGCGACGTAGGGGAGTACCGGGCGGTGTCGGAGCTGGGGC
GGCCTACCGCCGAGTCCTGGAACAGCCAGAAGGACTACCTGGAGCAGAAG
CGGGGCCAGGTGGACAACTACTGCAGACACAACTACGGGGTTGGTGAGAG
CTTCACAGTGCAGCGGCGAGTCCAACCTAAGGTGACTGTGTATCCTGCAA
AGACCCAGCCCCTGCAGCACCACACCCTCCTGGTCTGCTCTGTGAACGGT
TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAATGGCCAGGAAGA
GAAGGCTGGGGTGGTCTCCACAGGCCTGATCCAGAATGGAGACTGGACCT
TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCAGAGTGGAGAGGTTTAC
ACCTGCCAAGTGGAGCACCCAAGCGTGACCAGCCCTCTCACAGTGGAATG
GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
GTTTTGTGCTGGGCCTGCTCTTCCTTGGGGCTGGGCTGTTCATCTACTTC
AGGAATCAGAAAGGACTCCTGAGC--------------------------
-------------------------------
>C8
ATGGTGTGTCTGAAGCTCCCTGGAGGCTCCTGCATGGCAGCTCTGACAGT
GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC
CACGTTTCTTGGAGTATTCTACATCTGAGTGTCACTTCTTCAACGGGACG
GAGCGGGTGCGGTACCTGGATAGATACTTCTACAACCAGGAGGAGACCCT
GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
GGCCTGACGCCGAGTACTGGAACAGCCAGAAGGACATCCTGGAAGACCAG
CGGGCCTCGGTGGACAATTACTGCAGATACAACTACGGGGTTGGTGAGAG
CTTCACAGTGCAGCGGCGAGTCCAACCTAAGGTGACTGTGTATCCTGCAA
AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAATGGT
TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCT
TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCAGAGTGGAGAGGTTTAC
ACCTGCCAAGTGGAGCACCCAAGCGTGACCAGCCCTCTCACAGTGGAATG
GAGAGCACAGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTGTTCATCTACTTC
AGGAATCAGAAAGGACACACTGGACTTCAGCCAACAGGACTCCTGAGC--
-------------------------------
>C1
MVCLKLPGGSSLAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGT
ERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQK
RGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY
TCQVEHPSVTSALTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGHSGLQPTGFLS
>C2
MVCLRLPGGSYVAALTVTLMVLSSPLALVGDTRPRFLELVKHECHFFNGT
ERVRYLDRYIHNQEEVVRFDSDVGEYRAVTELGRPDAEYWNSQKDYVEQK
RGQVDNYCRHNYGVFESFTVQRRVQPKMTVYPAKTQPLQHHNLLVCSVSG
FYPGSIEVRWFRNNQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
TCQVEHPSVTTPITVQWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGGSGLQPTGLLS
>C3
MVCLRLPGGFCMAALTVTLMVLSSPLALAGDTRPRFLEQAKSECHFFNGT
ERVRYLQRYFYNQEEYVRFDSDVGEYRAVTELGRPSAEYWNSQKELLEQK
RGQVDNYCRHNYRVGESFTVQRRVQPKVTVYPAKTQPLQHHSLLVCSVSG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
TCQVEHPSVMSPLTVQWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGRSGLQPTGLLS
>C4
MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTRPRFLEQVKSECHFFNGT
ERVRFLERHFYNQEEFVRFDSDVGEYRAVSELGRPVAESWNSQKDLLEQK
RGQVDNYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHTLLVCSVSG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY
TCQVEHPSVTSPLTVQWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGHSGLQPTGLLS
>C5
MVCLKLPGGSYMAALTVTLMVLSSPLALAGDTQPRFLEQFKSECHFFNGT
ERVRYLQRYFYNQEEYVRYDSDVGEYRAVTELGRPDAKYWNSQKDILEQR
RARVDNYCRHNYGVGESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGHSGLHPTGLLS
>C6
MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTRSRFLELVKSECHFFNGT
ERVRFLERYFYNQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDYVEQK
RGQVDNYCRHNYRVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVNG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY
TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGHSGLQPTGFLS
>C7
oooooooooooMAALTVTLMVLSSPLALAGDTRPHFLEQGKSECHFFNGT
ERVRFLERHFYNQEEYLRFDSDVGEYRAVSELGRPTAESWNSQKDYLEQK
RGQVDNYCRHNYGVGESFTVQRRVQPKVTVYPAKTQPLQHHTLLVCSVNG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGLLSoooooooo
>C8
MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTRPRFLEYSTSECHFFNGT
ERVRYLDRYFYNQEETLRFDSDVGEYRAVTELGRPDAEYWNSQKDILEDQ
RASVDNYCRYNYGVGESFTVQRRVQPKVTVYPAKTQPLQHHNLLVCSVNG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
TCQVEHPSVTSPLTVEWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGHTGLQPTGLLS


                               MrBayes v3.1.2

                      (Bayesian Analysis of Phylogeny)

                                     by

                  John P. Huelsenbeck and Fredrik Ronquist

                 Section of Ecology, Behavior and Evolution
                       Division of Biological Sciences
                     University of California, San Diego
                           johnh@biomail.ucsd.edu

                       School of Computational Science
                           Florida State University
                            ronquist@csit.fsu.edu 

              Distributed under the GNU General Public License

               Type "help" or "help <command>" for information
                     on the commands that are available.



   Executing file "/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 62
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated matrix
      Matrix has 8 taxa and 831 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Setting default partition (does not divide up characters).
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Taxon 7 -> C7
      Taxon 8 -> C8
      Setting output file names to "/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p/t>"
      Successfully read matrix
   Exiting data block
   Reading MrBayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Resetting model values to defaults (NB! Any existing model settings will be deleted!)
      Reinitializing link table (linking all parameters)
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
      applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 3608949311
      Seed = 1523489907
      Swapseed = 1523489907
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is uniformly dist-
                        ributed on the interval (0.00,200.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is uniformly dist-
                        ributed on the interval (0.00,200.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is uniformly dist-
                        ributed on the interval (0.00,200.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Topology         6  6  6
         Brlens           7  7  7
         ------------------------

         All parameters can be linked or unlinked across partitions

         1 --  Parameter  = Revmat
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = 1, 2, and 3
         2 --  Parameter  = Statefreq
               Prior      = Dirichlet
               Partitions = 1, 2, and 3
         3 --  Parameter  = Shape
               Prior      = Uniform(0.00,200.00)
               Partitions = 1 and 2
         4 --  Parameter  = Shape
               Prior      = Uniform(0.00,200.00)
               Partition  = 3
         5 --  Parameter  = Pinvar
               Prior      = Uniform(0.00,1.00)
               Partitions = 1, 2, and 3
         6 --  Parameter  = Topology
               Prior      = All topologies equally probable a priori
               Partitions = 1, 2, and 3
         7 --  Parameter  = Brlens
               Prior      = Branch lengths are Unconstrained:Exponential(10.0)
               Partitions = 1, 2, and 3

      Number of taxa = 8
      Number of characters = 831
      Compressing data matrix for division 1
      Division 1 has 44 unique site patterns
      Compressing data matrix for division 2
      Division 2 has 39 unique site patterns
      Compressing data matrix for division 3
      Division 3 has 44 unique site patterns
      The MCMC sampler will use the following moves:
         With prob.  Chain will change
            4.00 %   param. 1 (revmat) with Dirichlet proposal
            4.00 %   param. 2 (state frequencies) with Dirichlet proposal
            4.00 %   param. 3 (gamma shape) with multiplier
            4.00 %   param. 4 (gamma shape) with multiplier
            4.00 %   param. 5 (prop. invar. sites) with sliding window
           60.00 %   param. 6 (topology and branch lengths) with extending TBR
           20.00 %   param. 6 (topology and branch lengths) with LOCAL
      Creating parsimony (bitset) matrix for division 1
      Creating parsimony (bitset) matrix for division 2
      Creating parsimony (bitset) matrix for division 3
      Initializing conditional likelihoods for terminals
      Initializing invariable-site conditional likelihoods
      Initializing conditional likelihoods for internal nodes
      Initial log likelihoods for run 1:
         Chain 1 -- -2291.263105
         Chain 2 -- -2316.350509
         Chain 3 -- -2312.963111
         Chain 4 -- -2313.115222
      Initial log likelihoods for run 2:
         Chain 1 -- -2305.130403
         Chain 2 -- -2294.754429
         Chain 3 -- -2305.236391
         Chain 4 -- -2310.080126

      Chain results:

          1 -- [-2291.263] (-2307.095) (-2311.503) (-2306.212) * (-2291.248) (-2294.754) [-2301.509] (-2310.080) 
        100 -- (-2097.689) [-2116.813] (-2119.763) (-2137.816) * [-2082.058] (-2103.815) (-2110.407) (-2110.351) -- 0:00:00
        200 -- [-2041.079] (-2053.664) (-2064.423) (-2048.945) * (-2047.639) (-2049.891) (-2062.919) [-2040.104] -- 0:00:00
        300 -- (-2032.745) (-2021.013) (-2034.452) [-2010.999] * [-2014.988] (-2024.976) (-2048.373) (-2023.338) -- 0:00:00
        400 -- (-2020.975) (-2024.543) (-2008.101) [-1992.515] * (-2017.819) [-1999.812] (-2027.015) (-2005.976) -- 0:00:00
        500 -- (-2006.801) (-2010.988) (-2008.333) [-1987.383] * (-2013.101) [-1995.767] (-2009.315) (-2001.573) -- 0:00:00
        600 -- (-2011.729) (-2001.248) (-1999.763) [-1989.978] * (-1999.430) [-1988.529] (-2007.505) (-2005.919) -- 0:00:00
        700 -- (-2003.326) [-1999.169] (-1998.156) (-1995.166) * (-2000.656) (-1984.602) (-2011.453) [-1990.285] -- 0:00:00
        800 -- (-2000.657) (-1998.907) [-2001.833] (-1991.611) * (-2002.962) (-1985.574) (-2001.625) [-1992.991] -- 0:00:00
        900 -- [-2005.718] (-1999.347) (-1994.430) (-1993.780) * (-1997.805) [-1983.260] (-2002.735) (-1984.726) -- 0:00:00
       1000 -- (-2004.658) (-2006.740) (-1987.497) [-1993.965] * [-1999.587] (-1979.865) (-2004.439) (-1989.764) -- 0:00:00

      Average standard deviation of split frequencies: 0.088388

       1100 -- (-1997.408) (-2002.218) (-1983.478) [-1992.111] * (-1994.979) [-1978.904] (-2002.536) (-1999.845) -- 0:00:00
       1200 -- (-2002.851) (-2004.060) [-1981.174] (-1989.000) * (-1995.520) [-1979.168] (-1990.081) (-1986.768) -- 0:00:00
       1300 -- (-1989.255) (-2003.633) [-1977.390] (-1986.846) * (-1999.346) (-1979.110) [-1991.343] (-1988.468) -- 0:00:00
       1400 -- (-1992.268) (-2000.894) (-1977.746) [-1986.106] * (-2001.922) (-1988.700) (-1983.696) [-1987.650] -- 0:00:00
       1500 -- (-1988.715) (-1992.637) [-1977.370] (-1984.410) * (-1995.155) (-1986.885) [-1985.338] (-1982.766) -- 0:00:00
       1600 -- (-1995.665) (-1995.882) (-1978.240) [-1979.738] * (-1991.085) (-1987.611) (-1986.015) [-1982.289] -- 0:00:00
       1700 -- (-2007.966) (-1998.681) (-1986.557) [-1982.050] * (-1990.720) [-1985.778] (-1984.824) (-1981.951) -- 0:00:00
       1800 -- (-1997.413) (-1998.232) (-1981.985) [-1977.568] * (-1983.377) (-1989.995) [-1990.075] (-1984.168) -- 0:09:14
       1900 -- (-2007.594) (-1995.739) (-1984.790) [-1981.015] * [-1984.130] (-1987.220) (-1986.529) (-1993.067) -- 0:08:45
       2000 -- (-1994.959) [-1984.576] (-1988.328) (-1984.426) * (-1987.393) (-1988.942) [-1985.336] (-1987.349) -- 0:08:19

      Average standard deviation of split frequencies: 0.039284

       2100 -- (-1991.896) [-1985.112] (-1980.100) (-1986.242) * [-1984.399] (-1992.024) (-1979.771) (-1991.104) -- 0:07:55
       2200 -- (-1990.821) [-1987.291] (-1986.645) (-1980.286) * (-1984.033) (-1993.354) [-1979.410] (-1993.460) -- 0:07:33
       2300 -- (-1993.402) (-1987.634) [-1978.865] (-1987.583) * [-1982.680] (-1991.352) (-1983.125) (-1982.858) -- 0:07:13
       2400 -- (-1997.588) (-1986.707) (-1979.526) [-1987.381] * (-1985.621) (-1988.804) [-1981.911] (-1981.057) -- 0:06:55
       2500 -- (-1988.353) (-1988.232) [-1982.177] (-1985.381) * (-1981.598) (-1991.694) (-1993.775) [-1983.410] -- 0:06:39
       2600 -- (-1991.598) (-2000.615) (-1978.279) [-1982.530] * (-1983.168) (-1986.509) (-1995.992) [-1983.216] -- 0:06:23
       2700 -- (-1993.023) (-1997.303) (-1984.355) [-1981.670] * [-1985.026] (-1987.847) (-1990.036) (-1983.273) -- 0:06:09
       2800 -- (-1992.422) (-1992.601) [-1991.251] (-1994.688) * (-1985.816) (-1987.212) (-1988.461) [-1982.010] -- 0:05:56
       2900 -- (-1991.408) (-1987.167) [-1989.569] (-1995.137) * [-1988.062] (-1995.714) (-1992.900) (-1987.618) -- 0:05:43
       3000 -- (-1982.931) (-1988.891) [-1987.776] (-1999.610) * (-1985.983) (-1987.699) (-1987.979) [-1983.855] -- 0:05:32

      Average standard deviation of split frequencies: 0.047877

       3100 -- [-1984.000] (-1988.764) (-1986.522) (-2004.669) * (-1984.061) [-1985.480] (-1994.876) (-1981.372) -- 0:05:21
       3200 -- [-1984.938] (-1989.799) (-1990.072) (-1996.596) * (-1985.592) (-1977.132) (-1991.128) [-1981.905] -- 0:05:11
       3300 -- (-1988.409) [-1983.326] (-1994.406) (-1999.252) * (-1979.577) (-1978.715) (-1999.533) [-1981.301] -- 0:05:02
       3400 -- (-1983.614) [-1991.570] (-1995.198) (-1995.323) * (-1989.572) [-1979.613] (-1983.886) (-1984.272) -- 0:04:53
       3500 -- (-1982.285) (-1991.253) [-1986.552] (-1993.460) * (-1990.096) (-1985.507) (-1986.079) [-1980.962] -- 0:04:44
       3600 -- (-1984.553) (-2007.616) [-1983.209] (-1991.949) * (-1995.273) (-1983.698) (-1988.715) [-1980.138] -- 0:04:36
       3700 -- [-1992.261] (-1992.392) (-1986.217) (-1989.707) * (-1990.486) [-1986.628] (-1992.331) (-1986.671) -- 0:04:29
       3800 -- (-1988.605) [-1987.625] (-1986.542) (-1990.380) * (-1994.267) [-1984.074] (-1991.354) (-1985.839) -- 0:04:22
       3900 -- (-1997.613) (-1985.584) [-1984.742] (-1993.301) * (-1993.316) [-1981.544] (-1986.855) (-1994.948) -- 0:04:15
       4000 -- (-1992.181) (-1985.780) [-1983.556] (-1986.677) * (-1986.951) [-1981.707] (-1989.150) (-1991.059) -- 0:04:09

      Average standard deviation of split frequencies: 0.045620

       4100 -- (-1990.202) (-1985.826) (-1982.766) [-1986.443] * [-1994.520] (-1981.304) (-1993.163) (-1995.096) -- 0:04:02
       4200 -- (-1990.011) (-1983.612) [-1980.186] (-1985.248) * (-1995.372) [-1981.107] (-1997.123) (-1995.397) -- 0:07:54
       4300 -- (-2000.713) (-1989.787) [-1979.936] (-1984.736) * (-2002.290) [-1985.250] (-1988.684) (-1994.041) -- 0:07:43
       4400 -- (-1987.609) (-1986.296) (-1983.550) [-1986.212] * (-2006.547) [-1983.049] (-1987.212) (-1993.856) -- 0:07:32
       4500 -- (-1992.595) (-1989.608) (-1989.069) [-1985.234] * (-1993.147) [-1979.108] (-1987.250) (-1993.989) -- 0:07:22
       4600 -- (-1993.954) (-1988.087) (-1988.887) [-1980.612] * [-1989.038] (-1986.834) (-1983.567) (-1992.097) -- 0:07:12
       4700 -- (-1992.102) [-1982.068] (-1987.035) (-1984.512) * [-1991.703] (-1986.917) (-1990.553) (-1997.929) -- 0:07:03
       4800 -- (-1995.091) [-1985.694] (-1987.282) (-1984.888) * [-1984.159] (-1983.674) (-1997.624) (-1995.603) -- 0:06:54
       4900 -- (-1989.827) (-1986.565) (-1985.524) [-1981.205] * [-1987.362] (-1986.175) (-2001.695) (-1993.909) -- 0:06:46
       5000 -- (-1989.853) (-1982.218) (-1990.204) [-1984.089] * (-1993.422) [-1994.016] (-1992.789) (-1992.311) -- 0:06:38

      Average standard deviation of split frequencies: 0.011332

       5100 -- (-1990.727) [-1979.587] (-1990.917) (-1990.389) * [-1983.174] (-1989.825) (-1997.008) (-1991.922) -- 0:06:30
       5200 -- (-1993.084) [-1981.849] (-1986.010) (-1992.257) * [-1979.253] (-1999.100) (-1988.892) (-1993.659) -- 0:06:22
       5300 -- (-1991.345) [-1982.980] (-1986.540) (-1991.384) * (-1986.203) (-1992.987) [-1984.658] (-1990.837) -- 0:06:15
       5400 -- (-2005.549) (-1988.639) [-1986.730] (-1985.681) * [-1987.771] (-1991.807) (-1992.249) (-1987.833) -- 0:06:08
       5500 -- [-1988.740] (-1981.747) (-1990.184) (-1987.919) * (-1987.350) (-1989.705) (-1985.277) [-1984.795] -- 0:06:01
       5600 -- [-1982.307] (-1988.884) (-1989.181) (-1994.864) * (-1990.992) (-1985.960) [-1982.180] (-1986.190) -- 0:05:55
       5700 -- [-1985.734] (-1983.628) (-1989.669) (-1987.655) * (-1992.122) (-1989.063) [-1979.685] (-1987.194) -- 0:05:48
       5800 -- [-1980.985] (-1991.609) (-1995.433) (-1989.280) * (-1993.173) (-1988.342) [-1984.546] (-1989.578) -- 0:05:42
       5900 -- (-1982.624) [-1991.506] (-1994.123) (-1986.818) * (-1990.967) (-1985.014) (-1989.859) [-1987.210] -- 0:05:36
       6000 -- (-1983.392) (-1991.635) (-1993.957) [-1981.223] * [-1986.329] (-1982.529) (-1993.173) (-1987.295) -- 0:05:31

      Average standard deviation of split frequencies: 0.017568

       6100 -- (-1985.541) [-1984.623] (-1998.556) (-1983.763) * (-1984.361) [-1982.604] (-1997.152) (-1986.988) -- 0:05:25
       6200 -- (-1982.773) (-1986.861) (-1995.727) [-1984.154] * (-1986.928) [-1976.201] (-1993.307) (-1994.250) -- 0:05:20
       6300 -- (-1982.004) [-1986.683] (-1990.284) (-1984.866) * (-1979.659) [-1976.994] (-1994.563) (-1993.680) -- 0:05:15
       6400 -- (-1980.205) (-1987.406) [-1982.238] (-1981.947) * [-1979.847] (-1981.506) (-2004.774) (-1994.842) -- 0:05:10
       6500 -- [-1980.648] (-2000.655) (-1980.116) (-1984.950) * (-1993.087) [-1979.668] (-1999.702) (-1991.598) -- 0:05:05
       6600 -- (-1980.896) (-1998.904) [-1978.036] (-1993.588) * (-1991.598) [-1981.022] (-1994.246) (-1999.714) -- 0:05:01
       6700 -- [-1976.716] (-1998.677) (-1982.729) (-1994.566) * [-1986.541] (-1977.254) (-1991.588) (-1992.510) -- 0:07:24
       6800 -- (-1979.938) (-2000.425) [-1979.721] (-1995.547) * (-1985.925) (-1982.635) [-1988.503] (-1989.855) -- 0:07:18
       6900 -- [-1980.012] (-1998.227) (-1987.251) (-1997.037) * (-1985.824) [-1978.785] (-1986.038) (-1999.822) -- 0:07:11
       7000 -- [-1980.193] (-1988.462) (-1989.284) (-1989.970) * (-1983.476) [-1980.340] (-1989.560) (-1992.572) -- 0:07:05

      Average standard deviation of split frequencies: 0.020577

       7100 -- (-1985.449) [-1987.595] (-1993.670) (-1993.183) * [-1985.503] (-1980.030) (-1985.553) (-1993.536) -- 0:06:59
       7200 -- (-1985.000) (-1988.168) [-1984.804] (-2009.756) * [-1983.962] (-1986.795) (-1987.916) (-1990.728) -- 0:06:53
       7300 -- (-1989.336) (-1983.645) [-1983.981] (-1996.519) * [-1983.774] (-1986.834) (-1985.376) (-1989.609) -- 0:06:47
       7400 -- (-1993.049) (-1981.215) [-1984.438] (-1995.501) * (-1987.145) [-1982.789] (-1984.619) (-1994.386) -- 0:06:42
       7500 -- (-1990.947) (-1980.596) (-1982.678) [-1991.124] * (-1979.700) [-1980.802] (-1987.668) (-1992.766) -- 0:06:37
       7600 -- (-1995.702) [-1984.587] (-1989.259) (-1992.547) * (-1978.048) [-1984.120] (-1988.981) (-2003.014) -- 0:06:31
       7700 -- (-1990.719) [-1982.697] (-1992.037) (-1988.633) * [-1977.183] (-1989.744) (-1986.918) (-1993.791) -- 0:06:26
       7800 -- (-1981.114) (-1984.945) [-1979.599] (-1983.146) * [-1985.504] (-1995.768) (-1985.606) (-1993.900) -- 0:06:21
       7900 -- (-1983.982) [-1979.429] (-1979.436) (-1985.636) * [-1986.172] (-1989.577) (-1982.400) (-1994.788) -- 0:06:16
       8000 -- (-1980.892) [-1982.898] (-1987.108) (-1988.910) * (-1991.026) (-1997.573) [-1982.566] (-1987.116) -- 0:06:12

      Average standard deviation of split frequencies: 0.024840

       8100 -- [-1980.660] (-1978.362) (-1989.756) (-1989.272) * [-1995.389] (-1996.937) (-1983.086) (-1986.074) -- 0:06:07
       8200 -- (-1984.594) [-1981.745] (-1987.046) (-1994.973) * (-2003.493) (-1988.066) [-1977.035] (-1986.673) -- 0:06:02
       8300 -- [-1985.692] (-1986.921) (-1986.840) (-1987.445) * (-2005.414) (-1993.743) [-1979.174] (-1987.411) -- 0:05:58
       8400 -- (-1981.532) [-1988.652] (-1989.807) (-1985.926) * (-2017.508) (-1994.923) [-1979.945] (-1998.937) -- 0:05:54
       8500 -- (-1981.664) (-1992.675) (-1990.059) [-1985.582] * (-1994.798) (-1993.796) [-1981.489] (-2004.895) -- 0:05:49
       8600 -- (-1989.057) (-1991.480) [-1987.435] (-1990.655) * (-2001.025) (-1987.570) [-1982.584] (-2015.608) -- 0:05:45
       8700 -- (-2006.268) [-1993.075] (-1994.998) (-1994.783) * [-1985.128] (-1986.825) (-1978.054) (-2003.591) -- 0:05:41
       8800 -- (-1999.631) [-1985.144] (-1983.887) (-1998.244) * (-1982.719) (-1990.107) [-1978.800] (-2003.071) -- 0:05:37
       8900 -- (-1997.670) [-1979.203] (-1985.809) (-1994.374) * [-1988.188] (-1993.672) (-1985.556) (-2004.984) -- 0:05:34
       9000 -- (-1989.558) [-1978.518] (-1989.574) (-1987.069) * (-1981.765) (-1988.125) [-1985.432] (-2000.665) -- 0:05:30

      Average standard deviation of split frequencies: 0.024888

       9100 -- (-1984.601) [-1981.555] (-1987.460) (-1987.998) * (-1993.016) [-1982.917] (-1986.460) (-1999.912) -- 0:05:26
       9200 -- [-1979.719] (-1982.878) (-1989.476) (-1991.674) * (-1986.985) [-1984.287] (-1986.457) (-1998.456) -- 0:05:23
       9300 -- (-1982.126) [-1979.774] (-1983.191) (-1999.341) * [-1983.527] (-1987.361) (-1989.328) (-2006.967) -- 0:05:19
       9400 -- (-1981.909) [-1979.519] (-1979.111) (-2004.001) * [-1982.045] (-1985.717) (-1987.091) (-2012.366) -- 0:05:16
       9500 -- (-1985.900) (-1986.859) [-1981.491] (-1994.865) * (-1985.880) (-1991.197) [-1990.786] (-2000.175) -- 0:05:12
       9600 -- (-1988.655) (-1987.673) [-1989.951] (-1992.056) * [-1989.579] (-1992.842) (-1989.014) (-2004.923) -- 0:05:09
       9700 -- (-1990.598) (-1989.550) [-1987.103] (-1994.046) * (-1987.387) (-2002.329) [-1987.332] (-2010.528) -- 0:05:06
       9800 -- (-1989.494) (-1988.190) (-1992.335) [-1990.503] * [-1981.995] (-1997.394) (-1984.192) (-2008.782) -- 0:06:44
       9900 -- (-1987.629) [-1984.712] (-1988.438) (-2007.277) * (-1982.034) (-1997.172) [-1983.028] (-2009.723) -- 0:06:40
      10000 -- (-1991.640) [-1984.186] (-1988.140) (-2011.301) * (-1988.038) (-1997.804) [-1979.446] (-2009.189) -- 0:06:36

      Average standard deviation of split frequencies: 0.025254

      10100 -- [-1990.264] (-1989.054) (-1990.516) (-2002.811) * [-1985.904] (-1998.717) (-1985.395) (-2006.398) -- 0:06:32
      10200 -- (-1993.036) [-1985.319] (-1986.665) (-2010.140) * (-1988.831) (-1995.431) [-1980.627] (-1999.323) -- 0:06:28
      10300 -- (-1989.709) (-1988.622) [-1990.592] (-2008.592) * (-1988.210) (-1998.502) [-1984.774] (-1998.657) -- 0:06:24
      10400 -- [-1994.280] (-1990.508) (-1997.964) (-2000.192) * (-1983.277) (-1988.194) [-1981.283] (-1999.219) -- 0:06:20
      10500 -- (-1992.465) [-1991.354] (-1995.879) (-1999.213) * (-1984.654) (-1996.002) [-1982.746] (-1997.240) -- 0:06:16
      10600 -- [-1989.390] (-1993.248) (-1988.170) (-1987.971) * (-1992.894) (-1999.242) (-1985.496) [-1992.739] -- 0:06:13
      10700 -- (-1990.563) [-1990.238] (-1996.104) (-1989.738) * (-1987.561) [-1991.446] (-1987.010) (-1997.997) -- 0:06:09
      10800 -- (-1995.013) (-1989.629) [-1994.571] (-1990.154) * (-1993.366) (-2000.874) [-1982.055] (-1993.204) -- 0:06:06
      10900 -- (-2002.453) [-1985.688] (-1992.251) (-1985.885) * [-1985.843] (-1999.679) (-1985.585) (-1995.279) -- 0:06:02
      11000 -- (-1991.126) [-1984.189] (-1990.363) (-1990.148) * (-1984.996) (-2001.262) [-1985.242] (-1991.757) -- 0:05:59

      Average standard deviation of split frequencies: 0.031267

      11100 -- (-2001.850) [-1984.033] (-1988.373) (-1994.465) * (-1993.224) (-2008.248) [-1983.956] (-1986.836) -- 0:05:56
      11200 -- (-2000.494) [-1991.066] (-1989.862) (-2001.563) * [-1985.481] (-2002.289) (-1990.304) (-1990.410) -- 0:05:53
      11300 -- (-1990.295) (-1984.762) [-1986.049] (-2004.548) * (-1988.911) (-1996.668) (-1988.175) [-1990.785] -- 0:05:49
      11400 -- (-1983.291) [-1984.498] (-1990.907) (-2002.836) * (-1990.167) [-1994.272] (-1983.542) (-1985.382) -- 0:05:46
      11500 -- (-1984.706) [-1986.784] (-1992.706) (-1994.132) * (-1993.926) (-1994.384) [-1979.702] (-1993.681) -- 0:05:43
      11600 -- (-1985.730) (-1992.415) [-1989.367] (-1994.396) * (-1991.077) [-1984.346] (-1985.979) (-1989.650) -- 0:05:40
      11700 -- (-1979.111) [-1986.588] (-1993.820) (-1998.635) * (-2001.117) (-1981.270) (-1985.373) [-1984.020] -- 0:05:37
      11800 -- (-1980.903) [-1986.787] (-1991.578) (-2003.333) * (-1994.187) [-1979.189] (-1985.598) (-1992.241) -- 0:05:34
      11900 -- [-1983.677] (-1986.400) (-1990.287) (-2000.973) * (-1996.452) [-1982.046] (-1987.443) (-1992.176) -- 0:05:32
      12000 -- (-1985.357) [-1989.151] (-1991.351) (-1999.785) * (-2003.578) [-1981.654] (-1985.327) (-1996.810) -- 0:05:29

      Average standard deviation of split frequencies: 0.032192

      12100 -- (-1989.341) (-1989.661) [-1984.440] (-1999.242) * (-1999.256) [-1985.573] (-1993.978) (-1994.411) -- 0:05:26
      12200 -- (-1984.738) (-1990.994) [-1990.316] (-1992.172) * [-1987.914] (-1986.249) (-1979.839) (-1991.111) -- 0:05:23
      12300 -- [-1987.636] (-1987.385) (-1993.144) (-2000.939) * (-1991.196) [-1977.935] (-1983.221) (-1990.772) -- 0:05:21
      12400 -- [-1980.887] (-1983.922) (-1994.184) (-1992.888) * (-1988.783) [-1980.154] (-1979.567) (-1991.132) -- 0:05:18
      12500 -- [-1987.342] (-1985.247) (-1992.136) (-1994.426) * (-1996.944) [-1982.802] (-1980.954) (-1991.540) -- 0:05:16
      12600 -- (-1992.590) [-1980.901] (-1986.675) (-2003.347) * (-2000.512) [-1982.208] (-1982.173) (-1990.566) -- 0:05:13
      12700 -- (-1989.267) [-1983.924] (-1985.489) (-1997.564) * (-1998.247) (-1984.870) [-1981.886] (-1987.236) -- 0:05:10
      12800 -- (-1997.721) (-1983.862) [-1985.297] (-2004.475) * (-1997.619) (-1989.255) [-1980.549] (-1987.257) -- 0:05:08
      12900 -- (-1995.120) [-1981.921] (-1993.495) (-1998.941) * (-1989.870) [-1987.266] (-1982.139) (-1991.783) -- 0:05:06
      13000 -- (-1989.155) [-1982.348] (-1990.257) (-1992.971) * (-1986.154) (-1983.410) [-1976.019] (-1985.521) -- 0:06:19

      Average standard deviation of split frequencies: 0.029590

      13100 -- (-1989.285) [-1986.435] (-1989.345) (-1988.669) * (-1986.452) (-1995.168) [-1977.678] (-1982.781) -- 0:06:16
      13200 -- (-1986.486) [-1978.640] (-1990.771) (-1987.247) * [-1981.860] (-1985.478) (-1980.574) (-1985.465) -- 0:06:13
      13300 -- (-1986.778) [-1978.166] (-1990.010) (-1992.028) * (-1986.653) (-1982.963) [-1986.339] (-1987.211) -- 0:06:10
      13400 -- (-1998.954) [-1984.958] (-1987.060) (-1991.382) * [-1987.321] (-1987.205) (-1988.184) (-1993.675) -- 0:06:08
      13500 -- [-1988.458] (-1983.492) (-1990.547) (-1987.177) * (-1985.864) (-1983.936) [-1984.474] (-1998.006) -- 0:06:05
      13600 -- (-1982.885) [-1981.568] (-1995.539) (-1994.972) * (-1989.005) [-1981.391] (-1985.799) (-1995.674) -- 0:06:02
      13700 -- [-1981.591] (-1989.415) (-1991.854) (-1990.119) * (-1990.475) [-1984.470] (-1990.639) (-2002.295) -- 0:05:59
      13800 -- [-1978.944] (-1987.889) (-2000.162) (-1989.259) * (-1990.606) [-1981.476] (-1993.746) (-1992.670) -- 0:05:57
      13900 -- (-1991.370) [-1983.386] (-1993.428) (-1999.616) * (-1992.374) [-1982.109] (-2001.762) (-1988.969) -- 0:05:54
      14000 -- (-2000.813) [-1984.278] (-1985.596) (-2006.807) * (-1991.914) [-1984.351] (-1999.711) (-2000.428) -- 0:05:52

      Average standard deviation of split frequencies: 0.029542

      14100 -- (-1985.809) [-1979.359] (-1987.605) (-2002.472) * (-1990.730) [-1984.802] (-1998.640) (-1994.671) -- 0:05:49
      14200 -- (-1980.983) (-1984.756) [-1989.195] (-2008.359) * (-1997.132) (-1990.421) [-1989.115] (-1993.996) -- 0:05:47
      14300 -- [-1979.534] (-1990.669) (-1989.545) (-2000.106) * (-1999.206) [-1985.446] (-1997.340) (-1998.275) -- 0:05:44
      14400 -- [-1982.036] (-1994.387) (-1986.934) (-1994.207) * (-1998.352) [-1986.884] (-2005.658) (-1998.391) -- 0:05:42
      14500 -- [-1980.997] (-1997.636) (-1995.209) (-1994.052) * (-2001.487) (-1990.947) (-1999.504) [-1993.581] -- 0:05:39
      14600 -- [-1979.771] (-1995.207) (-1997.725) (-1990.240) * (-2000.524) [-1991.096] (-1999.584) (-1995.523) -- 0:05:37
      14700 -- [-1980.354] (-2004.993) (-1991.874) (-1987.526) * (-1994.211) (-1991.489) (-1996.897) [-1995.244] -- 0:05:35
      14800 -- (-1980.871) (-1995.719) (-1989.047) [-1983.946] * (-1995.564) [-1984.035] (-1989.340) (-1996.403) -- 0:05:32
      14900 -- [-1981.881] (-1997.115) (-1990.471) (-1986.862) * [-1990.016] (-1985.282) (-1990.409) (-1997.344) -- 0:05:30
      15000 -- [-1986.102] (-1985.716) (-1991.120) (-1989.446) * (-2003.873) [-1980.245] (-1992.746) (-1998.745) -- 0:05:28

      Average standard deviation of split frequencies: 0.028355

      15100 -- (-1985.697) [-1984.582] (-1991.385) (-1990.276) * (-2004.451) [-1976.299] (-1988.292) (-1998.471) -- 0:05:26
      15200 -- [-1983.301] (-1984.856) (-1986.508) (-1990.951) * (-1996.467) [-1980.160] (-1994.099) (-1998.533) -- 0:05:23
      15300 -- (-1993.028) (-1991.095) [-1987.189] (-1988.430) * (-1990.806) [-1976.479] (-1996.150) (-2009.635) -- 0:05:21
      15400 -- (-1986.452) [-1990.362] (-1984.395) (-1984.765) * (-1990.156) [-1978.524] (-1996.379) (-2007.698) -- 0:05:19
      15500 -- (-1985.262) (-1992.117) [-1986.360] (-1987.563) * (-1989.085) [-1980.537] (-1989.478) (-2008.897) -- 0:05:17
      15600 -- [-1980.574] (-2004.120) (-1991.135) (-1983.642) * (-1993.304) [-1983.684] (-1984.206) (-2012.129) -- 0:05:15
      15700 -- [-1980.207] (-1995.267) (-1987.520) (-1986.367) * (-2000.178) [-1979.390] (-1982.357) (-2002.314) -- 0:05:13
      15800 -- [-1981.204] (-1991.236) (-1982.801) (-1992.333) * (-1998.816) [-1978.822] (-1991.754) (-1998.564) -- 0:05:11
      15900 -- [-1983.250] (-1994.576) (-1985.632) (-1993.885) * (-1999.008) [-1980.944] (-1983.808) (-2000.512) -- 0:05:09
      16000 -- (-1983.438) (-1999.619) [-1985.906] (-1992.532) * (-2000.189) (-1983.880) [-1980.331] (-1999.263) -- 0:05:07

      Average standard deviation of split frequencies: 0.025045

      16100 -- (-1983.945) (-2002.525) [-1987.727] (-1996.570) * (-1997.852) [-1983.350] (-1986.463) (-1998.250) -- 0:05:05
      16200 -- (-1988.777) (-2002.627) [-1989.816] (-1995.911) * (-1995.483) [-1983.506] (-1984.646) (-2004.500) -- 0:06:04
      16300 -- [-1986.810] (-1990.123) (-1988.740) (-2000.784) * (-1989.380) [-1981.817] (-1985.936) (-1995.723) -- 0:06:02
      16400 -- [-1983.770] (-1986.746) (-1990.821) (-2005.375) * (-1994.476) [-1981.111] (-1984.387) (-1990.409) -- 0:05:59
      16500 -- (-1983.947) (-1992.358) (-1993.945) [-1992.196] * (-1993.516) (-1984.222) [-1983.008] (-1988.135) -- 0:05:57
      16600 -- [-1992.322] (-1992.632) (-1995.502) (-1994.145) * (-1993.678) (-1984.613) [-1989.336] (-1992.019) -- 0:05:55
      16700 -- (-1982.261) (-1995.604) [-1983.873] (-1992.735) * (-1994.684) (-1987.947) [-1981.792] (-1984.876) -- 0:05:53
      16800 -- [-1986.536] (-1993.930) (-1989.416) (-1985.630) * (-1987.702) (-1993.872) [-1987.307] (-1988.178) -- 0:05:51
      16900 -- [-1982.250] (-1985.144) (-2001.023) (-1987.711) * [-1995.942] (-1999.547) (-1991.838) (-1988.071) -- 0:05:49
      17000 -- [-1979.478] (-1993.743) (-1991.050) (-1991.296) * (-1997.842) (-2007.583) (-1994.349) [-1987.369] -- 0:05:46

      Average standard deviation of split frequencies: 0.022709

      17100 -- [-1980.217] (-1993.671) (-2006.257) (-1984.383) * [-1994.040] (-2001.718) (-2013.159) (-1985.057) -- 0:05:44
      17200 -- (-1983.561) (-2000.730) (-1990.891) [-1987.981] * [-1988.647] (-1996.123) (-2010.613) (-1988.227) -- 0:05:42
      17300 -- (-1993.199) (-1993.090) [-1985.963] (-1988.429) * (-1989.687) (-2001.846) (-2004.789) [-1985.133] -- 0:05:40
      17400 -- (-1990.982) (-1996.658) (-1992.029) [-1991.039] * (-1986.560) (-2000.515) (-2005.690) [-1987.207] -- 0:05:38
      17500 -- (-1998.415) (-2002.302) [-1983.642] (-1986.056) * [-1987.916] (-1996.291) (-2000.901) (-1994.239) -- 0:05:36
      17600 -- (-1998.584) (-1983.675) [-1987.320] (-1990.598) * (-1996.412) [-2000.115] (-2002.039) (-1994.402) -- 0:05:34
      17700 -- (-1992.528) [-1980.172] (-1986.882) (-1991.891) * (-1997.419) (-1994.558) (-2002.504) [-1987.649] -- 0:05:32
      17800 -- (-1994.899) [-1983.150] (-1993.847) (-1988.406) * (-1995.702) (-2002.574) (-2003.131) [-1985.717] -- 0:05:31
      17900 -- (-2003.513) [-1979.284] (-1991.786) (-1984.885) * (-1990.899) (-1999.837) (-2006.646) [-1986.562] -- 0:05:29
      18000 -- (-2000.152) [-1986.678] (-1989.585) (-1985.836) * (-2001.929) (-1989.945) (-2005.276) [-1988.383] -- 0:05:27

      Average standard deviation of split frequencies: 0.020054

      18100 -- (-2001.018) [-1983.058] (-1995.837) (-1990.359) * (-2000.109) [-1989.842] (-2002.181) (-1993.579) -- 0:05:25
      18200 -- (-1991.146) [-1981.276] (-1989.961) (-2000.557) * (-1990.570) [-1985.482] (-1993.790) (-1993.195) -- 0:05:23
      18300 -- (-1984.783) (-1983.033) [-1984.216] (-2001.105) * (-1991.477) (-1989.009) [-1990.537] (-1997.718) -- 0:05:21
      18400 -- (-1992.966) (-1986.794) [-1982.577] (-1996.745) * (-1994.911) (-1992.286) [-1987.657] (-1994.959) -- 0:05:20
      18500 -- (-1988.235) (-1990.845) [-1982.719] (-2009.687) * (-1997.218) (-1994.459) (-1990.234) [-1991.468] -- 0:05:18
      18600 -- (-1985.782) (-1990.571) [-1984.424] (-1987.642) * (-1991.314) (-1993.433) [-1986.839] (-1996.138) -- 0:05:16
      18700 -- [-1990.369] (-1996.141) (-1988.466) (-1986.849) * (-1994.476) [-1983.262] (-1990.842) (-1992.894) -- 0:05:14
      18800 -- (-1988.967) (-1997.167) (-1991.222) [-1982.236] * (-1997.099) (-1989.176) [-1988.408] (-1990.384) -- 0:05:13
      18900 -- (-1991.391) (-1997.170) (-2003.973) [-1991.729] * (-1998.378) [-1979.833] (-1985.124) (-1991.409) -- 0:05:11
      19000 -- (-1998.465) [-1991.808] (-1990.195) (-1987.848) * (-2001.283) (-1993.729) (-1987.803) [-1986.360] -- 0:05:09

      Average standard deviation of split frequencies: 0.021045

      19100 -- (-1997.348) [-1984.913] (-1987.774) (-1985.856) * [-1994.472] (-1986.258) (-1988.636) (-1990.258) -- 0:05:08
      19200 -- (-2000.607) (-1991.309) (-1987.005) [-1983.919] * (-1988.705) [-1977.790] (-1991.771) (-1987.858) -- 0:05:06
      19300 -- (-1999.096) (-1993.768) [-1982.570] (-1984.399) * (-1989.857) (-1985.834) [-1991.731] (-1987.709) -- 0:05:04
      19400 -- (-1996.066) (-1997.506) [-1981.170] (-1983.932) * (-1990.985) [-1985.368] (-1994.778) (-1993.206) -- 0:05:53
      19500 -- (-2006.701) (-1991.543) [-1983.353] (-1986.511) * (-1990.055) (-1988.720) [-1989.812] (-1995.896) -- 0:05:51
      19600 -- (-1991.386) (-1996.937) [-1982.356] (-1991.108) * (-1993.854) (-1983.937) (-1994.181) [-1989.628] -- 0:05:50
      19700 -- (-1999.812) (-1991.961) (-1989.591) [-1984.147] * (-1992.049) (-1984.306) [-1990.472] (-1985.486) -- 0:05:48
      19800 -- (-2004.232) (-1990.728) (-1995.399) [-1982.488] * (-1995.178) [-1982.708] (-1989.363) (-1986.204) -- 0:05:46
      19900 -- (-1993.559) (-1989.395) (-1988.637) [-1983.631] * (-1992.054) [-1984.954] (-1996.795) (-1986.628) -- 0:05:44
      20000 -- [-1987.724] (-1987.282) (-1986.585) (-1986.089) * (-1991.037) [-1982.428] (-1995.397) (-1985.669) -- 0:05:43

      Average standard deviation of split frequencies: 0.021407

      20100 -- (-1995.628) [-1982.543] (-1984.536) (-1987.245) * (-1992.818) [-1983.300] (-2003.184) (-1991.898) -- 0:05:41
      20200 -- (-1999.066) (-1984.359) (-1987.013) [-1985.755] * (-1997.030) [-1984.551] (-1991.293) (-1992.347) -- 0:05:39
      20300 -- (-1987.530) (-1983.404) [-1986.358] (-1985.574) * (-1997.032) [-1988.960] (-1991.904) (-1990.472) -- 0:05:37
      20400 -- (-1992.757) (-1988.626) [-1991.283] (-1990.796) * (-1996.858) [-1986.762] (-1993.698) (-1992.905) -- 0:05:36
      20500 -- (-1992.054) (-1990.042) [-1994.539] (-1987.660) * [-1997.993] (-1983.653) (-1988.728) (-1994.267) -- 0:05:34
      20600 -- (-1993.963) (-1987.523) [-1989.963] (-1988.065) * (-1999.533) [-1981.124] (-1993.419) (-1997.569) -- 0:05:32
      20700 -- (-1994.730) (-1989.940) (-1997.176) [-1985.635] * (-1998.368) [-1984.459] (-1985.557) (-2000.449) -- 0:05:31
      20800 -- (-1992.064) (-1994.708) (-1993.162) [-1981.306] * (-1998.055) [-1985.786] (-1986.689) (-2005.631) -- 0:05:29
      20900 -- (-2002.635) [-1991.604] (-1996.300) (-1978.659) * (-2004.968) [-1987.606] (-1989.382) (-2000.101) -- 0:05:27
      21000 -- (-1996.366) (-1994.231) (-1993.059) [-1983.477] * (-1995.805) (-1985.556) [-1979.704] (-1991.197) -- 0:05:26

      Average standard deviation of split frequencies: 0.019059

      21100 -- (-1992.118) (-1989.788) (-1996.983) [-1981.758] * [-1989.077] (-1988.944) (-1983.637) (-2004.146) -- 0:05:24
      21200 -- [-1989.552] (-1989.663) (-1988.899) (-1986.596) * (-1988.586) (-1988.232) [-1980.508] (-1997.695) -- 0:05:23
      21300 -- (-1991.804) (-1990.088) (-1988.423) [-1987.019] * (-1990.697) (-1982.599) [-1980.423] (-2002.708) -- 0:05:21
      21400 -- (-1987.927) (-1993.474) (-1989.797) [-1984.597] * (-1989.584) [-1980.688] (-1981.577) (-2001.073) -- 0:05:20
      21500 -- (-1994.182) (-2000.224) [-1986.081] (-1982.138) * (-1994.968) (-1982.024) [-1982.274] (-1997.433) -- 0:05:18
      21600 -- (-1989.625) (-1993.576) (-1991.042) [-1983.040] * (-1988.381) [-1989.721] (-1981.487) (-1990.455) -- 0:05:17
      21700 -- [-1987.513] (-1990.202) (-1982.176) (-1989.299) * (-1992.394) (-1995.346) (-1981.324) [-1987.204] -- 0:05:15
      21800 -- (-1984.450) (-1996.742) (-1989.836) [-1983.350] * (-1991.233) (-1989.588) [-1983.378] (-1989.265) -- 0:05:14
      21900 -- [-1986.959] (-1997.086) (-1988.521) (-1986.251) * (-1988.280) (-1985.400) [-1982.998] (-1991.412) -- 0:05:12
      22000 -- [-1984.378] (-1994.210) (-1985.720) (-1983.778) * (-1991.514) (-1993.289) [-1991.047] (-1992.790) -- 0:05:11

      Average standard deviation of split frequencies: 0.020081

      22100 -- [-1982.356] (-1998.227) (-1982.561) (-1982.466) * (-1990.380) (-2000.429) (-1996.084) [-1988.834] -- 0:05:09
      22200 -- (-1984.220) (-2003.576) [-1985.361] (-1983.726) * [-1993.908] (-2009.900) (-1994.338) (-1990.233) -- 0:05:08
      22300 -- (-1984.283) (-2009.672) (-1989.498) [-1992.791] * [-1991.044] (-2001.473) (-1985.300) (-1988.386) -- 0:05:06
      22400 -- [-1981.955] (-1998.878) (-1990.133) (-1990.425) * (-1990.289) (-2004.228) [-1982.542] (-1992.810) -- 0:05:05
      22500 -- [-1982.277] (-1987.962) (-1992.020) (-1989.149) * (-1995.316) (-2006.203) [-1980.233] (-1996.670) -- 0:05:47
      22600 -- (-1982.023) (-1982.768) (-1992.456) [-1991.512] * (-1997.411) (-1997.509) [-1983.551] (-1991.036) -- 0:05:45
      22700 -- [-1977.731] (-1981.797) (-1995.434) (-1991.103) * (-1997.962) [-1987.519] (-1984.441) (-1995.560) -- 0:05:44
      22800 -- (-1979.443) [-1976.009] (-1990.482) (-1992.443) * (-2001.489) (-1992.369) [-1985.441] (-1992.437) -- 0:05:42
      22900 -- [-1978.156] (-1980.549) (-1997.328) (-1982.836) * (-1996.956) [-1984.738] (-1983.990) (-1999.633) -- 0:05:41
      23000 -- [-1980.304] (-1980.048) (-2001.675) (-1993.822) * (-1998.251) [-1981.992] (-1987.058) (-1993.412) -- 0:05:39

      Average standard deviation of split frequencies: 0.020900

      23100 -- [-1986.246] (-1981.760) (-2000.529) (-1992.044) * (-1989.518) [-1983.986] (-1982.712) (-1994.119) -- 0:05:38
      23200 -- (-1983.596) [-1981.996] (-2005.523) (-1989.758) * (-1991.448) (-1981.634) [-1992.770] (-2004.221) -- 0:05:36
      23300 -- [-1981.972] (-1987.827) (-2005.252) (-1985.874) * (-1994.298) [-1980.503] (-1983.760) (-1994.663) -- 0:05:35
      23400 -- [-1977.693] (-1985.118) (-1992.279) (-1993.665) * (-1993.119) (-1984.340) [-1983.199] (-2002.956) -- 0:05:33
      23500 -- [-1978.103] (-1992.070) (-1989.232) (-1998.673) * (-1994.039) [-1979.978] (-1992.675) (-2004.428) -- 0:05:32
      23600 -- [-1983.977] (-1992.342) (-1991.169) (-2002.427) * (-1995.537) [-1980.007] (-1990.336) (-2006.081) -- 0:05:30
      23700 -- [-1984.692] (-1990.632) (-1993.161) (-2009.011) * (-1994.433) (-1988.268) [-1985.735] (-2005.579) -- 0:05:29
      23800 -- (-1981.782) (-1991.878) [-1982.776] (-1997.529) * (-1990.417) [-1989.210] (-1987.638) (-2000.254) -- 0:05:28
      23900 -- (-1989.822) (-1992.143) [-1985.720] (-2012.508) * (-1989.506) (-1987.105) [-1991.374] (-1999.533) -- 0:05:26
      24000 -- (-1987.107) [-1984.071] (-1994.152) (-2007.801) * (-1992.931) (-1987.464) [-1984.520] (-2002.831) -- 0:05:25

      Average standard deviation of split frequencies: 0.018417

      24100 -- (-1991.221) [-1986.958] (-1987.089) (-2016.333) * (-1991.076) (-1991.893) [-1980.033] (-2005.244) -- 0:05:23
      24200 -- (-1985.612) (-1989.357) [-1986.402] (-2006.036) * (-1988.585) (-1991.422) [-1980.951] (-2010.603) -- 0:05:22
      24300 -- (-1990.576) (-1988.711) (-1985.395) [-1996.111] * [-1990.308] (-1989.571) (-1984.379) (-2000.915) -- 0:05:21
      24400 -- (-1993.703) [-1980.814] (-1982.909) (-1994.554) * (-1992.081) (-1986.357) [-1979.683] (-1996.590) -- 0:05:19
      24500 -- (-1989.913) (-1981.056) [-1985.780] (-2006.661) * (-1994.416) (-1988.841) [-1980.856] (-1995.037) -- 0:05:18
      24600 -- (-1979.715) [-1979.258] (-1985.839) (-1993.538) * (-1992.820) (-1993.487) [-1978.671] (-1995.861) -- 0:05:17
      24700 -- [-1979.087] (-1990.954) (-1981.554) (-1990.588) * (-1994.132) (-1989.203) [-1981.362] (-1991.676) -- 0:05:15
      24800 -- [-1984.847] (-1994.978) (-1982.544) (-1992.284) * (-1992.869) (-1990.938) [-1980.557] (-1990.610) -- 0:05:14
      24900 -- (-1987.171) [-1979.642] (-1990.382) (-1993.973) * (-1991.560) (-1994.263) [-1982.177] (-1994.189) -- 0:05:13
      25000 -- (-1986.035) [-1977.945] (-1988.684) (-1991.038) * (-1996.571) (-1995.048) [-1981.040] (-1993.942) -- 0:05:12

      Average standard deviation of split frequencies: 0.015500

      25100 -- (-2000.958) [-1978.238] (-1991.151) (-1991.512) * (-2008.635) (-1988.551) [-1983.551] (-1997.248) -- 0:05:10
      25200 -- (-1990.604) [-1983.689] (-1986.236) (-1989.597) * (-1999.612) (-1990.117) [-1979.361] (-1994.074) -- 0:05:09
      25300 -- [-1981.761] (-1985.519) (-1986.673) (-1995.056) * (-2006.041) (-1987.651) [-1980.141] (-1991.328) -- 0:05:08
      25400 -- (-1987.946) [-1985.774] (-1987.981) (-1983.521) * (-2004.593) (-1988.960) (-1979.440) [-1983.164] -- 0:05:06
      25500 -- (-1986.543) [-1984.246] (-1985.132) (-1986.985) * (-1997.452) (-1986.801) [-1977.498] (-1987.349) -- 0:05:05
      25600 -- (-1987.048) (-1995.887) [-1986.428] (-1994.689) * (-2002.329) (-1987.754) [-1980.720] (-1992.168) -- 0:05:04
      25700 -- [-1982.612] (-1988.903) (-1978.438) (-1994.299) * (-1998.258) (-1985.996) [-1985.073] (-1987.092) -- 0:05:41
      25800 -- [-1981.302] (-1988.015) (-1982.943) (-1988.210) * (-1995.106) [-1983.245] (-1992.418) (-1989.738) -- 0:05:39
      25900 -- (-1980.781) (-1994.044) [-1986.926] (-1992.723) * (-1994.134) (-1992.918) (-1990.975) [-1986.507] -- 0:05:38
      26000 -- [-1982.958] (-1994.596) (-1990.221) (-1987.514) * (-1999.892) (-1988.475) (-1986.554) [-1984.965] -- 0:05:37

      Average standard deviation of split frequencies: 0.014946

      26100 -- (-1984.340) (-1988.014) [-1985.930] (-1988.824) * (-1993.357) [-1989.118] (-1987.033) (-1986.470) -- 0:05:35
      26200 -- (-1983.766) (-1992.212) (-1988.807) [-1989.291] * [-1990.961] (-1988.860) (-1987.467) (-1995.426) -- 0:05:34
      26300 -- (-1988.243) (-1989.013) (-1987.320) [-1989.559] * (-1998.120) (-1984.475) [-1982.292] (-1999.338) -- 0:05:33
      26400 -- (-1985.323) (-2000.220) (-1986.533) [-1985.023] * (-2004.653) (-1985.122) [-1980.315] (-1998.249) -- 0:05:31
      26500 -- [-1983.137] (-2000.077) (-1984.478) (-1994.328) * (-1995.484) [-1988.950] (-1987.952) (-1990.216) -- 0:05:30
      26600 -- (-1987.870) (-1996.767) [-1989.339] (-1995.810) * [-1989.580] (-1990.398) (-1986.677) (-1998.811) -- 0:05:29
      26700 -- [-1982.528] (-1994.899) (-1990.110) (-1997.543) * (-1995.099) [-1982.437] (-1994.840) (-1999.636) -- 0:05:28
      26800 -- (-1982.154) (-1993.536) (-1987.946) [-1991.662] * (-2004.380) (-1991.455) [-1981.364] (-1993.051) -- 0:05:26
      26900 -- (-1983.851) (-1999.699) (-1989.413) [-1986.695] * (-1994.874) [-1986.759] (-1985.828) (-1998.467) -- 0:05:25
      27000 -- [-1982.772] (-1996.031) (-1991.171) (-1995.618) * (-2000.548) (-1988.675) [-1988.561] (-2000.813) -- 0:05:24

      Average standard deviation of split frequencies: 0.016341

      27100 -- [-1983.707] (-1992.480) (-1988.983) (-1984.938) * (-1997.467) (-1991.402) [-1987.183] (-2001.233) -- 0:05:23
      27200 -- (-1985.812) (-1994.998) (-1993.266) [-1988.620] * (-1993.037) [-1988.596] (-1985.389) (-2004.053) -- 0:05:21
      27300 -- [-1984.571] (-1990.254) (-1989.630) (-1990.108) * (-1989.340) (-1986.108) [-1984.410] (-2010.119) -- 0:05:20
      27400 -- [-1985.715] (-1989.119) (-1986.005) (-1990.634) * (-1997.063) (-1988.569) [-1981.817] (-1995.603) -- 0:05:19
      27500 -- (-1986.500) (-1992.765) [-1985.351] (-1990.380) * (-1998.764) [-1988.256] (-1981.739) (-1996.173) -- 0:05:18
      27600 -- [-1997.108] (-1988.996) (-1989.426) (-1988.391) * (-2001.126) (-1991.453) [-1987.917] (-1992.011) -- 0:05:17
      27700 -- (-1992.970) [-1986.490] (-1982.502) (-1989.979) * (-1993.333) (-1991.533) [-1986.825] (-1991.558) -- 0:05:15
      27800 -- (-1986.576) [-1981.478] (-1985.705) (-1990.863) * (-2001.195) (-1995.229) (-1983.620) [-1986.466] -- 0:05:14
      27900 -- (-1983.498) [-1981.122] (-1982.886) (-1991.073) * (-2005.933) (-1992.489) [-1984.885] (-1988.241) -- 0:05:13
      28000 -- (-1996.066) [-1984.865] (-1978.490) (-1988.200) * (-2007.728) [-1983.001] (-1988.634) (-1991.128) -- 0:05:12

      Average standard deviation of split frequencies: 0.017714

      28100 -- (-1984.922) (-1985.585) [-1978.810] (-1993.817) * (-2007.236) [-1984.645] (-1988.264) (-1991.817) -- 0:05:11
      28200 -- (-1991.258) (-1993.772) [-1987.396] (-1994.426) * (-2002.346) [-1985.300] (-1990.991) (-1995.269) -- 0:05:10
      28300 -- (-1991.609) (-1988.181) [-1982.635] (-1993.969) * (-2003.028) (-1991.142) [-1989.748] (-1994.418) -- 0:05:09
      28400 -- [-1986.706] (-1998.771) (-1990.122) (-1986.520) * (-2000.820) [-1983.034] (-1989.287) (-1990.828) -- 0:05:07
      28500 -- (-1986.887) (-2000.547) (-1989.027) [-1984.961] * (-2003.626) (-1985.858) [-1985.100] (-1989.599) -- 0:05:06
      28600 -- (-1989.269) (-1991.959) (-1996.670) [-1986.831] * (-1997.634) (-1989.936) [-1986.853] (-1993.499) -- 0:05:05
      28700 -- (-1993.812) [-1984.242] (-1994.247) (-1992.063) * (-2003.595) (-1983.650) (-1993.898) [-1987.475] -- 0:05:04
      28800 -- [-1988.788] (-1988.636) (-1987.089) (-1993.047) * (-2000.486) [-1985.083] (-1984.813) (-1988.745) -- 0:05:03
      28900 -- [-1986.754] (-1990.498) (-1985.150) (-1990.193) * (-1997.705) [-1984.559] (-1979.672) (-1990.262) -- 0:05:36
      29000 -- (-1986.738) (-1993.429) [-1986.394] (-1988.536) * (-1996.125) (-1981.083) [-1983.146] (-1991.015) -- 0:05:34

      Average standard deviation of split frequencies: 0.015221

      29100 -- (-1981.659) (-1995.751) [-1985.899] (-1986.090) * (-1996.291) [-1988.047] (-1982.737) (-1985.647) -- 0:05:33
      29200 -- (-1984.512) (-1995.383) [-1988.856] (-1991.904) * (-1999.503) [-1980.755] (-1985.826) (-1990.358) -- 0:05:32
      29300 -- (-1984.295) (-1998.618) (-1985.537) [-1986.374] * [-1991.523] (-1982.280) (-1986.792) (-1988.383) -- 0:05:31
      29400 -- [-1984.464] (-1999.707) (-1992.100) (-1990.969) * [-1987.166] (-1983.293) (-1983.214) (-1989.180) -- 0:05:30
      29500 -- (-1981.325) (-1998.059) [-1988.049] (-1996.338) * (-1989.690) (-1988.310) [-1980.493] (-1988.308) -- 0:05:28
      29600 -- (-1984.088) (-1990.443) [-1979.829] (-1996.791) * (-1989.378) [-1985.053] (-1980.458) (-1988.142) -- 0:05:27
      29700 -- (-1986.739) (-1984.162) (-1979.931) [-1986.794] * (-1990.097) (-1984.326) [-1981.259] (-1994.319) -- 0:05:26
      29800 -- (-1992.576) (-1988.730) (-1989.749) [-1985.494] * (-1988.453) (-1992.915) [-1980.204] (-1990.193) -- 0:05:25
      29900 -- (-1979.834) [-1987.736] (-1987.208) (-1983.725) * (-1993.750) (-1992.658) [-1981.521] (-1990.537) -- 0:05:24
      30000 -- (-1979.421) (-1992.092) [-1983.585] (-1989.561) * (-1997.814) (-1985.713) [-1981.185] (-1992.785) -- 0:05:23

      Average standard deviation of split frequencies: 0.012962

      30100 -- (-1985.925) (-1996.671) [-1983.102] (-1985.433) * (-1992.509) (-1986.845) (-1983.818) [-1990.543] -- 0:05:22
      30200 -- (-1984.922) (-1988.051) [-1978.572] (-1992.423) * (-1995.030) (-1994.235) [-1979.929] (-1991.687) -- 0:05:21
      30300 -- (-1986.603) (-1985.597) [-1976.587] (-1994.583) * (-1999.076) (-1991.812) [-1981.600] (-1995.299) -- 0:05:20
      30400 -- (-1990.817) (-1985.493) (-1979.958) [-1984.283] * (-2015.024) (-1989.436) [-1984.998] (-1994.272) -- 0:05:18
      30500 -- (-1993.356) (-1983.096) [-1983.227] (-1990.803) * (-2000.939) (-1986.251) [-1987.501] (-1994.386) -- 0:05:17
      30600 -- (-1990.089) (-1982.969) [-1980.651] (-1989.831) * (-1993.987) (-1983.261) [-1982.135] (-1994.748) -- 0:05:16
      30700 -- (-1993.489) (-1991.547) [-1981.973] (-1994.004) * (-1988.855) (-1988.687) [-1980.574] (-1988.764) -- 0:05:15
      30800 -- (-1988.930) (-1983.908) [-1981.626] (-1989.140) * (-1988.504) (-1993.745) [-1981.281] (-1985.083) -- 0:05:14
      30900 -- (-1995.616) (-1984.329) [-1983.491] (-1984.410) * (-1992.891) [-1990.537] (-1981.651) (-1989.733) -- 0:05:13
      31000 -- (-1994.343) (-1981.576) [-1980.112] (-1983.983) * (-1989.718) (-1984.013) [-1985.314] (-1992.465) -- 0:05:12

      Average standard deviation of split frequencies: 0.012519

      31100 -- (-1994.922) (-1984.982) [-1983.311] (-1982.304) * [-1987.067] (-1988.178) (-1988.742) (-1990.006) -- 0:05:11
      31200 -- (-2002.258) (-1982.705) [-1978.890] (-1982.218) * (-1989.315) [-1984.954] (-1984.533) (-1993.847) -- 0:05:10
      31300 -- (-2011.040) [-1982.394] (-1979.367) (-1980.203) * [-1991.675] (-1995.341) (-1981.056) (-2004.206) -- 0:05:09
      31400 -- (-2004.073) (-1979.815) [-1980.548] (-1985.886) * (-1992.987) (-1990.534) [-1982.900] (-2009.283) -- 0:05:08
      31500 -- (-1990.202) [-1980.835] (-1999.084) (-1982.354) * (-1992.125) (-1988.481) [-1986.426] (-2007.061) -- 0:05:07
      31600 -- (-1998.135) [-1986.462] (-1988.925) (-1989.043) * (-1984.520) (-1984.164) [-1984.863] (-2002.351) -- 0:05:06
      31700 -- (-1994.710) [-1981.350] (-1978.571) (-1992.598) * (-1987.539) (-1989.763) [-1985.604] (-1996.603) -- 0:05:05
      31800 -- (-1992.598) [-1984.103] (-1980.359) (-1995.668) * (-1993.214) (-1983.493) [-1984.022] (-1995.603) -- 0:05:04
      31900 -- (-1993.154) (-1987.221) [-1983.382] (-1987.672) * (-1987.844) [-1983.470] (-1984.762) (-2007.348) -- 0:05:03
      32000 -- (-1988.997) (-1985.414) (-1983.134) [-1987.317] * (-1993.288) [-1990.557] (-1995.810) (-2009.776) -- 0:05:02

      Average standard deviation of split frequencies: 0.011317

      32100 -- (-1987.799) (-1984.028) [-1983.250] (-1984.634) * (-1989.970) (-1996.573) (-1989.130) [-1999.469] -- 0:05:31
      32200 -- (-1985.006) [-1986.429] (-1980.926) (-1979.729) * (-1987.741) (-1991.612) [-1985.036] (-1995.156) -- 0:05:30
      32300 -- (-1980.202) (-1984.435) (-1992.206) [-1987.626] * [-1986.640] (-1989.666) (-1992.467) (-1994.591) -- 0:05:29
      32400 -- [-1988.166] (-1986.890) (-1995.377) (-1984.436) * (-1983.742) (-1986.777) [-1980.888] (-1996.472) -- 0:05:28
      32500 -- (-1999.292) (-1988.750) [-1989.395] (-1987.300) * (-1983.323) (-1987.225) [-1980.336] (-2002.173) -- 0:05:27
      32600 -- (-1991.476) [-1977.911] (-1986.682) (-1987.700) * (-1995.297) [-1980.798] (-1986.431) (-2000.880) -- 0:05:26
      32700 -- (-1995.897) (-1977.690) (-1991.589) [-1984.910] * (-1994.090) [-1984.614] (-1985.569) (-1996.930) -- 0:05:25
      32800 -- (-1997.361) [-1979.830] (-1998.615) (-1988.267) * (-1988.606) [-1986.070] (-1981.803) (-1997.686) -- 0:05:24
      32900 -- (-2003.201) (-1986.638) (-2000.559) [-1988.512] * (-1989.536) (-1985.091) (-1990.969) [-1988.100] -- 0:05:23
      33000 -- (-2009.009) (-1982.663) (-1993.443) [-1986.037] * [-1987.217] (-1983.943) (-1996.749) (-1985.624) -- 0:05:22

      Average standard deviation of split frequencies: 0.013388

      33100 -- (-2006.630) [-1982.017] (-1984.841) (-1983.266) * (-1983.120) (-1990.366) (-1990.774) [-1991.699] -- 0:05:21
      33200 -- [-1989.611] (-1992.000) (-1984.661) (-1987.908) * (-1988.819) [-1980.304] (-1991.344) (-1993.823) -- 0:05:20
      33300 -- (-1998.361) (-1985.528) [-1982.528] (-1985.178) * [-1986.946] (-1983.506) (-1990.429) (-1992.430) -- 0:05:19
      33400 -- (-2004.065) [-1981.417] (-1984.430) (-1991.531) * (-1996.627) [-1986.283] (-1993.251) (-1999.027) -- 0:05:18
      33500 -- (-1999.902) (-1984.640) [-1987.940] (-1986.645) * (-1997.774) (-1988.995) [-1984.073] (-2005.058) -- 0:05:17
      33600 -- (-2006.056) [-1981.509] (-1985.765) (-1995.049) * (-1995.694) (-1991.461) [-1983.074] (-1997.966) -- 0:05:16
      33700 -- (-1995.215) [-1984.273] (-1989.447) (-1999.842) * (-1995.842) (-1979.732) [-1979.763] (-2001.089) -- 0:05:15
      33800 -- (-1998.474) (-1988.489) [-1982.616] (-1995.842) * (-2006.393) (-1980.060) [-1982.634] (-1998.150) -- 0:05:14
      33900 -- [-1993.436] (-1990.231) (-1989.834) (-1998.299) * (-2007.123) (-1982.144) [-1983.689] (-2004.107) -- 0:05:13
      34000 -- (-1992.165) (-1994.293) [-1987.997] (-1988.143) * (-2003.310) (-1987.156) [-1988.742] (-1999.309) -- 0:05:12

      Average standard deviation of split frequencies: 0.015389

      34100 -- (-1994.596) (-1991.273) (-1983.946) [-1986.402] * (-1997.663) [-1982.049] (-1986.335) (-1992.769) -- 0:05:11
      34200 -- (-1985.385) (-1990.406) [-1978.227] (-1989.310) * (-1999.421) (-1988.548) [-1982.706] (-1993.767) -- 0:05:10
      34300 -- (-1988.553) (-1987.524) [-1981.412] (-1990.982) * (-2002.491) (-1991.001) [-1983.156] (-1997.791) -- 0:05:09
      34400 -- (-1985.353) (-1984.213) [-1979.776] (-1989.749) * (-2002.352) (-1987.488) [-1985.403] (-1998.545) -- 0:05:08
      34500 -- (-1988.398) [-1981.826] (-1983.350) (-1991.406) * (-2001.239) [-1978.082] (-1992.890) (-2009.999) -- 0:05:07
      34600 -- (-1988.560) (-1980.803) [-1981.271] (-2007.529) * (-2002.990) [-1975.378] (-1989.699) (-1990.665) -- 0:05:06
      34700 -- (-1995.091) (-1990.261) [-1985.360] (-2001.061) * (-1989.570) (-1981.367) [-1986.956] (-1997.061) -- 0:05:06
      34800 -- (-1992.833) (-1989.591) [-1981.643] (-1991.115) * [-1985.103] (-1985.359) (-1983.967) (-2004.899) -- 0:05:05
      34900 -- (-1992.053) [-1986.304] (-1980.918) (-2001.918) * (-1989.280) (-1989.449) [-1981.191] (-2001.694) -- 0:05:04
      35000 -- (-1985.684) (-1985.973) [-1977.763] (-1995.028) * [-1987.982] (-1991.461) (-1981.493) (-2003.559) -- 0:05:03

      Average standard deviation of split frequencies: 0.015688

      35100 -- [-1982.549] (-1985.923) (-1982.616) (-1993.989) * (-1988.117) [-1987.806] (-1989.948) (-2002.870) -- 0:05:02
      35200 -- [-1980.975] (-1986.954) (-1986.961) (-1996.137) * (-1992.325) [-1986.656] (-1992.803) (-1998.322) -- 0:05:01
      35300 -- [-1979.100] (-1990.985) (-1981.990) (-1980.292) * (-1986.171) (-1996.256) [-1990.902] (-2003.458) -- 0:05:27
      35400 -- [-1978.700] (-1990.992) (-1980.862) (-1987.572) * (-1993.937) [-1984.812] (-1996.717) (-2001.156) -- 0:05:26
      35500 -- [-1979.219] (-1991.788) (-1983.540) (-1995.746) * (-1989.105) [-1982.488] (-1995.152) (-1999.922) -- 0:05:26
      35600 -- (-1991.172) (-1992.791) [-1986.570] (-1995.519) * (-1988.353) [-1978.495] (-1999.708) (-1997.047) -- 0:05:25
      35700 -- (-1991.137) (-1995.425) [-1987.150] (-2003.376) * (-1987.814) [-1986.067] (-1993.768) (-1998.813) -- 0:05:24
      35800 -- (-1986.143) [-1983.269] (-1991.791) (-1997.021) * [-1995.912] (-1984.713) (-1987.641) (-1996.427) -- 0:05:23
      35900 -- (-1985.986) [-1985.950] (-1986.673) (-2000.359) * (-2000.833) (-1981.291) [-1989.395] (-1990.741) -- 0:05:22
      36000 -- [-1987.907] (-1986.140) (-1992.686) (-1997.461) * (-1997.404) [-1983.590] (-1987.997) (-1999.133) -- 0:05:21

      Average standard deviation of split frequencies: 0.014537

      36100 -- (-1982.426) [-1986.744] (-1985.282) (-1997.422) * (-1999.877) (-1983.255) [-1986.583] (-2007.127) -- 0:05:20
      36200 -- (-1983.738) (-1985.901) [-1983.324] (-1999.205) * (-1995.129) [-1982.663] (-1985.971) (-1995.706) -- 0:05:19
      36300 -- (-1979.805) [-1987.171] (-1984.364) (-1995.352) * (-1993.048) (-1982.716) [-1985.515] (-1991.167) -- 0:05:18
      36400 -- (-1982.313) (-1991.039) [-1981.897] (-1997.285) * (-1992.404) [-1982.372] (-1990.881) (-1998.209) -- 0:05:17
      36500 -- [-1984.731] (-1986.724) (-1980.884) (-1995.930) * (-2000.320) [-1981.551] (-1988.476) (-1987.032) -- 0:05:16
      36600 -- (-1994.443) (-1986.609) [-1976.067] (-1986.282) * (-2004.552) [-1981.426] (-1991.525) (-1992.454) -- 0:05:15
      36700 -- (-1989.643) (-1984.735) [-1980.033] (-2001.101) * (-2004.023) [-1983.340] (-1982.404) (-1997.642) -- 0:05:14
      36800 -- (-1985.563) [-1981.808] (-1981.517) (-1999.527) * (-1991.061) [-1982.666] (-1986.980) (-1992.374) -- 0:05:14
      36900 -- (-1988.831) (-1982.172) [-1983.159] (-1993.563) * (-1994.128) (-1984.624) [-1986.097] (-1991.226) -- 0:05:13
      37000 -- [-1987.864] (-1991.145) (-1985.097) (-1992.451) * (-1995.392) (-1987.989) [-1983.747] (-1990.590) -- 0:05:12

      Average standard deviation of split frequencies: 0.017741

      37100 -- (-1984.292) [-1984.277] (-1987.126) (-2002.127) * (-1999.681) [-1982.471] (-1992.195) (-1990.228) -- 0:05:11
      37200 -- (-1985.510) (-1986.405) [-1988.330] (-2008.202) * (-1991.710) (-1989.404) (-1986.823) [-1985.901] -- 0:05:10
      37300 -- [-1979.507] (-1986.217) (-1981.635) (-1990.885) * (-2000.196) [-1983.547] (-1986.418) (-1991.742) -- 0:05:09
      37400 -- [-1979.145] (-1985.255) (-1985.208) (-1993.226) * (-2000.984) (-1983.567) [-1985.893] (-1987.032) -- 0:05:08
      37500 -- (-1987.150) [-1988.214] (-1982.657) (-1996.894) * (-1997.239) (-1983.992) [-1990.033] (-1997.009) -- 0:05:08
      37600 -- [-1983.363] (-1983.253) (-1983.876) (-2001.531) * (-1991.415) [-1989.448] (-1993.383) (-1993.330) -- 0:05:07
      37700 -- [-1985.673] (-1981.336) (-1986.852) (-1991.216) * (-1988.932) (-1993.191) [-1993.868] (-1994.032) -- 0:05:06
      37800 -- (-1984.230) [-1983.929] (-1986.436) (-1991.266) * (-1988.090) [-1979.341] (-2003.609) (-1995.380) -- 0:05:05
      37900 -- (-1996.535) [-1983.281] (-1991.876) (-1989.883) * (-1999.505) (-1977.951) (-1993.259) [-1988.515] -- 0:05:04
      38000 -- (-1997.838) [-1983.932] (-1979.711) (-1999.411) * (-1999.468) [-1977.676] (-1985.388) (-1991.507) -- 0:05:03

      Average standard deviation of split frequencies: 0.015541

      38100 -- (-1992.008) (-1975.989) [-1983.264] (-1993.344) * (-2000.397) (-1979.882) [-1988.191] (-1995.011) -- 0:05:02
      38200 -- (-1987.945) [-1980.109] (-1987.557) (-1993.706) * (-2002.778) [-1983.722] (-1986.283) (-1992.841) -- 0:05:02
      38300 -- (-1986.005) (-1980.570) [-1989.106] (-1996.530) * (-1997.435) [-1980.761] (-1989.287) (-1993.161) -- 0:05:01
      38400 -- (-1990.119) [-1983.943] (-1991.821) (-1996.364) * (-2004.934) [-1981.971] (-1990.014) (-1987.233) -- 0:05:25
      38500 -- [-1989.235] (-1982.460) (-1983.136) (-1995.015) * (-1999.534) [-1983.092] (-1983.285) (-1990.177) -- 0:05:24
      38600 -- (-1995.088) [-1989.720] (-1996.033) (-2009.294) * (-1997.401) (-1982.045) [-1978.993] (-1996.690) -- 0:05:23
      38700 -- (-1996.401) [-1985.328] (-2002.244) (-2008.845) * (-1997.727) (-1980.594) [-1980.635] (-2009.765) -- 0:05:22
      38800 -- (-1995.460) [-1987.216] (-1999.212) (-2000.743) * (-1986.014) [-1983.380] (-1987.797) (-1996.000) -- 0:05:22
      38900 -- (-1998.674) [-1981.515] (-1990.782) (-2000.350) * (-1986.946) [-1984.877] (-1983.726) (-1998.427) -- 0:05:21
      39000 -- (-1997.871) (-1983.759) (-1990.753) [-2000.922] * (-1985.518) [-1980.481] (-1981.639) (-2000.162) -- 0:05:20

      Average standard deviation of split frequencies: 0.015805

      39100 -- (-2005.666) (-1991.876) [-1985.108] (-1998.998) * [-1983.189] (-1981.565) (-1981.547) (-2016.988) -- 0:05:19
      39200 -- [-2001.205] (-1992.486) (-1991.810) (-1993.541) * [-1982.813] (-1988.859) (-1982.195) (-2000.307) -- 0:05:18
      39300 -- (-1996.206) (-1988.949) (-1989.347) [-1986.615] * (-1986.879) [-1986.775] (-1989.122) (-2012.315) -- 0:05:17
      39400 -- (-1998.048) (-1992.180) (-1991.186) [-1984.710] * [-1988.666] (-1986.307) (-1989.638) (-1996.576) -- 0:05:16
      39500 -- (-2001.983) (-1987.719) (-1987.071) [-1985.756] * (-1985.198) (-1988.702) [-1985.151] (-1994.571) -- 0:05:16
      39600 -- (-2007.461) (-1990.677) (-1988.057) [-1984.787] * (-1986.873) (-1986.064) [-1990.527] (-1999.433) -- 0:05:15
      39700 -- (-2000.227) [-1993.041] (-1994.112) (-1986.393) * (-1991.786) (-1990.874) [-1993.052] (-1994.191) -- 0:05:14
      39800 -- (-2004.242) (-1988.583) [-1996.859] (-1985.303) * (-1989.225) [-1992.752] (-1987.374) (-1992.199) -- 0:05:13
      39900 -- (-1998.952) (-1995.596) (-1995.187) [-1984.557] * (-1992.152) (-1994.869) (-1982.789) [-1985.732] -- 0:05:12
      40000 -- (-1999.716) (-1992.824) (-1988.894) [-1987.369] * (-1995.407) (-1992.482) (-1982.635) [-1986.933] -- 0:05:12

      Average standard deviation of split frequencies: 0.014431

      40100 -- (-1996.171) (-1991.087) [-1989.688] (-1987.875) * (-1999.996) (-1983.922) [-1982.796] (-1986.282) -- 0:05:11
      40200 -- (-1988.334) [-1986.316] (-1988.956) (-1992.878) * (-1997.183) (-1989.385) [-1985.034] (-1997.078) -- 0:05:10
      40300 -- (-1990.917) (-1985.475) (-1995.059) [-1989.679] * (-1992.529) (-1988.422) [-1981.528] (-2000.477) -- 0:05:09
      40400 -- (-1987.864) [-1986.876] (-1995.649) (-1988.968) * (-1986.426) [-1984.193] (-1981.765) (-2003.010) -- 0:05:08
      40500 -- (-1991.264) (-1985.874) [-1985.714] (-1985.119) * [-1988.422] (-1983.859) (-1986.084) (-1998.274) -- 0:05:07
      40600 -- (-1994.539) (-1984.936) [-1985.794] (-1992.992) * (-1991.946) (-1980.569) [-1984.775] (-2002.414) -- 0:05:07
      40700 -- [-1995.508] (-1989.875) (-1987.309) (-2005.567) * (-1989.472) (-1984.431) [-1983.552] (-2006.058) -- 0:05:06
      40800 -- (-2003.299) (-1986.640) [-1985.206] (-2000.010) * (-1998.030) (-1992.382) [-1992.382] (-2000.114) -- 0:05:05
      40900 -- (-2000.957) [-1981.320] (-1981.869) (-1995.424) * (-1994.301) [-1982.384] (-1993.723) (-1995.630) -- 0:05:04
      41000 -- (-2003.835) [-1979.401] (-1982.891) (-2006.844) * (-2001.097) [-1984.902] (-2001.264) (-1996.762) -- 0:05:04

      Average standard deviation of split frequencies: 0.015038

      41100 -- (-1992.901) [-1981.306] (-1986.890) (-2000.778) * (-2000.470) (-1984.629) [-1988.850] (-1995.728) -- 0:05:03
      41200 -- (-1996.038) [-1980.957] (-1983.041) (-2007.921) * (-2001.391) (-1982.965) [-1989.635] (-1994.601) -- 0:05:02
      41300 -- (-1992.365) [-1986.954] (-1982.900) (-2001.655) * (-1992.093) (-1983.109) [-1987.648] (-1993.266) -- 0:05:01
      41400 -- (-1995.225) (-1990.293) [-1978.099] (-1995.456) * [-1988.583] (-1984.306) (-1985.717) (-1988.896) -- 0:05:01
      41500 -- (-1991.706) (-1987.038) [-1976.485] (-1996.699) * [-1986.120] (-1984.148) (-1987.605) (-1992.360) -- 0:05:00
      41600 -- (-1985.996) [-1980.581] (-1976.473) (-1993.450) * (-1989.783) (-1985.725) [-1979.761] (-2003.658) -- 0:05:22
      41700 -- (-1984.851) [-1982.042] (-1987.447) (-1990.989) * (-1986.465) (-1983.814) [-1977.710] (-1995.528) -- 0:05:21
      41800 -- (-1991.750) (-1984.144) (-1980.737) [-1987.290] * (-1989.610) (-1993.028) [-1983.048] (-2001.505) -- 0:05:20
      41900 -- (-1990.980) (-1994.558) (-1987.320) [-1985.053] * (-1989.508) (-1992.101) [-1980.995] (-1998.383) -- 0:05:20
      42000 -- (-1992.411) (-1988.581) (-1984.095) [-1984.123] * (-1990.061) (-1984.491) [-1982.647] (-1992.286) -- 0:05:19

      Average standard deviation of split frequencies: 0.016623

      42100 -- (-1988.660) (-1990.682) [-1980.797] (-1989.051) * (-1994.357) [-1986.553] (-1983.866) (-1994.478) -- 0:05:18
      42200 -- (-2001.295) [-1983.232] (-1980.565) (-1993.141) * (-1989.239) (-1984.535) [-1987.295] (-2009.396) -- 0:05:17
      42300 -- (-1995.211) [-1982.276] (-1990.061) (-1991.841) * (-1985.843) [-1989.250] (-1980.616) (-2011.067) -- 0:05:16
      42400 -- (-1995.947) (-1984.596) [-1988.327] (-1990.046) * (-1985.574) [-1988.485] (-1981.735) (-2004.978) -- 0:05:16
      42500 -- (-1989.688) (-1984.586) (-1995.423) [-1997.762] * (-1988.211) (-1989.102) [-1984.297] (-2002.351) -- 0:05:15
      42600 -- (-1996.201) (-1987.613) (-1985.719) [-1996.699] * (-1987.765) (-1992.462) [-1983.066] (-2003.826) -- 0:05:14
      42700 -- (-2003.582) (-1984.206) [-1990.808] (-1992.495) * [-1983.966] (-2000.402) (-1985.177) (-2000.077) -- 0:05:13
      42800 -- (-1993.506) (-1988.705) [-1991.688] (-1992.261) * (-1989.399) (-1990.992) [-1981.778] (-2003.050) -- 0:05:13
      42900 -- (-1992.920) [-1988.865] (-1988.686) (-1994.839) * (-1987.010) (-1989.900) [-1986.996] (-2002.813) -- 0:05:12
      43000 -- (-1993.325) (-1988.444) [-1983.708] (-1997.278) * (-1988.563) (-1986.482) [-1978.979] (-2004.790) -- 0:05:11

      Average standard deviation of split frequencies: 0.015901

      43100 -- (-1993.592) (-1991.807) [-1984.126] (-2002.805) * (-1989.959) (-1982.030) [-1980.209] (-1998.254) -- 0:05:10
      43200 -- (-1995.261) (-1996.994) [-1989.700] (-1989.061) * (-1999.202) (-1980.999) [-1978.376] (-1991.700) -- 0:05:10
      43300 -- (-2009.722) [-1989.838] (-1987.576) (-1993.192) * (-1992.827) [-1981.764] (-1978.551) (-1991.179) -- 0:05:09
      43400 -- (-2006.601) (-1987.670) [-1984.940] (-2004.295) * (-1987.824) (-1988.373) [-1982.530] (-1996.394) -- 0:05:08
      43500 -- (-2004.817) [-1984.485] (-1982.790) (-2000.212) * (-1991.399) [-1977.987] (-1991.975) (-1991.678) -- 0:05:07
      43600 -- (-2013.966) (-1982.593) [-1987.291] (-1991.112) * (-1989.955) (-1984.037) [-1991.062] (-2000.116) -- 0:05:07
      43700 -- (-2000.772) (-1984.417) [-1989.202] (-1997.332) * (-1992.180) [-1986.335] (-1990.507) (-1998.465) -- 0:05:06
      43800 -- (-2001.120) [-1977.573] (-1989.125) (-2000.390) * (-1989.644) [-1981.237] (-1990.156) (-1990.308) -- 0:05:05
      43900 -- (-1999.845) [-1978.600] (-1993.542) (-1999.564) * (-1990.238) [-1980.930] (-1990.885) (-1995.189) -- 0:05:04
      44000 -- (-1994.140) [-1974.785] (-1986.430) (-2003.225) * (-1988.867) (-1978.518) [-1991.171] (-2006.628) -- 0:05:04

      Average standard deviation of split frequencies: 0.014344

      44100 -- (-1991.286) [-1978.058] (-1997.013) (-2004.940) * (-1993.973) (-1980.382) [-1986.425] (-1995.912) -- 0:05:03
      44200 -- (-1994.107) [-1980.142] (-1991.299) (-1992.867) * (-1994.427) (-1983.379) [-1984.971] (-1996.395) -- 0:05:02
      44300 -- (-1997.592) [-1979.725] (-1992.322) (-1994.228) * (-1989.812) [-1985.373] (-1994.755) (-1993.484) -- 0:05:02
      44400 -- (-1998.045) (-1985.165) (-1990.082) [-1989.681] * (-1992.355) (-1986.197) (-1988.224) [-1992.423] -- 0:05:01
      44500 -- (-1995.442) [-1991.520] (-1985.006) (-1991.717) * (-1993.224) [-1985.299] (-1992.093) (-1996.382) -- 0:05:00
      44600 -- [-1993.749] (-2001.923) (-1997.119) (-1992.406) * (-1993.502) (-1984.877) [-1987.087] (-2001.543) -- 0:04:59
      44700 -- (-2003.998) (-1996.151) [-1983.956] (-1990.856) * (-1992.477) [-1980.992] (-1980.358) (-1996.605) -- 0:04:59
      44800 -- (-1993.592) [-1990.485] (-1991.162) (-1993.489) * (-1993.246) (-1988.018) [-1978.792] (-1997.088) -- 0:05:19
      44900 -- (-1987.824) (-1986.943) (-1993.588) [-1993.052] * (-1995.826) [-1986.781] (-1983.561) (-1998.584) -- 0:05:19
      45000 -- (-1992.235) (-1988.757) [-1978.101] (-1991.965) * (-1996.746) (-1982.520) [-1981.208] (-2004.098) -- 0:05:18

      Average standard deviation of split frequencies: 0.014601

      45100 -- (-1995.262) (-1986.517) [-1979.199] (-1992.879) * (-1998.250) (-1983.524) [-1982.681] (-1990.173) -- 0:05:17
      45200 -- (-1992.249) (-1981.392) [-1978.577] (-1985.131) * (-1992.437) (-1980.148) (-1985.152) [-1992.331] -- 0:05:16
      45300 -- (-1989.843) (-1979.894) [-1978.661] (-1991.807) * (-1984.737) [-1977.218] (-1985.753) (-1989.950) -- 0:05:16
      45400 -- (-1990.520) [-1980.164] (-1979.732) (-2009.440) * [-1987.243] (-1978.384) (-1990.713) (-1989.594) -- 0:05:15
      45500 -- (-1992.046) (-1990.142) [-1983.084] (-1999.138) * (-1990.238) [-1984.890] (-1992.085) (-1987.215) -- 0:05:14
      45600 -- (-1988.302) (-1984.406) [-1981.718] (-1991.251) * (-1996.036) [-1987.974] (-2001.438) (-1989.468) -- 0:05:13
      45700 -- [-1993.561] (-1985.996) (-1983.675) (-1989.167) * (-1999.769) (-1991.881) (-1998.584) [-1989.137] -- 0:05:13
      45800 -- (-1988.381) (-1991.973) [-1980.055] (-1988.301) * (-2002.294) (-1999.154) [-1997.665] (-1984.605) -- 0:05:12
      45900 -- (-1990.482) (-1985.348) [-1980.856] (-1990.156) * (-2000.784) [-1986.703] (-1992.107) (-1986.591) -- 0:05:11
      46000 -- [-1984.927] (-1987.952) (-1988.586) (-1998.062) * (-1999.153) [-1991.167] (-1995.836) (-1983.700) -- 0:05:11

      Average standard deviation of split frequencies: 0.013722

      46100 -- (-1986.478) (-1985.890) [-1986.146] (-2000.547) * (-1998.273) [-1986.393] (-1990.647) (-1982.743) -- 0:05:10
      46200 -- (-1984.510) [-1986.539] (-1990.309) (-1997.821) * (-1994.366) (-1983.180) (-1996.738) [-1980.127] -- 0:05:09
      46300 -- [-1985.001] (-1986.361) (-1987.916) (-1999.559) * (-1998.884) [-1984.623] (-1996.257) (-1984.057) -- 0:05:08
      46400 -- [-1984.597] (-1987.261) (-1985.297) (-1999.323) * (-1998.235) [-1985.274] (-1993.437) (-1987.755) -- 0:05:08
      46500 -- (-1997.201) (-1988.487) [-1981.189] (-1993.380) * (-1998.100) [-1987.650] (-1991.033) (-1996.659) -- 0:05:07
      46600 -- (-1990.744) (-1998.344) [-1980.865] (-2002.701) * (-1991.795) [-1986.814] (-1997.739) (-1984.138) -- 0:05:06
      46700 -- [-1985.375] (-1996.197) (-1984.294) (-1998.863) * (-1993.742) (-1986.691) [-1996.048] (-1987.707) -- 0:05:06
      46800 -- (-1984.781) (-1990.515) [-1983.970] (-2001.278) * [-1992.950] (-1984.427) (-1997.489) (-1983.620) -- 0:05:05
      46900 -- [-1980.286] (-1988.789) (-1984.786) (-1994.166) * [-1987.096] (-1987.854) (-1987.665) (-1986.944) -- 0:05:04
      47000 -- (-1985.082) (-1986.747) [-1980.468] (-1993.162) * [-1985.778] (-2002.280) (-1989.475) (-1985.792) -- 0:05:04

      Average standard deviation of split frequencies: 0.012841

      47100 -- (-1983.960) (-1987.234) [-1981.418] (-1992.432) * [-1984.527] (-1997.021) (-1997.096) (-1992.054) -- 0:05:03
      47200 -- (-1984.901) (-1984.578) [-1982.023] (-1995.774) * (-1986.742) (-2001.288) [-1985.751] (-1987.070) -- 0:05:02
      47300 -- (-1985.265) (-1985.715) [-1982.969] (-1997.640) * (-1987.048) (-1996.999) [-1985.664] (-1986.423) -- 0:05:02
      47400 -- (-1985.760) (-1985.971) [-1985.231] (-2000.268) * (-1991.329) (-2003.226) (-1984.296) [-1985.693] -- 0:05:01
      47500 -- (-1990.523) (-1986.988) [-1982.095] (-2004.400) * (-1989.359) (-2000.138) [-1986.848] (-1992.686) -- 0:05:00
      47600 -- (-1985.179) (-1990.694) [-1984.530] (-2003.409) * [-1991.048] (-1998.512) (-1993.985) (-1990.662) -- 0:05:00
      47700 -- (-1987.357) (-1989.044) [-1987.625] (-1994.681) * (-1990.090) (-1999.208) (-1992.839) [-1989.346] -- 0:04:59
      47800 -- [-1986.904] (-1997.584) (-1995.723) (-1995.709) * [-1990.365] (-1996.710) (-1989.267) (-1988.494) -- 0:04:58
      47900 -- [-1982.503] (-2000.565) (-1986.804) (-1996.956) * (-2000.272) (-2006.884) [-1984.327] (-1992.160) -- 0:05:18
      48000 -- [-1980.285] (-2009.391) (-1994.885) (-1995.839) * (-1996.401) (-2004.657) [-1979.643] (-1986.290) -- 0:05:17

      Average standard deviation of split frequencies: 0.013711

      48100 -- [-1984.251] (-2011.865) (-1989.135) (-2004.827) * (-2001.299) (-2015.221) [-1981.169] (-1987.205) -- 0:05:16
      48200 -- (-1984.463) (-2015.173) [-1988.411] (-1999.597) * (-1997.885) (-2009.602) (-1981.198) [-1985.003] -- 0:05:15
      48300 -- (-1986.353) (-1995.739) [-1998.997] (-2003.466) * (-1999.503) (-2007.844) [-1987.162] (-1985.844) -- 0:05:15
      48400 -- (-1987.589) [-1981.367] (-1997.917) (-2001.018) * [-1988.324] (-1998.629) (-1985.757) (-1983.060) -- 0:05:14
      48500 -- (-1987.675) [-1987.717] (-1990.856) (-1991.595) * (-1991.442) (-1999.178) (-1990.750) [-1982.173] -- 0:05:13
      48600 -- (-1984.126) [-1985.732] (-1988.419) (-1995.086) * (-1992.637) (-1990.085) (-1988.583) [-1979.664] -- 0:05:13
      48700 -- [-1984.080] (-1983.948) (-1984.599) (-1999.330) * (-1991.045) (-1992.767) (-1987.644) [-1985.887] -- 0:05:12
      48800 -- (-1987.193) (-1984.946) [-1986.580] (-1994.508) * [-1989.835] (-1994.462) (-1986.577) (-1989.405) -- 0:05:11
      48900 -- (-1986.974) [-1980.830] (-1985.990) (-1999.542) * (-1986.899) (-1997.923) (-1989.069) [-1985.600] -- 0:05:11
      49000 -- (-1989.416) [-1978.984] (-1981.620) (-1995.352) * (-1990.005) (-1997.877) (-1992.048) [-1986.354] -- 0:05:10

      Average standard deviation of split frequencies: 0.014783

      49100 -- (-1992.967) [-1977.363] (-1983.980) (-1994.725) * (-1995.049) (-1992.102) (-1992.652) [-1987.184] -- 0:05:09
      49200 -- (-1991.776) (-1983.469) [-1981.010] (-1991.170) * (-1998.262) (-1991.189) (-1989.027) [-1990.919] -- 0:05:09
      49300 -- (-1989.186) [-1983.609] (-1981.710) (-1991.060) * (-1997.539) [-1988.517] (-1987.153) (-1987.659) -- 0:05:08
      49400 -- (-2000.832) (-1988.704) [-1987.703] (-1988.936) * (-1996.451) [-1989.042] (-1986.049) (-1985.327) -- 0:05:07
      49500 -- (-1998.034) (-1986.406) [-1982.807] (-1990.689) * (-1989.579) (-1994.186) (-1994.600) [-1983.131] -- 0:05:07
      49600 -- (-1995.479) (-1988.586) [-1987.559] (-1989.779) * (-1992.145) (-1998.051) [-1987.400] (-1979.589) -- 0:05:06
      49700 -- (-2006.524) (-1988.243) [-1976.977] (-1989.078) * (-1988.470) (-1993.088) (-1983.191) [-1984.445] -- 0:05:05
      49800 -- (-2005.368) (-1992.480) [-1978.106] (-1985.042) * (-1992.571) (-1997.697) [-1981.759] (-1982.050) -- 0:05:05
      49900 -- (-2004.282) (-1992.754) [-1978.379] (-1991.526) * (-1993.616) (-1995.461) [-1985.394] (-1984.094) -- 0:05:04
      50000 -- (-1999.194) (-1989.764) [-1978.433] (-1989.544) * (-1991.658) (-2001.642) [-1983.926] (-1983.528) -- 0:05:04

      Average standard deviation of split frequencies: 0.015045

      50100 -- (-1990.098) (-1985.965) [-1975.311] (-1990.739) * (-1991.475) (-1996.251) (-1980.972) [-1984.773] -- 0:05:03
      50200 -- (-1989.187) (-1982.368) (-1979.541) [-1987.442] * (-1998.718) (-1989.271) (-1981.062) [-1984.053] -- 0:05:02
      50300 -- [-1982.351] (-1989.000) (-1986.918) (-1991.694) * (-2004.533) (-1992.682) (-1983.489) [-1987.557] -- 0:05:02
      50400 -- (-1984.483) (-1988.862) [-1985.867] (-1991.343) * (-1992.592) (-1996.111) [-1980.669] (-1993.656) -- 0:05:01
      50500 -- (-1988.696) [-1983.957] (-1985.271) (-1990.781) * (-1993.106) (-1999.585) [-1982.678] (-1990.515) -- 0:05:00
      50600 -- (-1981.980) (-1980.041) [-1987.321] (-1994.765) * [-1990.928] (-2008.409) (-1982.086) (-1992.966) -- 0:05:00
      50700 -- (-1980.862) [-1980.527] (-1991.060) (-1997.735) * (-1991.248) (-1997.953) [-1983.480] (-1999.431) -- 0:04:59
      50800 -- (-1990.497) [-1977.877] (-1990.821) (-1991.792) * (-2001.697) [-1992.551] (-1980.941) (-1997.653) -- 0:04:58
      50900 -- (-1986.528) [-1980.614] (-1992.516) (-1995.635) * (-1998.936) (-1989.683) [-1981.941] (-1994.193) -- 0:04:58
      51000 -- (-1992.340) (-1989.900) [-1990.474] (-1993.388) * (-2002.017) (-1993.187) [-1982.706] (-1999.076) -- 0:04:57

      Average standard deviation of split frequencies: 0.014994

      51100 -- [-1981.339] (-1989.282) (-1989.822) (-1995.837) * (-2008.474) (-1990.226) [-1980.359] (-2004.022) -- 0:05:15
      51200 -- [-1977.548] (-1991.766) (-1996.297) (-1991.143) * (-1997.230) (-1993.461) [-1980.561] (-1995.202) -- 0:05:15
      51300 -- [-1981.081] (-1988.991) (-1993.864) (-1989.353) * (-1997.488) (-1996.017) (-1982.703) [-1992.750] -- 0:05:14
      51400 -- [-1981.413] (-1989.327) (-1996.840) (-2002.505) * (-2002.653) (-1996.875) [-1981.353] (-1992.268) -- 0:05:13
      51500 -- [-1985.966] (-1991.919) (-1997.126) (-2005.325) * (-2001.023) (-1989.880) [-1982.527] (-1999.699) -- 0:05:13
      51600 -- (-1994.297) [-1985.451] (-2002.078) (-1993.845) * (-1992.785) [-1989.698] (-1983.942) (-1987.569) -- 0:05:12
      51700 -- (-1996.893) [-1988.395] (-2005.727) (-2000.262) * (-2004.327) (-1990.120) (-1982.540) [-1985.851] -- 0:05:11
      51800 -- (-1998.306) [-1982.235] (-1992.579) (-2002.433) * (-1997.825) [-1990.083] (-1988.182) (-1987.357) -- 0:05:11
      51900 -- (-1999.085) [-1985.701] (-1983.302) (-1999.380) * (-1997.260) (-1990.827) (-1983.327) [-1981.882] -- 0:05:10
      52000 -- (-1990.675) (-1980.004) [-1981.390] (-1996.664) * (-1998.508) (-1998.179) [-1987.230] (-1980.528) -- 0:05:09

      Average standard deviation of split frequencies: 0.014209

      52100 -- (-1994.034) [-1984.098] (-1982.227) (-1995.043) * (-1995.079) [-1992.914] (-1988.959) (-1983.194) -- 0:05:09
      52200 -- (-1998.713) [-1987.559] (-1980.435) (-1986.606) * (-1991.106) (-1999.118) [-1985.142] (-1982.374) -- 0:05:08
      52300 -- (-2007.457) (-1990.779) (-1980.626) [-1985.384] * (-1989.920) (-1997.914) [-1980.714] (-1985.441) -- 0:05:08
      52400 -- (-1998.903) (-1991.670) [-1977.691] (-1988.666) * (-1998.485) (-2001.800) (-1985.379) [-1987.322] -- 0:05:07
      52500 -- (-1999.511) (-2001.338) [-1978.969] (-1987.503) * (-1989.436) (-1995.038) (-1985.867) [-1981.971] -- 0:05:06
      52600 -- (-1998.861) (-2002.168) [-1981.443] (-1986.281) * (-1990.975) [-1983.428] (-1986.009) (-1982.819) -- 0:05:06
      52700 -- (-1999.461) (-1997.294) [-1980.805] (-1990.868) * (-1986.772) (-1984.237) (-1985.642) [-1984.136] -- 0:05:05
      52800 -- (-2004.771) (-1989.794) [-1978.148] (-1996.142) * (-1987.006) (-1986.471) (-1986.030) [-1982.143] -- 0:05:04
      52900 -- (-2004.754) (-1999.988) [-1979.666] (-1990.329) * [-1983.734] (-1985.639) (-1989.401) (-1983.863) -- 0:05:04
      53000 -- (-2003.694) [-1991.514] (-1987.905) (-1996.085) * (-1986.778) (-1986.647) (-1988.118) [-1982.144] -- 0:05:03

      Average standard deviation of split frequencies: 0.014937

      53100 -- (-2014.123) (-1983.556) [-1991.594] (-2005.407) * (-1993.450) (-1992.298) [-1988.477] (-1981.854) -- 0:05:03
      53200 -- (-2005.150) (-1989.049) (-1985.905) [-1994.669] * (-1990.639) (-1991.982) (-1991.152) [-1982.016] -- 0:05:02
      53300 -- (-2004.893) [-1984.888] (-1991.718) (-1992.718) * (-1989.997) (-1994.273) (-1989.108) [-1982.204] -- 0:05:01
      53400 -- (-2000.649) (-1982.286) [-1981.282] (-1991.952) * (-2003.951) (-1988.482) [-1990.474] (-1983.623) -- 0:05:01
      53500 -- (-2006.986) (-1983.821) [-1990.477] (-1991.225) * (-2009.012) (-1994.267) (-1994.158) [-1982.788] -- 0:05:00
      53600 -- (-2006.628) [-1985.555] (-1986.393) (-1993.282) * (-2003.741) (-1987.675) (-1991.293) [-1984.381] -- 0:05:00
      53700 -- (-2016.750) (-1987.316) (-1983.308) [-1988.101] * (-2006.887) (-1986.514) (-2001.134) [-1982.630] -- 0:04:59
      53800 -- (-1998.725) [-1984.971] (-1981.155) (-1985.521) * (-2007.247) [-1990.495] (-1998.358) (-1980.008) -- 0:04:58
      53900 -- (-1997.586) (-1985.710) [-1985.779] (-1990.717) * (-2002.840) (-1990.010) (-1991.501) [-1977.438] -- 0:04:58
      54000 -- (-1989.951) (-1980.858) (-1989.013) [-1987.484] * (-2005.640) (-1995.095) (-1997.559) [-1982.777] -- 0:04:57

      Average standard deviation of split frequencies: 0.015177

      54100 -- (-1990.270) [-1983.567] (-1982.478) (-1993.862) * (-2003.791) (-1990.943) (-1997.761) [-1986.401] -- 0:04:57
      54200 -- (-2001.648) (-1989.914) [-1984.361] (-1989.548) * [-1996.919] (-1989.819) (-1993.786) (-1984.604) -- 0:04:56
      54300 -- (-1995.529) [-1982.691] (-1985.809) (-1993.618) * (-2010.597) (-1993.340) (-1999.882) [-1983.722] -- 0:05:13
      54400 -- (-1990.318) (-1980.599) [-1984.663] (-1997.293) * (-1995.882) (-1996.315) (-1990.673) [-1984.473] -- 0:05:12
      54500 -- (-1997.996) [-1984.692] (-1987.019) (-2006.204) * (-1992.876) (-1993.461) [-1992.494] (-1987.015) -- 0:05:12
      54600 -- (-1992.201) (-1987.514) [-1982.116] (-1995.505) * (-1994.233) (-1992.754) (-1993.868) [-1983.969] -- 0:05:11
      54700 -- (-1994.489) (-1993.184) [-1981.927] (-1999.617) * (-1993.487) (-1996.182) (-1998.254) [-1980.312] -- 0:05:11
      54800 -- (-1993.855) (-2001.541) [-1982.640] (-1990.769) * (-1995.876) [-1992.756] (-1992.985) (-1983.895) -- 0:05:10
      54900 -- (-1992.119) (-1989.023) [-1987.974] (-1996.131) * (-2001.823) [-1995.598] (-1993.398) (-1992.072) -- 0:05:09
      55000 -- (-2010.943) (-1992.944) [-1980.100] (-1991.831) * (-2002.373) (-1993.324) [-1991.798] (-1986.264) -- 0:05:09

      Average standard deviation of split frequencies: 0.015616

      55100 -- (-2012.117) (-1992.155) [-1979.969] (-1993.909) * (-2006.636) (-1991.244) (-1999.723) [-1986.907] -- 0:05:08
      55200 -- (-2001.745) (-1992.958) [-1983.495] (-1991.850) * (-2000.650) [-1987.609] (-1995.808) (-1987.011) -- 0:05:08
      55300 -- (-2007.599) [-1991.285] (-1989.362) (-1993.969) * (-2001.674) [-1984.854] (-1999.419) (-1987.440) -- 0:05:07
      55400 -- (-2002.966) [-1984.453] (-1987.983) (-1992.819) * (-1998.598) [-1986.742] (-1995.262) (-1987.548) -- 0:05:06
      55500 -- (-1987.922) (-1984.580) (-1982.887) [-1987.429] * (-1998.643) [-1987.815] (-1999.291) (-1988.417) -- 0:05:06
      55600 -- (-1989.714) (-1985.746) (-1994.466) [-1985.195] * (-2001.008) (-1983.704) (-1999.537) [-1985.773] -- 0:05:05
      55700 -- (-1988.497) [-1979.878] (-1993.606) (-1994.773) * (-2006.033) (-1988.789) (-2002.098) [-1980.505] -- 0:05:05
      55800 -- (-1986.203) (-1986.290) [-1984.792] (-1994.934) * (-1994.347) (-1986.969) (-1997.897) [-1983.012] -- 0:05:04
      55900 -- (-1986.124) [-1982.329] (-1996.115) (-1999.635) * (-1987.645) (-1987.162) (-1989.449) [-1991.461] -- 0:05:04
      56000 -- (-1986.334) [-1984.067] (-1993.069) (-1994.820) * (-1992.046) (-1991.522) (-1990.931) [-1982.085] -- 0:05:03

      Average standard deviation of split frequencies: 0.016556

      56100 -- (-1986.965) [-1981.639] (-1982.554) (-1996.434) * (-1994.680) (-1988.210) (-1994.695) [-1981.798] -- 0:05:02
      56200 -- (-1991.454) [-1982.780] (-1981.917) (-1996.247) * (-1990.129) [-1986.445] (-2004.764) (-1986.555) -- 0:05:02
      56300 -- (-1989.302) (-1988.029) [-1982.911] (-1989.208) * (-2004.081) [-1986.303] (-2012.407) (-1985.331) -- 0:05:01
      56400 -- [-1980.483] (-1985.073) (-1984.426) (-1988.139) * (-2013.705) (-1984.746) (-2010.161) [-1986.654] -- 0:05:01
      56500 -- (-1986.702) (-1987.384) (-1985.670) [-1983.857] * (-2004.701) [-1982.854] (-1997.160) (-1990.211) -- 0:05:00
      56600 -- (-1989.990) (-1985.320) (-1987.498) [-1986.215] * (-1997.605) [-1986.778] (-1995.329) (-1985.062) -- 0:05:00
      56700 -- (-1985.172) (-1989.792) (-1991.370) [-1986.063] * (-2001.562) [-1987.887] (-1992.948) (-1989.059) -- 0:04:59
      56800 -- (-1991.866) (-1988.218) (-1998.687) [-1987.401] * (-2000.373) (-1985.929) (-1988.456) [-1981.049] -- 0:04:58
      56900 -- (-1992.976) (-1982.008) (-2009.567) [-1987.005] * (-1999.434) (-1986.170) (-1988.311) [-1978.553] -- 0:04:58
      57000 -- [-1991.289] (-1984.823) (-1994.932) (-1987.331) * (-1999.391) (-1989.885) (-1989.431) [-1979.795] -- 0:04:57

      Average standard deviation of split frequencies: 0.015776

      57100 -- (-1998.914) [-1981.416] (-1994.859) (-1987.944) * (-2001.541) (-1996.427) (-1996.317) [-1979.783] -- 0:04:57
      57200 -- (-2001.810) (-1985.197) (-1991.320) [-1993.021] * (-1998.079) (-2000.158) (-1991.467) [-1983.607] -- 0:04:56
      57300 -- (-1990.373) [-1986.331] (-1986.012) (-1996.367) * (-1993.509) (-1994.347) (-1994.777) [-1984.587] -- 0:04:56
      57400 -- (-1994.356) (-1988.448) [-1989.759] (-1986.630) * (-2002.695) [-1991.445] (-1994.342) (-1981.847) -- 0:05:12
      57500 -- (-1993.973) (-1984.879) [-1987.277] (-1990.635) * (-1994.581) [-1986.082] (-1994.598) (-1987.961) -- 0:05:11
      57600 -- [-1982.239] (-1994.016) (-1990.879) (-1995.375) * (-1997.529) [-1981.857] (-2005.230) (-1984.379) -- 0:05:10
      57700 -- (-1981.381) (-1991.251) (-1985.931) [-1992.432] * (-1993.752) (-1985.809) (-1993.684) [-1980.217] -- 0:05:10
      57800 -- (-1987.935) (-1998.278) [-1985.539] (-1987.784) * (-2001.008) (-1990.784) (-2001.252) [-1986.613] -- 0:05:09
      57900 -- [-1989.470] (-1995.819) (-1984.878) (-1996.635) * (-2001.963) (-1990.187) (-1997.365) [-1986.805] -- 0:05:09
      58000 -- (-1984.118) (-1993.643) [-1983.128] (-2002.073) * (-1992.865) [-1988.864] (-2001.954) (-1988.726) -- 0:05:08

      Average standard deviation of split frequencies: 0.014365

      58100 -- [-1980.029] (-1987.601) (-1985.067) (-1995.840) * [-1984.426] (-1989.583) (-2003.418) (-1989.402) -- 0:05:08
      58200 -- [-1982.113] (-1986.198) (-1984.953) (-1987.831) * [-1985.445] (-1998.010) (-1994.793) (-1984.888) -- 0:05:07
      58300 -- (-1981.000) [-1991.422] (-1991.962) (-1995.534) * [-1987.782] (-1989.398) (-1989.811) (-1987.298) -- 0:05:06
      58400 -- [-1981.735] (-1993.713) (-1988.325) (-1988.770) * (-1986.959) [-1986.627] (-1997.657) (-1997.746) -- 0:05:06
      58500 -- [-1983.896] (-1992.727) (-1994.854) (-1990.254) * (-1985.255) (-1988.199) [-1991.795] (-1996.940) -- 0:05:05
      58600 -- (-1983.996) [-1988.928] (-1984.900) (-1990.062) * (-1982.010) [-1985.921] (-1995.144) (-1991.301) -- 0:05:05
      58700 -- (-1988.416) [-1985.552] (-1987.872) (-1991.662) * [-1985.070] (-1988.524) (-1988.007) (-1997.017) -- 0:05:04
      58800 -- (-1988.362) (-1988.844) [-1985.679] (-1991.947) * [-1993.436] (-1988.205) (-1992.169) (-1999.060) -- 0:05:04
      58900 -- (-1996.070) (-1988.019) [-1987.327] (-1992.518) * [-1995.375] (-1987.660) (-1985.646) (-1999.036) -- 0:05:03
      59000 -- (-2001.662) (-1991.058) (-1985.664) [-1989.989] * [-1992.149] (-1990.139) (-1987.293) (-1994.457) -- 0:05:03

      Average standard deviation of split frequencies: 0.014788

      59100 -- (-1996.728) [-1987.018] (-1993.738) (-1990.805) * (-1991.418) [-1989.351] (-1993.624) (-1990.283) -- 0:05:02
      59200 -- (-1999.539) (-1988.795) [-1993.022] (-1990.170) * (-1995.401) [-1988.349] (-1995.590) (-1981.797) -- 0:05:01
      59300 -- (-2003.287) (-1989.240) (-1988.786) [-1986.897] * (-1994.412) (-1989.813) (-1990.578) [-1984.838] -- 0:05:01
      59400 -- (-1993.168) (-1995.737) [-1982.058] (-1987.344) * (-1999.355) (-1989.695) (-1994.103) [-1982.067] -- 0:05:00
      59500 -- [-1983.279] (-1999.637) (-1988.460) (-1991.020) * (-1995.902) (-1988.243) (-1996.739) [-1979.245] -- 0:05:00
      59600 -- [-1982.446] (-1994.380) (-1985.498) (-1996.889) * (-2000.070) (-1988.035) (-1987.417) [-1983.308] -- 0:04:59
      59700 -- [-1983.845] (-1992.871) (-1993.250) (-1992.405) * (-1995.551) [-1994.269] (-1998.580) (-1987.297) -- 0:04:59
      59800 -- [-1983.981] (-1994.107) (-1995.882) (-1992.374) * (-1991.501) (-1992.293) (-1995.188) [-1985.775] -- 0:04:58
      59900 -- [-1982.712] (-1996.141) (-1994.087) (-1994.033) * (-1987.672) (-2000.192) (-1997.960) [-1979.077] -- 0:04:58
      60000 -- (-1994.882) (-1991.120) (-1996.931) [-1990.932] * [-1984.452] (-1999.811) (-2000.081) (-1987.287) -- 0:04:57

      Average standard deviation of split frequencies: 0.015231

      60100 -- [-1987.165] (-1991.038) (-2001.598) (-1998.133) * [-1983.658] (-1989.928) (-1994.598) (-1998.663) -- 0:04:57
      60200 -- [-1978.776] (-1992.182) (-1993.679) (-2008.261) * (-1986.793) [-1992.242] (-1996.541) (-1995.490) -- 0:04:56
      60300 -- [-1978.301] (-1990.955) (-1992.787) (-2003.926) * (-1989.773) [-1991.537] (-1997.598) (-2001.601) -- 0:04:56
      60400 -- [-1977.022] (-1990.827) (-1990.165) (-1993.895) * [-1987.437] (-1989.921) (-2002.572) (-1998.467) -- 0:04:55
      60500 -- [-1987.188] (-1990.544) (-1992.789) (-1997.676) * [-1992.239] (-1991.115) (-1991.358) (-2000.526) -- 0:04:55
      60600 -- [-1986.134] (-1988.548) (-1993.098) (-1999.082) * [-1989.905] (-1990.349) (-1991.422) (-1999.975) -- 0:05:10
      60700 -- [-1983.304] (-1988.615) (-1999.054) (-1992.530) * (-1985.833) (-1991.110) [-1991.977] (-1994.035) -- 0:05:09
      60800 -- [-1980.586] (-1988.997) (-2000.522) (-1990.378) * [-1991.141] (-1989.677) (-1990.592) (-1997.623) -- 0:05:08
      60900 -- (-1983.034) [-1986.242] (-2006.770) (-1990.202) * (-1989.430) (-1991.916) [-1988.436] (-1995.661) -- 0:05:08
      61000 -- (-1985.435) [-1985.861] (-1994.077) (-1986.263) * [-1986.960] (-1991.454) (-1994.543) (-1988.192) -- 0:05:07

      Average standard deviation of split frequencies: 0.015405

      61100 -- (-1989.022) [-1986.721] (-1995.699) (-1988.091) * (-1986.746) (-1993.670) (-1995.274) [-1990.696] -- 0:05:07
      61200 -- [-1988.723] (-1993.980) (-1986.732) (-1993.357) * [-1979.094] (-1991.982) (-1995.640) (-1992.628) -- 0:05:06
      61300 -- (-1988.615) (-1991.062) [-1990.490] (-1999.702) * [-1986.205] (-1993.093) (-1990.564) (-1993.821) -- 0:05:06
      61400 -- [-1986.274] (-1993.575) (-2002.104) (-1989.476) * [-1984.084] (-2001.519) (-1991.181) (-1994.013) -- 0:05:05
      61500 -- (-1988.833) (-1991.565) [-1988.244] (-1993.338) * [-1981.745] (-2001.110) (-1990.274) (-1994.050) -- 0:05:05
      61600 -- [-1987.206] (-1993.673) (-1996.335) (-1997.065) * [-1979.078] (-1995.667) (-1990.004) (-1988.753) -- 0:05:04
      61700 -- [-1984.620] (-2003.151) (-1994.493) (-1990.663) * (-1981.156) [-1992.667] (-1998.952) (-1981.621) -- 0:05:04
      61800 -- (-1990.294) (-1992.429) [-1990.170] (-1991.077) * (-1982.590) (-2003.105) (-2002.196) [-1977.975] -- 0:05:03
      61900 -- [-1990.255] (-2002.769) (-1990.736) (-1989.102) * [-1982.008] (-1997.717) (-1994.029) (-1986.061) -- 0:05:03
      62000 -- (-1988.358) (-2001.899) (-1992.574) [-1983.794] * (-1986.281) (-1997.836) (-1994.324) [-1982.497] -- 0:05:02

      Average standard deviation of split frequencies: 0.015174

      62100 -- [-1986.928] (-1999.978) (-1991.313) (-1979.878) * (-1984.795) (-1997.856) (-1998.992) [-1986.427] -- 0:05:02
      62200 -- (-1991.553) (-2001.679) (-1995.781) [-1986.220] * (-1978.963) (-1989.112) (-1986.424) [-1984.925] -- 0:05:01
      62300 -- [-1985.399] (-1986.275) (-2000.758) (-1990.443) * (-1986.890) (-1991.849) (-1992.626) [-1993.515] -- 0:05:01
      62400 -- [-1980.288] (-1993.547) (-1996.347) (-1989.530) * (-1983.688) (-1998.039) (-1993.839) [-1986.380] -- 0:05:00
      62500 -- [-1980.706] (-1995.109) (-2001.804) (-1988.221) * [-1984.118] (-1993.735) (-1993.348) (-1985.162) -- 0:05:00
      62600 -- (-1984.339) (-1994.708) (-1990.493) [-1987.207] * [-1984.027] (-1988.868) (-1998.469) (-1984.257) -- 0:04:59
      62700 -- [-1979.882] (-1993.154) (-1995.393) (-1989.624) * (-1988.641) [-1993.752] (-2000.394) (-1988.763) -- 0:04:58
      62800 -- [-1980.362] (-1989.490) (-1994.175) (-1983.806) * [-1985.759] (-1994.632) (-1993.850) (-1995.389) -- 0:04:58
      62900 -- [-1984.655] (-1988.438) (-1991.900) (-1982.112) * (-1985.192) (-2000.008) [-1988.062] (-1989.631) -- 0:04:57
      63000 -- (-1988.344) (-1991.270) (-2000.963) [-1984.321] * [-1982.823] (-2002.784) (-1988.153) (-1992.170) -- 0:04:57

      Average standard deviation of split frequencies: 0.014279

      63100 -- [-1982.404] (-1991.407) (-1993.325) (-1992.802) * (-1984.669) (-2007.459) (-1984.476) [-1982.970] -- 0:04:56
      63200 -- [-1983.219] (-1993.720) (-1994.840) (-1986.884) * (-1989.479) (-2007.007) (-1989.089) [-1986.561] -- 0:04:56
      63300 -- [-1980.773] (-1994.645) (-1997.249) (-1989.452) * (-1987.727) (-2003.942) [-1987.515] (-1987.555) -- 0:04:55
      63400 -- (-1986.045) (-1998.583) (-1996.551) [-1984.772] * [-1986.302] (-2001.555) (-1993.212) (-1993.941) -- 0:04:55
      63500 -- (-1987.849) (-2002.069) (-1993.547) [-1980.071] * [-1984.050] (-2007.946) (-1984.456) (-1993.893) -- 0:04:54
      63600 -- (-1983.442) (-2002.560) (-1995.462) [-1982.927] * [-1980.119] (-2007.978) (-1984.875) (-1992.190) -- 0:04:54
      63700 -- [-1986.751] (-2002.193) (-1994.706) (-1990.543) * [-1982.520] (-1992.761) (-1988.149) (-1992.061) -- 0:04:53
      63800 -- (-1987.400) (-2001.980) (-1994.663) [-1980.898] * (-1993.737) (-1994.745) [-1986.976] (-1997.041) -- 0:05:08
      63900 -- (-1989.807) (-2003.923) [-1990.160] (-1983.184) * (-1989.649) (-1995.415) (-1988.472) [-1987.426] -- 0:05:07
      64000 -- [-1989.027] (-2007.867) (-1988.751) (-1983.761) * [-1985.508] (-1997.271) (-1995.958) (-1981.909) -- 0:05:07

      Average standard deviation of split frequencies: 0.015331

      64100 -- (-1989.645) (-1998.260) (-1994.631) [-1984.202] * (-1985.183) (-1994.970) (-1992.843) [-1984.677] -- 0:05:06
      64200 -- (-1987.359) (-1996.637) (-2004.732) [-1984.527] * [-1979.396] (-1991.348) (-1994.590) (-1989.363) -- 0:05:06
      64300 -- [-1989.209] (-1994.219) (-1996.560) (-1984.479) * [-1981.489] (-1992.106) (-1998.095) (-1987.894) -- 0:05:05
      64400 -- [-1987.638] (-1996.533) (-1990.415) (-1984.671) * [-1987.177] (-1994.303) (-1996.360) (-1994.572) -- 0:05:05
      64500 -- (-1989.932) (-1997.068) (-1991.220) [-1983.495] * [-1981.376] (-1994.121) (-1997.896) (-1991.254) -- 0:05:04
      64600 -- (-1983.348) (-2002.684) [-1991.274] (-1984.206) * (-1984.736) [-1993.636] (-1996.072) (-2003.102) -- 0:05:04
      64700 -- (-1980.162) (-2005.317) (-1998.543) [-1993.015] * (-1990.236) (-1992.318) (-1990.622) [-1996.033] -- 0:05:03
      64800 -- [-1981.742] (-2002.352) (-1992.681) (-1993.230) * [-1984.447] (-1999.933) (-1985.202) (-1992.198) -- 0:05:03
      64900 -- [-1981.802] (-1999.563) (-1997.771) (-1985.656) * (-1984.781) (-1996.065) [-1986.317] (-1990.738) -- 0:05:02
      65000 -- [-1982.643] (-2004.274) (-1993.305) (-1982.644) * (-1983.618) (-1993.284) [-1982.073] (-1983.422) -- 0:05:02

      Average standard deviation of split frequencies: 0.015080

      65100 -- [-1982.154] (-1998.195) (-1997.162) (-1981.168) * (-1992.770) (-1995.232) [-1987.037] (-1980.277) -- 0:05:01
      65200 -- [-1984.451] (-2002.114) (-2000.966) (-1992.931) * (-1980.000) (-2009.669) [-1986.939] (-1983.215) -- 0:05:01
      65300 -- [-1981.391] (-1997.441) (-2001.512) (-1992.541) * (-1987.605) (-2007.023) (-1990.959) [-1983.071] -- 0:05:00
      65400 -- [-1977.158] (-1992.474) (-1997.805) (-1990.269) * (-1990.311) (-2001.088) (-1988.906) [-1982.875] -- 0:05:00
      65500 -- [-1985.198] (-1992.862) (-2002.125) (-1996.145) * (-1991.161) (-2001.489) (-1991.145) [-1979.021] -- 0:04:59
      65600 -- (-1984.000) [-1991.459] (-2001.963) (-1993.438) * (-1985.008) (-1990.941) (-1989.441) [-1978.701] -- 0:04:59
      65700 -- [-1983.955] (-1993.236) (-1992.131) (-1992.838) * [-1985.262] (-1996.998) (-1992.568) (-1983.635) -- 0:04:58
      65800 -- [-1990.336] (-1993.248) (-1990.718) (-1990.604) * (-1990.653) (-2003.818) (-1996.048) [-1981.686] -- 0:04:58
      65900 -- (-1990.953) (-1998.068) [-1988.566] (-1996.584) * (-1990.661) (-2004.520) (-1998.900) [-1983.073] -- 0:04:57
      66000 -- [-1991.084] (-2004.074) (-1991.479) (-1994.072) * (-1989.106) (-1996.526) (-2004.016) [-1979.759] -- 0:04:57

      Average standard deviation of split frequencies: 0.015682

      66100 -- [-1992.173] (-1993.902) (-1993.928) (-1994.093) * (-1989.062) (-1995.058) (-1995.813) [-1984.049] -- 0:04:56
      66200 -- (-1988.356) (-1998.584) [-1989.626] (-2000.396) * [-1990.379] (-1991.607) (-2002.897) (-1994.828) -- 0:04:56
      66300 -- [-1986.853] (-1995.203) (-1986.227) (-2016.108) * [-1988.867] (-1991.693) (-2009.707) (-1987.546) -- 0:04:55
      66400 -- (-1986.044) (-1994.069) [-1989.670] (-1997.376) * [-1984.261] (-1990.052) (-2003.273) (-1987.520) -- 0:04:55
      66500 -- (-1980.641) (-1994.516) [-1990.213] (-1998.853) * (-1986.466) (-1992.895) (-1990.883) [-1984.739] -- 0:04:54
      66600 -- [-1982.541] (-1988.753) (-1990.479) (-1986.003) * (-1992.036) (-1984.666) (-1993.344) [-1984.594] -- 0:04:54
      66700 -- (-1982.322) (-1987.809) (-1989.789) [-1987.003] * (-1984.894) (-1986.429) (-1993.909) [-1981.281] -- 0:04:53
      66800 -- [-1981.563] (-1987.923) (-1991.731) (-1983.854) * (-1978.496) [-1987.083] (-1996.863) (-1986.217) -- 0:04:53
      66900 -- (-1988.829) (-1996.249) (-1995.355) [-1982.865] * (-1988.436) (-1985.344) (-1993.155) [-1982.070] -- 0:05:06
      67000 -- (-1991.472) (-1990.683) (-1998.372) [-1987.493] * (-1988.252) (-1984.758) (-1994.905) [-1980.640] -- 0:05:06

      Average standard deviation of split frequencies: 0.012627

      67100 -- [-1982.536] (-2002.975) (-1992.808) (-1986.344) * (-1992.648) (-1985.610) (-1998.114) [-1980.476] -- 0:05:05
      67200 -- [-1986.096] (-1998.969) (-1991.316) (-1985.827) * (-1989.211) (-1981.200) (-2002.721) [-1983.646] -- 0:05:05
      67300 -- (-1986.558) (-1999.521) (-1995.074) [-1982.634] * [-1988.247] (-1984.483) (-1998.155) (-1982.354) -- 0:05:04
      67400 -- (-1983.982) [-1990.021] (-1998.545) (-1985.848) * (-1991.716) (-1989.255) (-2000.949) [-1980.010] -- 0:05:04
      67500 -- [-1979.260] (-1995.687) (-1995.142) (-1981.567) * (-1988.855) (-1992.853) (-1994.645) [-1980.587] -- 0:05:03
      67600 -- (-1982.091) (-1988.569) (-1989.029) [-1980.995] * (-1991.814) [-1987.680] (-2004.709) (-1980.154) -- 0:05:03
      67700 -- (-1983.923) (-1988.692) (-1988.365) [-1983.454] * (-1990.448) (-1987.389) (-1994.626) [-1980.321] -- 0:05:02
      67800 -- (-1989.443) (-1988.870) (-1990.363) [-1983.855] * (-1994.223) (-1987.884) (-1990.853) [-1984.206] -- 0:05:02
      67900 -- (-1985.904) (-1993.547) (-1991.999) [-1983.797] * (-1989.294) (-1985.628) (-1988.576) [-1983.378] -- 0:05:02
      68000 -- [-1984.801] (-1996.607) (-1998.631) (-1985.158) * (-1985.239) (-1983.906) (-1994.955) [-1981.255] -- 0:05:01

      Average standard deviation of split frequencies: 0.012059

      68100 -- [-1982.755] (-1997.983) (-2001.687) (-1988.375) * (-1990.443) [-1988.320] (-1995.191) (-1981.933) -- 0:05:01
      68200 -- [-1984.219] (-1999.416) (-1994.388) (-1991.103) * (-1985.990) (-1986.327) (-2010.443) [-1982.440] -- 0:05:00
      68300 -- (-1986.229) [-1996.659] (-1994.672) (-1989.162) * (-1988.438) [-1983.700] (-2000.315) (-1987.404) -- 0:05:00
      68400 -- [-1984.501] (-1999.186) (-1998.422) (-1992.913) * (-1985.789) [-1978.898] (-2001.384) (-1985.867) -- 0:04:59
      68500 -- [-1985.761] (-1995.777) (-1989.724) (-1989.802) * (-1992.434) (-1985.757) (-1994.483) [-1988.323] -- 0:04:59
      68600 -- (-1989.616) (-2003.309) (-2003.922) [-1984.736] * (-1998.064) (-1981.202) (-1994.851) [-1991.201] -- 0:04:58
      68700 -- (-1992.344) (-2002.234) (-2006.240) [-1981.911] * (-1989.651) (-1988.431) [-1989.424] (-1991.032) -- 0:04:58
      68800 -- (-1991.574) (-2009.839) (-2004.101) [-1985.384] * (-1990.881) [-1987.175] (-1993.464) (-1995.272) -- 0:04:57
      68900 -- [-1992.252] (-2006.962) (-1998.524) (-1983.570) * (-1988.659) (-1991.778) (-1993.418) [-1985.042] -- 0:04:57
      69000 -- (-1988.872) (-2007.909) (-2008.697) [-1981.015] * (-1996.768) (-1985.538) [-1983.908] (-1983.189) -- 0:04:56

      Average standard deviation of split frequencies: 0.012457

      69100 -- [-1986.361] (-1998.723) (-2006.636) (-1982.101) * (-1992.845) (-1986.972) (-1994.059) [-1985.876] -- 0:04:56
      69200 -- (-1985.050) (-1994.319) (-2008.888) [-1982.855] * (-1990.886) (-1995.008) [-1994.198] (-1984.792) -- 0:04:55
      69300 -- [-1984.797] (-1995.430) (-1997.029) (-1997.576) * (-1992.591) [-1979.955] (-1991.279) (-1989.618) -- 0:04:55
      69400 -- [-1984.438] (-1993.596) (-2002.309) (-1992.489) * (-1987.920) [-1978.305] (-1990.178) (-1990.697) -- 0:04:55
      69500 -- [-1980.488] (-1991.343) (-2000.639) (-1989.972) * (-1995.606) [-1982.986] (-2001.085) (-1985.433) -- 0:04:54
      69600 -- (-1984.199) (-2005.828) (-1997.217) [-1984.161] * (-1998.533) (-1996.707) (-1997.306) [-1980.667] -- 0:04:54
      69700 -- (-1988.647) (-2001.954) (-1996.571) [-1984.690] * (-1993.364) (-1992.124) (-1993.125) [-1983.647] -- 0:04:53
      69800 -- [-1982.564] (-1996.563) (-1994.015) (-1984.422) * (-2002.741) (-1994.395) (-1992.546) [-1978.061] -- 0:04:53
      69900 -- [-1983.717] (-2000.723) (-1989.720) (-1985.452) * (-2006.903) (-1989.243) (-1993.538) [-1980.985] -- 0:04:52
      70000 -- [-1981.463] (-1995.078) (-1987.492) (-1985.829) * (-1995.602) [-1989.872] (-1988.401) (-1980.309) -- 0:04:52

      Average standard deviation of split frequencies: 0.011139

      70100 -- [-1983.209] (-2003.751) (-1987.219) (-1991.789) * (-1997.075) (-1988.721) (-1983.578) [-1978.566] -- 0:05:05
      70200 -- [-1982.519] (-2006.327) (-1987.871) (-1997.518) * (-1993.710) [-1993.179] (-1990.134) (-1980.676) -- 0:05:04
      70300 -- (-1984.182) (-1998.970) [-1991.856] (-1991.349) * (-1988.952) (-1990.285) (-1990.288) [-1982.550] -- 0:05:04
      70400 -- [-1983.425] (-1993.047) (-2000.225) (-2001.085) * [-1983.951] (-1980.943) (-1994.241) (-1980.345) -- 0:05:03
      70500 -- [-1980.705] (-1989.654) (-1994.527) (-2004.404) * (-1985.113) [-1979.888] (-1994.581) (-1979.080) -- 0:05:03
      70600 -- (-1985.238) [-1990.447] (-1992.163) (-1995.667) * (-1981.213) [-1980.431] (-1989.423) (-1982.619) -- 0:05:02
      70700 -- (-1984.271) (-1988.764) (-1999.764) [-1996.492] * (-1986.725) [-1982.615] (-1992.954) (-1983.092) -- 0:05:02
      70800 -- (-1983.143) [-1990.055] (-2006.112) (-1998.962) * [-1986.208] (-1977.711) (-1996.273) (-1986.555) -- 0:05:01
      70900 -- [-1984.715] (-1988.132) (-1998.458) (-1991.618) * (-1987.200) [-1976.975] (-1993.037) (-1992.488) -- 0:05:01
      71000 -- [-1980.054] (-1991.865) (-2003.043) (-1988.459) * (-1981.813) [-1980.092] (-1990.340) (-1993.427) -- 0:05:00

      Average standard deviation of split frequencies: 0.012107

      71100 -- [-1980.693] (-1990.390) (-2002.687) (-1992.493) * [-1984.845] (-1982.465) (-1996.869) (-1991.997) -- 0:05:00
      71200 -- [-1979.478] (-1992.530) (-1994.863) (-1984.941) * (-1986.111) [-1981.376] (-1993.750) (-1990.663) -- 0:05:00
      71300 -- [-1982.925] (-1996.154) (-1993.627) (-1980.884) * (-1985.819) [-1980.627] (-1992.311) (-1994.254) -- 0:04:59
      71400 -- [-1985.048] (-1993.888) (-1991.322) (-1977.797) * (-1986.434) [-1978.171] (-1997.051) (-1994.349) -- 0:04:59
      71500 -- [-1984.675] (-1995.205) (-1990.603) (-1982.359) * (-1985.307) (-1981.593) [-1989.630] (-1992.802) -- 0:04:58
      71600 -- [-1984.948] (-1990.107) (-1989.416) (-1984.811) * (-1989.782) [-1976.984] (-1987.372) (-2000.748) -- 0:04:58
      71700 -- (-1988.075) (-1994.292) (-1993.114) [-1986.427] * (-1999.785) (-1984.402) [-1981.681] (-1991.790) -- 0:04:57
      71800 -- (-1988.476) (-1990.590) (-1993.335) [-1982.833] * (-1990.558) (-1979.492) [-1988.631] (-2000.152) -- 0:04:57
      71900 -- [-1987.724] (-1990.752) (-1996.289) (-1983.915) * (-1991.520) [-1978.582] (-1986.780) (-1993.375) -- 0:04:56
      72000 -- (-1987.403) (-1992.808) (-1986.809) [-1985.949] * (-1994.657) [-1985.909] (-1985.487) (-2004.847) -- 0:04:56

      Average standard deviation of split frequencies: 0.010643

      72100 -- (-1983.236) (-1990.452) (-1989.645) [-1984.095] * (-1997.758) [-1985.348] (-1992.941) (-1991.662) -- 0:04:56
      72200 -- (-1990.035) (-1988.113) [-1989.195] (-1988.513) * (-2005.836) (-1982.037) (-1984.170) [-1988.559] -- 0:04:55
      72300 -- [-1983.605] (-1987.486) (-1990.804) (-1985.593) * (-2001.504) (-1978.924) [-1986.250] (-1991.864) -- 0:04:55
      72400 -- (-1991.557) (-1994.161) [-1984.869] (-1988.828) * (-2006.112) [-1979.360] (-1995.176) (-1992.966) -- 0:04:54
      72500 -- (-1985.794) (-2001.505) [-1990.379] (-1999.434) * (-1986.367) [-1976.819] (-1994.710) (-1993.096) -- 0:04:54
      72600 -- [-1989.083] (-1991.598) (-1994.726) (-1990.594) * (-1990.934) [-1979.078] (-1989.932) (-1988.877) -- 0:04:53
      72700 -- [-1989.245] (-1989.419) (-1993.940) (-1986.343) * (-1986.388) [-1981.711] (-1996.415) (-1991.851) -- 0:04:53
      72800 -- (-1990.154) (-1992.081) (-1996.656) [-1986.737] * (-1995.348) [-1979.285] (-1995.395) (-1987.146) -- 0:04:52
      72900 -- (-1982.493) (-1995.747) (-1996.243) [-1993.485] * (-1994.279) (-1988.971) (-1997.778) [-1983.026] -- 0:04:52
      73000 -- (-1991.492) (-1996.068) [-1994.186] (-1990.498) * (-1993.875) (-1997.230) (-1999.685) [-1987.195] -- 0:04:52

      Average standard deviation of split frequencies: 0.010488

      73100 -- (-1985.033) (-1985.141) (-2003.677) [-1982.078] * [-1989.076] (-1996.435) (-1996.392) (-1992.399) -- 0:04:51
      73200 -- [-1984.435] (-1990.423) (-1994.627) (-1989.300) * (-1992.374) [-1992.825] (-1999.296) (-1994.710) -- 0:05:03
      73300 -- [-1984.771] (-1988.785) (-1994.185) (-1990.296) * [-1988.372] (-1992.290) (-2008.691) (-1990.644) -- 0:05:03
      73400 -- [-1977.724] (-1993.903) (-1992.344) (-1984.761) * [-1984.126] (-1997.514) (-2005.999) (-1989.425) -- 0:05:02
      73500 -- [-1976.939] (-1989.243) (-2001.201) (-1986.127) * [-1983.610] (-1989.888) (-2002.150) (-1987.913) -- 0:05:02
      73600 -- (-1979.890) [-1987.932] (-1994.242) (-1986.432) * [-1985.228] (-1994.828) (-1991.739) (-1985.057) -- 0:05:02
      73700 -- (-1979.128) [-1984.173] (-2007.247) (-1987.393) * (-1988.549) (-1988.380) [-1990.740] (-1995.738) -- 0:05:01
      73800 -- (-1979.973) [-1989.143] (-1988.763) (-1988.624) * [-1985.633] (-1993.428) (-1986.122) (-1994.009) -- 0:05:01
      73900 -- (-1979.943) [-1986.659] (-1984.512) (-1988.556) * (-1984.331) (-1998.737) (-1987.093) [-1988.514] -- 0:05:00
      74000 -- [-1980.423] (-1992.764) (-1984.693) (-1991.178) * [-1984.490] (-1994.502) (-1991.367) (-1991.428) -- 0:05:00

      Average standard deviation of split frequencies: 0.009811

      74100 -- (-1982.955) (-1993.277) [-1981.890] (-1991.499) * (-1985.268) (-1989.029) (-1994.835) [-1988.927] -- 0:04:59
      74200 -- (-1994.442) (-1996.958) [-1985.999] (-1989.651) * [-1979.203] (-1989.046) (-1992.348) (-1993.580) -- 0:04:59
      74300 -- (-1992.065) (-1998.827) [-1980.974] (-1989.570) * (-1980.876) [-1983.494] (-1987.633) (-1999.407) -- 0:04:59
      74400 -- [-1990.915] (-1993.706) (-1984.488) (-1990.231) * (-1980.514) [-1986.667] (-1988.471) (-2003.856) -- 0:04:58
      74500 -- [-1986.581] (-1990.191) (-1986.585) (-1987.941) * [-1979.798] (-1987.894) (-1989.953) (-1999.929) -- 0:04:58
      74600 -- (-1985.523) [-1986.778] (-1988.864) (-2000.895) * [-1979.352] (-1988.483) (-1990.541) (-2006.923) -- 0:04:57
      74700 -- (-1991.923) [-1986.215] (-1988.783) (-2000.485) * [-1984.313] (-1982.985) (-1997.741) (-2006.706) -- 0:04:57
      74800 -- (-1998.926) (-1987.120) [-1997.001] (-1991.049) * [-1978.172] (-1986.395) (-1988.909) (-2007.135) -- 0:04:56
      74900 -- (-1992.677) [-1984.124] (-1994.982) (-1988.673) * [-1977.237] (-1985.291) (-1991.733) (-1998.656) -- 0:04:56
      75000 -- (-1993.489) (-1991.768) (-1993.286) [-1983.793] * [-1979.033] (-1984.201) (-1991.873) (-2003.086) -- 0:04:56

      Average standard deviation of split frequencies: 0.008418

      75100 -- (-2000.145) (-1986.157) (-1992.609) [-1985.754] * (-1979.769) [-1979.826] (-2001.868) (-2004.422) -- 0:04:55
      75200 -- (-2004.971) [-1990.073] (-1992.692) (-1986.568) * [-1984.733] (-1983.465) (-1991.230) (-1998.762) -- 0:04:55
      75300 -- (-1998.967) (-1993.719) (-1988.983) [-1984.642] * [-1981.358] (-1988.636) (-2000.158) (-1988.712) -- 0:04:54
      75400 -- (-1985.351) (-1991.378) [-1986.330] (-1988.361) * [-1982.928] (-2001.673) (-1990.626) (-1986.864) -- 0:04:54
      75500 -- [-1987.500] (-1993.545) (-1989.368) (-1986.200) * (-2005.380) (-1994.962) (-1988.945) [-1989.813] -- 0:04:53
      75600 -- (-1987.455) (-1992.615) (-1986.973) [-1982.040] * (-1994.037) (-1995.998) (-1990.171) [-1989.345] -- 0:04:53
      75700 -- (-1988.937) (-1985.960) (-1987.178) [-1988.434] * (-1996.336) (-1999.085) (-1993.939) [-1987.939] -- 0:04:53
      75800 -- (-1994.109) (-1987.568) (-1983.887) [-1987.722] * [-1995.483] (-1993.970) (-1995.102) (-1988.088) -- 0:04:52
      75900 -- (-1997.767) (-1992.416) (-1987.431) [-1986.279] * [-1993.112] (-1995.170) (-1996.104) (-1990.219) -- 0:04:52
      76000 -- (-1999.895) (-1994.303) (-1986.997) [-1988.402] * (-1992.225) [-1995.384] (-1994.995) (-1994.254) -- 0:04:51

      Average standard deviation of split frequencies: 0.009730

      76100 -- (-1995.732) (-1998.441) [-1983.854] (-1999.777) * (-1998.440) (-1997.607) [-1990.572] (-1989.925) -- 0:04:51
      76200 -- (-1992.928) (-1989.585) (-1985.028) [-1989.410] * (-2003.239) (-1994.765) (-1995.911) [-1990.921] -- 0:04:50
      76300 -- (-2003.485) (-1989.892) [-1989.070] (-1988.847) * (-1997.487) [-1985.932] (-1990.857) (-2001.913) -- 0:04:50
      76400 -- (-1997.443) [-1989.862] (-1986.353) (-1991.123) * (-1993.096) [-1980.494] (-1988.939) (-1993.138) -- 0:05:02
      76500 -- (-1997.662) [-1989.946] (-1985.176) (-1993.718) * (-1994.674) [-1978.444] (-1988.275) (-1992.516) -- 0:05:01
      76600 -- (-2008.296) [-1985.657] (-1985.179) (-1989.571) * (-1995.085) (-1982.505) [-1981.090] (-1989.529) -- 0:05:01
      76700 -- (-1994.343) [-1990.221] (-1986.020) (-1996.649) * (-1987.646) [-1983.049] (-1981.887) (-1992.781) -- 0:05:00
      76800 -- (-1984.770) [-1986.216] (-1994.764) (-1996.606) * (-1991.219) (-1980.789) [-1980.646] (-1986.665) -- 0:05:00
      76900 -- (-1984.213) [-1988.055] (-1987.892) (-1989.345) * (-1986.594) [-1983.044] (-1982.730) (-1993.190) -- 0:05:00
      77000 -- (-1987.517) (-1986.122) (-1990.445) [-1982.959] * (-1993.675) (-1984.954) [-1979.194] (-2007.114) -- 0:04:59

      Average standard deviation of split frequencies: 0.008723

      77100 -- (-1994.744) (-1986.889) (-1985.293) [-1980.102] * (-1996.710) (-1987.645) [-1981.122] (-1999.897) -- 0:04:59
      77200 -- (-1989.813) [-1986.706] (-1994.523) (-1981.263) * (-1997.621) [-1988.732] (-1986.728) (-2000.681) -- 0:04:58
      77300 -- (-1991.981) (-1990.194) (-2009.510) [-1984.647] * [-1989.044] (-1984.464) (-1985.248) (-1996.272) -- 0:04:58
      77400 -- (-1995.769) [-1984.808] (-2007.718) (-1986.171) * (-1988.785) [-1981.464] (-1992.424) (-1994.159) -- 0:04:57
      77500 -- (-1990.185) (-1985.440) (-1999.794) [-1988.288] * (-1994.364) [-1983.976] (-1987.385) (-1992.672) -- 0:04:57
      77600 -- (-1985.875) (-1987.511) (-2008.559) [-1983.910] * [-1987.007] (-1986.392) (-1990.436) (-1996.921) -- 0:04:57
      77700 -- (-1994.552) (-1987.287) (-2006.480) [-1983.015] * (-1985.879) (-1986.464) (-1990.121) [-1989.567] -- 0:04:56
      77800 -- (-1986.823) (-1990.483) (-2007.124) [-1984.677] * (-1982.538) (-1999.482) (-1990.884) [-1981.693] -- 0:04:56
      77900 -- (-1996.491) [-1986.904] (-2004.169) (-1982.965) * (-1982.816) (-1992.065) (-1989.144) [-1981.296] -- 0:04:55
      78000 -- (-1992.644) (-1990.402) (-1991.877) [-1985.095] * [-1982.591] (-2002.304) (-1984.836) (-1980.705) -- 0:04:55

      Average standard deviation of split frequencies: 0.009136

      78100 -- (-2001.965) (-1988.661) (-1989.345) [-1983.045] * [-1981.053] (-2005.402) (-1993.975) (-1982.254) -- 0:04:55
      78200 -- (-1996.192) (-1998.520) (-1987.053) [-1980.499] * (-1983.836) (-2000.681) (-1987.752) [-1985.327] -- 0:04:54
      78300 -- [-1988.749] (-1995.705) (-1988.691) (-1985.204) * [-1981.438] (-1995.053) (-1994.390) (-1985.185) -- 0:04:54
      78400 -- (-1986.064) (-1990.260) [-1991.712] (-1990.314) * [-1983.982] (-1991.753) (-1988.554) (-1988.993) -- 0:04:53
      78500 -- (-1992.078) [-1995.699] (-1990.193) (-1996.099) * [-1984.972] (-1993.430) (-1991.461) (-1991.940) -- 0:04:53
      78600 -- (-1996.536) [-1994.266] (-1994.148) (-1996.350) * [-1982.943] (-1992.248) (-1989.662) (-1997.572) -- 0:04:53
      78700 -- (-2002.229) (-1996.405) [-1994.973] (-1999.637) * [-1986.357] (-1991.455) (-1991.578) (-1995.594) -- 0:04:52
      78800 -- [-1989.299] (-1995.482) (-1992.622) (-1999.141) * [-1989.259] (-1991.917) (-1987.510) (-1997.814) -- 0:04:52
      78900 -- (-1988.767) (-1994.696) (-1993.001) [-1987.652] * (-1989.256) [-1980.619] (-1989.029) (-1988.229) -- 0:04:51
      79000 -- (-1987.270) (-2001.115) (-1996.508) [-1983.095] * [-1983.405] (-1981.761) (-1987.251) (-1983.794) -- 0:04:51

      Average standard deviation of split frequencies: 0.009183

      79100 -- (-1990.232) (-2005.244) [-1991.426] (-1981.280) * [-1979.356] (-1988.293) (-1985.744) (-1997.921) -- 0:04:51
      79200 -- (-1990.267) (-1994.872) (-1985.849) [-1980.886] * [-1980.338] (-1993.196) (-1982.702) (-1980.975) -- 0:04:50
      79300 -- (-1983.305) (-1988.940) [-1990.163] (-1981.894) * [-1980.025] (-1993.618) (-1982.516) (-1986.194) -- 0:04:50
      79400 -- (-1987.729) (-1996.768) (-1986.980) [-1982.054] * (-1988.224) (-1989.825) (-1982.980) [-1981.536] -- 0:04:49
      79500 -- [-1981.134] (-1996.518) (-1988.569) (-1988.337) * (-2006.667) (-1995.133) [-1988.470] (-1989.168) -- 0:04:49
      79600 -- [-1979.358] (-1997.221) (-1986.552) (-1989.679) * (-1994.976) (-2000.367) [-1990.486] (-1987.601) -- 0:05:00
      79700 -- [-1978.704] (-1991.722) (-1985.163) (-1991.689) * (-1998.339) (-1989.836) (-1991.911) [-1986.453] -- 0:05:00
      79800 -- [-1975.803] (-1991.834) (-1990.531) (-1995.279) * (-1988.303) [-1984.049] (-1989.773) (-1987.097) -- 0:04:59
      79900 -- [-1986.061] (-1997.463) (-1992.689) (-2001.610) * (-1985.218) [-1984.880] (-2004.040) (-1992.701) -- 0:04:59
      80000 -- (-1984.248) [-1988.868] (-1995.252) (-1986.836) * (-1982.315) (-1989.553) [-1988.319] (-1988.527) -- 0:04:59

      Average standard deviation of split frequencies: 0.009412

      80100 -- [-1984.162] (-1994.122) (-1994.406) (-1990.853) * (-1986.101) (-1990.896) (-1998.628) [-1990.097] -- 0:04:58
      80200 -- [-1986.110] (-1990.109) (-1988.515) (-1996.080) * [-1981.676] (-1987.193) (-1993.570) (-1985.789) -- 0:04:58
      80300 -- (-1987.294) (-1997.408) [-1988.790] (-1992.750) * (-1988.421) (-1994.676) (-1994.482) [-1985.330] -- 0:04:57
      80400 -- (-1987.068) [-1990.583] (-1985.206) (-1997.743) * [-1979.734] (-1995.878) (-2003.212) (-1991.244) -- 0:04:57
      80500 -- (-1991.272) (-1989.408) [-1985.240] (-1989.996) * [-1980.406] (-1997.531) (-1995.851) (-1993.145) -- 0:04:56
      80600 -- (-1995.559) (-1994.551) (-1983.992) [-1981.713] * [-1985.369] (-2000.886) (-1990.012) (-1991.977) -- 0:04:56
      80700 -- [-1988.643] (-1998.722) (-1985.729) (-1983.270) * (-1981.252) (-1996.714) (-1992.179) [-1989.950] -- 0:04:56
      80800 -- (-1987.198) (-1993.985) [-1982.880] (-1986.878) * [-1989.054] (-1991.668) (-1987.974) (-1992.038) -- 0:04:55
      80900 -- (-1997.902) (-1996.964) [-1983.753] (-1987.250) * [-1986.750] (-1992.182) (-1988.158) (-1990.400) -- 0:04:55
      81000 -- (-1996.442) (-1984.887) [-1982.492] (-1992.193) * (-1987.586) [-1985.261] (-1992.274) (-1987.913) -- 0:04:54

      Average standard deviation of split frequencies: 0.009621

      81100 -- (-1992.223) (-1988.367) [-1988.425] (-1993.648) * (-1990.650) [-1985.794] (-1997.631) (-1988.635) -- 0:04:54
      81200 -- (-1989.079) (-1991.940) [-1982.752] (-2002.586) * (-1992.696) (-1987.642) [-1994.670] (-1990.957) -- 0:04:54
      81300 -- (-1988.862) (-1996.465) [-1985.646] (-2012.255) * (-1995.707) [-1991.368] (-1996.956) (-1996.344) -- 0:04:53
      81400 -- (-1990.921) [-1989.651] (-1983.325) (-1996.758) * (-1991.618) [-1981.158] (-1990.456) (-1999.049) -- 0:04:53
      81500 -- [-1985.924] (-1988.370) (-1994.829) (-1993.872) * (-1992.663) [-1979.689] (-1994.894) (-1992.202) -- 0:04:53
      81600 -- [-1986.562] (-1989.937) (-1987.736) (-1995.625) * (-1984.793) [-1985.915] (-1994.463) (-1984.615) -- 0:04:52
      81700 -- (-1989.663) (-1992.464) [-1985.829] (-1994.911) * [-1984.315] (-1996.194) (-1991.109) (-1983.062) -- 0:04:52
      81800 -- (-1987.619) (-2000.796) [-1987.117] (-1988.745) * [-1987.410] (-1994.835) (-1993.005) (-1985.416) -- 0:04:51
      81900 -- (-1986.929) (-2001.088) [-1981.373] (-1992.150) * [-1984.562] (-1991.797) (-1993.773) (-1986.180) -- 0:04:51
      82000 -- (-1988.353) (-1991.491) [-1986.552] (-1997.528) * (-1989.533) (-1996.721) [-1982.940] (-1984.212) -- 0:04:51

      Average standard deviation of split frequencies: 0.009839

      82100 -- [-1990.709] (-1989.594) (-1993.570) (-1992.957) * (-1989.706) (-1996.707) [-1982.719] (-1986.375) -- 0:04:50
      82200 -- [-1985.934] (-1991.128) (-1990.842) (-1992.098) * (-1982.939) (-2003.124) (-1984.552) [-1983.597] -- 0:04:50
      82300 -- [-1988.629] (-1991.060) (-1993.493) (-1998.318) * (-1990.160) (-1996.071) (-1988.757) [-1983.172] -- 0:04:49
      82400 -- (-1996.820) [-1986.165] (-1985.098) (-1997.514) * (-1984.834) (-1990.795) [-1981.429] (-1985.637) -- 0:04:49
      82500 -- (-1988.182) (-1987.377) [-1983.790] (-2008.783) * [-1985.466] (-1999.796) (-1984.915) (-1992.420) -- 0:04:49
      82600 -- [-1981.858] (-1994.078) (-1987.670) (-2007.188) * (-1985.996) (-1994.416) [-1987.632] (-1990.426) -- 0:04:48
      82700 -- (-1984.816) (-1986.877) [-1983.755] (-2001.628) * (-1992.235) (-1989.677) [-1984.244] (-1992.372) -- 0:04:59
      82800 -- (-1984.837) [-1989.884] (-1983.973) (-2003.518) * (-1992.214) (-1989.308) (-1982.090) [-1986.916] -- 0:04:59
      82900 -- [-1983.171] (-1992.486) (-1981.374) (-1997.326) * (-1995.410) (-1996.507) [-1977.892] (-1990.126) -- 0:04:58
      83000 -- (-1980.175) (-1990.042) [-1981.373] (-1998.604) * (-1999.688) [-1985.082] (-1981.722) (-1992.141) -- 0:04:58

      Average standard deviation of split frequencies: 0.009713

      83100 -- (-1981.975) (-1986.666) [-1982.082] (-1996.423) * (-2001.248) [-1980.097] (-1986.534) (-1988.190) -- 0:04:57
      83200 -- (-1978.724) (-1985.992) [-1979.520] (-1998.186) * (-1997.499) (-1983.338) (-1987.226) [-1988.259] -- 0:04:57
      83300 -- [-1986.526] (-1989.992) (-1983.078) (-1986.853) * (-1994.645) (-1986.216) [-1984.016] (-1989.881) -- 0:04:57
      83400 -- (-1989.337) (-1991.189) [-1981.591] (-1989.482) * (-2009.783) [-1987.270] (-1986.453) (-1989.792) -- 0:04:56
      83500 -- [-1986.455] (-1990.174) (-1979.326) (-1990.561) * (-2001.326) (-1988.454) (-1988.671) [-1990.061] -- 0:04:56
      83600 -- (-1985.593) (-1991.435) [-1978.677] (-1993.435) * (-1995.776) (-1993.443) (-1987.307) [-1990.777] -- 0:04:55
      83700 -- [-1985.959] (-1996.293) (-1986.851) (-1991.440) * (-1982.587) (-1985.139) [-1987.534] (-1990.082) -- 0:04:55
      83800 -- (-1979.311) (-2000.644) [-1989.215] (-1987.935) * (-1980.204) (-1991.697) [-1981.947] (-1983.073) -- 0:04:55
      83900 -- [-1978.545] (-1996.980) (-1992.424) (-1987.642) * [-1979.733] (-1988.612) (-1982.135) (-1989.009) -- 0:04:54
      84000 -- [-1977.978] (-2001.625) (-1991.841) (-1986.367) * [-1981.465] (-1993.220) (-1987.000) (-1989.453) -- 0:04:54

      Average standard deviation of split frequencies: 0.009605

      84100 -- (-1981.019) (-1998.567) (-1992.098) [-1984.349] * [-1980.947] (-1985.721) (-1992.405) (-1984.483) -- 0:04:54
      84200 -- (-1984.075) (-1996.214) (-1986.928) [-1978.132] * (-1981.225) (-1983.878) (-1990.303) [-1982.607] -- 0:04:53
      84300 -- (-1979.481) (-1995.498) (-1982.382) [-1980.714] * (-1990.612) (-1989.189) (-1990.824) [-1983.410] -- 0:04:53
      84400 -- (-1987.832) (-1994.876) (-1995.674) [-1981.431] * (-1984.433) (-1993.641) (-1990.820) [-1986.339] -- 0:04:52
      84500 -- (-1984.742) (-1991.078) (-1997.934) [-1983.263] * (-1992.293) [-1989.286] (-1985.461) (-1986.654) -- 0:04:52
      84600 -- (-1981.663) (-1991.799) (-1989.712) [-1980.317] * [-1985.161] (-1990.024) (-1987.806) (-1984.469) -- 0:04:52
      84700 -- [-1982.361] (-1994.079) (-1988.690) (-1983.650) * (-1994.515) (-1991.238) (-1993.289) [-1984.186] -- 0:04:51
      84800 -- [-1986.045] (-1994.109) (-1996.691) (-1978.857) * (-1985.515) (-1991.228) (-1988.840) [-1984.781] -- 0:04:51
      84900 -- [-1980.888] (-2006.226) (-1993.076) (-1988.907) * [-1986.469] (-1991.819) (-1989.506) (-1993.202) -- 0:04:51
      85000 -- [-1982.768] (-2001.033) (-1990.103) (-1991.768) * (-1987.668) [-1995.905] (-1989.314) (-1988.271) -- 0:04:50

      Average standard deviation of split frequencies: 0.009485

      85100 -- (-1982.966) (-1998.130) (-1987.691) [-1986.554] * (-1989.678) (-2000.410) [-1989.693] (-1986.241) -- 0:04:50
      85200 -- (-1986.539) (-1992.156) (-1988.903) [-1983.697] * (-1990.064) (-1988.581) [-1987.235] (-1985.567) -- 0:04:49
      85300 -- (-1982.678) (-1992.166) (-1989.356) [-1982.180] * (-1991.975) (-1987.807) (-1991.633) [-1982.913] -- 0:04:49
      85400 -- (-1989.862) (-1990.521) (-1990.612) [-1982.445] * (-1996.341) [-1980.418] (-1989.374) (-1984.445) -- 0:04:49
      85500 -- (-1990.989) (-1992.772) (-1994.059) [-1982.122] * (-1991.152) (-1982.286) (-1984.985) [-1986.620] -- 0:04:48
      85600 -- [-1991.367] (-2001.169) (-1993.044) (-1988.489) * (-1990.541) [-1983.382] (-1987.555) (-1988.202) -- 0:04:48
      85700 -- [-1982.315] (-2011.818) (-2001.574) (-1986.353) * (-1986.786) [-1983.763] (-1987.554) (-1983.938) -- 0:04:48
      85800 -- [-1986.414] (-1994.180) (-1992.157) (-1989.241) * (-1995.528) (-1984.114) [-1994.369] (-1986.919) -- 0:04:47
      85900 -- (-1992.634) (-1993.008) (-1994.572) [-1985.001] * (-2001.999) (-1985.278) [-1986.946] (-1990.561) -- 0:04:57
      86000 -- (-1987.729) (-1989.678) (-1990.706) [-1984.079] * (-1999.364) [-1982.328] (-1981.942) (-1987.617) -- 0:04:57

      Average standard deviation of split frequencies: 0.009539

      86100 -- [-1981.782] (-1995.304) (-1991.534) (-1987.197) * (-2005.854) (-1982.009) [-1986.170] (-1991.247) -- 0:04:57
      86200 -- [-1981.273] (-1994.224) (-1990.777) (-1985.482) * (-1993.216) (-1984.101) (-1989.299) [-1985.669] -- 0:04:56
      86300 -- [-1984.983] (-1992.304) (-1997.748) (-1985.987) * (-1990.097) [-1983.120] (-1988.733) (-1989.629) -- 0:04:56
      86400 -- [-1985.580] (-1994.761) (-1990.546) (-1993.477) * (-1990.817) [-1981.125] (-1987.912) (-1996.803) -- 0:04:56
      86500 -- (-1981.699) (-2002.615) (-1990.035) [-1983.092] * (-1988.402) [-1982.029] (-1985.595) (-1990.172) -- 0:04:55
      86600 -- [-1986.529] (-1998.349) (-1994.903) (-1982.869) * [-1988.073] (-1986.911) (-1988.289) (-1987.580) -- 0:04:55
      86700 -- [-1983.380] (-1999.357) (-2002.574) (-1989.021) * (-1985.614) [-1985.705] (-1993.359) (-1994.303) -- 0:04:54
      86800 -- (-1986.793) (-1991.070) (-2009.595) [-1989.826] * (-1987.614) (-1993.049) (-1996.566) [-1990.730] -- 0:04:54
      86900 -- (-1983.829) (-1997.151) (-2000.671) [-1985.538] * (-1990.699) [-1992.272] (-1998.195) (-1989.139) -- 0:04:54
      87000 -- [-1981.988] (-1993.753) (-1990.205) (-1988.912) * (-1994.145) (-1986.615) (-1998.882) [-1989.272] -- 0:04:53

      Average standard deviation of split frequencies: 0.009576

      87100 -- [-1982.570] (-1992.449) (-1993.753) (-1989.668) * (-1997.636) (-1982.235) (-1993.878) [-1988.002] -- 0:04:53
      87200 -- [-1980.432] (-1990.029) (-1990.008) (-1987.668) * (-2002.792) [-1984.942] (-1992.290) (-1989.573) -- 0:04:53
      87300 -- (-1979.609) [-1989.729] (-1988.688) (-1990.972) * (-1998.879) [-1986.576] (-1990.102) (-1989.520) -- 0:04:52
      87400 -- (-1979.637) [-1990.086] (-1990.680) (-1986.916) * (-1998.576) (-1985.535) (-1989.763) [-1984.655] -- 0:04:52
      87500 -- [-1978.504] (-1986.078) (-1992.049) (-1983.720) * (-1990.387) (-1984.931) [-1989.812] (-1997.673) -- 0:04:52
      87600 -- (-1980.194) (-1988.605) (-1997.754) [-1984.143] * (-1995.498) (-1985.641) [-1988.408] (-1996.494) -- 0:04:51
      87700 -- (-1982.246) (-1990.259) (-2002.353) [-1979.120] * [-1992.067] (-1993.680) (-2004.130) (-1997.304) -- 0:04:51
      87800 -- [-1980.700] (-1987.700) (-2003.052) (-1979.531) * (-1996.982) [-1986.290] (-1999.081) (-1987.728) -- 0:04:50
      87900 -- (-1985.326) (-1989.944) (-2000.549) [-1980.345] * (-1999.985) [-1981.606] (-1997.411) (-1987.053) -- 0:04:50
      88000 -- (-1984.282) (-1989.606) (-1995.328) [-1982.488] * (-2009.848) (-1980.620) (-1999.325) [-1982.982] -- 0:04:50

      Average standard deviation of split frequencies: 0.009169

      88100 -- [-1982.271] (-1989.467) (-1990.441) (-1985.711) * (-1989.832) [-1981.223] (-1998.259) (-1983.478) -- 0:04:49
      88200 -- [-1983.049] (-1989.885) (-1992.412) (-1987.244) * (-1986.100) [-1984.456] (-1995.074) (-1985.825) -- 0:04:49
      88300 -- [-1988.868] (-1999.646) (-1992.371) (-1994.200) * (-1991.173) (-1989.577) (-1990.364) [-1984.197] -- 0:04:49
      88400 -- (-1988.808) [-1987.169] (-1990.209) (-1994.309) * [-1995.499] (-1988.898) (-1994.964) (-1990.077) -- 0:04:48
      88500 -- [-1985.194] (-1997.755) (-1986.632) (-1986.560) * (-1993.963) (-1989.910) (-1988.259) [-1982.737] -- 0:04:48
      88600 -- (-1995.845) (-2002.927) [-1987.216] (-1987.138) * (-1987.785) [-1986.611] (-1990.137) (-1983.610) -- 0:04:48
      88700 -- (-1988.314) (-2005.969) (-1990.416) [-1988.445] * (-1988.965) [-1981.771] (-1993.938) (-1987.340) -- 0:04:47
      88800 -- (-1986.257) (-2016.418) (-1990.699) [-1987.595] * (-1992.576) (-1983.357) [-1986.317] (-1987.485) -- 0:04:47
      88900 -- (-1991.882) (-2015.042) [-1988.381] (-1983.791) * (-1990.004) (-1984.703) (-1987.671) [-1984.122] -- 0:04:46
      89000 -- (-1994.685) (-2008.383) (-1991.108) [-1981.108] * (-2002.302) (-1984.348) (-1986.647) [-1983.756] -- 0:04:56

      Average standard deviation of split frequencies: 0.009060

      89100 -- (-1996.628) (-1998.684) (-1993.416) [-1981.305] * (-1997.733) [-1977.698] (-1987.835) (-1981.569) -- 0:04:56
      89200 -- (-1994.442) (-1998.035) (-1994.010) [-1981.131] * (-1991.418) (-1986.134) (-1992.587) [-1987.491] -- 0:04:56
      89300 -- (-1999.187) (-1992.230) (-1995.307) [-1979.259] * (-1993.544) [-1985.799] (-1992.653) (-1984.442) -- 0:04:55
      89400 -- (-1988.987) (-1994.143) (-1991.408) [-1980.841] * (-1992.981) (-1987.699) [-1990.719] (-1999.353) -- 0:04:55
      89500 -- (-1983.337) (-1987.192) (-2002.798) [-1980.635] * (-1996.843) [-1987.266] (-1990.777) (-1991.922) -- 0:04:55
      89600 -- (-1988.185) [-1985.357] (-2002.488) (-1979.159) * (-1999.519) (-1992.867) [-1987.352] (-1992.863) -- 0:04:54
      89700 -- (-1993.568) (-1984.267) (-2008.103) [-1977.995] * (-1994.929) (-1996.555) [-1989.670] (-1993.556) -- 0:04:54
      89800 -- (-1997.246) [-1984.242] (-2002.777) (-1977.647) * [-1989.931] (-1993.973) (-1993.129) (-1994.304) -- 0:04:53
      89900 -- (-1991.591) [-1992.187] (-1998.000) (-1984.376) * (-1993.152) (-1990.853) (-1990.952) [-1991.632] -- 0:04:53
      90000 -- [-1989.743] (-1988.159) (-1991.513) (-1985.910) * (-1994.061) (-1993.526) [-1985.769] (-1995.842) -- 0:04:53

      Average standard deviation of split frequencies: 0.009414

      90100 -- (-1991.271) [-1986.608] (-1996.956) (-1986.480) * (-2003.132) [-1991.053] (-1988.158) (-1989.884) -- 0:04:52
      90200 -- (-1986.083) [-1985.503] (-1991.460) (-1998.110) * (-1998.082) [-1990.597] (-1990.342) (-1986.616) -- 0:04:52
      90300 -- (-1987.304) (-1989.735) [-1985.795] (-1992.591) * (-1999.539) (-1987.432) (-1996.239) [-1986.085] -- 0:04:52
      90400 -- (-1990.042) (-2002.149) (-1989.532) [-1984.258] * (-2004.969) (-1987.514) [-1990.025] (-1987.891) -- 0:04:51
      90500 -- (-1988.690) (-1995.198) (-1995.481) [-1983.664] * (-2002.815) [-1984.850] (-1985.905) (-1995.296) -- 0:04:51
      90600 -- [-1985.361] (-1990.562) (-1989.281) (-1988.101) * (-1998.754) [-1980.699] (-1985.473) (-1988.441) -- 0:04:51
      90700 -- (-1984.142) (-1990.975) (-1990.883) [-1984.715] * (-2008.359) [-1984.430] (-1993.517) (-1994.813) -- 0:04:50
      90800 -- (-1991.162) (-1998.618) (-1987.396) [-1982.610] * (-2004.397) [-1990.998] (-1994.383) (-1999.438) -- 0:04:50
      90900 -- [-1988.601] (-1999.916) (-1996.281) (-1988.807) * (-2001.627) [-1989.006] (-1987.784) (-1993.513) -- 0:04:50
      91000 -- [-1981.494] (-1996.828) (-1996.911) (-1990.528) * (-2004.720) (-1988.705) [-1987.623] (-1996.592) -- 0:04:49

      Average standard deviation of split frequencies: 0.009156

      91100 -- (-1985.130) (-1999.126) (-1996.175) [-1985.856] * (-2005.187) [-1985.634] (-1996.344) (-1997.875) -- 0:04:49
      91200 -- (-1983.039) (-1996.653) (-1997.007) [-1987.384] * (-2016.938) [-1984.077] (-1993.042) (-2001.153) -- 0:04:48
      91300 -- [-1982.965] (-2002.098) (-1991.013) (-1985.649) * (-2000.170) [-1986.928] (-1999.023) (-1987.185) -- 0:04:48
      91400 -- (-1985.313) (-2001.725) (-1996.659) [-1983.346] * (-2001.277) (-1986.987) [-1992.408] (-1987.266) -- 0:04:48
      91500 -- [-1977.068] (-2010.834) (-1989.953) (-1984.548) * (-2001.659) [-1984.266] (-1995.635) (-1990.813) -- 0:04:47
      91600 -- [-1982.215] (-2002.964) (-1991.622) (-1995.045) * (-1994.055) (-1989.218) (-1998.690) [-1985.420] -- 0:04:47
      91700 -- (-1983.463) (-2001.598) (-1989.659) [-1984.162] * (-1994.581) [-1988.826] (-1996.104) (-1991.086) -- 0:04:47
      91800 -- [-1981.420] (-1993.872) (-2006.437) (-1984.519) * (-1994.211) [-1988.076] (-1997.034) (-1990.076) -- 0:04:46
      91900 -- [-1979.405] (-1998.259) (-1999.472) (-1985.780) * (-1996.716) [-1984.407] (-1991.747) (-1988.899) -- 0:04:46
      92000 -- (-1985.036) (-2003.552) (-1995.413) [-1982.028] * (-2000.576) (-1983.600) (-1992.491) [-1991.363] -- 0:04:46

      Average standard deviation of split frequencies: 0.009064

      92100 -- (-1988.788) (-2000.669) (-2000.135) [-1981.219] * (-1998.544) [-1990.211] (-1995.969) (-1994.455) -- 0:04:55
      92200 -- (-1992.448) (-2007.140) (-1999.888) [-1980.747] * (-2008.928) (-1991.956) (-1996.847) [-1992.741] -- 0:04:55
      92300 -- (-1996.437) (-1995.371) (-2004.306) [-1987.399] * (-1992.755) [-1991.658] (-1994.123) (-1991.203) -- 0:04:55
      92400 -- (-1997.034) (-1999.821) (-1998.787) [-1981.364] * (-1995.749) [-1991.841] (-2006.262) (-1989.598) -- 0:04:54
      92500 -- (-2000.201) (-1995.776) (-1992.060) [-1982.010] * (-1999.522) [-1987.982] (-2002.373) (-1991.974) -- 0:04:54
      92600 -- [-1991.182] (-1992.331) (-1994.746) (-1983.163) * (-1993.541) (-1984.512) (-2000.510) [-1994.930] -- 0:04:53
      92700 -- (-1992.135) (-1991.409) (-1991.724) [-1980.415] * (-1991.938) [-1983.649] (-2000.302) (-1994.583) -- 0:04:53
      92800 -- (-1986.004) (-1991.532) (-1996.640) [-1978.549] * (-1991.592) [-1984.626] (-1992.338) (-1994.293) -- 0:04:53
      92900 -- [-1980.446] (-1993.799) (-1991.568) (-1982.831) * [-1994.874] (-1990.003) (-1993.142) (-1992.686) -- 0:04:52
      93000 -- [-1985.464] (-1996.155) (-1985.367) (-1982.586) * (-1992.712) (-1992.888) (-1992.729) [-1991.210] -- 0:04:52

      Average standard deviation of split frequencies: 0.008815

      93100 -- [-1983.293] (-1997.419) (-1988.423) (-1985.827) * [-1989.452] (-1987.947) (-2000.391) (-1992.022) -- 0:04:52
      93200 -- [-1978.317] (-1997.256) (-1990.905) (-1983.601) * [-1990.477] (-1989.521) (-1996.310) (-2000.123) -- 0:04:51
      93300 -- [-1976.261] (-1995.694) (-1995.861) (-1986.655) * (-1997.667) (-1999.939) (-2003.547) [-1994.521] -- 0:04:51
      93400 -- [-1980.050] (-1993.652) (-2001.687) (-1990.902) * (-1995.559) [-1992.693] (-2010.265) (-1997.609) -- 0:04:51
      93500 -- [-1980.444] (-1992.619) (-2004.089) (-1986.353) * (-2002.373) [-1990.885] (-2007.233) (-1990.839) -- 0:04:50
      93600 -- (-1983.174) (-1991.670) [-1992.908] (-1990.267) * (-2000.635) (-1997.196) (-1990.597) [-1991.119] -- 0:04:50
      93700 -- (-1984.059) (-1993.215) [-1986.361] (-1983.862) * (-1999.296) (-1989.703) (-1995.319) [-1990.751] -- 0:04:50
      93800 -- [-1981.731] (-2001.168) (-1987.557) (-1983.302) * (-2000.477) [-1988.037] (-1995.829) (-1992.440) -- 0:04:49
      93900 -- (-1983.642) (-2002.618) (-1984.698) [-1980.570] * (-1997.124) (-1982.728) [-1992.952] (-1988.795) -- 0:04:49
      94000 -- (-1984.602) (-2006.745) (-1986.077) [-1990.148] * (-1998.581) [-1985.894] (-1991.248) (-1995.707) -- 0:04:49

      Average standard deviation of split frequencies: 0.009873

      94100 -- [-1982.094] (-2005.173) (-1990.736) (-1985.303) * (-1994.141) (-1990.776) [-1992.230] (-1995.404) -- 0:04:48
      94200 -- (-1989.658) (-2001.912) (-1995.424) [-1983.464] * (-2004.089) (-1994.533) (-1992.745) [-1984.198] -- 0:04:48
      94300 -- [-1982.826] (-2007.504) (-1995.131) (-1980.928) * (-2006.575) (-1999.860) [-1989.019] (-1983.476) -- 0:04:48
      94400 -- (-1987.620) (-1991.553) (-1994.446) [-1978.353] * (-2009.656) (-1995.438) (-1989.469) [-1985.394] -- 0:04:47
      94500 -- [-1981.866] (-1990.038) (-1987.474) (-1982.179) * (-2001.407) (-1992.234) [-1986.050] (-1987.852) -- 0:04:47
      94600 -- [-1979.008] (-1999.261) (-1986.506) (-1985.609) * (-2013.247) (-1995.665) (-1988.010) [-1989.174] -- 0:04:47
      94700 -- [-1979.597] (-1994.082) (-1988.894) (-1986.431) * (-2005.176) (-1995.632) [-1991.497] (-1984.372) -- 0:04:46
      94800 -- (-1981.741) (-1995.120) (-1991.574) [-1985.024] * (-2000.687) (-1995.837) (-1997.499) [-1982.251] -- 0:04:46
      94900 -- [-1981.839] (-1991.181) (-1999.958) (-1987.694) * (-1997.019) (-2010.411) [-1989.683] (-1983.921) -- 0:04:46
      95000 -- [-1977.558] (-1990.450) (-1990.903) (-1985.632) * (-1998.753) (-2006.540) (-1993.919) [-1985.259] -- 0:04:45

      Average standard deviation of split frequencies: 0.010045

      95100 -- [-1978.843] (-1990.770) (-1993.596) (-1988.578) * [-1993.501] (-2001.358) (-1994.107) (-1984.482) -- 0:04:45
      95200 -- [-1976.951] (-1985.448) (-1991.264) (-2001.649) * [-1991.392] (-2003.823) (-1994.327) (-1990.329) -- 0:04:45
      95300 -- [-1980.286] (-1988.335) (-1994.627) (-2002.312) * (-1989.668) [-1993.757] (-2000.035) (-1988.349) -- 0:04:54
      95400 -- [-1981.478] (-1991.961) (-1990.747) (-2004.461) * [-1992.100] (-1988.834) (-2001.283) (-1986.127) -- 0:04:53
      95500 -- (-1985.706) (-1986.327) (-1996.430) [-1988.639] * (-1990.698) [-1981.860] (-2011.426) (-1998.498) -- 0:04:53
      95600 -- [-1985.691] (-1992.539) (-1994.773) (-1986.784) * (-1988.307) [-1980.542] (-1992.856) (-1992.590) -- 0:04:53
      95700 -- (-1999.972) (-1994.127) (-1994.439) [-1987.229] * (-1987.545) [-1979.103] (-1988.282) (-1998.701) -- 0:04:52
      95800 -- (-1995.372) (-1997.253) (-1995.893) [-1985.688] * (-1994.986) [-1981.489] (-1990.873) (-1994.400) -- 0:04:52
      95900 -- (-1994.618) (-1992.196) (-1993.128) [-1986.392] * (-1993.573) [-1980.364] (-1994.151) (-1996.924) -- 0:04:52
      96000 -- (-1991.528) (-1993.176) (-1992.888) [-1984.021] * [-1992.304] (-1984.939) (-1994.132) (-1993.223) -- 0:04:51

      Average standard deviation of split frequencies: 0.010648

      96100 -- (-1993.504) (-2003.974) (-2000.926) [-1987.925] * (-1992.361) (-1982.549) (-1989.588) [-1988.135] -- 0:04:51
      96200 -- (-1996.594) (-1994.403) (-1993.018) [-1988.571] * (-1990.006) [-1990.681] (-1997.670) (-1989.929) -- 0:04:51
      96300 -- (-2006.019) (-1997.329) [-1986.766] (-1999.032) * (-1989.707) (-2001.485) [-1990.159] (-1992.651) -- 0:04:50
      96400 -- [-1998.113] (-1994.511) (-1987.403) (-1999.701) * [-1989.065] (-2005.321) (-1985.249) (-2003.326) -- 0:04:50
      96500 -- (-1995.048) (-2000.732) [-1988.056] (-1996.523) * [-1988.738] (-1994.042) (-1986.052) (-1997.150) -- 0:04:50
      96600 -- (-1992.335) (-1992.036) [-1989.926] (-1992.818) * (-1993.038) (-1994.203) (-1987.091) [-1994.095] -- 0:04:49
      96700 -- (-1989.295) (-1989.952) (-1996.079) [-1988.980] * (-1998.299) (-2001.526) (-1990.061) [-1993.276] -- 0:04:49
      96800 -- (-1990.958) [-1989.514] (-1985.807) (-1993.843) * [-1990.609] (-2003.353) (-1987.149) (-1992.785) -- 0:04:49
      96900 -- (-1999.134) (-1992.896) [-1985.048] (-2000.752) * [-1989.456] (-1995.730) (-1988.019) (-1988.292) -- 0:04:48
      97000 -- (-2007.078) (-1993.187) [-1983.874] (-1993.709) * (-1993.265) (-2001.724) (-1985.341) [-1986.948] -- 0:04:48

      Average standard deviation of split frequencies: 0.010947

      97100 -- (-2008.816) [-1991.896] (-1983.229) (-1984.401) * (-1996.115) (-1994.979) [-1986.121] (-1988.273) -- 0:04:48
      97200 -- (-2008.210) (-1995.427) (-1982.241) [-1978.921] * (-1997.566) (-1995.515) [-1986.521] (-1989.079) -- 0:04:47
      97300 -- (-1999.703) (-1992.340) (-1984.204) [-1980.110] * (-1994.017) (-1993.159) (-1991.052) [-1990.231] -- 0:04:47
      97400 -- (-1997.571) (-2001.912) (-1987.804) [-1978.176] * (-1992.704) (-1993.301) [-1984.599] (-2000.007) -- 0:04:47
      97500 -- (-1991.099) (-1998.804) (-1987.477) [-1978.631] * (-2000.194) (-1997.214) [-1987.361] (-1998.677) -- 0:04:46
      97600 -- (-1991.645) (-1998.706) (-1985.615) [-1986.495] * (-2000.994) (-2001.269) [-1990.641] (-2007.633) -- 0:04:46
      97700 -- (-1993.721) (-1996.305) (-1986.743) [-1984.718] * [-1991.586] (-1999.356) (-1986.351) (-2006.874) -- 0:04:46
      97800 -- (-2003.567) (-1999.993) (-1988.425) [-1984.711] * (-1996.490) (-2004.940) [-1990.064] (-1999.357) -- 0:04:45
      97900 -- (-2014.763) (-1997.485) (-1984.465) [-1983.263] * (-1993.510) (-2008.969) [-1986.465] (-2000.246) -- 0:04:45
      98000 -- (-2006.859) (-1998.459) (-1986.957) [-1986.202] * (-2002.028) (-2000.301) [-1984.882] (-2000.571) -- 0:04:45

      Average standard deviation of split frequencies: 0.011254

      98100 -- (-2003.954) [-1994.419] (-1991.750) (-1988.663) * (-1991.948) [-1987.435] (-1985.519) (-2007.287) -- 0:04:45
      98200 -- (-2001.389) (-1990.656) (-1992.863) [-1989.214] * (-1989.540) (-1995.925) [-1984.079] (-1996.529) -- 0:04:44
      98300 -- (-1998.807) [-1992.826] (-1992.736) (-1989.317) * [-1984.559] (-1995.858) (-1990.621) (-1991.460) -- 0:04:44
      98400 -- (-1991.653) (-1996.661) (-1998.166) [-1985.493] * [-1984.531] (-1997.545) (-1989.833) (-1985.297) -- 0:04:44
      98500 -- (-1986.581) [-1990.718] (-1998.999) (-1988.711) * [-1981.689] (-1997.214) (-2001.286) (-1989.273) -- 0:04:52
      98600 -- (-1992.163) (-1992.837) (-1995.712) [-1989.610] * [-1984.691] (-2007.014) (-1996.388) (-1987.030) -- 0:04:52
      98700 -- [-1988.021] (-1989.759) (-1990.813) (-1993.130) * (-1988.237) (-2001.725) (-1990.011) [-1986.612] -- 0:04:52
      98800 -- [-1987.357] (-1989.018) (-1988.469) (-1991.644) * (-1986.677) (-1996.633) (-1991.293) [-1992.139] -- 0:04:51
      98900 -- (-1984.651) (-1988.620) [-1988.616] (-2000.374) * [-1990.120] (-1993.032) (-1996.274) (-1992.367) -- 0:04:51
      99000 -- [-1986.341] (-1995.947) (-1986.120) (-2003.327) * (-1994.919) (-1992.427) [-1988.993] (-1988.857) -- 0:04:51

      Average standard deviation of split frequencies: 0.011812

      99100 -- (-1986.096) (-1996.221) [-1984.895] (-1996.196) * (-1990.851) (-1991.957) [-1988.877] (-1989.136) -- 0:04:50
      99200 -- [-1987.782] (-2000.362) (-1978.780) (-1987.347) * (-1996.418) (-1999.038) (-1994.563) [-1989.606] -- 0:04:50
      99300 -- (-1986.444) (-1996.295) [-1982.212] (-1989.140) * (-1997.047) (-1991.456) [-1988.632] (-1990.804) -- 0:04:50
      99400 -- (-1987.603) (-1986.533) [-1978.101] (-1989.737) * (-1996.750) (-2001.234) [-1985.230] (-1991.321) -- 0:04:49
      99500 -- (-1989.881) (-1981.974) (-1980.589) [-1983.167] * (-1996.516) (-1996.766) (-1989.989) [-1990.996] -- 0:04:49
      99600 -- (-1987.161) [-1984.688] (-1993.555) (-1988.215) * (-1990.197) (-1991.084) (-1995.301) [-1987.782] -- 0:04:49
      99700 -- (-1987.328) (-1989.583) [-1989.805] (-1990.264) * (-1986.487) (-1988.061) (-1997.456) [-1985.766] -- 0:04:48
      99800 -- (-1987.283) (-1991.480) [-1980.348] (-1995.492) * (-1982.871) (-1993.914) [-1992.068] (-1992.077) -- 0:04:48
      99900 -- (-1989.738) (-1989.419) [-1980.779] (-1993.083) * (-1985.252) (-1997.160) (-1994.442) [-1984.677] -- 0:04:48
      100000 -- (-1995.770) (-1990.222) [-1982.097] (-2002.221) * [-1986.485] (-1995.772) (-1994.313) (-1985.268) -- 0:04:48

      Average standard deviation of split frequencies: 0.011433

      100100 -- (-1986.291) (-1993.995) [-1981.552] (-2002.691) * [-1983.160] (-1990.605) (-2001.616) (-1985.702) -- 0:04:47
      100200 -- (-1990.581) (-1984.560) [-1982.858] (-1997.303) * (-1987.603) (-1992.204) (-2005.038) [-1989.294] -- 0:04:47
      100300 -- [-1987.049] (-1989.673) (-1983.523) (-1999.125) * (-1991.737) [-1991.238] (-1999.610) (-1993.329) -- 0:04:47
      100400 -- (-1988.288) [-1988.540] (-1978.556) (-2006.793) * [-1993.693] (-1993.212) (-1991.520) (-1993.267) -- 0:04:46
      100500 -- [-1984.403] (-1994.481) (-1981.070) (-2005.517) * (-1989.990) (-1999.962) [-1996.626] (-1994.438) -- 0:04:46
      100600 -- [-1981.127] (-1998.955) (-1975.632) (-1992.320) * [-1984.027] (-2000.271) (-1993.661) (-1991.074) -- 0:04:46
      100700 -- (-1984.702) (-1984.034) [-1975.550] (-1998.845) * (-1986.551) (-1996.053) [-1988.342] (-1994.424) -- 0:04:45
      100800 -- [-1983.083] (-1994.606) (-1988.982) (-1999.571) * [-1993.656] (-1998.796) (-1999.999) (-1984.968) -- 0:04:45
      100900 -- (-1979.263) (-2003.752) [-1986.645] (-2016.677) * (-1992.433) (-1990.035) (-2003.764) [-1986.338] -- 0:04:45
      101000 -- [-1976.913] (-1995.238) (-1982.759) (-2008.286) * [-1989.574] (-1994.867) (-1996.162) (-1986.069) -- 0:04:44

      Average standard deviation of split frequencies: 0.011446

      101100 -- [-1982.956] (-2003.797) (-1988.460) (-2005.481) * [-1988.276] (-1989.544) (-1990.074) (-1991.817) -- 0:04:44
      101200 -- [-1992.531] (-1996.967) (-1987.986) (-2005.113) * (-1990.216) (-1993.741) (-1986.910) [-1989.209] -- 0:04:44
      101300 -- [-1987.868] (-1995.599) (-1989.235) (-1998.359) * (-1991.963) [-1987.704] (-1988.076) (-1988.156) -- 0:04:43
      101400 -- (-1989.030) (-1997.747) (-1984.640) [-1991.694] * (-1998.641) [-1984.581] (-1986.687) (-1993.778) -- 0:04:43
      101500 -- (-1985.219) (-1994.971) [-1988.829] (-1997.475) * (-2000.741) (-1991.404) [-1987.919] (-1999.615) -- 0:04:43
      101600 -- (-1988.049) (-1996.126) (-1998.063) [-1986.929] * (-1991.605) (-1989.950) [-1987.747] (-1995.549) -- 0:04:51
      101700 -- [-1984.962] (-2000.215) (-1995.988) (-1993.144) * (-2000.825) (-1989.652) (-1988.078) [-1990.329] -- 0:04:51
      101800 -- (-1982.249) (-1996.097) (-1987.573) [-1987.538] * (-1998.975) [-1986.794] (-1993.611) (-1991.120) -- 0:04:51
      101900 -- (-1988.657) (-2001.450) [-1984.878] (-1986.595) * [-1986.634] (-1991.143) (-1993.461) (-1987.215) -- 0:04:50
      102000 -- (-1992.199) (-2001.947) (-1985.171) [-1986.651] * (-2001.427) (-1993.757) [-1991.138] (-1994.974) -- 0:04:50

      Average standard deviation of split frequencies: 0.010682

      102100 -- (-1984.109) (-2003.981) (-1981.561) [-1995.441] * (-1994.860) (-1986.617) [-1994.086] (-1989.598) -- 0:04:50
      102200 -- (-1985.332) (-2002.301) (-1982.162) [-1986.403] * (-1991.972) (-1995.215) [-1991.141] (-1986.460) -- 0:04:49
      102300 -- (-1984.787) (-1997.344) [-1988.722] (-1994.615) * (-1995.175) (-1989.710) [-1985.805] (-1997.337) -- 0:04:49
      102400 -- (-1983.609) (-2001.111) (-1992.312) [-1992.713] * (-2000.363) (-1988.719) [-1985.455] (-1998.473) -- 0:04:49
      102500 -- [-1980.983] (-1993.345) (-1996.475) (-1995.385) * (-1995.870) (-1992.765) [-1984.485] (-2001.687) -- 0:04:48
      102600 -- [-1979.873] (-1988.758) (-1984.419) (-2002.164) * (-1999.110) (-1994.264) [-1989.698] (-1996.079) -- 0:04:48
      102700 -- (-1982.401) (-1986.432) [-1991.721] (-1988.541) * [-1993.298] (-2001.829) (-1991.533) (-1998.440) -- 0:04:48
      102800 -- [-1981.170] (-1984.182) (-1993.462) (-1988.267) * (-2001.654) [-1991.692] (-2003.540) (-2000.871) -- 0:04:48
      102900 -- [-1982.247] (-1985.932) (-1982.060) (-1994.321) * (-1993.793) [-1993.434] (-1993.754) (-1999.170) -- 0:04:47
      103000 -- (-1982.487) [-1989.716] (-1986.501) (-1996.633) * [-1998.041] (-1993.803) (-1996.829) (-1999.342) -- 0:04:47

      Average standard deviation of split frequencies: 0.010832

      103100 -- (-1984.971) (-1990.948) [-1988.820] (-1996.214) * (-2002.879) [-1994.960] (-1994.987) (-1999.399) -- 0:04:47
      103200 -- [-1985.286] (-1989.633) (-1991.483) (-1996.870) * [-1993.909] (-1999.971) (-1996.672) (-2002.998) -- 0:04:46
      103300 -- (-1989.215) [-1989.154] (-1993.345) (-1990.196) * (-1994.284) (-2002.599) (-1996.324) [-1992.282] -- 0:04:46
      103400 -- (-1985.752) [-1992.860] (-1994.196) (-1998.012) * (-1990.503) (-1998.084) (-2006.630) [-1987.305] -- 0:04:46
      103500 -- [-1984.291] (-1993.940) (-2000.804) (-2001.760) * (-1990.036) [-1992.280] (-2001.686) (-1984.142) -- 0:04:45
      103600 -- [-1988.311] (-1996.293) (-1993.095) (-2001.755) * (-1994.033) (-1995.204) (-1993.421) [-1984.926] -- 0:04:45
      103700 -- [-1984.778] (-1997.587) (-2000.000) (-1994.366) * [-1994.965] (-1995.576) (-1989.478) (-1988.722) -- 0:04:45
      103800 -- (-1989.952) (-1996.048) (-1992.622) [-1992.256] * (-1990.463) (-1992.461) [-1991.431] (-1987.994) -- 0:04:44
      103900 -- [-1987.919] (-1994.994) (-1993.729) (-2003.049) * [-1987.396] (-1989.709) (-1993.486) (-1994.156) -- 0:04:44
      104000 -- (-1989.715) [-1989.943] (-1994.665) (-1998.136) * (-1995.647) [-1993.583] (-1990.746) (-1997.098) -- 0:04:44

      Average standard deviation of split frequencies: 0.010735

      104100 -- [-1988.095] (-1986.049) (-1997.117) (-1994.483) * (-1995.120) (-1996.238) (-1988.786) [-1996.997] -- 0:04:44
      104200 -- (-1993.180) [-1985.533] (-1990.106) (-2001.503) * (-1991.296) [-1992.955] (-1993.497) (-1999.270) -- 0:04:43
      104300 -- (-1985.537) (-1993.833) [-1986.587] (-1996.139) * (-2001.728) [-1988.251] (-1992.074) (-1992.758) -- 0:04:43
      104400 -- [-1987.949] (-2005.944) (-1989.787) (-1998.429) * (-1997.177) [-1986.482] (-1995.057) (-1989.734) -- 0:04:43
      104500 -- (-1988.404) (-2003.563) [-1988.112] (-1997.094) * (-1991.382) (-1987.971) [-1994.968] (-1987.050) -- 0:04:42
      104600 -- (-1983.872) (-2002.679) [-1992.649] (-1997.803) * (-1996.139) (-1995.859) (-2010.613) [-1989.427] -- 0:04:42
      104700 -- [-1986.619] (-2013.905) (-1991.343) (-1989.370) * (-1995.729) [-1991.876] (-2019.597) (-1994.803) -- 0:04:50
      104800 -- [-1984.178] (-2005.945) (-1988.681) (-2004.856) * (-1992.702) [-1992.466] (-2018.422) (-1994.184) -- 0:04:50
      104900 -- [-1981.214] (-1994.793) (-1988.830) (-1997.627) * (-1998.072) [-1985.891] (-2019.048) (-1984.004) -- 0:04:50
      105000 -- (-1989.550) [-1986.375] (-1986.736) (-1999.948) * (-1998.480) [-1989.081] (-2010.269) (-1986.984) -- 0:04:49

      Average standard deviation of split frequencies: 0.011267

      105100 -- (-1994.465) [-1983.544] (-1986.533) (-2006.284) * (-2003.323) [-2001.147] (-2004.100) (-1988.526) -- 0:04:49
      105200 -- (-1987.795) [-1984.775] (-1987.219) (-2004.493) * (-2004.926) (-1998.901) (-1998.973) [-1986.588] -- 0:04:49
      105300 -- [-1981.629] (-1986.761) (-1989.891) (-2001.007) * (-2000.683) (-1993.177) (-1994.542) [-1987.482] -- 0:04:48
      105400 -- [-1985.484] (-1985.861) (-1990.857) (-1995.347) * (-2003.865) (-1990.884) (-1998.069) [-1985.884] -- 0:04:48
      105500 -- [-1985.045] (-1989.053) (-1985.156) (-1996.977) * (-1993.731) (-1996.776) (-1998.326) [-1986.868] -- 0:04:48
      105600 -- (-1987.486) [-1991.810] (-1990.256) (-1997.558) * [-1985.696] (-1996.943) (-2000.087) (-1991.159) -- 0:04:47
      105700 -- (-2003.520) (-1996.614) [-1986.323] (-1995.835) * [-1985.444] (-1992.647) (-1998.027) (-1988.064) -- 0:04:47
      105800 -- (-1996.992) (-1997.305) [-1984.861] (-2003.477) * (-1989.104) [-1988.756] (-2002.246) (-1988.820) -- 0:04:47
      105900 -- (-1992.756) [-1995.796] (-1991.835) (-1999.604) * [-1992.196] (-1985.768) (-1995.010) (-1988.453) -- 0:04:47
      106000 -- [-1985.770] (-1988.339) (-1981.635) (-1991.364) * (-1991.644) [-1988.616] (-1996.046) (-1995.797) -- 0:04:46

      Average standard deviation of split frequencies: 0.011421

      106100 -- (-1987.228) (-1988.736) [-1981.195] (-1984.887) * (-1996.761) (-1994.637) (-1992.751) [-1987.963] -- 0:04:46
      106200 -- (-1987.320) [-1989.460] (-1993.239) (-1986.922) * [-1995.010] (-1989.314) (-1994.821) (-1990.449) -- 0:04:46
      106300 -- [-1983.637] (-1991.326) (-1996.469) (-1989.827) * (-1991.219) [-1986.031] (-1994.246) (-1991.309) -- 0:04:45
      106400 -- [-1978.897] (-1997.764) (-1994.634) (-1991.731) * (-1989.906) (-1991.229) (-1995.711) [-1995.372] -- 0:04:45
      106500 -- [-1985.036] (-2000.133) (-1996.329) (-1999.594) * (-1994.040) (-1996.389) (-1991.567) [-1992.923] -- 0:04:45
      106600 -- (-1986.828) [-1991.779] (-1988.479) (-2004.459) * (-1990.030) [-1995.711] (-1996.271) (-1989.609) -- 0:04:44
      106700 -- (-1987.535) (-1991.920) (-1993.275) [-1991.575] * [-1989.366] (-1993.319) (-1997.801) (-1993.523) -- 0:04:44
      106800 -- (-1995.350) [-1986.789] (-1987.793) (-1989.277) * [-1986.453] (-1992.320) (-1996.147) (-1988.070) -- 0:04:44
      106900 -- (-2001.084) [-1987.682] (-1988.866) (-1994.714) * [-1985.145] (-1994.501) (-1987.755) (-1989.190) -- 0:04:44
      107000 -- (-1992.381) [-1981.714] (-1986.927) (-1996.884) * (-1985.499) (-1992.981) (-1994.010) [-1986.376] -- 0:04:43

      Average standard deviation of split frequencies: 0.011559

      107100 -- (-1996.142) (-1984.668) [-1983.839] (-2008.236) * (-1983.707) (-1992.496) (-1991.519) [-1988.626] -- 0:04:43
      107200 -- (-1982.519) (-1981.593) [-1986.164] (-2003.991) * (-1993.145) [-1989.452] (-1991.675) (-1989.907) -- 0:04:43
      107300 -- (-1987.338) [-1993.379] (-1997.772) (-2010.371) * (-1995.023) (-1996.242) (-1997.356) [-1986.739] -- 0:04:42
      107400 -- [-1990.043] (-1991.094) (-1998.440) (-2004.437) * (-1989.938) (-1989.841) [-1987.859] (-1991.854) -- 0:04:42
      107500 -- (-1983.783) [-1989.931] (-1993.429) (-1995.172) * (-1989.546) (-1991.011) [-1985.704] (-1994.224) -- 0:04:42
      107600 -- [-1983.789] (-1996.030) (-1996.775) (-1993.216) * (-1991.003) (-1986.488) [-1990.200] (-1992.359) -- 0:04:41
      107700 -- [-1982.644] (-1993.928) (-1989.865) (-1993.386) * [-1987.092] (-1986.372) (-1988.132) (-1996.612) -- 0:04:41
      107800 -- [-1980.765] (-2002.802) (-1985.028) (-1987.689) * (-1990.752) [-1988.942] (-1988.311) (-1995.043) -- 0:04:41
      107900 -- (-1985.018) (-1999.777) [-1983.809] (-1988.724) * (-1990.828) (-1989.637) (-1995.621) [-1988.390] -- 0:04:49
      108000 -- [-1981.906] (-1996.789) (-1988.677) (-1994.045) * [-1991.168] (-1987.204) (-1993.874) (-1990.611) -- 0:04:49

      Average standard deviation of split frequencies: 0.010836

      108100 -- [-1980.278] (-1994.651) (-1987.874) (-1996.844) * [-1985.233] (-1988.425) (-1994.078) (-1991.137) -- 0:04:48
      108200 -- [-1985.601] (-1997.393) (-1989.621) (-1993.786) * [-1986.366] (-2001.288) (-1997.180) (-1992.213) -- 0:04:48
      108300 -- [-1981.158] (-1997.363) (-1991.846) (-1990.701) * (-1992.495) (-2009.407) [-1995.765] (-1992.804) -- 0:04:48
      108400 -- [-1982.557] (-1994.559) (-1991.897) (-1993.049) * [-1985.913] (-2001.688) (-1995.367) (-1996.108) -- 0:04:47
      108500 -- (-1985.114) [-1990.018] (-1991.142) (-1991.333) * [-1984.788] (-1994.745) (-1994.402) (-1997.095) -- 0:04:47
      108600 -- [-1984.715] (-1988.179) (-1992.154) (-1989.292) * [-1987.440] (-1993.910) (-2000.986) (-1991.769) -- 0:04:47
      108700 -- (-1988.883) (-1993.265) [-1985.713] (-1999.486) * (-1993.614) (-1993.909) (-1991.403) [-1983.663] -- 0:04:46
      108800 -- [-1989.747] (-2001.339) (-1991.329) (-1995.125) * (-2000.938) (-1991.354) (-1992.840) [-1984.277] -- 0:04:46
      108900 -- (-1987.937) (-2015.353) (-1993.941) [-1989.299] * (-2003.934) [-1991.816] (-1996.947) (-1989.487) -- 0:04:46
      109000 -- (-1985.373) (-2012.716) [-1986.152] (-1993.510) * (-1994.583) (-1997.887) (-1999.917) [-1989.892] -- 0:04:46

      Average standard deviation of split frequencies: 0.010854

      109100 -- [-1983.077] (-2007.862) (-1987.269) (-1991.625) * (-1992.012) (-1999.423) [-2003.340] (-1990.463) -- 0:04:45
      109200 -- [-1981.891] (-2004.775) (-1993.000) (-1992.505) * (-2001.478) (-1999.590) (-2003.847) [-1991.156] -- 0:04:45
      109300 -- (-1983.898) (-1999.526) (-2000.733) [-1991.101] * (-1997.631) [-1992.181] (-1996.338) (-1995.211) -- 0:04:45
      109400 -- [-1982.255] (-2002.058) (-1990.903) (-1985.971) * (-1997.551) (-2011.371) (-1998.072) [-1991.511] -- 0:04:44
      109500 -- (-1983.015) (-1999.282) (-1994.335) [-1986.238] * [-1986.181] (-1998.892) (-1996.834) (-1989.951) -- 0:04:44
      109600 -- [-1985.928] (-2000.293) (-2002.621) (-1994.625) * (-1988.194) (-1990.400) (-1997.716) [-1985.455] -- 0:04:44
      109700 -- [-1987.505] (-1993.043) (-1995.007) (-1993.145) * (-1986.426) [-1986.954] (-2000.899) (-1990.698) -- 0:04:44
      109800 -- (-1987.273) [-1986.085] (-1997.330) (-1994.260) * [-1984.885] (-1989.589) (-2010.555) (-1999.794) -- 0:04:43
      109900 -- (-1989.212) (-1988.668) [-1991.107] (-2000.888) * [-1983.911] (-1995.836) (-1996.940) (-1996.748) -- 0:04:43
      110000 -- (-1987.754) (-1987.812) [-1988.347] (-2002.722) * [-1984.784] (-2000.722) (-1995.746) (-1995.896) -- 0:04:43

      Average standard deviation of split frequencies: 0.010517

      110100 -- (-1992.909) (-1992.023) (-1991.911) [-1991.325] * [-1993.242] (-1996.655) (-1999.744) (-2002.858) -- 0:04:42
      110200 -- (-1994.259) [-1995.410] (-2001.438) (-1993.896) * (-1994.085) [-1998.624] (-1989.660) (-1993.726) -- 0:04:42
      110300 -- (-1992.058) (-2007.641) [-1990.305] (-1992.386) * (-1996.974) (-1997.532) [-1992.489] (-1994.551) -- 0:04:42
      110400 -- (-1987.980) (-1999.332) (-1984.066) [-1986.099] * (-1995.707) (-2012.132) [-1992.423] (-1991.010) -- 0:04:42
      110500 -- (-1981.675) (-1996.526) (-1987.998) [-1987.841] * [-1989.735] (-2005.068) (-1992.389) (-1991.142) -- 0:04:41
      110600 -- (-1979.820) (-2010.572) [-1985.868] (-1995.332) * (-1989.289) (-1994.317) (-1992.045) [-1986.886] -- 0:04:41
      110700 -- [-1978.062] (-1999.715) (-1987.913) (-1993.526) * (-1997.045) (-2004.208) [-1998.132] (-1986.353) -- 0:04:41
      110800 -- [-1979.934] (-1998.807) (-1987.288) (-1991.343) * [-1991.693] (-1989.801) (-1997.849) (-1997.221) -- 0:04:40
      110900 -- [-1983.195] (-1996.936) (-1983.516) (-1995.493) * [-1990.174] (-1985.165) (-2004.433) (-2005.341) -- 0:04:40
      111000 -- (-1987.769) (-1993.330) [-1984.438] (-1996.938) * [-1988.208] (-1989.941) (-2006.475) (-1995.767) -- 0:04:48

      Average standard deviation of split frequencies: 0.010538

      111100 -- (-1986.934) (-1998.741) [-1982.231] (-1999.783) * [-1992.818] (-1990.641) (-1998.422) (-1990.907) -- 0:04:48
      111200 -- (-1991.832) (-1992.432) [-1981.332] (-2003.047) * (-1996.925) (-1991.558) (-2001.547) [-1997.647] -- 0:04:47
      111300 -- (-1987.335) [-1994.110] (-1980.575) (-1993.600) * [-1992.333] (-1990.869) (-1998.705) (-2001.548) -- 0:04:47
      111400 -- (-1995.989) (-1996.746) [-1983.948] (-1990.879) * (-1995.279) (-1996.151) [-1997.542] (-1997.342) -- 0:04:47
      111500 -- (-1994.584) (-1993.564) [-1985.434] (-1989.369) * (-2002.619) (-1993.593) (-1999.658) [-1990.183] -- 0:04:46
      111600 -- (-1998.714) (-1990.186) [-1990.478] (-1995.051) * (-1994.109) (-1990.791) (-1996.388) [-1990.058] -- 0:04:46
      111700 -- (-1996.589) [-1989.557] (-1982.645) (-1998.445) * [-1992.927] (-1986.080) (-1998.905) (-1988.943) -- 0:04:46
      111800 -- (-1998.665) [-1985.324] (-1983.285) (-1995.722) * (-1995.521) [-1987.901] (-2000.866) (-1995.957) -- 0:04:46
      111900 -- (-2003.167) [-1983.042] (-1981.811) (-1992.451) * (-1993.479) [-1991.182] (-2003.129) (-1996.995) -- 0:04:45
      112000 -- (-1992.498) (-1982.696) [-1979.625] (-1999.871) * (-1995.766) [-1991.966] (-2000.903) (-1997.376) -- 0:04:45

      Average standard deviation of split frequencies: 0.009969

      112100 -- (-1986.417) (-1983.326) (-1978.687) [-1991.405] * (-1989.229) [-1990.127] (-1996.654) (-1995.713) -- 0:04:45
      112200 -- (-1985.714) (-1989.261) [-1984.434] (-1990.864) * (-1991.546) (-2004.091) [-1990.968] (-1987.444) -- 0:04:44
      112300 -- (-1983.503) (-1986.333) [-1982.440] (-1992.636) * (-1985.245) (-2006.948) [-1991.555] (-1994.330) -- 0:04:44
      112400 -- (-1983.916) (-1985.414) [-1984.028] (-1995.140) * (-1995.199) (-1998.993) [-1991.263] (-1992.287) -- 0:04:44
      112500 -- [-1984.187] (-1986.809) (-1991.622) (-1993.329) * (-1989.912) (-1998.057) [-1990.619] (-1996.237) -- 0:04:44
      112600 -- (-1990.539) [-1984.779] (-2009.661) (-1994.976) * [-1984.734] (-2001.770) (-1996.954) (-2000.364) -- 0:04:43
      112700 -- (-1986.884) [-1988.533] (-1996.212) (-1997.480) * [-1987.912] (-1999.047) (-1997.042) (-2005.114) -- 0:04:43
      112800 -- (-1986.185) [-1984.609] (-1997.484) (-1995.147) * (-1992.142) [-2003.157] (-1995.602) (-1999.552) -- 0:04:43
      112900 -- [-1989.726] (-1985.763) (-1998.498) (-1996.581) * (-1999.569) (-2013.022) [-1983.714] (-1993.182) -- 0:04:42
      113000 -- (-1988.858) [-1981.060] (-2008.195) (-1995.684) * (-2011.316) (-1998.539) (-1990.238) [-1994.108] -- 0:04:42

      Average standard deviation of split frequencies: 0.009519

      113100 -- [-1987.181] (-1982.199) (-1991.748) (-1994.083) * (-2003.496) (-1998.263) (-1989.399) [-1990.736] -- 0:04:42
      113200 -- [-1983.196] (-1981.061) (-1986.183) (-1999.321) * (-2005.742) (-1996.692) [-1987.723] (-1990.789) -- 0:04:42
      113300 -- (-1990.261) [-1981.064] (-1989.622) (-1992.876) * (-2000.883) (-2002.299) (-1994.302) [-1990.476] -- 0:04:41
      113400 -- (-1987.646) (-1986.993) (-1983.879) [-1992.104] * (-1993.100) (-2000.930) (-2004.985) [-1989.414] -- 0:04:41
      113500 -- (-1986.679) (-1983.123) [-1978.815] (-1995.766) * [-1996.796] (-2005.737) (-1996.481) (-1987.845) -- 0:04:41
      113600 -- (-1997.802) (-1984.504) [-1982.650] (-1994.565) * [-1995.524] (-2009.313) (-1998.240) (-1990.952) -- 0:04:40
      113700 -- (-1991.379) [-1985.285] (-1985.993) (-1988.562) * [-1990.179] (-2005.518) (-1994.037) (-1988.747) -- 0:04:40
      113800 -- (-1991.219) (-1995.498) (-1993.447) [-1988.699] * (-2007.199) (-2003.869) [-1991.037] (-1990.041) -- 0:04:40
      113900 -- (-1989.384) [-1990.782] (-1989.479) (-1984.299) * (-1995.089) (-1999.579) [-1989.470] (-1990.251) -- 0:04:40
      114000 -- (-1990.092) (-1997.157) (-1989.492) [-1991.093] * (-2008.043) (-1995.787) (-1989.399) [-1993.991] -- 0:04:39

      Average standard deviation of split frequencies: 0.009559

      114100 -- [-1994.739] (-1998.223) (-1980.795) (-1992.232) * [-1991.772] (-1991.660) (-1989.957) (-2001.185) -- 0:04:39
      114200 -- (-1993.551) (-2000.341) (-1982.194) [-1990.839] * (-1987.996) [-1988.356] (-1988.343) (-2004.725) -- 0:04:46
      114300 -- (-2004.042) (-1996.635) [-1981.773] (-1994.432) * [-1986.501] (-1994.990) (-1989.832) (-1998.988) -- 0:04:46
      114400 -- (-1998.216) (-1997.176) [-1977.044] (-1996.368) * [-1988.482] (-1987.775) (-1997.411) (-1992.283) -- 0:04:46
      114500 -- (-1995.598) (-1996.100) [-1977.002] (-1994.460) * (-1995.078) (-1989.124) (-1996.609) [-1992.891] -- 0:04:46
      114600 -- [-1985.675] (-1989.914) (-1983.533) (-1990.844) * (-1995.568) [-1986.590] (-1997.394) (-1987.205) -- 0:04:45
      114700 -- [-1986.060] (-1988.370) (-1983.711) (-1994.169) * (-2000.950) (-1988.864) (-1999.886) [-1984.728] -- 0:04:45
      114800 -- (-1985.931) (-1988.170) (-1988.124) [-1989.135] * (-2001.315) (-1990.527) (-2001.000) [-1986.295] -- 0:04:45
      114900 -- [-1984.900] (-1985.085) (-1982.763) (-1995.321) * [-1994.135] (-1997.000) (-2004.088) (-1986.489) -- 0:04:45
      115000 -- (-1989.466) [-1988.232] (-1987.610) (-1990.969) * (-1993.127) (-2003.929) (-2002.694) [-1987.324] -- 0:04:44

      Average standard deviation of split frequencies: 0.009353

      115100 -- (-1987.112) (-1994.477) [-1985.871] (-1989.611) * (-1993.053) (-2010.316) (-2003.948) [-1988.320] -- 0:04:44
      115200 -- (-2000.836) (-1999.170) [-1991.415] (-1987.076) * [-1991.181] (-2002.421) (-2008.795) (-1990.375) -- 0:04:44
      115300 -- (-1999.225) (-1994.883) (-1987.502) [-1986.624] * (-2000.010) (-1998.472) (-1995.136) [-1986.894] -- 0:04:43
      115400 -- (-1993.383) (-2007.237) [-1993.951] (-1983.314) * (-2000.745) (-2003.476) [-1987.531] (-1987.933) -- 0:04:43
      115500 -- (-1991.733) (-1993.496) (-1996.427) [-1985.603] * (-1991.785) (-2004.052) (-1990.635) [-1990.513] -- 0:04:43
      115600 -- [-1980.044] (-1994.172) (-1992.415) (-1991.227) * (-1995.165) (-2007.159) (-1993.947) [-1990.111] -- 0:04:43
      115700 -- [-1983.493] (-1995.327) (-1995.617) (-1992.564) * (-1998.275) (-1996.289) (-1998.165) [-1989.285] -- 0:04:42
      115800 -- [-1987.556] (-1994.330) (-1989.338) (-1996.790) * (-2003.541) [-1996.265] (-2000.382) (-1989.617) -- 0:04:42
      115900 -- [-1985.963] (-1994.857) (-2007.064) (-1997.125) * (-2001.547) (-1997.856) (-1995.921) [-1987.660] -- 0:04:42
      116000 -- (-1988.979) (-1996.009) (-1997.397) [-1987.885] * (-2000.848) (-2004.086) (-1992.014) [-1985.130] -- 0:04:41

      Average standard deviation of split frequencies: 0.009046

      116100 -- [-1986.005] (-1995.713) (-1994.270) (-1991.952) * (-2000.124) (-1993.579) [-1991.286] (-1987.385) -- 0:04:41
      116200 -- (-1992.582) [-1994.544] (-1991.479) (-2002.537) * [-2001.010] (-1994.532) (-1989.858) (-1986.675) -- 0:04:41
      116300 -- (-1989.027) (-1999.798) [-1988.238] (-1996.666) * (-1996.302) (-1991.594) (-1987.413) [-1981.760] -- 0:04:41
      116400 -- (-1988.784) (-2005.555) [-1985.690] (-2003.944) * (-1995.729) (-1997.322) (-1988.999) [-1985.529] -- 0:04:40
      116500 -- [-1983.499] (-1998.864) (-1993.203) (-2002.092) * (-1989.085) [-1999.040] (-1995.982) (-1983.986) -- 0:04:40
      116600 -- [-1983.930] (-1995.707) (-1984.726) (-2005.514) * [-1988.134] (-1992.034) (-1996.812) (-1984.968) -- 0:04:40
      116700 -- (-1982.933) (-1997.583) [-1982.779] (-1987.544) * (-2003.353) (-1985.117) (-1989.394) [-1982.042] -- 0:04:40
      116800 -- (-1984.836) (-2006.448) [-1988.359] (-1992.368) * (-1997.800) (-1989.180) [-1990.682] (-1987.228) -- 0:04:39
      116900 -- [-1986.261] (-1991.761) (-1987.611) (-1998.605) * (-1991.806) (-1987.610) (-1985.623) [-1984.477] -- 0:04:39
      117000 -- [-1983.882] (-1995.433) (-1983.096) (-1995.312) * (-1992.880) (-1990.070) (-1989.834) [-1980.553] -- 0:04:39

      Average standard deviation of split frequencies: 0.008849

      117100 -- [-1985.290] (-1995.864) (-1993.878) (-1989.202) * (-1990.518) (-1996.062) (-1992.413) [-1991.764] -- 0:04:38
      117200 -- (-1995.355) (-1993.391) (-1986.874) [-1985.677] * (-2001.091) (-1999.839) (-1987.681) [-1984.379] -- 0:04:38
      117300 -- [-1982.616] (-1989.474) (-1992.581) (-1987.561) * (-1991.020) (-2018.651) (-1994.624) [-1986.590] -- 0:04:45
      117400 -- [-1985.142] (-1991.180) (-1985.182) (-1987.864) * (-1986.835) (-2004.648) (-2000.602) [-1989.077] -- 0:04:45
      117500 -- (-1983.883) (-1986.842) [-1982.436] (-1990.838) * [-1986.456] (-1996.809) (-2002.438) (-1986.906) -- 0:04:45
      117600 -- (-1986.943) (-1984.906) [-1977.705] (-1994.291) * (-1987.506) (-1990.987) (-2019.005) [-1981.613] -- 0:04:45
      117700 -- (-1985.256) (-1986.861) [-1980.861] (-2006.505) * [-1990.476] (-1988.686) (-2001.881) (-1982.333) -- 0:04:44
      117800 -- (-1990.393) (-1986.834) [-1980.846] (-1997.455) * (-1991.204) (-1992.996) (-1994.798) [-1983.457] -- 0:04:44
      117900 -- (-1994.169) (-1979.181) [-1979.572] (-1990.798) * (-1989.731) (-1988.896) (-2014.141) [-1982.217] -- 0:04:44
      118000 -- (-1991.861) [-1988.084] (-1983.933) (-1996.023) * (-1986.489) (-1990.306) (-2005.524) [-1981.231] -- 0:04:44

      Average standard deviation of split frequencies: 0.009121

      118100 -- (-1996.628) (-1990.532) [-1987.871] (-1997.901) * (-1988.020) (-1996.370) (-2010.211) [-1980.485] -- 0:04:43
      118200 -- [-1986.723] (-1993.740) (-1992.805) (-2007.315) * [-1991.088] (-1997.832) (-2018.544) (-1992.952) -- 0:04:43
      118300 -- (-1988.542) [-1988.640] (-1992.738) (-2007.238) * [-1987.161] (-1987.156) (-2009.213) (-1995.320) -- 0:04:43
      118400 -- (-1997.066) (-1992.732) [-1991.605] (-2009.011) * [-1983.052] (-1996.398) (-2004.030) (-1993.593) -- 0:04:42
      118500 -- (-1991.012) [-1985.742] (-1991.122) (-2008.502) * [-1985.754] (-1996.021) (-2009.807) (-1989.021) -- 0:04:42
      118600 -- (-1998.841) [-1982.705] (-1997.339) (-1999.159) * [-1983.445] (-1997.228) (-1993.583) (-1985.591) -- 0:04:42
      118700 -- (-1996.533) [-1980.365] (-1994.008) (-1995.100) * (-1989.035) (-1996.669) (-1994.035) [-1981.643] -- 0:04:42
      118800 -- (-1989.414) (-1983.470) [-1987.328] (-1999.322) * (-1991.550) (-1999.038) (-1985.450) [-1982.459] -- 0:04:41
      118900 -- (-1986.669) [-1979.002] (-1992.431) (-1998.303) * (-1986.226) (-1997.763) [-1982.847] (-1985.401) -- 0:04:41
      119000 -- (-1991.838) [-1980.515] (-1989.899) (-1992.556) * (-1989.891) (-2011.445) (-1982.451) [-1985.397] -- 0:04:41

      Average standard deviation of split frequencies: 0.009378

      119100 -- (-1989.434) [-1981.955] (-1993.392) (-2010.023) * (-1992.004) (-2003.709) (-1985.049) [-1980.407] -- 0:04:41
      119200 -- (-1992.071) (-1981.643) (-1986.033) [-1997.264] * (-1998.475) [-1987.694] (-1998.479) (-1984.934) -- 0:04:40
      119300 -- (-1984.024) [-1990.208] (-1991.217) (-2004.916) * (-1999.716) (-1988.852) (-1999.103) [-1982.125] -- 0:04:40
      119400 -- [-1986.672] (-1987.289) (-1990.986) (-1995.140) * (-2001.378) [-1989.696] (-1993.185) (-1982.886) -- 0:04:40
      119500 -- [-1991.151] (-1995.858) (-1993.378) (-1998.598) * (-1995.496) (-1993.111) [-1990.988] (-1982.285) -- 0:04:39
      119600 -- (-1986.239) (-1986.431) [-1987.051] (-2000.525) * (-2004.836) (-1988.056) (-1988.173) [-1985.036] -- 0:04:39
      119700 -- [-1982.968] (-1987.338) (-1986.076) (-2004.990) * (-2001.566) (-1986.826) (-1994.367) [-1986.052] -- 0:04:39
      119800 -- [-1982.452] (-1989.640) (-1985.162) (-1999.508) * (-2005.121) [-1982.701] (-1990.886) (-1989.662) -- 0:04:39
      119900 -- [-1981.829] (-1991.485) (-1986.134) (-1999.425) * (-1990.160) [-1984.844] (-1992.620) (-1990.635) -- 0:04:38
      120000 -- (-1994.645) (-1996.894) [-1987.751] (-1989.765) * [-1989.327] (-1986.619) (-1991.752) (-2000.659) -- 0:04:38

      Average standard deviation of split frequencies: 0.009081

      120100 -- (-1998.688) (-1997.224) (-1993.664) [-1988.770] * (-1987.074) [-1981.415] (-1988.061) (-1996.219) -- 0:04:38
      120200 -- (-1987.618) [-1992.936] (-1988.805) (-1997.495) * (-1990.295) (-1986.375) [-1987.257] (-1998.100) -- 0:04:38
      120300 -- (-1990.831) [-1988.696] (-1982.723) (-1992.302) * (-1985.182) (-1986.630) [-1991.468] (-1994.238) -- 0:04:37
      120400 -- (-1994.987) (-1998.680) (-1986.276) [-1995.022] * [-1988.743] (-1990.176) (-1997.749) (-2002.095) -- 0:04:37
      120500 -- (-1995.507) (-1994.571) [-1982.478] (-2002.372) * [-1988.625] (-1997.536) (-1994.362) (-2009.216) -- 0:04:44
      120600 -- (-2003.999) (-1995.677) [-1976.156] (-2000.911) * [-1986.374] (-1994.908) (-1996.453) (-2000.638) -- 0:04:44
      120700 -- (-1995.710) (-1987.535) [-1982.923] (-1995.555) * [-1992.822] (-1999.078) (-1996.127) (-2003.293) -- 0:04:44
      120800 -- (-2004.567) [-1993.672] (-1982.883) (-2005.276) * (-1995.143) [-1991.972] (-2003.299) (-2002.210) -- 0:04:43
      120900 -- (-1992.702) (-1991.364) [-1980.782] (-2005.334) * [-1995.980] (-1996.656) (-2009.918) (-1991.433) -- 0:04:43
      121000 -- [-1982.296] (-2000.010) (-1983.503) (-1992.558) * (-1994.975) (-1987.211) (-1996.343) [-1985.552] -- 0:04:43

      Average standard deviation of split frequencies: 0.008446

      121100 -- [-1985.327] (-2001.064) (-1982.107) (-1986.764) * [-1995.400] (-1994.706) (-1997.225) (-1988.825) -- 0:04:43
      121200 -- (-1989.511) (-1997.185) [-1983.846] (-1992.214) * (-1990.393) (-1996.872) (-1993.521) [-1988.824] -- 0:04:42
      121300 -- (-1994.267) [-1989.316] (-1986.739) (-1990.209) * (-1989.583) (-2002.987) (-1994.464) [-1988.826] -- 0:04:42
      121400 -- (-1995.333) [-1984.732] (-1994.990) (-1997.704) * [-1987.481] (-2008.184) (-1992.806) (-1998.833) -- 0:04:42
      121500 -- (-1989.147) [-1982.665] (-1993.509) (-1996.180) * (-1993.173) (-2003.416) (-1994.018) [-1993.925] -- 0:04:41
      121600 -- (-1979.299) [-1982.034] (-1998.158) (-2003.236) * (-1992.549) [-1992.185] (-1994.143) (-1997.144) -- 0:04:41
      121700 -- [-1984.453] (-1986.386) (-1998.760) (-2000.839) * (-1993.043) [-1991.328] (-1991.309) (-1994.867) -- 0:04:41
      121800 -- [-1979.636] (-1986.107) (-2001.287) (-2004.501) * (-1993.865) (-1997.238) (-1991.848) [-1997.167] -- 0:04:41
      121900 -- [-1981.566] (-1987.869) (-2007.775) (-1999.169) * [-1992.076] (-1998.795) (-1992.075) (-2006.497) -- 0:04:40
      122000 -- [-1984.813] (-1984.168) (-2002.286) (-1988.134) * [-1992.202] (-2000.515) (-2000.281) (-1994.825) -- 0:04:40

      Average standard deviation of split frequencies: 0.007940

      122100 -- [-1986.567] (-1987.037) (-1994.008) (-1990.801) * (-1991.800) (-2001.769) (-1998.691) [-1991.157] -- 0:04:40
      122200 -- [-1985.947] (-1982.824) (-1990.863) (-1991.946) * [-1987.781] (-1994.280) (-1997.197) (-1986.999) -- 0:04:40
      122300 -- (-1991.500) (-1981.363) (-1985.815) [-1991.188] * [-1985.043] (-1985.986) (-1991.534) (-1991.336) -- 0:04:39
      122400 -- (-1987.411) [-1980.499] (-1990.232) (-1998.528) * (-1987.600) [-1988.235] (-1989.095) (-1995.590) -- 0:04:39
      122500 -- (-1987.039) (-1982.820) (-1987.903) [-1993.757] * (-1993.006) (-1987.353) [-1989.838] (-1998.608) -- 0:04:39
      122600 -- (-1991.755) (-1987.962) [-1987.332] (-2001.707) * (-1997.195) (-1991.585) [-1989.884] (-1989.281) -- 0:04:39
      122700 -- (-1986.550) (-1995.380) [-1984.899] (-1993.474) * (-1992.484) (-1996.817) (-1994.243) [-1994.191] -- 0:04:38
      122800 -- [-1988.320] (-1991.236) (-1986.935) (-2013.205) * (-1990.751) (-1998.679) (-1992.667) [-1994.674] -- 0:04:38
      122900 -- [-1984.457] (-1996.121) (-1987.760) (-2002.437) * (-1990.113) (-1991.202) [-1985.643] (-1993.909) -- 0:04:38
      123000 -- (-1982.887) (-1998.982) [-1988.207] (-2000.051) * (-1991.222) (-1987.370) [-1988.094] (-1992.581) -- 0:04:38

      Average standard deviation of split frequencies: 0.008309

      123100 -- [-1983.630] (-2000.768) (-1985.439) (-2001.999) * (-1997.536) (-1997.436) [-1990.457] (-1994.616) -- 0:04:37
      123200 -- [-1980.044] (-2005.241) (-1981.310) (-1999.563) * (-2003.341) (-1995.226) [-1986.890] (-1999.394) -- 0:04:37
      123300 -- (-1992.453) (-1996.794) [-1979.691] (-2002.360) * (-2001.251) [-1989.748] (-1987.642) (-1990.979) -- 0:04:37
      123400 -- [-1993.094] (-2004.905) (-1990.168) (-2002.081) * [-1998.801] (-1990.359) (-1985.853) (-1997.332) -- 0:04:37
      123500 -- [-1984.631] (-1998.630) (-1999.036) (-1993.492) * (-1997.546) [-1986.755] (-1985.660) (-1997.393) -- 0:04:36
      123600 -- [-1989.064] (-2001.743) (-1999.396) (-1994.271) * (-1993.035) [-1985.086] (-1988.557) (-1999.711) -- 0:04:43
      123700 -- (-1987.574) (-1995.965) (-2001.180) [-1992.084] * (-1990.091) [-1986.506] (-1994.610) (-2002.566) -- 0:04:43
      123800 -- [-1984.860] (-2000.079) (-1988.638) (-1996.445) * (-1986.980) (-1989.374) (-1991.965) [-1993.205] -- 0:04:43
      123900 -- [-1981.867] (-2001.513) (-1984.025) (-1992.836) * (-1988.706) (-1989.261) [-1985.158] (-1991.998) -- 0:04:42
      124000 -- [-1986.105] (-1997.819) (-1988.714) (-2000.018) * (-1991.016) [-1988.530] (-1990.328) (-1992.589) -- 0:04:42

      Average standard deviation of split frequencies: 0.008138

      124100 -- (-1993.089) (-1996.912) [-1987.142] (-2001.459) * [-1996.477] (-2001.787) (-1991.718) (-1990.148) -- 0:04:42
      124200 -- (-1991.793) (-1999.854) [-1985.561] (-1992.397) * (-1994.420) [-1997.185] (-1988.960) (-2002.861) -- 0:04:42
      124300 -- (-1985.246) (-2001.234) [-1980.461] (-1992.243) * [-1991.946] (-1997.025) (-1990.192) (-2006.297) -- 0:04:41
      124400 -- (-1982.983) (-1998.715) [-1980.920] (-1995.121) * (-1992.331) (-2000.209) [-1989.088] (-1998.497) -- 0:04:41
      124500 -- (-1984.867) (-2005.174) (-1982.671) [-1989.522] * [-1989.927] (-1996.724) (-1993.636) (-1994.957) -- 0:04:41
      124600 -- [-1989.908] (-2008.768) (-1991.234) (-1988.709) * [-1990.468] (-2002.374) (-1991.702) (-1997.673) -- 0:04:41
      124700 -- [-1982.115] (-2000.274) (-1983.680) (-1988.991) * (-1992.652) [-1992.526] (-1991.302) (-1998.433) -- 0:04:40
      124800 -- (-1988.575) (-1995.411) (-1989.709) [-1988.946] * (-1992.438) (-1994.207) [-1989.787] (-2007.741) -- 0:04:40
      124900 -- (-1988.686) (-1987.694) (-1984.317) [-1988.761] * (-1988.304) (-1991.260) [-1990.509] (-2009.673) -- 0:04:40
      125000 -- (-1984.833) (-1997.159) [-1989.793] (-1989.719) * [-1986.575] (-1992.672) (-1986.216) (-2005.276) -- 0:04:40

      Average standard deviation of split frequencies: 0.007746

      125100 -- (-1981.180) (-1996.025) [-1991.181] (-1994.702) * [-1991.533] (-1993.549) (-1994.759) (-2003.153) -- 0:04:39
      125200 -- (-1987.055) [-1990.611] (-1984.995) (-1994.930) * [-1995.165] (-1994.115) (-1995.141) (-1998.996) -- 0:04:39
      125300 -- (-1984.727) [-1983.735] (-1983.540) (-1989.703) * [-1990.434] (-2001.246) (-1989.886) (-2001.401) -- 0:04:39
      125400 -- (-1988.713) [-1979.770] (-1989.512) (-1994.465) * (-1999.137) (-1993.216) [-1991.386] (-1991.604) -- 0:04:38
      125500 -- (-1998.497) [-1981.987] (-1985.205) (-1989.117) * [-1985.450] (-1995.900) (-1993.628) (-1987.498) -- 0:04:38
      125600 -- (-1999.001) [-1983.686] (-1986.765) (-1987.256) * (-1996.492) (-1998.296) [-1991.067] (-1993.836) -- 0:04:38
      125700 -- (-1993.702) [-1984.025] (-1985.103) (-1992.316) * (-1988.198) (-1995.795) [-1989.502] (-1997.661) -- 0:04:38
      125800 -- (-1994.655) (-1982.984) [-1978.209] (-2006.876) * (-1986.754) (-2001.677) [-1991.205] (-2000.472) -- 0:04:37
      125900 -- (-1995.906) (-1983.628) [-1979.812] (-1999.352) * [-1986.534] (-1998.787) (-1998.115) (-1998.339) -- 0:04:37
      126000 -- (-2002.078) (-1989.496) [-1980.055] (-1987.578) * (-1991.789) [-1994.660] (-1997.953) (-1995.460) -- 0:04:37

      Average standard deviation of split frequencies: 0.007475

      126100 -- (-2012.444) (-1983.649) [-1982.282] (-1989.002) * (-1999.136) [-1990.995] (-1997.951) (-2003.716) -- 0:04:37
      126200 -- (-2019.366) (-1989.089) [-1986.693] (-1988.836) * [-1991.162] (-1987.419) (-1993.617) (-1999.256) -- 0:04:36
      126300 -- (-2014.966) (-1990.778) [-1987.919] (-2003.267) * (-1997.288) (-1984.898) [-1991.225] (-1995.066) -- 0:04:36
      126400 -- (-2014.990) (-1996.429) [-1982.090] (-2004.115) * (-1993.243) [-1987.822] (-1988.836) (-1998.170) -- 0:04:36
      126500 -- (-2004.685) (-1981.564) [-1983.559] (-2015.129) * (-1986.568) [-1987.813] (-1988.668) (-1998.037) -- 0:04:36
      126600 -- (-2005.013) (-1986.295) (-1987.262) [-1994.019] * [-1989.478] (-1989.591) (-2002.216) (-2003.002) -- 0:04:35
      126700 -- (-2001.706) (-1984.179) [-1983.138] (-1992.743) * [-1990.103] (-1994.808) (-1998.573) (-1993.362) -- 0:04:42
      126800 -- (-1997.311) (-1985.116) [-1980.375] (-1995.213) * (-1992.422) (-2001.376) (-1989.438) [-1987.826] -- 0:04:42
      126900 -- (-1989.057) (-1980.297) [-1980.360] (-1989.696) * (-1989.207) (-1994.519) (-1988.246) [-1990.976] -- 0:04:42
      127000 -- (-1988.173) (-1982.713) [-1984.023] (-1996.795) * [-1989.641] (-1991.189) (-1992.209) (-2000.139) -- 0:04:41

      Average standard deviation of split frequencies: 0.007518

      127100 -- (-1992.094) [-1984.480] (-1990.378) (-2001.125) * (-1993.936) (-1987.570) [-1991.637] (-2001.549) -- 0:04:41
      127200 -- (-1995.259) (-1985.581) [-1982.653] (-1993.793) * (-1993.886) [-1995.757] (-1986.323) (-2000.108) -- 0:04:41
      127300 -- (-1981.239) (-1989.393) (-1989.981) [-1990.410] * (-1988.196) [-1989.769] (-1990.495) (-2001.593) -- 0:04:41
      127400 -- [-1987.050] (-1991.602) (-1995.737) (-1992.036) * (-1989.982) (-2002.920) [-1986.789] (-1991.704) -- 0:04:40
      127500 -- (-1989.525) [-1991.122] (-1991.406) (-1992.920) * (-1988.508) (-2001.256) [-1983.737] (-1995.842) -- 0:04:40
      127600 -- (-1991.616) (-1998.025) (-1989.807) [-1987.039] * [-1991.732] (-2002.909) (-1987.759) (-1994.365) -- 0:04:40
      127700 -- (-1997.369) (-1995.785) [-1987.190] (-1988.375) * (-1987.773) (-2002.414) [-1984.385] (-1990.505) -- 0:04:40
      127800 -- (-2013.780) (-1994.151) [-1986.019] (-1988.770) * (-1988.834) (-1999.129) [-1985.703] (-1992.744) -- 0:04:39
      127900 -- (-2015.688) (-1989.840) (-1993.700) [-1988.509] * [-1991.946] (-1997.310) (-1993.081) (-1994.253) -- 0:04:39
      128000 -- (-2022.910) (-1988.182) [-1992.056] (-1993.807) * (-1991.480) [-1995.524] (-1992.332) (-1996.792) -- 0:04:39

      Average standard deviation of split frequencies: 0.007253

      128100 -- (-2015.818) (-1990.753) (-1995.628) [-1990.653] * (-1988.176) (-1993.879) [-1991.566] (-2002.021) -- 0:04:39
      128200 -- (-1996.351) [-1983.577] (-1996.931) (-1997.870) * [-1986.717] (-1987.468) (-2000.082) (-2005.788) -- 0:04:38
      128300 -- (-1992.235) (-1985.685) [-1995.252] (-2001.220) * (-1985.700) [-1985.209] (-1985.046) (-1989.435) -- 0:04:38
      128400 -- (-1989.353) [-1984.343] (-1989.842) (-2004.811) * (-1996.715) (-1991.606) (-1987.276) [-1992.229] -- 0:04:38
      128500 -- (-1997.795) [-1982.657] (-1991.328) (-1996.304) * (-1996.008) [-1991.350] (-1990.176) (-1997.341) -- 0:04:38
      128600 -- (-1996.219) [-1984.388] (-1987.221) (-1991.071) * (-1998.403) (-1989.365) [-1991.276] (-1993.260) -- 0:04:37
      128700 -- [-1989.336] (-1985.880) (-1988.425) (-1990.295) * (-1990.735) (-1992.334) [-1985.226] (-1996.087) -- 0:04:37
      128800 -- (-1987.580) [-1990.975] (-1996.181) (-1993.850) * (-1991.662) (-1989.744) [-1983.913] (-1995.744) -- 0:04:37
      128900 -- (-1983.634) [-1987.956] (-1995.897) (-1994.302) * (-1989.182) (-1995.101) (-1985.944) [-1991.626] -- 0:04:37
      129000 -- [-1985.406] (-1983.881) (-2011.839) (-1991.572) * (-1987.118) (-2005.694) [-1984.577] (-1986.285) -- 0:04:36

      Average standard deviation of split frequencies: 0.007193

      129100 -- (-1985.259) (-1984.746) (-1997.266) [-1987.710] * (-1988.218) (-1992.930) [-1987.743] (-1988.394) -- 0:04:36
      129200 -- (-1990.072) [-1989.621] (-2006.031) (-1989.558) * (-2003.884) (-1998.715) (-1986.609) [-1985.521] -- 0:04:36
      129300 -- [-1988.821] (-1983.304) (-2011.385) (-1988.832) * (-1998.637) (-1987.956) [-1991.346] (-1985.961) -- 0:04:36
      129400 -- (-1993.431) [-1986.500] (-2017.096) (-1989.224) * (-1995.590) (-1994.464) (-1998.511) [-1990.272] -- 0:04:35
      129500 -- (-1990.476) [-1980.846] (-2009.109) (-1987.808) * (-1995.174) (-1990.852) (-2000.615) [-1991.724] -- 0:04:35
      129600 -- (-1991.375) [-1980.789] (-2005.910) (-1991.703) * (-2000.362) [-1990.905] (-1994.705) (-1985.284) -- 0:04:35
      129700 -- [-1987.914] (-1990.000) (-2002.601) (-1985.941) * (-1995.975) [-1985.537] (-1997.663) (-1988.049) -- 0:04:35
      129800 -- (-1985.525) [-1982.115] (-1998.147) (-1985.769) * (-1990.458) (-1988.365) (-1996.992) [-1985.994] -- 0:04:41
      129900 -- (-1984.446) [-1986.446] (-1999.966) (-1989.256) * (-1989.537) [-1989.380] (-1997.440) (-1988.499) -- 0:04:41
      130000 -- (-1988.904) (-1990.399) (-1998.013) [-1983.062] * (-1987.464) (-1992.605) (-2002.588) [-1991.578] -- 0:04:41

      Average standard deviation of split frequencies: 0.007348

      130100 -- (-1993.493) (-1994.879) (-1997.746) [-1989.443] * [-1989.692] (-1994.907) (-1997.754) (-1998.320) -- 0:04:40
      130200 -- (-1999.103) [-1988.230] (-2008.058) (-1983.668) * (-1986.899) (-1994.763) [-1989.163] (-1998.614) -- 0:04:40
      130300 -- (-1998.020) [-1982.209] (-2001.071) (-1984.087) * (-1990.617) [-1992.445] (-1987.831) (-1990.989) -- 0:04:40
      130400 -- (-2000.817) [-1983.406] (-2001.999) (-1995.588) * (-1994.527) (-1991.389) [-1990.360] (-1995.627) -- 0:04:40
      130500 -- (-2001.482) [-1980.613] (-2005.125) (-1994.407) * (-1991.730) (-1995.636) [-1989.534] (-2005.779) -- 0:04:39
      130600 -- (-1998.809) [-1983.381] (-1995.902) (-1993.233) * (-1987.531) [-1986.891] (-1990.724) (-1999.681) -- 0:04:39
      130700 -- (-2007.804) [-1979.749] (-1993.339) (-1990.999) * (-1990.990) [-1987.621] (-2002.972) (-2004.328) -- 0:04:39
      130800 -- (-1998.854) [-1985.851] (-1986.066) (-1994.021) * [-1991.326] (-1992.591) (-1998.604) (-1998.145) -- 0:04:39
      130900 -- (-2009.287) (-1987.249) [-1985.336] (-2008.875) * [-1993.356] (-1991.884) (-2000.087) (-1995.634) -- 0:04:38
      131000 -- (-1995.435) [-1984.386] (-1989.776) (-2002.518) * (-1991.739) (-1990.482) (-1997.714) [-1992.036] -- 0:04:38

      Average standard deviation of split frequencies: 0.006673

      131100 -- (-1996.811) (-1985.320) [-1987.903] (-1992.942) * (-1990.187) (-1992.211) (-1996.847) [-1993.214] -- 0:04:38
      131200 -- (-1996.517) [-1982.214] (-1987.935) (-1997.196) * [-1990.002] (-1996.317) (-1992.181) (-2001.715) -- 0:04:38
      131300 -- (-1991.269) [-1985.478] (-1986.812) (-1989.337) * (-1985.747) [-1990.571] (-1994.379) (-1997.066) -- 0:04:37
      131400 -- (-1985.495) [-1981.397] (-1988.550) (-1989.807) * [-1984.505] (-2000.239) (-1990.800) (-1996.876) -- 0:04:37
      131500 -- (-1989.557) [-1983.701] (-1996.672) (-1998.899) * (-1987.543) [-2002.644] (-1989.546) (-1998.698) -- 0:04:37
      131600 -- (-1993.509) [-1982.097] (-1993.490) (-1992.423) * [-1984.733] (-1996.764) (-1987.343) (-1992.742) -- 0:04:37
      131700 -- (-1989.686) [-1986.198] (-1994.704) (-1987.615) * (-1987.877) (-1994.939) [-1985.968] (-1993.158) -- 0:04:36
      131800 -- (-1988.023) [-1983.023] (-2001.258) (-1989.348) * [-1989.325] (-1999.782) (-1997.052) (-1989.933) -- 0:04:36
      131900 -- (-1993.945) (-1988.324) (-1997.168) [-1982.193] * (-1984.919) (-1993.462) (-2001.947) [-1988.379] -- 0:04:36
      132000 -- (-1990.313) (-1986.269) (-2001.374) [-1983.716] * (-1986.102) [-1991.752] (-2001.600) (-1984.088) -- 0:04:36

      Average standard deviation of split frequencies: 0.006626

      132100 -- (-1990.977) [-1987.190] (-2004.097) (-1992.037) * (-1984.496) (-1995.150) (-1996.403) [-1980.939] -- 0:04:35
      132200 -- [-1991.858] (-1990.710) (-1996.292) (-1986.526) * (-1985.421) (-1993.133) (-2006.155) [-1984.105] -- 0:04:35
      132300 -- (-1992.789) (-1992.180) [-1994.936] (-1989.970) * [-1983.935] (-1991.887) (-1998.886) (-1988.335) -- 0:04:35
      132400 -- [-1989.503] (-1993.237) (-1998.988) (-1997.604) * [-1985.000] (-1993.924) (-1994.819) (-1989.140) -- 0:04:35
      132500 -- [-1989.868] (-1996.293) (-1989.937) (-1997.454) * [-1986.926] (-1993.347) (-1990.993) (-1991.868) -- 0:04:34
      132600 -- (-1991.393) (-1998.458) (-1992.539) [-1987.022] * [-1990.359] (-1991.257) (-1984.882) (-1993.508) -- 0:04:34
      132700 -- (-1990.347) (-1998.080) (-1993.714) [-1986.244] * (-1997.485) (-1997.718) [-1983.940] (-1985.955) -- 0:04:34
      132800 -- (-1990.619) (-2004.326) (-2004.474) [-1985.234] * (-2000.940) (-1996.808) (-1985.513) [-1986.566] -- 0:04:34
      132900 -- (-1989.965) (-2008.830) (-2002.020) [-1989.247] * (-1999.319) (-1994.791) [-1986.850] (-1990.224) -- 0:04:34
      133000 -- (-1994.323) (-1996.086) (-1996.907) [-1988.231] * (-1997.691) (-1992.590) [-1988.127] (-1994.745) -- 0:04:40

      Average standard deviation of split frequencies: 0.006067

      133100 -- (-1994.018) (-1991.272) (-1997.882) [-1983.856] * (-1995.662) (-1997.240) [-1991.516] (-2001.739) -- 0:04:40
      133200 -- (-1993.645) (-1995.262) (-1993.828) [-1984.445] * (-2000.531) (-1997.651) (-1987.234) [-1991.948] -- 0:04:39
      133300 -- (-1996.063) (-1990.851) (-1986.790) [-1984.851] * (-1998.518) (-1990.818) [-1991.489] (-1992.556) -- 0:04:39
      133400 -- (-1990.144) (-1994.879) [-1985.446] (-1991.847) * (-2007.624) [-1994.203] (-2000.406) (-1989.759) -- 0:04:39
      133500 -- (-1985.651) (-1995.532) (-1988.843) [-1987.174] * (-1996.445) (-1988.305) [-1997.022] (-1991.290) -- 0:04:39
      133600 -- [-1986.668] (-1990.762) (-1997.789) (-1988.870) * [-1992.227] (-1989.336) (-1997.103) (-1988.228) -- 0:04:38
      133700 -- (-1995.028) [-1981.941] (-2008.571) (-1982.924) * (-1998.387) [-1985.201] (-1998.266) (-1984.439) -- 0:04:38
      133800 -- (-1993.787) (-1987.865) (-2004.073) [-1985.132] * (-2000.650) [-1985.959] (-1992.646) (-1986.731) -- 0:04:38
      133900 -- (-1986.204) [-1986.040] (-1993.322) (-1985.088) * (-1990.884) [-1986.877] (-1988.909) (-1996.739) -- 0:04:38
      134000 -- (-1988.382) [-1980.132] (-1995.561) (-1990.813) * (-1989.436) (-1992.124) [-1989.480] (-1988.024) -- 0:04:37

      Average standard deviation of split frequencies: 0.006527

      134100 -- (-1996.230) [-1978.443] (-1998.439) (-1981.381) * (-1991.754) (-1986.907) [-1991.462] (-1994.546) -- 0:04:37
      134200 -- (-1988.330) [-1982.781] (-1999.726) (-1988.317) * (-1989.896) (-1989.494) (-1986.636) [-1990.721] -- 0:04:37
      134300 -- (-1993.736) [-1982.647] (-2000.845) (-1992.276) * (-1993.872) [-1987.291] (-1990.058) (-1994.335) -- 0:04:37
      134400 -- (-1997.119) (-1982.998) (-2003.865) [-1985.703] * (-1990.998) [-1986.294] (-1987.753) (-1989.996) -- 0:04:36
      134500 -- (-1997.753) [-1987.792] (-2002.812) (-1982.712) * (-1992.909) [-1987.665] (-1988.731) (-1996.353) -- 0:04:36
      134600 -- (-1994.791) (-1982.229) (-2000.372) [-1982.270] * [-1990.740] (-1988.152) (-1998.703) (-1993.438) -- 0:04:36
      134700 -- (-1996.285) (-1993.144) (-1996.958) [-1983.263] * (-1992.093) (-1993.401) [-1988.600] (-1989.873) -- 0:04:36
      134800 -- (-1998.968) (-1992.400) (-1991.174) [-1986.221] * (-1990.651) [-1986.302] (-1995.157) (-1998.400) -- 0:04:35
      134900 -- (-2003.735) (-1988.754) [-1991.786] (-1986.466) * (-1991.057) (-1992.670) (-1988.912) [-1987.916] -- 0:04:35
      135000 -- (-1993.563) (-1988.887) [-1986.908] (-1988.302) * (-1992.679) (-1996.034) [-1989.995] (-1990.159) -- 0:04:35

      Average standard deviation of split frequencies: 0.006475

      135100 -- (-1991.206) (-1988.721) (-1989.086) [-1984.693] * (-1986.411) (-1999.718) [-1989.699] (-1994.425) -- 0:04:35
      135200 -- [-1986.546] (-1991.594) (-1992.724) (-1986.163) * (-1990.485) (-1997.247) [-1991.576] (-1997.706) -- 0:04:35
      135300 -- [-1985.600] (-1990.584) (-1987.262) (-1985.994) * [-1991.202] (-1999.648) (-1990.249) (-2000.658) -- 0:04:34
      135400 -- (-1989.346) (-1990.349) (-1990.367) [-1984.491] * [-1995.125] (-1998.767) (-1993.349) (-1997.667) -- 0:04:34
      135500 -- (-1987.165) (-1993.485) (-1997.796) [-1978.273] * (-1992.365) (-1990.353) [-1991.909] (-2000.968) -- 0:04:34
      135600 -- (-1990.151) (-1994.305) (-1993.958) [-1979.979] * [-1983.702] (-1996.137) (-1985.411) (-1997.088) -- 0:04:34
      135700 -- (-2006.154) (-2002.919) (-1993.690) [-1979.125] * (-1988.542) (-2000.442) [-1984.918] (-1993.505) -- 0:04:33
      135800 -- (-1994.035) (-2009.521) (-1996.141) [-1979.917] * (-1995.792) (-1992.136) [-1985.163] (-1999.983) -- 0:04:33
      135900 -- (-1995.262) (-1997.626) (-1991.608) [-1981.386] * (-1989.755) (-1995.694) [-1987.018] (-1999.209) -- 0:04:33
      136000 -- [-1993.264] (-2001.168) (-1993.041) (-1985.808) * (-1995.521) (-1991.610) [-1991.662] (-1990.623) -- 0:04:33

      Average standard deviation of split frequencies: 0.007025

      136100 -- (-1995.198) (-1997.152) (-1991.155) [-1983.822] * (-1998.778) (-1991.997) (-1992.211) [-1994.159] -- 0:04:39
      136200 -- (-1987.963) (-2004.550) [-1991.414] (-1990.409) * (-2001.290) (-1996.066) (-1992.322) [-1990.005] -- 0:04:39
      136300 -- [-1988.699] (-1990.474) (-1986.250) (-1990.375) * [-1998.118] (-1993.645) (-1995.007) (-1993.785) -- 0:04:38
      136400 -- (-1991.599) (-1985.349) (-1986.297) [-1986.784] * (-1999.181) [-1989.031] (-1996.238) (-1992.883) -- 0:04:38
      136500 -- [-1988.905] (-1988.653) (-1985.172) (-1991.062) * (-1987.706) (-1990.999) (-1997.756) [-1997.599] -- 0:04:38
      136600 -- (-1988.004) (-1991.406) (-1981.579) [-1991.404] * [-1988.532] (-2008.624) (-1993.559) (-2002.768) -- 0:04:38
      136700 -- (-1993.821) (-1996.262) [-1990.272] (-1987.584) * [-1986.738] (-2006.595) (-1992.309) (-1994.954) -- 0:04:37
      136800 -- (-1989.324) (-1992.477) (-1986.812) [-1984.474] * [-1984.918] (-1998.647) (-1993.235) (-1991.009) -- 0:04:37
      136900 -- (-1986.484) (-1987.423) [-1988.696] (-1989.887) * (-1995.364) (-1996.594) (-1990.328) [-1986.508] -- 0:04:37
      137000 -- (-1989.692) [-1983.475] (-1991.991) (-1991.452) * (-1991.045) (-1998.185) (-1991.185) [-1988.951] -- 0:04:37

      Average standard deviation of split frequencies: 0.006577

      137100 -- [-1981.964] (-1986.272) (-1987.789) (-1995.242) * (-1992.296) (-1996.780) [-1990.282] (-1988.470) -- 0:04:36
      137200 -- (-1985.877) (-1987.082) (-1986.086) [-1991.544] * (-1997.770) (-1997.136) [-1990.992] (-1988.154) -- 0:04:36
      137300 -- (-1985.498) [-1980.571] (-1987.198) (-1996.615) * (-1998.202) (-1999.108) (-1997.140) [-1990.157] -- 0:04:36
      137400 -- (-1986.252) [-1983.780] (-1987.012) (-1998.910) * [-1992.590] (-1997.283) (-1996.357) (-1988.888) -- 0:04:36
      137500 -- (-1987.006) [-1981.724] (-1984.198) (-1995.461) * (-1991.225) (-1993.912) [-1988.902] (-1995.095) -- 0:04:36
      137600 -- (-1990.364) (-1984.198) [-1981.167] (-2000.611) * [-1992.178] (-1994.497) (-1988.247) (-1995.936) -- 0:04:35
      137700 -- (-1988.905) [-1988.856] (-1977.705) (-1991.748) * (-1992.122) (-1995.153) (-1989.268) [-1993.700] -- 0:04:35
      137800 -- (-1988.580) (-1983.964) [-1979.698] (-1994.961) * [-1986.956] (-1986.654) (-1992.271) (-1998.241) -- 0:04:35
      137900 -- (-1993.128) (-1986.832) [-1980.620] (-1996.609) * (-1989.781) (-1990.223) [-1988.701] (-1989.982) -- 0:04:35
      138000 -- (-1995.692) (-1992.374) [-1984.072] (-1991.553) * (-1990.190) (-1995.437) [-1983.903] (-1985.394) -- 0:04:34

      Average standard deviation of split frequencies: 0.005850

      138100 -- (-1988.687) (-1992.467) [-1983.099] (-1991.118) * (-1993.058) (-1998.258) (-1992.022) [-1993.685] -- 0:04:34
      138200 -- (-1989.677) (-1987.659) (-1992.006) [-1988.519] * (-1997.130) (-1990.456) [-1985.357] (-1988.837) -- 0:04:34
      138300 -- [-1984.550] (-1993.789) (-1988.351) (-1993.119) * (-1998.417) (-1996.033) [-1985.944] (-1989.324) -- 0:04:34
      138400 -- [-1983.110] (-1991.049) (-1992.322) (-1985.461) * (-1996.228) (-1997.338) [-1986.947] (-1991.798) -- 0:04:33
      138500 -- (-1984.873) (-2000.192) [-1989.058] (-1981.626) * (-1995.549) [-1993.061] (-1990.756) (-1991.269) -- 0:04:33
      138600 -- (-1990.944) [-1992.738] (-1999.972) (-1986.284) * (-1997.225) (-1990.883) (-1992.847) [-1989.645] -- 0:04:33
      138700 -- (-1998.250) (-1995.200) (-1994.898) [-1985.421] * (-2000.861) (-1991.134) (-1993.898) [-1986.286] -- 0:04:33
      138800 -- (-1994.963) (-1991.514) (-2004.604) [-1983.062] * (-2003.624) [-1991.146] (-1994.389) (-1989.640) -- 0:04:33
      138900 -- (-1993.004) (-1986.255) (-1998.571) [-1983.060] * (-2000.442) (-1995.117) (-1992.518) [-1992.354] -- 0:04:32
      139000 -- (-1991.105) (-1989.869) [-1988.653] (-1985.553) * (-1987.614) (-1997.451) (-1998.260) [-1987.550] -- 0:04:32

      Average standard deviation of split frequencies: 0.005805

      139100 -- (-1993.688) [-1979.081] (-1986.179) (-1994.779) * (-1986.331) (-1994.047) (-1998.757) [-1993.800] -- 0:04:32
      139200 -- (-1992.989) [-1985.926] (-1987.077) (-1991.892) * (-1989.586) (-1995.774) [-1993.646] (-1991.267) -- 0:04:32
      139300 -- (-2000.342) (-1993.262) [-1986.541] (-2002.267) * [-1996.152] (-1993.390) (-1992.888) (-1996.428) -- 0:04:38
      139400 -- (-1992.022) (-1992.109) [-1987.592] (-1988.611) * [-1989.223] (-1995.380) (-1994.029) (-1997.192) -- 0:04:37
      139500 -- (-1993.125) (-1995.921) (-1987.833) [-1983.446] * (-1988.637) (-1996.204) (-1992.304) [-1990.983] -- 0:04:37
      139600 -- (-1994.732) (-2001.916) (-1992.141) [-1981.649] * (-2002.094) [-1985.865] (-1985.606) (-1999.671) -- 0:04:37
      139700 -- (-2004.792) (-1998.598) (-1989.334) [-1988.317] * (-2001.567) (-1990.113) [-1984.855] (-1990.496) -- 0:04:37
      139800 -- (-2011.598) (-2002.982) (-1991.849) [-1986.067] * (-1993.010) (-1993.819) [-1986.785] (-1997.049) -- 0:04:36
      139900 -- (-2003.911) (-1999.226) (-1988.491) [-1988.656] * (-1999.281) [-1991.578] (-1987.431) (-2000.668) -- 0:04:36
      140000 -- (-2005.266) (-1999.370) (-1993.065) [-1985.802] * (-1992.185) (-1990.164) [-1989.131] (-2000.056) -- 0:04:36

      Average standard deviation of split frequencies: 0.006055

      140100 -- (-1988.827) (-1995.221) (-1985.024) [-1977.803] * (-1992.367) (-1997.851) (-1989.093) [-1992.452] -- 0:04:36
      140200 -- (-1986.406) (-1995.739) (-1978.522) [-1985.617] * [-1985.428] (-2002.422) (-1990.593) (-1989.510) -- 0:04:35
      140300 -- (-1989.080) (-1997.661) [-1982.275] (-1986.687) * [-1988.573] (-2007.683) (-1992.184) (-1992.462) -- 0:04:35
      140400 -- (-1990.342) (-1987.556) (-1988.918) [-1986.855] * [-1986.254] (-2002.262) (-1995.764) (-1993.463) -- 0:04:35
      140500 -- (-1996.664) (-1984.324) [-1987.314] (-1987.530) * (-1983.053) (-2001.234) (-1996.710) [-1985.915] -- 0:04:35
      140600 -- (-1990.968) [-1984.476] (-1990.069) (-1988.750) * (-1987.333) (-1993.179) (-2004.854) [-1986.612] -- 0:04:35
      140700 -- (-1991.751) (-1982.760) [-1983.078] (-1989.304) * (-1987.942) (-1997.168) (-2001.736) [-1986.448] -- 0:04:34
      140800 -- (-1991.206) [-1982.285] (-1987.701) (-1987.580) * (-1988.827) (-1999.783) (-1999.469) [-1984.976] -- 0:04:34
      140900 -- (-1993.171) (-1983.111) [-1986.219] (-1987.680) * (-1987.137) (-1996.633) (-2005.749) [-1990.879] -- 0:04:34
      141000 -- (-2002.663) [-1982.749] (-1983.632) (-1987.674) * [-1987.401] (-1985.874) (-2002.306) (-1988.922) -- 0:04:34

      Average standard deviation of split frequencies: 0.006200

      141100 -- (-1998.483) [-1983.678] (-1993.838) (-1986.142) * [-1988.651] (-1989.402) (-2008.493) (-1993.174) -- 0:04:33
      141200 -- (-1998.862) [-1978.664] (-1987.230) (-1990.861) * (-1992.964) [-1986.102] (-2011.274) (-1995.071) -- 0:04:33
      141300 -- (-1994.946) [-1978.426] (-1986.450) (-1990.614) * (-1986.474) [-1984.247] (-2010.945) (-1993.019) -- 0:04:33
      141400 -- (-1989.258) [-1981.704] (-1986.076) (-2002.946) * (-1998.948) (-1985.144) (-2008.596) [-1989.936] -- 0:04:33
      141500 -- (-1984.794) (-1980.327) [-1988.684] (-1992.483) * (-1993.871) [-1986.104] (-2011.218) (-1989.860) -- 0:04:33
      141600 -- (-1985.388) [-1981.850] (-2000.597) (-1990.575) * (-2003.540) [-1988.551] (-1999.981) (-1996.537) -- 0:04:32
      141700 -- (-1984.517) [-1979.737] (-1991.896) (-1996.201) * (-1995.248) [-1986.485] (-1994.926) (-1997.743) -- 0:04:32
      141800 -- (-1988.653) [-1982.572] (-1997.062) (-1996.915) * (-1998.207) (-1986.085) [-1988.568] (-1993.120) -- 0:04:32
      141900 -- (-1989.548) [-1981.922] (-1997.375) (-1997.517) * (-2004.524) [-1984.394] (-1988.885) (-1988.683) -- 0:04:32
      142000 -- (-1988.426) [-1983.116] (-2000.195) (-1992.154) * (-2000.729) (-1987.190) (-1986.971) [-1985.428] -- 0:04:31

      Average standard deviation of split frequencies: 0.007391

      142100 -- [-1989.552] (-1988.916) (-1996.920) (-1987.512) * (-1999.844) [-1988.336] (-1993.686) (-1986.755) -- 0:04:31
      142200 -- (-1991.126) [-1984.662] (-1995.853) (-1985.873) * (-2003.712) [-1983.327] (-1991.381) (-1990.236) -- 0:04:31
      142300 -- (-1990.462) (-1987.041) (-1994.695) [-1988.555] * (-1996.800) (-1988.639) (-2000.739) [-1992.408] -- 0:04:31
      142400 -- (-1993.121) (-1987.294) (-1996.644) [-1984.031] * (-1997.228) (-1991.764) (-1999.524) [-1991.370] -- 0:04:37
      142500 -- (-1988.699) [-1978.543] (-1990.045) (-1981.076) * (-2000.188) (-1988.742) (-1992.695) [-1987.563] -- 0:04:36
      142600 -- (-1985.829) (-1980.980) (-1994.039) [-1984.094] * (-2001.398) [-1989.253] (-2003.425) (-1987.411) -- 0:04:36
      142700 -- (-1986.192) (-1981.059) (-1984.200) [-1985.409] * (-1992.058) (-1985.194) (-1999.561) [-1988.070] -- 0:04:36
      142800 -- (-1984.878) [-1978.901] (-1992.340) (-1991.874) * (-1994.639) [-1989.415] (-2001.237) (-1994.760) -- 0:04:36
      142900 -- (-1992.287) [-1980.395] (-1989.465) (-1986.400) * (-1997.299) [-1986.242] (-1999.949) (-1990.211) -- 0:04:35
      143000 -- (-1993.849) [-1982.019] (-1989.171) (-1985.377) * (-2000.231) (-1988.295) (-2003.782) [-1988.228] -- 0:04:35

      Average standard deviation of split frequencies: 0.007618

      143100 -- (-1996.553) (-1986.124) (-1988.855) [-1979.616] * (-2002.540) (-1985.789) (-2000.737) [-1991.540] -- 0:04:35
      143200 -- (-1992.249) [-1981.512] (-1988.959) (-1984.626) * (-2002.746) (-1987.894) (-2014.459) [-1986.118] -- 0:04:35
      143300 -- (-1991.670) (-1982.085) (-1988.564) [-1983.668] * (-2010.191) [-1993.180] (-2007.144) (-1988.778) -- 0:04:35
      143400 -- (-1987.293) [-1991.037] (-1988.628) (-1985.824) * (-2000.688) [-1990.469] (-2001.085) (-1992.472) -- 0:04:34
      143500 -- (-1985.926) (-1989.376) [-1982.941] (-1988.881) * (-2002.470) (-1988.505) (-2008.709) [-1992.408] -- 0:04:34
      143600 -- [-1986.613] (-1986.163) (-1987.500) (-1986.056) * (-1998.203) [-1990.731] (-1996.770) (-1988.084) -- 0:04:34
      143700 -- (-1993.072) (-1986.578) [-1983.094] (-1991.066) * (-1997.660) [-1994.939] (-1999.694) (-1992.745) -- 0:04:34
      143800 -- (-1997.155) (-1992.399) [-1982.809] (-1996.226) * (-1994.484) [-1986.077] (-2000.777) (-1994.761) -- 0:04:33
      143900 -- (-1987.763) (-1990.955) [-1985.470] (-1992.930) * (-1990.088) (-1985.161) (-1991.115) [-1988.493] -- 0:04:33
      144000 -- (-2001.813) [-1987.897] (-1987.448) (-1992.353) * (-1988.413) [-1984.498] (-1995.655) (-1988.065) -- 0:04:33

      Average standard deviation of split frequencies: 0.007756

      144100 -- (-1998.224) [-1992.536] (-1994.721) (-2001.562) * [-1990.141] (-1988.933) (-1986.626) (-1986.755) -- 0:04:33
      144200 -- (-1997.339) (-2003.715) [-1998.734] (-2001.170) * (-1988.638) (-1990.554) (-1995.844) [-1987.866] -- 0:04:33
      144300 -- (-1997.018) (-2000.994) [-1991.342] (-2008.375) * (-1988.867) (-1995.229) (-2004.664) [-1985.147] -- 0:04:32
      144400 -- (-1990.141) (-2006.584) [-1986.740] (-2000.075) * (-1994.106) [-1988.632] (-2002.053) (-1986.532) -- 0:04:32
      144500 -- [-1982.913] (-2002.895) (-1988.196) (-1994.067) * (-1989.059) [-1993.315] (-2002.796) (-1987.771) -- 0:04:32
      144600 -- [-1986.963] (-1998.656) (-1986.535) (-1989.162) * (-1989.716) [-1982.163] (-2002.202) (-1987.534) -- 0:04:32
      144700 -- [-1984.207] (-1992.783) (-1989.468) (-1991.373) * (-1994.448) [-1978.699] (-2008.164) (-1995.862) -- 0:04:31
      144800 -- [-1995.407] (-1991.758) (-1985.753) (-1990.216) * (-1987.787) (-1990.163) (-2014.957) [-1992.774] -- 0:04:31
      144900 -- (-1985.919) (-1988.385) [-1983.561] (-1984.281) * [-1991.759] (-1988.387) (-2012.803) (-1994.188) -- 0:04:31
      145000 -- (-1988.891) [-1987.960] (-1992.686) (-1986.601) * (-1993.811) (-1984.661) (-2013.856) [-1994.858] -- 0:04:31

      Average standard deviation of split frequencies: 0.007050

      145100 -- (-1989.522) (-1990.117) (-1988.426) [-1986.609] * (-2002.939) [-1985.823] (-2007.103) (-2008.062) -- 0:04:31
      145200 -- [-1995.036] (-1985.372) (-1989.769) (-1983.293) * (-2002.492) [-1983.557] (-1997.401) (-2003.308) -- 0:04:30
      145300 -- (-1991.935) (-1989.230) (-1989.816) [-1981.293] * (-1995.134) [-1986.370] (-1994.748) (-1989.597) -- 0:04:30
      145400 -- (-1993.282) (-1994.105) (-1985.909) [-1984.356] * (-1995.828) (-1988.238) [-1987.962] (-1989.663) -- 0:04:30
      145500 -- (-1983.242) (-1990.945) (-1989.485) [-1981.729] * (-1997.072) (-1989.725) (-1993.066) [-1986.144] -- 0:04:36
      145600 -- (-1985.062) [-1988.571] (-1988.087) (-1981.814) * (-1995.530) (-1993.524) (-1994.874) [-1993.319] -- 0:04:35
      145700 -- (-1980.830) (-1991.048) (-1990.815) [-1980.379] * [-1989.598] (-1990.670) (-1991.234) (-1993.220) -- 0:04:35
      145800 -- (-1981.877) (-1996.585) (-1996.786) [-1978.120] * (-1998.005) (-1985.334) [-1987.891] (-1985.845) -- 0:04:35
      145900 -- (-1985.733) (-1998.780) (-1991.936) [-1978.951] * (-1994.452) (-1986.250) [-1987.737] (-1986.506) -- 0:04:35
      146000 -- [-1985.276] (-1995.481) (-1995.192) (-1980.110) * [-1999.067] (-1993.197) (-1989.173) (-1988.688) -- 0:04:34

      Average standard deviation of split frequencies: 0.006913

      146100 -- [-1986.564] (-1990.820) (-1994.106) (-1976.727) * (-2001.184) (-1988.201) (-1987.972) [-1983.265] -- 0:04:34
      146200 -- (-1994.074) (-2000.566) (-1992.779) [-1979.728] * (-2005.770) (-1997.365) (-1996.273) [-1983.631] -- 0:04:34
      146300 -- (-1986.458) (-1995.946) (-1996.647) [-1977.678] * (-1999.132) (-1992.073) (-1992.613) [-1983.466] -- 0:04:34
      146400 -- (-1987.993) [-1992.794] (-1999.056) (-1983.144) * (-2002.696) (-1996.267) (-2000.656) [-1986.897] -- 0:04:34
      146500 -- [-1985.205] (-1994.270) (-2001.067) (-1985.914) * [-1991.729] (-2000.212) (-1993.722) (-1985.590) -- 0:04:33
      146600 -- [-1989.855] (-1989.347) (-1995.947) (-1991.180) * (-1997.305) (-1990.592) (-1997.173) [-1989.051] -- 0:04:33
      146700 -- (-1987.329) [-1985.783] (-1994.512) (-1992.989) * (-1990.265) [-1988.217] (-1987.100) (-1992.480) -- 0:04:33
      146800 -- (-1986.288) [-1988.239] (-1995.827) (-1988.879) * (-1996.597) (-1989.089) (-1988.386) [-1989.037] -- 0:04:33
      146900 -- (-1987.636) [-1987.787] (-2003.675) (-1989.451) * (-1994.092) (-1993.617) (-1989.716) [-1990.177] -- 0:04:32
      147000 -- [-1988.659] (-1989.131) (-2003.026) (-1994.403) * (-1984.374) [-1983.712] (-1991.160) (-1992.535) -- 0:04:32

      Average standard deviation of split frequencies: 0.005764

      147100 -- [-1988.599] (-1992.543) (-2005.117) (-1998.379) * (-1990.628) [-1986.966] (-1996.272) (-1999.971) -- 0:04:32
      147200 -- [-1987.544] (-1990.378) (-2006.484) (-1992.630) * (-1991.290) [-1987.171] (-1993.741) (-1995.357) -- 0:04:32
      147300 -- (-1987.924) (-1993.135) (-1996.663) [-1984.666] * (-1987.345) [-1982.639] (-1998.102) (-1989.114) -- 0:04:32
      147400 -- (-1988.845) (-1986.319) (-1996.855) [-1987.498] * (-1996.012) [-1984.043] (-1996.950) (-1991.152) -- 0:04:31
      147500 -- (-1986.778) [-1983.838] (-1993.477) (-1981.399) * (-1992.992) [-1985.637] (-1999.691) (-1992.477) -- 0:04:31
      147600 -- (-1987.869) (-1989.211) (-2000.754) [-1979.767] * (-1988.511) [-1983.311] (-1994.905) (-1992.224) -- 0:04:31
      147700 -- (-1991.287) (-1995.151) (-1991.953) [-1993.355] * (-1988.649) [-1985.930] (-1993.094) (-1987.850) -- 0:04:31
      147800 -- (-1988.397) (-1989.585) (-1990.732) [-1986.547] * (-1987.351) (-1987.887) (-1990.489) [-1988.022] -- 0:04:30
      147900 -- (-1989.024) [-1990.545] (-1990.059) (-1993.330) * [-1983.753] (-1992.140) (-1991.686) (-1999.090) -- 0:04:30
      148000 -- (-1986.836) [-1989.625] (-1989.059) (-2002.639) * [-1987.154] (-1989.325) (-1992.209) (-2000.777) -- 0:04:30

      Average standard deviation of split frequencies: 0.005274

      148100 -- [-1990.925] (-1989.159) (-1995.551) (-1991.137) * [-1989.278] (-1989.849) (-1996.858) (-2001.767) -- 0:04:30
      148200 -- (-1991.075) (-1989.098) (-1996.633) [-1989.360] * (-1987.453) [-1985.515] (-1989.857) (-1999.342) -- 0:04:30
      148300 -- (-1990.002) [-1986.774] (-1996.376) (-1990.403) * (-1992.418) (-1981.316) [-1986.753] (-1999.028) -- 0:04:29
      148400 -- [-1979.299] (-1987.800) (-1994.367) (-1992.854) * (-1998.933) [-1986.841] (-1989.436) (-2001.429) -- 0:04:29
      148500 -- [-1983.312] (-1985.679) (-1989.175) (-1991.174) * [-1991.874] (-1986.700) (-1992.116) (-1997.424) -- 0:04:29
      148600 -- [-1989.214] (-1992.297) (-1989.012) (-1983.651) * (-2009.603) [-1980.039] (-1987.488) (-1994.381) -- 0:04:29
      148700 -- (-1986.577) (-1993.627) (-1988.268) [-1986.160] * (-2001.258) (-1984.545) [-1983.797] (-1987.583) -- 0:04:34
      148800 -- [-1984.222] (-1996.058) (-1995.833) (-1987.417) * (-1996.781) [-1987.360] (-1989.310) (-1984.452) -- 0:04:34
      148900 -- [-1979.159] (-1990.673) (-1991.966) (-1989.150) * (-2000.626) [-1984.245] (-1988.625) (-1986.224) -- 0:04:34
      149000 -- [-1979.977] (-1988.268) (-2003.365) (-1990.912) * (-1997.484) (-1982.817) [-1988.990] (-1989.759) -- 0:04:34

      Average standard deviation of split frequencies: 0.004694

      149100 -- [-1979.447] (-1988.148) (-2004.569) (-1983.796) * (-1990.909) (-1980.774) (-1991.426) [-1989.836] -- 0:04:33
      149200 -- [-1983.472] (-1990.113) (-2000.978) (-1989.323) * (-1991.178) [-1980.265] (-1990.086) (-1993.189) -- 0:04:33
      149300 -- (-1987.411) (-1988.719) (-1996.335) [-1987.171] * (-1994.541) (-1981.645) (-1993.726) [-1988.107] -- 0:04:33
      149400 -- [-1986.742] (-1987.679) (-2007.808) (-1991.886) * (-2001.740) [-1980.215] (-1994.056) (-1989.787) -- 0:04:33
      149500 -- (-1990.551) [-1992.622] (-2012.211) (-1993.416) * (-2001.555) [-1987.418] (-1992.540) (-1989.005) -- 0:04:33
      149600 -- (-1993.604) [-1985.734] (-2000.933) (-1988.573) * (-1995.510) [-1982.957] (-1988.595) (-1987.786) -- 0:04:32
      149700 -- (-1994.519) [-1988.805] (-1993.642) (-1989.711) * (-1993.444) [-1989.834] (-1986.460) (-1992.865) -- 0:04:32
      149800 -- (-1989.304) [-1989.490] (-1990.564) (-1985.643) * (-1994.156) [-1991.455] (-1984.313) (-1994.405) -- 0:04:32
      149900 -- (-1985.408) (-1984.421) [-1984.959] (-1982.912) * (-1991.122) (-1991.591) [-1986.763] (-1989.953) -- 0:04:32
      150000 -- [-1979.671] (-1985.180) (-1987.733) (-1992.980) * (-1996.248) [-1998.492] (-1996.447) (-1993.715) -- 0:04:32

      Average standard deviation of split frequencies: 0.004934

      150100 -- (-1987.209) [-1987.715] (-1987.133) (-1984.683) * (-1995.573) (-1996.073) [-1988.117] (-1990.303) -- 0:04:31
      150200 -- (-1993.137) [-1983.128] (-1989.930) (-1999.068) * (-1999.262) [-1986.711] (-1991.327) (-1992.202) -- 0:04:31
      150300 -- (-1987.976) [-1982.131] (-1996.146) (-1991.076) * (-1992.639) [-1982.025] (-1990.373) (-1996.643) -- 0:04:31
      150400 -- [-1990.008] (-1984.588) (-1989.043) (-1995.731) * (-1999.408) (-1981.874) (-1998.355) [-1992.418] -- 0:04:31
      150500 -- [-1987.423] (-1996.704) (-1990.692) (-1996.158) * (-1999.524) [-1984.710] (-2002.151) (-2002.762) -- 0:04:30
      150600 -- [-1986.650] (-1994.027) (-1993.128) (-1992.255) * (-1990.876) [-1982.359] (-1998.004) (-1991.985) -- 0:04:30
      150700 -- (-1984.947) [-1988.627] (-1993.684) (-1991.722) * (-1996.615) (-1986.371) (-1998.942) [-1987.865] -- 0:04:30
      150800 -- [-1984.325] (-1989.175) (-1994.222) (-1992.049) * (-1994.433) [-1979.337] (-1995.117) (-1988.331) -- 0:04:30
      150900 -- (-1986.442) [-1981.900] (-1993.100) (-1995.067) * (-2004.173) (-1975.408) (-1993.940) [-1989.717] -- 0:04:30
      151000 -- [-1980.813] (-1984.496) (-1999.838) (-1994.335) * (-2007.995) [-1976.332] (-1992.164) (-1991.994) -- 0:04:29

      Average standard deviation of split frequencies: 0.004543

      151100 -- [-1980.930] (-2000.686) (-1998.877) (-1988.744) * (-2002.100) [-1979.512] (-1995.476) (-1993.646) -- 0:04:29
      151200 -- (-1984.186) [-1988.712] (-1990.238) (-1987.570) * (-2003.230) [-1989.385] (-1995.417) (-1992.455) -- 0:04:29
      151300 -- (-1985.630) (-1997.444) (-1991.302) [-1985.916] * (-1995.821) (-1990.175) (-1990.552) [-1989.880] -- 0:04:29
      151400 -- (-1986.350) (-1990.485) [-1987.088] (-2000.899) * (-1991.860) (-1988.116) (-1998.498) [-1989.269] -- 0:04:29
      151500 -- [-1986.416] (-2000.737) (-1985.979) (-2003.044) * (-1994.824) [-1982.659] (-1992.620) (-1988.973) -- 0:04:28
      151600 -- [-1985.180] (-1992.999) (-1991.591) (-1998.038) * (-1990.744) [-1978.451] (-1999.349) (-1992.078) -- 0:04:28
      151700 -- [-1978.659] (-1993.103) (-1995.665) (-1987.972) * (-1990.614) [-1984.978] (-2000.109) (-1992.684) -- 0:04:28
      151800 -- [-1975.533] (-1992.893) (-1993.179) (-1981.622) * (-1988.873) [-1985.603] (-2005.970) (-1996.389) -- 0:04:33
      151900 -- [-1977.861] (-1995.855) (-1994.280) (-1980.938) * [-1982.691] (-1981.346) (-1996.434) (-1993.996) -- 0:04:33
      152000 -- [-1985.053] (-1994.660) (-2004.556) (-1987.884) * (-1988.653) [-1984.121] (-1994.045) (-1994.086) -- 0:04:33

      Average standard deviation of split frequencies: 0.005046

      152100 -- (-1982.568) (-1993.434) (-1998.121) [-1983.036] * [-1987.125] (-1982.851) (-1998.990) (-2000.459) -- 0:04:33
      152200 -- [-1985.314] (-1987.529) (-1995.623) (-1981.495) * [-1993.786] (-1984.022) (-2003.464) (-2002.583) -- 0:04:32
      152300 -- (-1984.540) (-1984.122) (-1995.211) [-1983.493] * (-1996.142) [-1981.842] (-1995.969) (-2002.121) -- 0:04:32
      152400 -- (-1982.997) (-1986.987) (-2000.410) [-1983.379] * (-1990.930) [-1979.753] (-1993.273) (-1999.248) -- 0:04:32
      152500 -- (-1981.776) (-1987.698) (-2001.033) [-1979.246] * [-1988.218] (-1989.882) (-1991.797) (-1997.919) -- 0:04:32
      152600 -- [-1983.361] (-1988.262) (-2009.236) (-1985.023) * (-1994.505) [-1990.726] (-1994.476) (-1992.467) -- 0:04:32
      152700 -- (-1985.718) (-1985.697) (-2004.847) [-1984.739] * (-1992.439) (-1994.329) (-1996.016) [-1987.448] -- 0:04:31
      152800 -- (-1990.637) [-1986.446] (-1994.705) (-1984.336) * (-1994.938) [-1992.904] (-2000.494) (-1993.268) -- 0:04:31
      152900 -- [-1991.618] (-1988.578) (-1995.429) (-1982.052) * (-1999.517) [-1990.999] (-2008.337) (-1993.376) -- 0:04:31
      153000 -- [-1984.827] (-1984.412) (-1997.158) (-1983.404) * (-1989.653) [-1982.589] (-2002.606) (-1995.711) -- 0:04:31

      Average standard deviation of split frequencies: 0.004660

      153100 -- [-1985.675] (-1985.881) (-1997.613) (-1992.557) * (-1991.690) [-1981.280] (-2000.862) (-1991.614) -- 0:04:31
      153200 -- (-1989.947) [-1985.395] (-1991.663) (-1992.515) * (-1995.084) [-1982.076] (-1994.123) (-1988.646) -- 0:04:30
      153300 -- (-1991.041) [-1985.592] (-1993.189) (-2002.304) * [-1992.871] (-1977.955) (-1997.965) (-1992.837) -- 0:04:30
      153400 -- (-1990.975) (-1984.277) (-1992.945) [-1994.263] * (-1995.533) [-1985.486] (-1989.659) (-1990.587) -- 0:04:30
      153500 -- (-1999.746) [-1985.138] (-1990.938) (-1999.720) * (-1992.586) [-1993.518] (-1999.782) (-1988.419) -- 0:04:30
      153600 -- (-1991.405) (-1988.287) [-1990.464] (-2002.055) * (-1992.900) [-1988.702] (-2012.484) (-1993.548) -- 0:04:30
      153700 -- (-1992.254) [-1987.973] (-1991.573) (-2003.780) * (-2005.836) [-1984.602] (-1992.863) (-1989.492) -- 0:04:29
      153800 -- (-2000.095) [-1985.575] (-1996.581) (-1994.577) * (-2004.816) (-1982.258) (-1994.246) [-1991.090] -- 0:04:29
      153900 -- (-2011.060) [-1984.495] (-2002.035) (-1990.825) * (-2000.863) [-1981.101] (-1995.208) (-1991.496) -- 0:04:29
      154000 -- (-1991.875) [-1985.782] (-1996.382) (-1997.627) * (-1996.249) (-1980.507) (-1997.425) [-1990.829] -- 0:04:29

      Average standard deviation of split frequencies: 0.005068

      154100 -- (-1994.605) (-1983.696) [-1989.917] (-1993.811) * (-1997.395) [-1987.203] (-2011.481) (-1990.316) -- 0:04:28
      154200 -- (-1986.766) (-1991.996) (-1987.035) [-1991.170] * (-2002.749) [-1982.859] (-2017.769) (-1995.957) -- 0:04:28
      154300 -- (-1997.227) [-1986.522] (-1988.305) (-1990.893) * (-1990.550) [-1983.525] (-2003.064) (-1995.169) -- 0:04:28
      154400 -- (-1987.198) [-1983.759] (-1999.104) (-1989.850) * (-1992.170) [-1982.834] (-2008.881) (-1983.477) -- 0:04:28
      154500 -- [-1988.388] (-1982.246) (-1998.456) (-1988.010) * (-1995.076) [-1977.888] (-2010.532) (-1986.196) -- 0:04:28
      154600 -- (-1981.854) [-1983.310] (-2005.104) (-1990.222) * [-1995.911] (-1979.159) (-2000.297) (-1988.694) -- 0:04:27
      154700 -- (-1984.975) [-1982.009] (-2008.266) (-1993.083) * (-1991.038) [-1979.816] (-1995.140) (-1987.324) -- 0:04:27
      154800 -- [-1981.983] (-1984.239) (-1993.615) (-2002.007) * (-2000.077) [-1983.007] (-1990.674) (-1987.214) -- 0:04:27
      154900 -- (-1981.720) [-1980.112] (-1996.596) (-1993.460) * (-1990.414) [-1983.017] (-1992.358) (-1992.876) -- 0:04:27
      155000 -- (-1984.791) [-1981.817] (-2001.340) (-1992.685) * (-1989.674) [-1977.856] (-1999.848) (-1991.924) -- 0:04:32

      Average standard deviation of split frequencies: 0.005033

      155100 -- (-1986.864) [-1983.756] (-2000.192) (-1994.391) * (-1990.905) (-1984.434) (-1998.081) [-1996.100] -- 0:04:32
      155200 -- [-1988.559] (-1987.505) (-2000.436) (-1994.559) * (-1993.137) [-1981.438] (-1994.756) (-1995.047) -- 0:04:32
      155300 -- (-1987.524) [-1987.488] (-2001.476) (-1996.519) * (-1989.406) [-1986.397] (-1991.613) (-1991.634) -- 0:04:31
      155400 -- [-1980.350] (-1986.152) (-1995.859) (-1991.784) * (-1999.944) (-1989.686) (-1991.124) [-1989.271] -- 0:04:31
      155500 -- (-1983.963) [-1982.359] (-1991.507) (-1997.970) * (-1987.047) [-1985.582] (-1989.475) (-1995.566) -- 0:04:31
      155600 -- [-1984.003] (-1979.337) (-1992.742) (-1993.733) * (-1991.676) [-1981.767] (-1996.655) (-1991.566) -- 0:04:31
      155700 -- (-1993.591) [-1983.571] (-1994.709) (-2001.726) * (-1998.153) [-1980.501] (-2019.787) (-1997.655) -- 0:04:31
      155800 -- [-1985.636] (-1984.785) (-1998.416) (-2006.473) * [-1985.314] (-1981.609) (-1996.001) (-1996.182) -- 0:04:30
      155900 -- [-1979.879] (-1985.300) (-1994.293) (-2000.272) * [-1984.568] (-1990.068) (-1996.868) (-2002.207) -- 0:04:30
      156000 -- (-1979.526) [-1985.707] (-2001.749) (-2003.651) * [-1987.014] (-1989.305) (-1992.929) (-2013.917) -- 0:04:30

      Average standard deviation of split frequencies: 0.005176

      156100 -- [-1984.087] (-1997.602) (-1993.757) (-1995.042) * (-1987.602) [-1986.185] (-1993.191) (-2017.288) -- 0:04:30
      156200 -- (-1983.821) (-1998.415) [-1994.348] (-1992.782) * [-1983.032] (-1987.696) (-1996.187) (-2012.062) -- 0:04:30
      156300 -- [-1986.695] (-1993.409) (-1994.002) (-1994.612) * [-1985.372] (-1984.541) (-1998.436) (-2004.337) -- 0:04:29
      156400 -- (-1992.654) [-1984.291] (-1990.320) (-1994.296) * (-1990.444) [-1990.621] (-1990.768) (-1996.315) -- 0:04:29
      156500 -- (-1995.952) (-1985.008) (-1996.360) [-1988.415] * (-1987.181) (-1994.442) [-1988.716] (-1994.399) -- 0:04:29
      156600 -- (-1994.676) [-1989.184] (-1997.751) (-1991.102) * (-1992.544) (-2004.483) (-1995.300) [-1993.821] -- 0:04:29
      156700 -- (-1990.895) (-1989.761) [-1993.563] (-1987.569) * [-1989.005] (-1987.737) (-2002.985) (-1995.435) -- 0:04:29
      156800 -- (-1997.456) (-1999.592) (-1993.270) [-1983.408] * [-1988.081] (-1987.364) (-1996.243) (-1996.441) -- 0:04:28
      156900 -- (-1995.665) (-1992.772) (-1990.837) [-1983.355] * (-1998.448) (-1989.131) (-1998.831) [-1990.224] -- 0:04:28
      157000 -- (-1997.047) (-1996.137) (-1989.199) [-1984.599] * (-2000.341) [-1989.915] (-1996.899) (-2012.369) -- 0:04:28

      Average standard deviation of split frequencies: 0.004969

      157100 -- (-1994.148) (-1999.186) (-1988.033) [-1988.518] * (-2001.772) [-1980.369] (-1992.171) (-1995.009) -- 0:04:28
      157200 -- (-1982.953) (-1985.685) (-1986.914) [-1984.240] * (-2002.373) (-1988.435) (-1994.072) [-1995.233] -- 0:04:28
      157300 -- (-1983.933) [-1986.398] (-1992.049) (-1985.832) * (-2000.610) [-1990.234] (-1989.912) (-1998.254) -- 0:04:27
      157400 -- (-1987.190) [-1980.523] (-1997.958) (-1989.987) * (-2002.167) (-1989.591) [-1992.659] (-1996.247) -- 0:04:27
      157500 -- (-1985.284) (-1986.097) (-1997.090) [-1986.064] * (-2000.737) [-1990.091] (-1997.010) (-2000.179) -- 0:04:27
      157600 -- (-1989.855) [-1982.261] (-1993.525) (-1984.708) * (-2007.018) [-1993.624] (-1992.828) (-1995.906) -- 0:04:27
      157700 -- (-1990.426) (-1990.787) (-1992.959) [-1982.015] * (-2012.732) (-1988.162) [-1988.136] (-2000.742) -- 0:04:27
      157800 -- (-1992.959) (-1987.889) (-1998.599) [-1983.864] * (-2005.095) [-1978.863] (-1995.560) (-2004.287) -- 0:04:26
      157900 -- [-1986.975] (-1986.634) (-2001.162) (-1994.086) * (-2002.966) [-1979.742] (-1991.968) (-1999.909) -- 0:04:26
      158000 -- (-1988.794) [-1983.330] (-1997.726) (-1990.104) * (-2000.779) [-1981.385] (-1986.176) (-1999.291) -- 0:04:26

      Average standard deviation of split frequencies: 0.005196

      158100 -- (-1990.323) [-1985.806] (-1998.126) (-1990.524) * (-1998.527) [-1988.148] (-1987.953) (-1996.550) -- 0:04:31
      158200 -- (-1995.295) [-1984.141] (-1995.079) (-1985.458) * (-1996.447) (-1985.747) [-1980.963] (-2001.364) -- 0:04:31
      158300 -- (-2000.514) (-1983.744) (-2000.974) [-1981.876] * (-1992.995) (-1984.247) [-1979.456] (-1993.520) -- 0:04:31
      158400 -- (-2001.985) (-1988.492) (-2002.488) [-1980.698] * (-1997.135) (-1987.334) [-1982.669] (-1990.056) -- 0:04:30
      158500 -- (-2000.870) [-1984.147] (-2001.914) (-1979.362) * (-2004.900) (-1980.599) [-1984.982] (-1988.743) -- 0:04:30
      158600 -- (-1997.870) (-1986.225) (-1996.517) [-1979.359] * (-1997.873) [-1981.006] (-1986.975) (-1981.021) -- 0:04:30
      158700 -- (-1993.392) (-1988.545) (-2000.992) [-1980.274] * (-1997.874) (-1992.229) (-1991.211) [-1991.959] -- 0:04:30
      158800 -- (-2000.737) (-1991.857) (-1993.620) [-1980.116] * (-1988.501) (-1982.471) [-1996.226] (-1995.515) -- 0:04:30
      158900 -- (-1998.948) (-1988.588) (-1989.744) [-1980.964] * (-1992.221) [-1982.900] (-1993.278) (-1994.076) -- 0:04:29
      159000 -- (-1993.215) (-1989.815) (-1993.700) [-1988.448] * (-1992.846) [-1985.389] (-1991.356) (-1996.601) -- 0:04:29

      Average standard deviation of split frequencies: 0.005668

      159100 -- (-1998.042) (-1987.742) (-1995.874) [-1984.326] * (-1988.271) [-1984.162] (-1994.770) (-1998.045) -- 0:04:29
      159200 -- (-1996.958) (-1990.527) (-2006.859) [-1979.637] * (-1987.265) (-1988.446) [-1987.762] (-2006.422) -- 0:04:29
      159300 -- (-2000.081) (-1990.342) (-2001.504) [-1977.681] * [-1990.968] (-1987.834) (-1999.083) (-1999.363) -- 0:04:29
      159400 -- (-2001.775) (-1991.855) (-1996.953) [-1980.239] * (-1997.949) [-1990.268] (-1999.719) (-1997.586) -- 0:04:28
      159500 -- (-1999.937) [-1993.151] (-2003.887) (-1990.933) * (-1994.469) (-1989.133) [-1986.498] (-1998.632) -- 0:04:28
      159600 -- (-1991.889) [-1990.343] (-2004.223) (-1987.040) * (-2003.874) (-1985.816) [-1985.709] (-2001.420) -- 0:04:28
      159700 -- (-1989.019) (-1991.244) (-2001.051) [-1990.035] * (-1991.119) [-1986.877] (-1983.730) (-1995.479) -- 0:04:28
      159800 -- (-1990.919) [-1984.540] (-2001.432) (-1987.032) * (-1995.847) [-1978.572] (-1984.682) (-1994.301) -- 0:04:28
      159900 -- (-1997.709) [-1985.901] (-2001.441) (-1988.128) * (-1994.315) [-1984.892] (-1983.099) (-1993.760) -- 0:04:27
      160000 -- (-1998.651) [-1983.089] (-1992.518) (-1992.635) * (-1988.675) (-1985.086) [-1984.394] (-1999.534) -- 0:04:27

      Average standard deviation of split frequencies: 0.005551

      160100 -- (-1993.368) (-1988.797) [-2000.403] (-2000.006) * (-1992.141) (-1985.300) [-1981.883] (-1995.855) -- 0:04:27
      160200 -- (-1996.429) [-1988.274] (-1991.517) (-1990.095) * (-1995.342) (-1985.960) [-1984.499] (-1991.601) -- 0:04:27
      160300 -- (-1991.471) (-1987.195) [-1990.818] (-1993.594) * (-2007.132) (-1981.475) [-1984.970] (-1987.223) -- 0:04:27
      160400 -- [-1988.050] (-1986.952) (-2000.536) (-1984.311) * (-2000.040) [-1989.361] (-1985.797) (-1991.525) -- 0:04:26
      160500 -- (-1993.318) (-1989.377) (-1999.933) [-1985.240] * (-2009.232) [-1988.323] (-1984.999) (-1995.950) -- 0:04:26
      160600 -- (-1990.876) (-1984.675) (-1991.289) [-1983.020] * (-1995.724) (-1988.152) [-1982.505] (-1991.243) -- 0:04:26
      160700 -- (-1995.703) [-1984.769] (-1990.077) (-1982.364) * (-2000.007) (-1983.987) [-1986.760] (-1995.374) -- 0:04:26
      160800 -- (-1993.121) [-1984.226] (-1989.909) (-1983.093) * (-1995.700) (-1982.486) [-1982.974] (-1993.986) -- 0:04:26
      160900 -- (-1993.281) (-1980.172) (-1988.658) [-1979.541] * (-1997.437) [-1982.732] (-1985.657) (-1996.485) -- 0:04:25
      161000 -- [-1991.309] (-1987.129) (-1986.621) (-1999.254) * [-1991.640] (-1985.813) (-1992.029) (-1999.727) -- 0:04:25

      Average standard deviation of split frequencies: 0.005514

      161100 -- (-1995.759) [-1997.535] (-1985.703) (-1998.098) * (-1998.459) [-1986.039] (-1986.158) (-1999.962) -- 0:04:25
      161200 -- (-1989.490) (-1996.762) [-1992.085] (-1984.798) * (-1999.054) [-1987.645] (-1991.202) (-2003.029) -- 0:04:25
      161300 -- (-1996.068) (-1991.725) (-1993.668) [-1991.727] * (-1995.748) [-1985.460] (-1990.909) (-2000.449) -- 0:04:30
      161400 -- (-1992.839) (-1994.528) (-1995.221) [-1980.042] * (-1990.436) [-1981.438] (-1983.355) (-2002.784) -- 0:04:30
      161500 -- (-1991.380) (-1986.005) (-1992.727) [-1978.672] * (-1995.453) (-1983.487) [-1982.444] (-2006.062) -- 0:04:29
      161600 -- (-2000.409) (-1987.892) (-1998.058) [-1979.494] * (-1995.077) [-1987.069] (-1980.118) (-1997.193) -- 0:04:29
      161700 -- (-1994.218) (-1983.407) (-2000.479) [-1980.248] * (-1995.290) (-1980.869) [-1982.477] (-1995.645) -- 0:04:29
      161800 -- (-1987.623) [-1984.426] (-1997.334) (-1979.491) * (-1991.815) [-1980.049] (-1984.437) (-1996.549) -- 0:04:29
      161900 -- (-1985.659) (-1982.604) (-1992.771) [-1984.402] * (-1995.091) [-1981.597] (-1984.436) (-2000.877) -- 0:04:29
      162000 -- [-1986.034] (-1984.749) (-1996.198) (-1985.902) * (-1988.972) (-1984.258) [-1989.141] (-1996.983) -- 0:04:28

      Average standard deviation of split frequencies: 0.005732

      162100 -- (-1988.551) [-1978.982] (-2007.869) (-1991.106) * (-1996.032) [-1981.721] (-1994.572) (-1998.539) -- 0:04:28
      162200 -- (-1992.796) [-1982.090] (-1997.044) (-1991.661) * (-1997.444) [-1985.603] (-1991.960) (-1997.122) -- 0:04:28
      162300 -- (-1994.580) [-1980.919] (-2006.276) (-1988.010) * (-1997.157) [-1985.868] (-1985.831) (-1999.456) -- 0:04:28
      162400 -- (-1993.276) [-1981.769] (-2013.213) (-1988.907) * (-1986.850) (-1984.092) (-1992.593) [-1993.542] -- 0:04:28
      162500 -- (-1990.153) [-1983.788] (-2010.995) (-1998.690) * [-1987.644] (-1986.383) (-1999.166) (-2002.616) -- 0:04:28
      162600 -- (-1996.903) (-1985.362) (-2008.830) [-1988.860] * [-1989.344] (-1985.892) (-1995.645) (-2001.811) -- 0:04:27
      162700 -- (-2000.464) [-1988.574] (-2006.569) (-1990.905) * (-1993.415) [-1983.192] (-1987.085) (-1995.893) -- 0:04:27
      162800 -- (-1998.358) [-1984.110] (-2012.238) (-1992.047) * (-1994.540) [-1983.875] (-1984.808) (-2005.519) -- 0:04:27
      162900 -- [-1992.313] (-1981.600) (-2019.264) (-1986.127) * (-1998.258) (-1982.251) [-1983.235] (-2006.133) -- 0:04:27
      163000 -- (-1995.971) [-1979.146] (-2011.513) (-1991.879) * (-1993.737) [-1981.484] (-1981.093) (-1998.415) -- 0:04:27

      Average standard deviation of split frequencies: 0.005447

      163100 -- (-1984.963) [-1978.102] (-2005.340) (-2001.078) * (-1994.488) (-1984.249) [-1983.468] (-1999.572) -- 0:04:26
      163200 -- (-1989.966) [-1977.637] (-2004.750) (-1994.415) * (-1992.195) (-1983.001) [-1983.270] (-1991.765) -- 0:04:26
      163300 -- (-1992.013) [-1975.534] (-2008.244) (-1985.483) * [-1985.475] (-1985.143) (-1988.280) (-1993.047) -- 0:04:26
      163400 -- (-1995.078) [-1977.346] (-2003.795) (-1985.290) * (-1986.203) [-1978.799] (-1987.073) (-1992.847) -- 0:04:26
      163500 -- (-1999.609) (-1987.353) (-2009.581) [-1983.916] * (-1987.091) [-1976.262] (-1997.840) (-1992.434) -- 0:04:26
      163600 -- (-1997.287) [-1985.342] (-1990.370) (-1981.987) * (-1988.144) (-1984.205) [-1985.169] (-1991.708) -- 0:04:25
      163700 -- (-1997.845) [-1985.812] (-1998.439) (-1978.411) * (-1993.092) (-1988.051) [-1984.961] (-1994.737) -- 0:04:25
      163800 -- (-1999.108) (-1982.274) (-1995.046) [-1978.699] * (-1990.985) (-1983.009) [-1983.054] (-1994.080) -- 0:04:25
      163900 -- (-2006.834) (-1984.475) (-1996.274) [-1981.116] * (-1991.178) [-1985.983] (-1992.547) (-1994.575) -- 0:04:25
      164000 -- (-2000.833) [-1983.440] (-1989.093) (-1985.310) * (-1993.063) (-1980.090) [-1989.976] (-1993.687) -- 0:04:25

      Average standard deviation of split frequencies: 0.005744

      164100 -- (-1994.041) [-1986.397] (-1994.276) (-1980.651) * (-1996.767) [-1980.879] (-1989.259) (-1994.347) -- 0:04:24
      164200 -- (-1996.195) (-1979.891) (-1997.103) [-1985.366] * (-1996.412) (-1983.627) [-1985.305] (-1989.877) -- 0:04:24
      164300 -- (-1996.150) [-1980.785] (-1993.509) (-1985.478) * (-1987.052) [-1985.953] (-1986.414) (-1993.182) -- 0:04:24
      164400 -- (-1997.071) (-1987.918) (-2000.943) [-1987.174] * (-1987.351) [-1983.875] (-1983.233) (-1993.263) -- 0:04:29
      164500 -- (-1992.731) (-1988.534) (-1997.122) [-1989.048] * (-1991.511) [-1987.476] (-1982.831) (-1995.091) -- 0:04:29
      164600 -- (-1995.819) (-1981.875) (-1992.065) [-1986.404] * (-1998.993) (-1995.297) [-1984.394] (-1985.645) -- 0:04:28
      164700 -- (-1990.998) [-1986.527] (-1991.898) (-1994.160) * (-1993.902) (-1998.615) [-1983.030] (-1992.505) -- 0:04:28
      164800 -- (-2004.578) (-1992.995) (-1993.040) [-1989.716] * (-1997.121) (-2000.895) [-1982.120] (-1996.914) -- 0:04:28
      164900 -- (-1998.137) (-1993.026) (-1990.310) [-1994.999] * (-1993.529) (-1999.415) [-1986.440] (-1993.089) -- 0:04:28
      165000 -- (-1991.689) (-1992.735) (-1994.698) [-1987.998] * (-1988.583) (-1995.019) [-1982.000] (-1998.723) -- 0:04:28

      Average standard deviation of split frequencies: 0.005626

      165100 -- [-1986.522] (-2001.137) (-1989.258) (-1993.094) * [-1984.588] (-1992.792) (-1979.616) (-1998.298) -- 0:04:28
      165200 -- [-1989.093] (-2001.637) (-1989.701) (-1998.557) * [-1982.971] (-1991.801) (-1979.265) (-1999.169) -- 0:04:27
      165300 -- (-1991.276) (-1995.660) (-1992.331) [-1989.457] * (-1989.037) [-1996.035] (-1986.594) (-2000.388) -- 0:04:27
      165400 -- (-1995.836) (-2000.652) (-1996.485) [-1990.875] * [-1986.925] (-1998.075) (-1984.882) (-2002.454) -- 0:04:27
      165500 -- (-1992.657) (-2015.973) (-2008.182) [-1988.152] * (-1991.494) (-1999.237) [-1981.368] (-1991.406) -- 0:04:27
      165600 -- [-1990.669] (-2005.274) (-2010.558) (-1994.542) * (-1990.886) (-1992.907) [-1982.976] (-1993.417) -- 0:04:27
      165700 -- [-1989.371] (-1991.026) (-2008.305) (-1994.310) * (-1993.250) (-1990.729) [-1985.563] (-1996.195) -- 0:04:26
      165800 -- [-1991.495] (-1986.838) (-2015.161) (-1987.182) * (-1999.805) (-1987.816) [-1987.941] (-2001.388) -- 0:04:26
      165900 -- [-1990.298] (-1988.689) (-2012.718) (-1991.131) * (-1994.335) (-1987.216) [-1987.928] (-1994.090) -- 0:04:26
      166000 -- (-1991.756) (-1993.785) (-2005.274) [-1987.820] * (-1986.002) [-1983.605] (-1983.584) (-2000.867) -- 0:04:26

      Average standard deviation of split frequencies: 0.005594

      166100 -- (-1993.740) [-1989.450] (-2001.259) (-1986.695) * [-1983.912] (-1984.126) (-1981.868) (-1996.856) -- 0:04:26
      166200 -- (-1992.177) (-1984.509) (-1994.238) [-1986.776] * [-1980.266] (-1979.747) (-1982.880) (-1997.609) -- 0:04:25
      166300 -- (-1993.523) (-1989.641) (-1998.834) [-1985.009] * [-1981.765] (-1987.017) (-1984.712) (-1995.122) -- 0:04:25
      166400 -- (-1995.706) [-1986.704] (-1992.539) (-1982.375) * (-1988.304) (-1984.974) [-1987.509] (-2002.419) -- 0:04:25
      166500 -- (-1998.898) (-1983.673) (-1988.443) [-1982.142] * (-1985.025) (-2002.287) [-1981.544] (-1995.950) -- 0:04:25
      166600 -- (-1999.163) (-1984.509) (-1989.639) [-1978.811] * (-1977.338) (-1991.677) [-1987.682] (-1992.423) -- 0:04:25
      166700 -- (-2003.643) (-1981.187) (-1986.637) [-1981.447] * [-1979.995] (-1985.391) (-1980.257) (-1994.203) -- 0:04:24
      166800 -- (-1996.689) [-1980.700] (-1988.132) (-1993.027) * [-1979.445] (-1987.119) (-1983.507) (-1996.567) -- 0:04:24
      166900 -- (-2000.019) [-1981.413] (-1987.197) (-1985.585) * (-1982.959) [-1983.721] (-1983.209) (-1992.257) -- 0:04:24
      167000 -- (-1997.481) [-1985.247] (-1999.751) (-1984.017) * [-1981.791] (-1983.489) (-1986.739) (-1988.003) -- 0:04:24

      Average standard deviation of split frequencies: 0.005558

      167100 -- (-2002.742) (-1980.537) (-1992.811) [-1984.204] * [-1978.746] (-1979.152) (-1991.881) (-1990.328) -- 0:04:24
      167200 -- (-1994.246) (-1978.920) (-1990.014) [-1988.604] * (-1981.311) [-1985.383] (-1990.500) (-1987.504) -- 0:04:23
      167300 -- (-1998.631) [-1981.334] (-1999.538) (-1986.507) * [-1976.746] (-1987.280) (-1997.357) (-1987.414) -- 0:04:23
      167400 -- (-1997.982) (-1978.815) (-1999.140) [-1986.669] * [-1975.274] (-1984.166) (-1991.807) (-1989.798) -- 0:04:23
      167500 -- (-2001.520) [-1980.351] (-1996.656) (-1987.966) * (-1980.416) (-1987.755) (-1991.985) [-1990.787] -- 0:04:23
      167600 -- (-1999.524) [-1981.120] (-1992.873) (-1992.830) * [-1979.042] (-1994.862) (-1987.169) (-1992.807) -- 0:04:28
      167700 -- (-1998.682) (-1989.371) (-1992.088) [-1992.520] * [-1981.680] (-1988.416) (-1994.483) (-1993.118) -- 0:04:28
      167800 -- (-2005.378) (-1984.277) (-1992.329) [-1993.521] * [-1981.495] (-1985.615) (-1998.915) (-1988.426) -- 0:04:27
      167900 -- (-2011.094) [-1983.263] (-1996.072) (-1990.056) * (-1985.999) [-1989.864] (-1998.859) (-1995.370) -- 0:04:27
      168000 -- (-2002.699) [-1981.430] (-1995.745) (-1993.822) * [-1982.811] (-1999.132) (-1992.260) (-1991.237) -- 0:04:27

      Average standard deviation of split frequencies: 0.005287

      168100 -- (-2002.550) [-1981.510] (-1994.799) (-1998.997) * [-1985.030] (-1986.432) (-1990.644) (-1995.197) -- 0:04:27
      168200 -- (-2006.570) [-1984.777] (-1995.601) (-1993.202) * (-1987.265) [-1982.019] (-1991.365) (-1988.382) -- 0:04:27
      168300 -- (-2001.929) [-1980.099] (-2000.431) (-1995.964) * (-1987.869) [-1981.828] (-1994.817) (-1992.545) -- 0:04:26
      168400 -- (-2006.547) [-1975.988] (-1996.919) (-1995.341) * (-1985.573) [-1982.762] (-1993.852) (-1996.310) -- 0:04:26
      168500 -- (-1994.406) [-1975.795] (-1994.181) (-1991.421) * [-1985.693] (-1979.671) (-1989.157) (-1990.866) -- 0:04:26
      168600 -- (-1986.990) [-1978.088] (-1997.449) (-1989.802) * (-1985.679) (-1987.471) [-1986.412] (-1999.128) -- 0:04:26
      168700 -- [-1989.268] (-1980.428) (-2000.198) (-1999.655) * [-1982.864] (-1985.898) (-1988.164) (-2003.826) -- 0:04:26
      168800 -- (-1994.690) [-1982.898] (-1991.627) (-1991.607) * [-1984.516] (-1981.226) (-1988.609) (-2011.599) -- 0:04:25
      168900 -- (-1993.706) (-1982.180) (-2001.405) [-1986.160] * (-1981.674) [-1980.523] (-2008.127) (-1998.473) -- 0:04:25
      169000 -- [-1988.449] (-1987.912) (-2004.482) (-1985.769) * (-1987.774) [-1978.003] (-2002.726) (-1999.210) -- 0:04:25

      Average standard deviation of split frequencies: 0.004776

      169100 -- (-1987.818) (-1991.392) (-1999.474) [-1987.016] * (-1989.200) [-1980.383] (-2000.437) (-2003.367) -- 0:04:25
      169200 -- (-1988.545) (-1983.971) (-1997.506) [-1982.773] * [-1984.085] (-1981.423) (-2000.735) (-1997.064) -- 0:04:25
      169300 -- (-1993.063) (-1984.630) (-2004.120) [-1983.250] * (-1983.726) [-1986.050] (-1989.299) (-1991.086) -- 0:04:24
      169400 -- (-1992.889) (-1991.261) (-2013.122) [-1979.586] * (-1981.589) [-1986.883] (-1989.860) (-2003.304) -- 0:04:24
      169500 -- (-1993.682) (-1991.031) (-2002.278) [-1984.912] * (-1981.035) (-1985.382) [-1989.162] (-1998.770) -- 0:04:24
      169600 -- (-1996.865) [-1984.946] (-1998.090) (-1984.264) * [-1984.518] (-1985.960) (-2004.547) (-1997.180) -- 0:04:24
      169700 -- (-1994.977) [-1986.809] (-1999.197) (-1982.750) * [-1988.745] (-1984.515) (-1992.285) (-1990.172) -- 0:04:24
      169800 -- (-2002.548) (-1988.190) (-1996.179) [-1983.077] * [-1988.694] (-1989.151) (-1988.296) (-1994.748) -- 0:04:24
      169900 -- (-2000.814) (-1987.867) (-1988.571) [-1986.432] * (-1989.245) (-1991.044) [-1986.847] (-1986.630) -- 0:04:23
      170000 -- (-2001.362) [-1991.698] (-1988.253) (-1996.739) * (-1992.492) (-1992.766) [-1986.514] (-1992.873) -- 0:04:23

      Average standard deviation of split frequencies: 0.004829

      170100 -- (-1992.602) (-2004.938) [-1990.188] (-1998.725) * (-1990.106) [-1991.921] (-1990.780) (-1995.152) -- 0:04:23
      170200 -- (-1994.998) (-1990.778) [-1995.106] (-1987.134) * [-1988.461] (-1988.244) (-1992.843) (-2001.698) -- 0:04:23
      170300 -- (-1994.449) (-1988.888) [-1987.649] (-1992.443) * [-1985.334] (-1979.504) (-1985.579) (-1997.691) -- 0:04:23
      170400 -- (-1994.542) (-1992.319) [-1988.649] (-1993.287) * [-1983.011] (-1981.397) (-1991.794) (-1993.529) -- 0:04:22
      170500 -- (-1999.813) (-1990.523) [-1988.310] (-1990.543) * (-1983.828) [-1979.162] (-1989.320) (-1992.578) -- 0:04:22
      170600 -- [-1989.141] (-1993.506) (-1994.068) (-1998.830) * [-1980.076] (-1985.667) (-1989.443) (-2004.254) -- 0:04:22
      170700 -- (-1994.505) [-1994.302] (-1990.470) (-1989.737) * (-1984.449) [-1980.598] (-1989.971) (-1999.413) -- 0:04:27
      170800 -- (-1991.603) (-1994.514) [-1987.559] (-1991.426) * (-1979.214) [-1979.746] (-1991.538) (-1996.756) -- 0:04:27
      170900 -- (-1986.513) (-1987.617) (-1991.262) [-1984.009] * [-1984.568] (-1985.594) (-1990.161) (-2006.424) -- 0:04:26
      171000 -- [-1985.339] (-1992.995) (-1991.725) (-1988.598) * (-1986.285) (-1997.295) [-1988.180] (-1990.586) -- 0:04:26

      Average standard deviation of split frequencies: 0.004878

      171100 -- (-1987.945) [-1985.931] (-1990.570) (-1989.538) * [-1978.283] (-1984.722) (-1991.123) (-1988.675) -- 0:04:26
      171200 -- (-1994.421) (-1989.004) (-1986.375) [-1983.242] * [-1984.692] (-1991.515) (-1992.231) (-1994.742) -- 0:04:26
      171300 -- (-1991.470) (-1995.425) [-1987.294] (-1981.400) * [-1983.903] (-1989.666) (-1985.718) (-1989.520) -- 0:04:26
      171400 -- (-1994.739) (-1996.268) (-1986.999) [-1985.308] * (-1984.871) (-1985.549) [-1986.494] (-1986.040) -- 0:04:25
      171500 -- (-2007.135) (-1993.511) [-1987.907] (-1991.262) * (-1991.673) (-1986.293) (-1990.444) [-1982.740] -- 0:04:25
      171600 -- (-2014.556) (-1988.699) [-1984.480] (-1987.037) * (-1995.875) [-1983.031] (-1990.084) (-1989.718) -- 0:04:25
      171700 -- (-2006.383) (-1994.228) [-1985.555] (-1992.016) * (-1987.690) [-1980.961] (-1995.847) (-1987.961) -- 0:04:25
      171800 -- (-2005.538) [-1985.555] (-1989.969) (-1992.360) * (-1990.972) [-1982.627] (-1998.620) (-2001.230) -- 0:04:25
      171900 -- (-1999.188) [-1987.375] (-1987.963) (-1996.901) * (-1989.367) [-1980.212] (-1993.212) (-1992.943) -- 0:04:24
      172000 -- (-2001.056) (-1988.129) (-1991.228) [-1992.720] * (-1990.424) [-1977.715] (-1994.261) (-1990.057) -- 0:04:24

      Average standard deviation of split frequencies: 0.004225

      172100 -- (-1998.792) (-1989.711) [-1991.471] (-1990.528) * (-1984.260) [-1977.315] (-1995.819) (-1991.680) -- 0:04:24
      172200 -- (-1999.267) (-1985.864) [-1985.641] (-1989.222) * [-1982.633] (-1987.198) (-1996.295) (-1990.789) -- 0:04:24
      172300 -- (-1991.778) (-1988.399) (-1988.030) [-1994.564] * [-1989.636] (-1992.383) (-1986.449) (-1989.049) -- 0:04:24
      172400 -- (-1985.440) [-1985.025] (-1991.131) (-1995.225) * (-1997.485) (-1998.052) [-1984.574] (-1999.057) -- 0:04:24
      172500 -- (-1986.994) (-1992.077) [-1991.534] (-1989.734) * (-1987.441) (-1996.713) [-1984.702] (-1989.030) -- 0:04:23
      172600 -- (-1986.842) [-1988.671] (-1996.896) (-1987.461) * [-1987.367] (-2003.573) (-1988.056) (-1987.019) -- 0:04:23
      172700 -- [-1986.559] (-1986.784) (-2009.305) (-1993.752) * [-1987.731] (-2000.218) (-1987.886) (-1989.275) -- 0:04:23
      172800 -- (-1988.617) [-1989.010] (-1990.199) (-1997.127) * [-1988.312] (-1990.711) (-1990.136) (-1992.052) -- 0:04:23
      172900 -- (-1996.092) [-1994.530] (-1989.855) (-1990.868) * (-1992.688) (-1992.448) [-1990.104] (-1998.270) -- 0:04:23
      173000 -- (-1996.571) (-2003.835) (-1996.089) [-1981.667] * [-1983.672] (-1992.505) (-1998.133) (-1996.881) -- 0:04:22

      Average standard deviation of split frequencies: 0.004433

      173100 -- (-2001.546) (-1994.744) (-1991.602) [-1983.128] * [-1984.732] (-2003.261) (-1991.208) (-1995.484) -- 0:04:22
      173200 -- (-1995.180) (-1995.391) (-1994.934) [-1985.551] * (-1989.517) (-1993.022) [-1986.345] (-1992.645) -- 0:04:22
      173300 -- (-2003.070) (-1998.244) (-1998.406) [-1984.300] * (-1987.365) (-1994.267) [-1988.141] (-1997.537) -- 0:04:22
      173400 -- (-1999.975) (-1984.059) (-1996.571) [-1982.814] * [-1985.464] (-1992.165) (-1991.798) (-1993.702) -- 0:04:22
      173500 -- (-2006.844) [-1988.444] (-1997.005) (-1984.133) * [-1984.130] (-2002.685) (-1994.672) (-1996.369) -- 0:04:22
      173600 -- (-2002.225) [-1988.401] (-1992.018) (-1987.802) * [-1981.229] (-1994.920) (-1991.494) (-1994.020) -- 0:04:21
      173700 -- (-2001.055) [-1982.574] (-1988.081) (-1981.505) * [-1980.610] (-2000.087) (-1993.538) (-1996.836) -- 0:04:21
      173800 -- (-1996.473) [-1982.428] (-1993.665) (-1985.677) * [-1982.899] (-1998.092) (-1993.922) (-1998.428) -- 0:04:26
      173900 -- (-1992.418) (-1980.704) (-1999.795) [-1978.644] * [-1983.738] (-2004.237) (-1998.619) (-2003.352) -- 0:04:26
      174000 -- (-1992.297) (-1985.235) (-2005.087) [-1975.951] * (-1982.734) [-1991.638] (-1987.358) (-2009.670) -- 0:04:25

      Average standard deviation of split frequencies: 0.005028

      174100 -- (-1992.574) (-1990.292) (-2000.990) [-1976.048] * [-1984.600] (-1994.130) (-1992.150) (-2001.931) -- 0:04:25
      174200 -- (-1993.384) (-1989.409) (-1993.319) [-1977.938] * [-1981.513] (-1995.801) (-1998.229) (-2002.561) -- 0:04:25
      174300 -- [-1987.430] (-1990.525) (-1988.596) (-1979.544) * [-1981.216] (-2003.631) (-1993.219) (-2000.839) -- 0:04:25
      174400 -- (-1990.570) [-1989.148] (-1989.885) (-1988.606) * [-1979.711] (-2001.538) (-1993.651) (-2000.995) -- 0:04:25
      174500 -- [-1987.425] (-1991.490) (-1988.170) (-1987.133) * [-1979.980] (-2002.901) (-1993.677) (-1991.892) -- 0:04:24
      174600 -- (-1986.881) (-1989.418) (-1985.991) [-1987.484] * [-1978.593] (-1999.098) (-1990.336) (-1995.165) -- 0:04:24
      174700 -- [-1987.258] (-1990.402) (-1992.423) (-1983.149) * [-1983.651] (-1990.620) (-1991.011) (-1997.693) -- 0:04:24
      174800 -- (-1989.263) (-1990.912) (-1992.767) [-1985.027] * [-1979.283] (-1987.189) (-1995.402) (-1993.939) -- 0:04:24
      174900 -- (-1995.374) (-1990.145) (-1991.768) [-1980.972] * (-1984.684) (-1990.493) [-1985.509] (-1993.471) -- 0:04:24
      175000 -- (-1995.877) (-1994.755) (-1987.581) [-1985.014] * (-1990.167) (-1993.216) [-1985.824] (-1996.212) -- 0:04:24

      Average standard deviation of split frequencies: 0.005151

      175100 -- (-2001.333) (-1994.628) (-1989.473) [-1979.270] * (-1988.702) (-2000.644) [-1984.889] (-1995.593) -- 0:04:23
      175200 -- (-2004.467) (-1998.341) (-1994.024) [-1979.864] * [-1988.993] (-1995.415) (-1988.814) (-1999.117) -- 0:04:23
      175300 -- (-2012.233) (-1993.412) (-1992.915) [-1983.407] * (-1991.537) (-1999.258) [-1992.545] (-1999.054) -- 0:04:23
      175400 -- (-2003.282) [-1989.222] (-1984.792) (-1985.995) * (-1993.075) (-1990.055) (-1997.408) [-1994.407] -- 0:04:23
      175500 -- (-1999.253) (-1990.093) [-1984.520] (-1986.222) * (-1986.258) (-1993.009) (-2000.872) [-1990.152] -- 0:04:23
      175600 -- (-1994.109) [-1986.878] (-1992.932) (-1984.997) * (-1988.309) (-1987.317) (-1997.375) [-1985.324] -- 0:04:22
      175700 -- (-2006.340) [-1984.828] (-1993.258) (-1982.900) * [-1989.872] (-1984.672) (-1991.778) (-1987.099) -- 0:04:22
      175800 -- (-1997.027) (-1988.782) (-2002.795) [-1979.759] * [-1982.571] (-1985.393) (-1992.117) (-1986.623) -- 0:04:22
      175900 -- (-1996.081) (-1990.605) (-1993.224) [-1979.332] * (-1987.559) [-1982.319] (-1995.441) (-1995.575) -- 0:04:22
      176000 -- (-1994.723) (-1992.291) (-1993.180) [-1980.734] * (-1986.015) [-1983.814] (-1995.620) (-1993.716) -- 0:04:22

      Average standard deviation of split frequencies: 0.005429

      176100 -- (-1994.353) (-1989.817) (-1988.843) [-1982.235] * (-1990.400) [-1985.042] (-1991.899) (-1987.691) -- 0:04:22
      176200 -- (-1989.440) (-1995.003) (-1990.396) [-1984.602] * (-1986.767) [-1981.129] (-1989.948) (-1990.578) -- 0:04:21
      176300 -- (-1987.811) (-1996.332) (-1987.683) [-1983.190] * [-1982.060] (-1985.579) (-1998.065) (-1988.689) -- 0:04:21
      176400 -- (-1989.961) (-1987.321) (-1990.098) [-1987.662] * (-1987.799) [-1984.036] (-1996.697) (-1990.368) -- 0:04:21
      176500 -- (-1991.955) [-1987.857] (-1995.267) (-1995.883) * (-1987.571) [-1990.597] (-1996.973) (-1987.019) -- 0:04:21
      176600 -- (-1992.180) [-1986.435] (-2000.193) (-1993.362) * (-1983.389) (-1989.584) [-1987.493] (-1988.583) -- 0:04:21
      176700 -- (-1989.793) [-1985.282] (-2004.263) (-1988.937) * [-1982.209] (-1992.125) (-1990.893) (-1995.058) -- 0:04:20
      176800 -- (-1995.473) (-1987.310) [-1999.679] (-1994.648) * (-1985.885) [-1987.901] (-1987.489) (-1998.071) -- 0:04:20
      176900 -- (-1992.819) [-1987.883] (-1994.972) (-1993.298) * (-1988.106) (-1994.751) [-1986.682] (-1991.146) -- 0:04:20
      177000 -- [-1988.301] (-1994.602) (-1990.101) (-1991.265) * [-1985.755] (-1993.256) (-1988.706) (-1992.936) -- 0:04:25

      Average standard deviation of split frequencies: 0.005549

      177100 -- (-1990.263) (-1990.551) (-1988.522) [-1987.034] * [-1982.211] (-1997.957) (-1990.404) (-1992.305) -- 0:04:24
      177200 -- (-1993.280) (-1994.887) (-1988.319) [-1984.956] * [-1982.468] (-2000.246) (-1999.079) (-1998.816) -- 0:04:24
      177300 -- (-1990.110) (-1998.228) (-1988.056) [-1982.985] * [-1979.639] (-1991.312) (-1999.346) (-1989.780) -- 0:04:24
      177400 -- (-1996.683) [-1994.081] (-1996.018) (-1980.109) * [-1981.239] (-1994.599) (-1989.115) (-1993.739) -- 0:04:24
      177500 -- (-1990.112) (-1997.846) (-2000.914) [-1979.327] * (-1983.280) (-2001.577) [-1987.510] (-1991.349) -- 0:04:24
      177600 -- (-1991.843) (-1995.939) (-2005.319) [-1982.048] * [-1980.859] (-1990.338) (-1987.334) (-1990.251) -- 0:04:23
      177700 -- (-1992.820) (-1993.567) (-1995.007) [-1985.389] * [-1983.373] (-1991.254) (-1992.065) (-1988.709) -- 0:04:23
      177800 -- (-1991.471) [-1990.015] (-1996.503) (-1984.496) * [-1991.648] (-1990.509) (-1993.808) (-1991.188) -- 0:04:23
      177900 -- [-1983.121] (-2000.925) (-1995.046) (-1985.111) * [-1986.564] (-1992.482) (-1990.958) (-1989.500) -- 0:04:23
      178000 -- (-1986.451) (-1994.006) (-1986.347) [-1982.819] * (-1990.052) [-1988.676] (-1987.198) (-1988.823) -- 0:04:23

      Average standard deviation of split frequencies: 0.005822

      178100 -- (-1991.481) (-1993.813) (-1986.632) [-1982.322] * (-1983.824) (-2003.880) [-1985.242] (-1985.871) -- 0:04:23
      178200 -- (-1991.785) (-1994.682) [-1984.535] (-1993.365) * (-2001.858) (-1990.398) (-1983.974) [-1983.349] -- 0:04:22
      178300 -- (-1995.002) (-2001.450) [-1986.490] (-1993.258) * (-1994.697) (-1989.218) (-1989.068) [-1985.164] -- 0:04:22
      178400 -- (-1993.780) (-2003.703) (-1987.243) [-1990.087] * (-1988.639) (-1990.784) (-1991.636) [-1991.197] -- 0:04:22
      178500 -- (-1991.813) (-2000.040) [-1985.589] (-1987.365) * [-1987.874] (-1987.957) (-1995.018) (-1987.284) -- 0:04:22
      178600 -- (-1991.829) (-1989.943) (-1984.133) [-1989.933] * [-1986.668] (-1977.544) (-2001.660) (-1995.834) -- 0:04:22
      178700 -- (-1995.654) [-1986.696] (-1986.173) (-1993.819) * (-1994.591) [-1980.787] (-1995.409) (-1995.389) -- 0:04:21
      178800 -- (-1999.683) (-1988.120) [-1990.739] (-1994.137) * (-1997.556) [-1982.212] (-1997.751) (-1985.976) -- 0:04:21
      178900 -- (-1994.695) (-1999.121) (-1992.773) [-1990.781] * (-2007.607) (-1987.896) (-1991.565) [-1980.820] -- 0:04:21
      179000 -- (-1992.788) (-2002.591) (-1999.868) [-1984.620] * (-2003.824) (-1987.741) (-1994.936) [-1980.142] -- 0:04:21

      Average standard deviation of split frequencies: 0.005487

      179100 -- (-1998.116) (-1995.719) [-2001.440] (-1985.738) * (-1996.375) (-1986.582) (-1999.290) [-1976.845] -- 0:04:21
      179200 -- (-1997.928) (-1994.526) (-1992.492) [-1986.748] * (-2001.925) (-1984.130) (-1990.773) [-1978.665] -- 0:04:21
      179300 -- (-1999.020) (-1986.674) (-1989.464) [-1986.080] * (-1995.959) (-1987.002) (-1986.164) [-1978.386] -- 0:04:20
      179400 -- (-2004.517) (-1995.230) [-1987.700] (-1984.071) * (-1985.914) (-2003.872) (-1986.377) [-1980.833] -- 0:04:20
      179500 -- (-1994.943) (-1995.757) (-1990.451) [-1985.932] * [-1986.266] (-1993.938) (-1989.417) (-1979.365) -- 0:04:20
      179600 -- (-1991.309) (-1992.955) (-1994.320) [-1983.960] * (-1989.524) (-1996.525) (-1991.224) [-1978.231] -- 0:04:20
      179700 -- [-1991.479] (-1989.942) (-1992.659) (-1993.821) * (-1984.773) (-1997.752) (-1991.117) [-1981.561] -- 0:04:20
      179800 -- (-1991.191) (-1988.438) (-1995.147) [-1992.800] * (-1987.613) (-1993.013) (-1986.874) [-1979.309] -- 0:04:20
      179900 -- (-1997.931) [-1984.374] (-1988.826) (-1996.560) * (-1987.822) (-1992.037) (-1994.059) [-1984.690] -- 0:04:19
      180000 -- (-1997.295) [-1985.638] (-1988.790) (-1993.206) * (-1987.737) (-1993.191) (-1988.578) [-1982.674] -- 0:04:19

      Average standard deviation of split frequencies: 0.005907

      180100 -- (-1993.831) (-1989.426) [-1985.499] (-1992.286) * (-1997.818) (-1990.363) (-1997.975) [-1981.867] -- 0:04:24
      180200 -- (-1992.761) [-1989.554] (-1989.027) (-1995.812) * (-1987.741) (-1988.249) [-1990.538] (-1987.021) -- 0:04:23
      180300 -- (-1992.143) [-1989.713] (-1992.874) (-2006.952) * (-1989.577) (-1984.238) (-1988.225) [-1981.801] -- 0:04:23
      180400 -- [-1990.822] (-1992.691) (-1994.050) (-2013.968) * [-1987.469] (-1982.723) (-1986.776) (-1981.649) -- 0:04:23
      180500 -- [-1992.701] (-1993.435) (-1998.155) (-2002.828) * (-1988.032) [-1985.261] (-1987.779) (-1983.417) -- 0:04:23
      180600 -- [-1987.256] (-2002.098) (-1995.977) (-1989.018) * (-1996.992) [-1982.332] (-1993.468) (-1986.383) -- 0:04:23
      180700 -- (-1985.440) (-2009.269) (-1992.723) [-1987.162] * (-1986.771) [-1983.970] (-1996.809) (-1987.984) -- 0:04:22
      180800 -- (-1997.366) (-2003.304) (-1994.950) [-1985.596] * (-1981.845) [-1985.018] (-1997.942) (-1991.617) -- 0:04:22
      180900 -- (-2000.213) (-2025.245) (-1994.543) [-1985.188] * (-1979.877) [-1981.681] (-1996.558) (-1988.762) -- 0:04:22
      181000 -- (-1992.713) (-2005.944) (-1998.105) [-1986.813] * (-1982.146) [-1985.935] (-1992.276) (-1988.314) -- 0:04:22

      Average standard deviation of split frequencies: 0.005872

      181100 -- (-1987.784) (-2002.664) (-1994.235) [-1985.042] * [-1982.078] (-1988.918) (-1989.567) (-1987.091) -- 0:04:22
      181200 -- [-1988.107] (-2000.832) (-1986.976) (-1988.580) * (-1983.047) (-1991.451) (-1989.147) [-1985.054] -- 0:04:22
      181300 -- (-1987.609) (-2000.527) [-1983.589] (-1990.580) * [-1981.782] (-1996.481) (-2003.202) (-1984.429) -- 0:04:21
      181400 -- (-1995.408) (-2007.016) (-1985.467) [-1985.210] * [-1980.935] (-1992.401) (-1994.575) (-1986.218) -- 0:04:21
      181500 -- (-1992.812) (-1994.817) [-1984.089] (-1987.898) * [-1982.997] (-1995.605) (-1990.100) (-1989.469) -- 0:04:21
      181600 -- (-1996.610) (-1995.753) [-1981.322] (-1985.985) * (-1984.203) (-2001.544) [-1986.803] (-1991.802) -- 0:04:21
      181700 -- (-1985.712) (-1996.537) (-1982.767) [-1984.624] * [-1981.348] (-1993.600) (-1989.156) (-1994.754) -- 0:04:21
      181800 -- (-1986.874) (-1997.257) (-1986.296) [-1984.772] * [-1981.834] (-2000.425) (-1988.150) (-1985.249) -- 0:04:21
      181900 -- (-1996.972) (-2008.138) [-1984.178] (-1988.690) * [-1985.344] (-1996.579) (-1987.748) (-1985.815) -- 0:04:20
      182000 -- (-1999.677) (-1998.206) (-1988.495) [-1992.519] * [-1983.685] (-1997.131) (-1987.533) (-1992.882) -- 0:04:20

      Average standard deviation of split frequencies: 0.005472

      182100 -- (-1993.803) (-1997.751) (-1990.586) [-1990.853] * [-1988.555] (-1997.232) (-1987.268) (-1997.146) -- 0:04:20
      182200 -- (-2000.373) (-1996.937) (-1988.008) [-1992.614] * [-1977.477] (-1995.456) (-1992.791) (-1988.595) -- 0:04:20
      182300 -- (-1997.044) (-1996.913) [-1987.997] (-1988.386) * [-1979.886] (-2007.480) (-1993.435) (-1988.733) -- 0:04:20
      182400 -- (-2000.670) (-1992.385) (-1990.702) [-1981.686] * (-1982.262) (-2006.794) (-1990.631) [-1981.187] -- 0:04:19
      182500 -- (-2006.326) (-1992.997) (-1993.098) [-1984.017] * [-1983.088] (-2004.268) (-1994.066) (-1987.265) -- 0:04:19
      182600 -- (-2007.236) (-1990.597) (-1983.682) [-1983.156] * [-1980.629] (-1999.812) (-2002.782) (-1993.676) -- 0:04:19
      182700 -- (-2001.760) (-1991.825) (-1986.716) [-1986.145] * [-1980.030] (-2003.704) (-1993.129) (-1993.812) -- 0:04:19
      182800 -- (-1999.842) (-1999.546) [-1990.202] (-1986.618) * [-1981.525] (-1994.327) (-1990.838) (-1985.156) -- 0:04:19
      182900 -- (-2001.492) (-2007.741) (-1989.106) [-1983.638] * [-1980.779] (-1996.727) (-1990.278) (-1981.545) -- 0:04:19
      183000 -- (-2008.999) (-2004.318) (-1991.884) [-1985.985] * [-1983.775] (-2006.057) (-1989.918) (-1979.374) -- 0:04:18

      Average standard deviation of split frequencies: 0.005734

      183100 -- (-1993.438) (-1997.068) [-1988.763] (-1992.798) * (-1982.482) (-2004.232) (-1989.536) [-1979.522] -- 0:04:23
      183200 -- (-1997.768) (-1994.161) [-1985.783] (-1984.446) * (-1985.387) (-1997.162) (-1990.390) [-1979.072] -- 0:04:23
      183300 -- (-1996.445) (-1998.475) [-1983.207] (-1988.317) * (-1979.178) (-2004.999) (-1986.897) [-1978.888] -- 0:04:22
      183400 -- (-1993.939) (-1991.230) (-1993.488) [-1984.956] * (-1982.848) (-1999.835) (-1992.601) [-1984.527] -- 0:04:22
      183500 -- (-1994.955) [-1989.343] (-2000.252) (-1981.626) * [-1982.458] (-2001.708) (-1990.610) (-1991.235) -- 0:04:22
      183600 -- [-1988.296] (-1985.548) (-1996.724) (-1983.686) * [-1980.373] (-2004.510) (-1986.053) (-1992.500) -- 0:04:22
      183700 -- (-1988.176) (-1986.487) (-2002.726) [-1981.173] * [-1990.387] (-2011.633) (-1989.073) (-1990.477) -- 0:04:22
      183800 -- (-1993.311) [-1991.196] (-1995.312) (-1989.773) * (-1987.535) (-2006.407) (-1990.956) [-1987.153] -- 0:04:22
      183900 -- (-1994.355) [-1986.822] (-2003.069) (-1988.819) * (-1985.151) (-2000.121) (-1990.800) [-1981.748] -- 0:04:21
      184000 -- (-1995.848) (-1998.182) [-1990.878] (-1992.487) * (-1984.699) (-1999.035) (-1989.826) [-1983.936] -- 0:04:21

      Average standard deviation of split frequencies: 0.005705

      184100 -- (-1991.796) (-1994.846) (-1988.450) [-1984.062] * (-1990.014) (-2005.679) (-2003.595) [-1988.072] -- 0:04:21
      184200 -- (-1989.291) (-1992.740) [-1985.377] (-1978.150) * (-1990.225) (-2002.632) (-1991.635) [-1987.888] -- 0:04:21
      184300 -- (-1990.975) (-1991.521) [-1989.501] (-1990.801) * (-1986.609) (-1998.856) (-1994.784) [-1987.488] -- 0:04:21
      184400 -- (-1994.087) (-1992.742) [-1990.945] (-1996.326) * [-1981.592] (-2000.549) (-1992.030) (-1993.083) -- 0:04:20
      184500 -- (-1989.577) [-1987.154] (-1984.368) (-2005.349) * [-1979.900] (-1999.836) (-1989.287) (-1994.740) -- 0:04:20
      184600 -- (-1994.786) (-1987.049) (-1986.529) [-1990.550] * [-1983.874] (-1995.546) (-1992.765) (-1995.477) -- 0:04:20
      184700 -- (-1983.481) (-1997.574) (-1990.255) [-1985.033] * [-1987.479] (-1996.716) (-1990.411) (-1996.575) -- 0:04:20
      184800 -- (-1986.994) (-2005.210) [-1989.620] (-1999.946) * [-1982.920] (-1994.372) (-1995.258) (-2002.628) -- 0:04:20
      184900 -- (-1988.058) (-1994.350) (-1988.472) [-1995.309] * [-1983.101] (-1998.271) (-1991.081) (-1996.032) -- 0:04:20
      185000 -- [-1987.021] (-1992.967) (-1993.160) (-1995.631) * [-1985.793] (-1991.356) (-1991.046) (-1997.173) -- 0:04:19

      Average standard deviation of split frequencies: 0.005673

      185100 -- (-1988.720) (-1992.729) (-1990.601) [-1995.705] * [-1983.903] (-1990.998) (-1992.086) (-1991.175) -- 0:04:19
      185200 -- [-1990.442] (-1999.921) (-1992.477) (-1999.127) * (-1985.622) (-1996.533) (-2001.512) [-1984.433] -- 0:04:19
      185300 -- [-1990.155] (-2001.432) (-1992.510) (-1995.079) * (-1993.883) (-1991.825) (-2002.237) [-1986.976] -- 0:04:19
      185400 -- (-1988.880) (-1996.850) [-1993.136] (-2004.661) * (-1990.540) [-1988.775] (-2001.850) (-1993.196) -- 0:04:19
      185500 -- [-1985.821] (-1997.856) (-1992.318) (-1997.056) * [-1988.865] (-1988.241) (-1996.218) (-1994.906) -- 0:04:19
      185600 -- [-1984.790] (-1990.271) (-2011.257) (-1987.861) * (-1987.919) [-1988.804] (-2002.598) (-1988.050) -- 0:04:18
      185700 -- (-1986.401) [-1986.571] (-2005.128) (-1988.008) * [-1986.756] (-1986.432) (-1990.350) (-1996.533) -- 0:04:18
      185800 -- [-1985.089] (-1988.922) (-2002.263) (-1988.814) * (-1988.051) (-2006.596) [-1990.109] (-2002.762) -- 0:04:18
      185900 -- (-1987.952) (-1984.537) (-1994.128) [-1993.886] * [-1989.532] (-2003.754) (-1990.300) (-1994.491) -- 0:04:18
      186000 -- (-1996.350) [-1983.704] (-1988.022) (-1990.458) * (-1990.939) (-1996.060) (-1994.450) [-1986.194] -- 0:04:18

      Average standard deviation of split frequencies: 0.006078

      186100 -- (-1995.685) [-1988.895] (-1992.817) (-1992.024) * [-1987.637] (-2004.199) (-1994.536) (-1987.800) -- 0:04:18
      186200 -- (-1990.507) [-1991.560] (-1998.852) (-1993.301) * (-1985.799) (-1994.024) (-1996.408) [-1985.095] -- 0:04:17
      186300 -- (-1988.374) [-1987.634] (-2005.750) (-1996.781) * (-1991.064) (-1996.159) (-1994.760) [-1981.579] -- 0:04:22
      186400 -- (-1988.109) [-1986.760] (-2007.862) (-1988.416) * [-1993.372] (-1997.695) (-1993.409) (-1984.960) -- 0:04:21
      186500 -- (-1985.759) (-1983.712) (-2001.486) [-1985.829] * (-1992.702) (-1999.354) (-1993.399) [-1983.676] -- 0:04:21
      186600 -- (-1985.950) [-1990.532] (-1990.193) (-1984.114) * (-1995.330) (-1993.511) (-1989.672) [-1981.849] -- 0:04:21
      186700 -- [-1986.316] (-1991.473) (-1992.289) (-1982.723) * (-1989.622) (-1996.797) (-1987.615) [-1983.434] -- 0:04:21
      186800 -- (-1987.366) (-1991.548) (-1992.145) [-1983.141] * (-1987.096) (-2005.294) (-1990.955) [-1985.169] -- 0:04:21
      186900 -- [-1978.345] (-1990.057) (-1998.447) (-1981.155) * [-1989.762] (-1993.909) (-1990.467) (-1987.878) -- 0:04:21
      187000 -- [-1981.647] (-1985.146) (-2006.838) (-1980.918) * [-1986.152] (-1997.465) (-1990.339) (-1992.722) -- 0:04:20

      Average standard deviation of split frequencies: 0.006044

      187100 -- (-1980.455) [-1985.178] (-2001.356) (-1982.447) * (-1991.088) (-1996.792) [-1987.255] (-1992.401) -- 0:04:20
      187200 -- (-1983.301) [-1983.220] (-1999.333) (-1985.155) * [-1985.911] (-1991.933) (-1996.695) (-1998.070) -- 0:04:20
      187300 -- (-1979.995) [-1982.275] (-2017.024) (-1985.479) * [-1981.138] (-1983.775) (-1989.050) (-1997.151) -- 0:04:20
      187400 -- [-1981.716] (-1989.103) (-1997.429) (-1983.403) * (-1982.232) [-1990.638] (-1986.373) (-2019.892) -- 0:04:20
      187500 -- (-1981.788) (-1988.767) (-1992.796) [-1984.008] * [-1983.525] (-1987.996) (-1993.403) (-2006.886) -- 0:04:20
      187600 -- (-1984.768) (-1994.528) (-1987.568) [-1981.496] * (-1984.087) [-1983.407] (-1999.129) (-2004.971) -- 0:04:19
      187700 -- [-1988.278] (-1996.644) (-1998.341) (-1989.678) * [-1981.666] (-1986.034) (-1995.498) (-2008.414) -- 0:04:19
      187800 -- (-1990.250) (-1994.251) (-1993.511) [-1986.211] * [-1979.190] (-1986.593) (-1999.439) (-1984.281) -- 0:04:19
      187900 -- [-1989.677] (-1990.797) (-1989.441) (-1990.096) * [-1982.584] (-1990.170) (-1995.360) (-1986.235) -- 0:04:19
      188000 -- (-1989.410) [-1986.929] (-1998.270) (-1984.993) * [-1979.596] (-1988.619) (-2001.305) (-1989.765) -- 0:04:19

      Average standard deviation of split frequencies: 0.006014

      188100 -- (-1982.359) (-1989.443) (-1990.900) [-1983.619] * (-1986.646) (-1991.849) (-2003.123) [-1982.885] -- 0:04:18
      188200 -- (-1979.999) (-1994.837) (-1988.732) [-1979.846] * [-1986.763] (-1995.414) (-2008.081) (-1987.314) -- 0:04:18
      188300 -- (-1986.886) (-1999.295) (-1990.651) [-1981.190] * (-1988.240) [-1987.730] (-2010.534) (-1982.994) -- 0:04:18
      188400 -- (-1991.378) (-2000.324) (-1988.886) [-1980.299] * (-2001.355) [-1984.090] (-2001.189) (-1983.080) -- 0:04:18
      188500 -- (-1994.924) (-1991.683) (-1989.949) [-1983.962] * (-2003.705) [-1987.108] (-1996.272) (-1985.411) -- 0:04:18
      188600 -- (-1990.555) [-1990.311] (-1992.973) (-1989.496) * (-1989.651) (-1992.975) (-1995.630) [-1987.331] -- 0:04:18
      188700 -- (-1991.700) (-1997.260) (-1989.772) [-1991.698] * (-1993.036) (-1993.066) (-1987.632) [-1987.591] -- 0:04:17
      188800 -- (-1988.651) (-1996.209) [-1992.980] (-1986.197) * (-1987.335) (-1991.693) (-1987.641) [-1985.411] -- 0:04:17
      188900 -- (-1995.816) (-1992.005) (-1992.681) [-1982.625] * (-1984.239) (-1994.024) (-1983.465) [-1985.385] -- 0:04:17
      189000 -- (-1997.643) (-1995.922) [-1980.126] (-1985.919) * (-1986.170) (-1989.948) [-1984.896] (-1993.350) -- 0:04:17

      Average standard deviation of split frequencies: 0.005695

      189100 -- (-1999.355) (-1994.418) (-1978.543) [-1986.073] * (-1990.138) (-1994.858) [-1982.113] (-1991.556) -- 0:04:17
      189200 -- (-1988.344) (-2003.956) [-1982.202] (-1984.657) * [-1983.905] (-1998.605) (-1986.000) (-2007.040) -- 0:04:17
      189300 -- (-1987.209) (-2007.760) (-1986.216) [-1982.206] * [-1984.668] (-1996.421) (-1989.155) (-2005.523) -- 0:04:16
      189400 -- [-1984.653] (-1994.789) (-1985.334) (-1993.051) * [-1982.890] (-1999.428) (-1989.110) (-1999.379) -- 0:04:21
      189500 -- [-1977.337] (-1991.228) (-1986.928) (-1988.884) * [-1985.897] (-1998.299) (-1988.959) (-2008.338) -- 0:04:20
      189600 -- [-1981.888] (-1997.499) (-1988.482) (-1988.427) * [-1984.721] (-1998.160) (-1995.655) (-1998.324) -- 0:04:20
      189700 -- (-1983.863) (-1990.956) (-1999.131) [-1981.006] * [-1982.871] (-1998.427) (-1992.823) (-1999.069) -- 0:04:20
      189800 -- [-1986.214] (-1998.393) (-1986.188) (-1984.043) * (-1989.444) [-1987.040] (-2001.530) (-1999.782) -- 0:04:20
      189900 -- [-1986.572] (-1996.438) (-1995.181) (-1990.261) * [-1986.823] (-1986.604) (-1996.522) (-1995.172) -- 0:04:20
      190000 -- (-1995.620) (-1991.653) (-1983.864) [-1982.698] * (-1982.861) [-1990.440] (-1997.771) (-1995.421) -- 0:04:20

      Average standard deviation of split frequencies: 0.005525

      190100 -- (-1988.762) (-2000.164) (-1981.577) [-1987.714] * [-1979.548] (-1991.150) (-1995.679) (-1989.055) -- 0:04:19
      190200 -- (-1990.133) (-1997.067) [-1981.208] (-1992.511) * (-1991.429) (-1989.951) (-1993.245) [-1989.060] -- 0:04:19
      190300 -- (-1986.921) (-2000.312) [-1983.290] (-1992.742) * [-1989.083] (-1995.168) (-1994.846) (-1984.310) -- 0:04:19
      190400 -- [-1984.909] (-2003.019) (-1989.385) (-1998.590) * (-1998.010) (-1999.914) (-1995.283) [-1986.354] -- 0:04:19
      190500 -- (-1985.594) (-2002.355) [-1987.243] (-1987.823) * (-2002.131) (-1994.149) (-1996.294) [-1998.355] -- 0:04:19
      190600 -- (-1991.182) (-1995.663) [-1980.227] (-1990.813) * (-1993.668) [-1991.500] (-1992.854) (-1989.166) -- 0:04:19
      190700 -- (-1987.977) (-1994.715) [-1977.396] (-1999.268) * (-1988.761) (-1989.073) (-1993.030) [-1987.903] -- 0:04:18
      190800 -- (-1986.484) (-1989.539) [-1977.048] (-2006.574) * (-1982.398) [-1988.199] (-1998.682) (-1989.862) -- 0:04:18
      190900 -- [-1984.425] (-1995.505) (-1979.672) (-2005.379) * (-1989.085) (-1990.033) (-1994.875) [-1980.905] -- 0:04:18
      191000 -- [-1982.909] (-1995.447) (-1984.239) (-2006.226) * (-1990.434) (-1983.878) (-1990.737) [-1981.248] -- 0:04:18

      Average standard deviation of split frequencies: 0.005283

      191100 -- [-1980.965] (-1998.890) (-1980.504) (-2006.327) * (-1990.244) (-1988.480) (-1989.436) [-1986.359] -- 0:04:18
      191200 -- [-1983.329] (-1995.358) (-1982.019) (-1994.676) * (-1988.181) (-1994.182) (-1985.707) [-1982.354] -- 0:04:18
      191300 -- [-1982.566] (-2002.013) (-1985.721) (-2000.700) * (-1985.795) (-1991.879) [-1985.261] (-1987.932) -- 0:04:17
      191400 -- [-1986.667] (-1992.754) (-1998.137) (-1996.982) * (-1995.254) (-1998.010) (-1986.484) [-1983.484] -- 0:04:17
      191500 -- (-1981.536) (-1988.353) (-1997.236) [-1991.515] * (-1994.808) [-1992.496] (-1997.147) (-1986.163) -- 0:04:17
      191600 -- [-1980.298] (-1992.691) (-1999.301) (-1992.300) * (-1992.132) (-1990.302) [-1988.958] (-1988.335) -- 0:04:17
      191700 -- (-1988.777) (-1990.725) (-1996.449) [-1990.817] * (-1991.350) [-1990.244] (-1988.514) (-1993.972) -- 0:04:17
      191800 -- [-1988.205] (-1997.055) (-1988.043) (-1994.681) * (-1990.148) [-1987.229] (-1989.543) (-1990.846) -- 0:04:17
      191900 -- [-1979.992] (-1999.070) (-1981.680) (-1989.116) * [-1991.205] (-1988.876) (-1987.525) (-1990.790) -- 0:04:16
      192000 -- [-1981.687] (-1997.792) (-1984.271) (-1990.908) * (-1994.197) [-1989.103] (-1992.479) (-1991.946) -- 0:04:16

      Average standard deviation of split frequencies: 0.005328

      192100 -- [-1989.705] (-1991.540) (-1986.103) (-1999.684) * (-1999.654) (-1988.829) [-1988.195] (-1991.073) -- 0:04:16
      192200 -- [-1987.193] (-1988.218) (-1983.918) (-1998.635) * (-2003.754) (-1991.144) (-1993.260) [-1988.526] -- 0:04:16
      192300 -- (-1990.625) (-1989.911) [-1986.876] (-1995.421) * (-2000.744) [-1990.781] (-1992.982) (-1983.876) -- 0:04:16
      192400 -- (-1988.263) (-1982.830) [-1982.493] (-1989.426) * (-2000.906) (-1990.901) (-1992.694) [-1984.502] -- 0:04:16
      192500 -- [-1980.507] (-1986.826) (-1981.068) (-1993.407) * (-1993.274) (-1997.214) (-1995.081) [-1978.234] -- 0:04:20
      192600 -- (-1986.103) (-1990.324) [-1980.347] (-1992.215) * (-1998.091) (-2001.607) (-1990.729) [-1976.456] -- 0:04:19
      192700 -- (-1992.323) (-1990.790) [-1980.553] (-1998.522) * (-2005.982) (-2000.838) (-1990.958) [-1983.018] -- 0:04:19
      192800 -- (-1989.662) (-1983.817) [-1984.228] (-1992.491) * (-2014.032) (-2000.150) [-1991.606] (-1981.705) -- 0:04:19
      192900 -- (-1991.601) (-1981.316) [-1983.798] (-1999.995) * (-1998.211) (-1999.994) (-1990.696) [-1980.636] -- 0:04:19
      193000 -- (-1989.342) (-1986.706) [-1981.670] (-2000.862) * (-2002.236) (-1999.156) (-1989.958) [-1988.455] -- 0:04:19

      Average standard deviation of split frequencies: 0.005159

      193100 -- (-1986.953) (-1993.679) [-1983.071] (-2005.380) * (-2003.088) (-1995.738) (-1984.289) [-1982.861] -- 0:04:19
      193200 -- (-1988.626) (-1994.072) [-1986.738] (-2004.710) * (-2002.262) (-1989.632) [-1984.384] (-1981.917) -- 0:04:18
      193300 -- (-1992.658) (-1991.498) [-1985.848] (-2001.913) * [-1997.513] (-1999.406) (-1986.817) (-1987.598) -- 0:04:18
      193400 -- [-1986.446] (-1990.542) (-1989.732) (-2016.573) * (-1997.157) (-2006.910) [-1984.883] (-1993.655) -- 0:04:18
      193500 -- [-1987.603] (-1985.044) (-1988.521) (-1997.964) * (-1997.522) (-1995.936) [-1986.381] (-1987.894) -- 0:04:18
      193600 -- [-1981.982] (-1986.688) (-1992.603) (-1998.092) * (-1994.795) (-1997.101) (-1993.903) [-1984.672] -- 0:04:18
      193700 -- [-1981.086] (-1983.954) (-1990.961) (-1993.969) * (-1987.202) (-1993.932) (-1998.626) [-1986.778] -- 0:04:18
      193800 -- (-1989.584) [-1982.487] (-1987.144) (-1988.623) * [-1983.956] (-1988.814) (-1996.918) (-1989.974) -- 0:04:17
      193900 -- (-2000.507) (-1990.094) [-1981.715] (-1988.401) * (-1988.813) (-1989.429) (-1987.343) [-1987.849] -- 0:04:17
      194000 -- (-1997.605) (-1988.032) [-1984.170] (-1993.185) * [-1986.034] (-1988.058) (-1989.109) (-1993.477) -- 0:04:17

      Average standard deviation of split frequencies: 0.005134

      194100 -- (-1990.517) (-1985.432) [-1981.716] (-1995.909) * [-1989.144] (-1992.909) (-1992.837) (-1985.880) -- 0:04:17
      194200 -- (-1990.845) (-1979.395) [-1980.058] (-1993.710) * (-1992.736) (-1991.434) (-1993.645) [-1983.820] -- 0:04:17
      194300 -- (-1988.166) (-1981.387) [-1979.137] (-1990.613) * (-1997.135) (-1990.548) (-1996.584) [-1988.588] -- 0:04:17
      194400 -- (-1982.289) [-1987.617] (-1982.061) (-1997.215) * [-1989.516] (-1993.015) (-1996.478) (-1983.141) -- 0:04:16
      194500 -- [-1987.729] (-1987.832) (-1981.759) (-1991.490) * (-1992.277) (-2001.008) (-1995.742) [-1985.189] -- 0:04:16
      194600 -- (-1985.879) [-1989.687] (-1978.782) (-1993.861) * (-1994.527) (-1993.324) (-1997.773) [-1986.328] -- 0:04:16
      194700 -- [-1986.511] (-1996.864) (-1977.250) (-1992.739) * (-1992.423) (-1990.264) (-2001.884) [-1984.609] -- 0:04:16
      194800 -- (-1989.618) (-2000.357) [-1978.692] (-2000.189) * [-1988.112] (-1994.110) (-1997.874) (-1985.561) -- 0:04:16
      194900 -- (-1993.409) (-1995.526) [-1979.956] (-2001.494) * (-1984.209) (-1992.715) (-2008.735) [-1982.107] -- 0:04:16
      195000 -- (-1990.107) (-1997.062) [-1987.782] (-1993.067) * (-1990.419) (-1992.659) (-2004.953) [-1986.202] -- 0:04:15

      Average standard deviation of split frequencies: 0.005244

      195100 -- [-1983.835] (-1988.360) (-1988.019) (-1998.663) * [-1989.781] (-1990.264) (-1991.105) (-1984.974) -- 0:04:15
      195200 -- [-1984.126] (-1985.246) (-1991.519) (-2000.684) * (-1989.960) (-1994.669) (-1996.367) [-1988.464] -- 0:04:15
      195300 -- [-1985.672] (-1991.555) (-1988.510) (-1998.793) * (-1995.839) [-1994.548] (-2001.245) (-1996.455) -- 0:04:15
      195400 -- (-1989.515) (-1982.820) [-1995.372] (-2000.906) * (-1989.053) (-1988.710) (-2005.568) [-1985.346] -- 0:04:15
      195500 -- (-1997.455) [-1979.653] (-1983.968) (-2005.710) * [-1991.235] (-1999.391) (-2009.530) (-1990.092) -- 0:04:15
      195600 -- (-1993.171) [-1985.627] (-1987.247) (-1995.897) * (-1987.014) [-1993.617] (-2004.974) (-1992.600) -- 0:04:19
      195700 -- (-1994.355) [-1990.369] (-1986.801) (-1988.287) * [-1988.616] (-1991.363) (-1995.747) (-1999.215) -- 0:04:18
      195800 -- (-1994.957) [-1990.303] (-1986.792) (-1988.968) * (-1984.909) [-1987.344] (-1990.668) (-1994.500) -- 0:04:18
      195900 -- (-1998.633) (-1996.853) [-1985.292] (-1987.466) * (-1985.622) [-1983.878] (-1992.870) (-2001.080) -- 0:04:18
      196000 -- (-1999.041) [-1989.445] (-1993.362) (-1993.681) * [-1984.598] (-1983.095) (-1989.458) (-1994.247) -- 0:04:18

      Average standard deviation of split frequencies: 0.004944

      196100 -- (-1994.890) [-1987.896] (-1992.040) (-2002.979) * [-1988.004] (-1987.789) (-1988.417) (-1989.071) -- 0:04:18
      196200 -- (-2001.229) (-1993.368) [-1988.255] (-1995.345) * [-1986.644] (-1995.594) (-1985.666) (-1985.222) -- 0:04:18
      196300 -- (-2011.594) (-1990.189) [-1987.008] (-1983.306) * (-1989.603) (-1992.529) (-1992.378) [-1983.232] -- 0:04:17
      196400 -- (-2012.334) (-1993.158) (-1987.772) [-1985.324] * (-1988.784) (-1989.715) (-1997.092) [-1984.951] -- 0:04:17
      196500 -- (-1997.056) (-1997.707) (-1985.875) [-1984.428] * (-1992.171) (-1986.340) (-1999.711) [-1986.266] -- 0:04:17
      196600 -- (-1993.382) (-1989.939) (-1986.458) [-1981.698] * (-1990.984) [-1982.885] (-1995.219) (-1985.051) -- 0:04:17
      196700 -- (-1997.482) (-1994.503) (-1987.252) [-1990.759] * (-1991.802) [-1984.517] (-1998.855) (-1986.995) -- 0:04:17
      196800 -- (-1994.381) [-1987.102] (-1988.615) (-1989.254) * (-1989.441) [-1986.403] (-1995.377) (-1987.788) -- 0:04:17
      196900 -- (-2001.328) [-1986.756] (-1989.023) (-1980.757) * (-1987.462) (-1992.540) (-1990.662) [-1979.257] -- 0:04:16
      197000 -- (-1992.352) (-1996.268) (-1992.865) [-1983.667] * (-1984.400) [-1987.429] (-1997.051) (-1982.582) -- 0:04:16

      Average standard deviation of split frequencies: 0.004781

      197100 -- (-1993.432) (-1994.175) (-1988.289) [-1981.056] * (-1985.602) (-1988.700) (-1994.397) [-1989.146] -- 0:04:16
      197200 -- (-2002.995) [-1986.976] (-1984.744) (-1985.738) * [-1990.414] (-2000.583) (-1995.248) (-1984.253) -- 0:04:16
      197300 -- (-2004.357) (-1985.945) [-1983.161] (-1988.699) * (-1986.028) [-1991.487] (-1991.396) (-1977.905) -- 0:04:16
      197400 -- (-2007.028) (-1987.670) [-1987.737] (-1992.526) * (-1988.674) (-1998.272) (-1994.857) [-1980.364] -- 0:04:16
      197500 -- (-2003.446) (-1997.300) (-1983.764) [-1987.666] * (-1989.916) (-2000.116) (-1995.481) [-1979.226] -- 0:04:15
      197600 -- (-1997.059) (-1997.833) [-1984.087] (-1985.838) * (-1993.794) (-1997.478) (-1989.932) [-1977.045] -- 0:04:15
      197700 -- (-1992.162) (-1992.987) (-1986.969) [-1986.560] * (-1986.813) (-2003.407) (-1998.987) [-1978.978] -- 0:04:15
      197800 -- (-1999.215) (-1991.808) [-1981.311] (-1981.080) * (-1983.952) (-2000.831) (-1991.297) [-1984.056] -- 0:04:15
      197900 -- (-1999.456) (-1989.562) (-1978.526) [-1981.781] * [-1983.024] (-1998.671) (-1984.472) (-1985.837) -- 0:04:15
      198000 -- (-1987.717) (-1990.961) [-1984.893] (-1986.098) * [-1984.717] (-1991.965) (-1989.549) (-1982.702) -- 0:04:15

      Average standard deviation of split frequencies: 0.004826

      198100 -- (-1986.954) (-1994.450) (-1979.085) [-1983.736] * [-1983.046] (-1992.700) (-1998.604) (-1987.219) -- 0:04:15
      198200 -- (-1988.883) (-1998.648) (-1989.975) [-1978.822] * [-1986.912] (-1989.657) (-1987.745) (-1985.675) -- 0:04:14
      198300 -- (-1992.172) (-1997.482) (-1987.458) [-1981.378] * (-1993.455) (-1988.849) (-1991.213) [-1982.464] -- 0:04:14
      198400 -- (-1992.801) (-1999.725) (-1986.928) [-1981.174] * (-1999.359) (-1987.995) (-1991.366) [-1983.817] -- 0:04:14
      198500 -- (-1997.032) (-2000.167) (-1989.266) [-1986.945] * (-1989.859) (-1985.410) (-1993.492) [-1982.283] -- 0:04:14
      198600 -- [-1989.720] (-1995.143) (-1985.520) (-1979.778) * [-1988.917] (-1995.344) (-1992.023) (-1981.973) -- 0:04:14
      198700 -- (-1988.429) (-1994.461) (-1983.516) [-1981.295] * (-1989.863) (-1999.896) (-1995.880) [-1981.200] -- 0:04:18
      198800 -- (-1991.469) [-1991.621] (-1990.145) (-1985.521) * (-1994.892) (-2000.419) (-1989.423) [-1983.314] -- 0:04:17
      198900 -- (-1996.028) [-1986.628] (-1993.658) (-1989.357) * (-1991.839) (-1995.781) (-1991.546) [-1982.746] -- 0:04:17
      199000 -- (-1998.259) (-1986.121) (-1998.593) [-1984.455] * (-1996.081) (-1989.303) (-1991.449) [-1983.610] -- 0:04:17

      Average standard deviation of split frequencies: 0.004530

      199100 -- (-1994.664) [-1989.771] (-1995.232) (-1990.604) * (-1993.230) (-1994.428) (-1987.809) [-1980.416] -- 0:04:17
      199200 -- (-1998.492) (-1989.234) (-1999.487) [-1987.992] * (-1996.829) (-1999.917) [-1986.477] (-1986.183) -- 0:04:17
      199300 -- (-1998.037) (-1987.620) [-1993.094] (-2000.114) * (-2005.735) (-1996.084) (-1982.656) [-1981.577] -- 0:04:17
      199400 -- (-1997.437) [-1988.212] (-2000.124) (-1995.359) * (-2000.225) (-2004.019) [-1985.797] (-1987.332) -- 0:04:16
      199500 -- (-1999.827) [-1981.923] (-1993.996) (-1984.583) * (-1996.801) (-2005.150) [-1989.421] (-1995.184) -- 0:04:16
      199600 -- (-2000.770) (-1986.760) (-1987.319) [-1987.275] * (-1998.265) (-1996.837) (-1991.228) [-1991.306] -- 0:04:16
      199700 -- (-1996.106) [-1980.750] (-1990.287) (-1982.341) * (-1997.200) (-1996.425) (-1990.297) [-1986.447] -- 0:04:16
      199800 -- (-1992.247) (-1988.467) (-1992.588) [-1981.213] * (-1998.044) (-1994.676) (-1991.237) [-1987.435] -- 0:04:16
      199900 -- (-1987.807) (-1991.823) [-1987.523] (-1978.171) * (-1992.284) (-1993.726) [-1989.265] (-1986.523) -- 0:04:16
      200000 -- (-1996.980) (-1988.060) (-1995.771) [-1986.086] * (-2007.199) (-1990.080) (-1992.000) [-1988.579] -- 0:04:16

      Average standard deviation of split frequencies: 0.004442

      200100 -- (-1992.956) [-1983.779] (-2001.119) (-1986.741) * (-2006.066) (-2002.954) [-1997.064] (-1992.511) -- 0:04:15
      200200 -- (-1992.589) [-1979.257] (-1995.180) (-1986.387) * (-1992.612) (-2003.845) (-1994.866) [-1985.646] -- 0:04:15
      200300 -- (-1994.406) (-1979.629) (-1998.439) [-1986.025] * (-1992.617) (-2000.350) (-1994.693) [-1985.552] -- 0:04:15
      200400 -- (-1994.641) [-1980.960] (-1998.135) (-1991.090) * [-1988.547] (-2008.651) (-1996.790) (-1989.314) -- 0:04:15
      200500 -- (-1999.472) [-1980.837] (-1997.453) (-1984.029) * (-1987.383) (-2003.667) (-1986.590) [-1981.902] -- 0:04:15
      200600 -- (-1999.725) (-1990.002) (-1999.104) [-1984.999] * (-1991.128) (-2019.960) (-1992.598) [-1980.404] -- 0:04:15
      200700 -- (-1998.672) (-1980.809) (-1994.967) [-1979.516] * (-1989.857) (-2020.492) (-1994.703) [-1981.035] -- 0:04:14
      200800 -- (-1997.837) (-1989.747) (-1996.880) [-1980.598] * (-1991.006) (-2003.298) (-1993.935) [-1983.510] -- 0:04:14
      200900 -- (-2004.245) (-1987.671) (-1986.123) [-1982.133] * (-1989.319) (-2011.564) (-1997.727) [-1984.568] -- 0:04:14
      201000 -- (-2007.982) (-1985.850) (-1986.940) [-1978.227] * (-1985.237) (-2011.947) [-1994.158] (-1983.399) -- 0:04:14

      Average standard deviation of split frequencies: 0.004351

      201100 -- (-2004.012) (-1985.974) (-1985.596) [-1982.261] * [-1985.454] (-1999.494) (-1998.497) (-1982.726) -- 0:04:14
      201200 -- (-2000.866) (-1991.818) (-1987.568) [-1980.699] * (-1987.521) (-1992.240) (-2002.131) [-1981.752] -- 0:04:14
      201300 -- (-1994.035) (-1988.627) (-1995.367) [-1981.305] * (-1994.979) (-1995.660) (-1996.966) [-1979.818] -- 0:04:13
      201400 -- (-1987.421) (-1988.437) (-1998.447) [-1983.290] * (-1990.144) (-1996.883) (-1992.346) [-1982.228] -- 0:04:13
      201500 -- (-1988.772) (-1994.835) (-2003.686) [-1982.273] * [-1985.363] (-2007.390) (-1998.323) (-1986.055) -- 0:04:13
      201600 -- (-1994.589) (-1984.896) (-1997.468) [-1985.437] * (-1986.605) (-2002.125) (-1999.972) [-1983.637] -- 0:04:13
      201700 -- (-1989.415) [-1985.286] (-1993.838) (-1980.579) * (-1987.309) [-1994.405] (-2000.181) (-1986.835) -- 0:04:13
      201800 -- (-1992.761) (-1985.897) (-1989.406) [-1984.475] * [-1985.998] (-2006.395) (-1997.606) (-1990.646) -- 0:04:17
      201900 -- (-1992.685) (-1986.704) (-1984.453) [-1981.346] * (-1990.903) (-1998.814) (-1996.467) [-1985.426] -- 0:04:16
      202000 -- (-2004.488) (-1983.379) [-1984.253] (-1982.047) * (-1995.200) (-2002.623) (-2003.787) [-1984.181] -- 0:04:16

      Average standard deviation of split frequencies: 0.004198

      202100 -- (-2005.996) [-1982.193] (-1983.047) (-1982.575) * (-1995.710) (-1998.896) (-1995.976) [-1982.251] -- 0:04:16
      202200 -- (-2002.445) (-1984.429) [-1988.731] (-1985.431) * (-1989.472) (-1995.778) (-1991.700) [-1982.331] -- 0:04:16
      202300 -- (-1993.772) (-1985.871) [-1979.750] (-1980.689) * (-1992.373) (-1997.812) (-1988.295) [-1981.590] -- 0:04:16
      202400 -- (-1994.139) (-1986.865) [-1979.240] (-1985.378) * (-1996.054) [-1996.156] (-1988.958) (-1980.119) -- 0:04:16
      202500 -- (-1991.896) [-1996.435] (-1979.199) (-1989.367) * (-1992.457) (-1994.758) (-1991.285) [-1982.965] -- 0:04:15
      202600 -- (-1991.892) (-1990.226) [-1979.783] (-1985.921) * (-1992.701) (-2000.874) (-1989.891) [-1982.413] -- 0:04:15
      202700 -- (-1992.259) (-1988.400) [-1982.446] (-1993.119) * (-1993.754) (-2000.768) (-1988.560) [-1990.853] -- 0:04:15
      202800 -- (-1991.331) (-1988.664) [-1995.323] (-1999.295) * (-1993.782) (-1998.995) [-1986.352] (-1990.445) -- 0:04:15
      202900 -- (-1987.811) [-1988.137] (-1984.287) (-1999.181) * [-1990.429] (-2002.492) (-1987.720) (-1990.970) -- 0:04:15
      203000 -- [-1988.543] (-1990.986) (-1989.121) (-1995.263) * (-1994.079) (-1999.749) (-1990.428) [-1983.372] -- 0:04:15

      Average standard deviation of split frequencies: 0.004176

      203100 -- [-1994.057] (-1982.991) (-1997.373) (-2001.274) * (-1995.105) (-2010.093) (-1991.282) [-1982.379] -- 0:04:15
      203200 -- (-1991.178) (-1985.460) (-1990.872) [-1991.634] * (-1994.340) (-1993.732) [-1991.849] (-1977.982) -- 0:04:14
      203300 -- (-1997.730) [-1985.004] (-1992.457) (-1989.222) * (-1992.636) (-1991.118) (-1990.636) [-1978.259] -- 0:04:14
      203400 -- (-1997.691) (-1988.422) (-1991.563) [-1990.690] * (-1990.033) (-1989.473) (-1987.610) [-1980.024] -- 0:04:14
      203500 -- (-1997.862) [-1986.332] (-1990.175) (-1993.455) * [-1994.864] (-1985.043) (-1989.035) (-1985.146) -- 0:04:14
      203600 -- (-2005.327) (-1986.825) [-1983.031] (-1994.548) * (-2004.706) (-1985.222) (-1996.168) [-1979.217] -- 0:04:14
      203700 -- [-1994.107] (-1985.465) (-1984.023) (-1993.105) * (-2005.943) (-1989.551) (-1987.330) [-1985.763] -- 0:04:14
      203800 -- (-1992.538) (-1990.358) (-1990.266) [-1990.516] * (-2002.032) (-1989.548) [-1986.583] (-1978.394) -- 0:04:13
      203900 -- (-1985.940) [-1988.395] (-1992.404) (-1999.359) * (-1995.168) (-1988.843) (-1993.277) [-1979.109] -- 0:04:13
      204000 -- [-1986.332] (-1990.677) (-1994.977) (-1993.586) * (-1993.521) (-1987.646) (-1992.702) [-1978.194] -- 0:04:13

      Average standard deviation of split frequencies: 0.004025

      204100 -- [-1991.156] (-1987.516) (-1992.147) (-2003.235) * (-2002.800) (-1988.652) (-1990.250) [-1981.158] -- 0:04:13
      204200 -- (-1989.635) (-1986.056) [-1986.543] (-2018.502) * (-2004.387) [-1986.650] (-1986.397) (-1987.705) -- 0:04:13
      204300 -- (-1995.329) [-1984.876] (-1991.756) (-2004.710) * (-1991.501) (-1991.334) [-1990.737] (-1990.650) -- 0:04:13
      204400 -- (-1994.048) [-1981.036] (-1992.865) (-2005.936) * (-1988.230) (-1993.997) (-1992.367) [-1986.469] -- 0:04:13
      204500 -- (-1996.930) [-1981.306] (-1987.169) (-1992.723) * [-1988.007] (-1984.495) (-1998.971) (-1983.960) -- 0:04:12
      204600 -- [-1989.298] (-1985.082) (-1994.280) (-1993.263) * (-1991.676) [-1987.426] (-1999.046) (-1986.892) -- 0:04:12
      204700 -- (-1998.636) [-1980.699] (-1992.722) (-1983.144) * [-1989.449] (-1988.442) (-2005.851) (-1998.292) -- 0:04:12
      204800 -- (-1999.212) (-1979.814) [-1984.430] (-1985.818) * (-1986.182) (-1994.179) (-1992.180) [-1983.593] -- 0:04:12
      204900 -- (-2004.925) [-1980.028] (-1989.143) (-1986.677) * [-1987.014] (-1993.996) (-1993.982) (-1988.216) -- 0:04:12
      205000 -- (-2003.463) (-1984.553) [-1983.626] (-1990.143) * (-1991.518) (-1992.152) [-1992.426] (-1984.787) -- 0:04:15

      Average standard deviation of split frequencies: 0.004398

      205100 -- (-2003.911) (-1989.001) [-1983.779] (-1989.609) * [-1991.244] (-1994.499) (-1994.115) (-1986.689) -- 0:04:15
      205200 -- (-2003.377) (-1984.244) (-1986.630) [-1984.125] * [-1985.633] (-1999.889) (-1995.784) (-1992.006) -- 0:04:15
      205300 -- (-2001.641) (-1980.574) (-1992.386) [-1981.283] * (-1982.526) (-1998.579) (-2000.012) [-1982.743] -- 0:04:15
      205400 -- (-2003.680) [-1977.472] (-1992.324) (-1984.480) * [-1981.885] (-1996.885) (-1998.236) (-1980.628) -- 0:04:15
      205500 -- (-2015.903) [-1976.879] (-1989.055) (-1986.218) * [-1986.004] (-1993.934) (-2003.129) (-1985.425) -- 0:04:15
      205600 -- (-2023.561) (-1984.065) (-1992.319) [-1986.512] * (-1988.837) (-1993.707) (-2012.153) [-1984.370] -- 0:04:15
      205700 -- (-2007.134) [-1981.950] (-1990.116) (-1988.636) * (-1994.282) (-1998.325) (-2005.073) [-1984.019] -- 0:04:14
      205800 -- (-1997.819) [-1984.904] (-1985.598) (-1993.927) * (-1994.441) (-2001.497) (-1994.486) [-1984.334] -- 0:04:14
      205900 -- (-2007.502) (-1986.751) [-1985.646] (-1994.036) * (-1996.384) (-1996.577) (-1996.582) [-1985.092] -- 0:04:14
      206000 -- (-2013.326) [-1982.773] (-1985.831) (-1997.700) * (-2002.007) (-1996.112) (-1995.485) [-1983.646] -- 0:04:14

      Average standard deviation of split frequencies: 0.004247

      206100 -- (-1996.881) (-1986.248) [-1984.550] (-1995.006) * (-1991.802) (-1991.500) (-1990.740) [-1981.305] -- 0:04:14
      206200 -- (-2003.259) (-1987.431) (-1980.201) [-1997.044] * (-1989.741) (-1991.559) (-1992.322) [-1981.424] -- 0:04:14
      206300 -- (-1991.214) (-1984.211) [-1983.181] (-1994.981) * (-1993.451) (-1991.177) (-1997.999) [-1983.518] -- 0:04:13
      206400 -- (-1995.848) (-1981.575) [-1982.343] (-1992.222) * (-1991.044) (-1990.029) (-1991.343) [-1982.075] -- 0:04:13
      206500 -- (-1998.789) [-1982.969] (-1983.284) (-1994.738) * (-1985.816) (-1989.887) [-1990.451] (-1984.031) -- 0:04:13
      206600 -- (-1999.994) [-1989.261] (-1982.325) (-1988.459) * (-1987.038) (-1987.352) (-1996.248) [-1983.894] -- 0:04:13
      206700 -- [-1990.483] (-1983.901) (-1979.381) (-1990.546) * (-1982.637) (-1990.523) (-1995.477) [-1980.256] -- 0:04:13
      206800 -- (-1997.697) [-1984.423] (-1985.494) (-1995.289) * (-1986.474) (-1997.627) (-1998.444) [-1981.090] -- 0:04:13
      206900 -- (-2003.907) (-1980.542) [-1988.544] (-1993.140) * (-1988.006) (-1994.282) (-2004.288) [-1983.419] -- 0:04:12
      207000 -- (-1997.550) [-1978.537] (-1996.843) (-1990.456) * [-1992.538] (-2001.530) (-2006.427) (-1987.713) -- 0:04:12

      Average standard deviation of split frequencies: 0.004290

      207100 -- (-1994.773) [-1981.745] (-1993.997) (-1997.869) * (-1992.422) (-2001.858) (-2001.423) [-1983.274] -- 0:04:12
      207200 -- (-1987.994) [-1981.305] (-1990.354) (-1995.236) * (-1990.380) (-1997.513) (-1993.807) [-1986.628] -- 0:04:12
      207300 -- (-1993.210) [-1983.688] (-1990.052) (-1995.612) * [-1984.939] (-1999.400) (-1995.974) (-1995.886) -- 0:04:12
      207400 -- [-1987.068] (-1983.467) (-1991.981) (-2001.376) * (-1995.012) (-1996.463) [-1993.801] (-1984.828) -- 0:04:12
      207500 -- (-1989.426) [-1980.874] (-1986.534) (-1992.598) * (-2000.084) (-1993.603) (-1996.627) [-1988.637] -- 0:04:12
      207600 -- (-1989.980) [-1983.855] (-1985.852) (-1999.128) * (-1997.565) (-2007.698) (-1997.158) [-1983.717] -- 0:04:11
      207700 -- [-1991.580] (-1988.363) (-1990.985) (-2001.451) * (-1990.940) (-2009.240) (-1996.262) [-1985.478] -- 0:04:11
      207800 -- (-1992.792) (-1997.989) [-1984.039] (-1990.968) * (-1988.130) (-2004.869) (-1992.284) [-1982.690] -- 0:04:11
      207900 -- (-1996.788) (-1994.899) [-1983.366] (-1994.022) * (-1993.857) (-2007.627) (-1992.929) [-1981.131] -- 0:04:11
      208000 -- (-1992.170) (-2001.091) [-1979.200] (-1993.348) * (-1998.543) (-2005.987) [-1984.435] (-1982.848) -- 0:04:11

      Average standard deviation of split frequencies: 0.004142

      208100 -- (-2006.043) (-2010.330) [-1984.342] (-1994.533) * (-1990.907) (-2001.459) (-1981.987) [-1981.579] -- 0:04:14
      208200 -- (-2001.250) (-2002.723) (-1980.615) [-2000.559] * (-1997.589) (-2000.673) (-1984.272) [-1982.392] -- 0:04:14
      208300 -- (-1993.259) (-1995.015) [-1983.533] (-1995.787) * (-1986.529) (-1989.329) (-1987.578) [-1984.566] -- 0:04:14
      208400 -- (-1996.364) (-1991.609) (-1985.617) [-1986.733] * (-1989.896) (-1988.311) (-1988.428) [-1984.077] -- 0:04:14
      208500 -- (-1990.440) [-1991.127] (-1987.045) (-1989.012) * [-1992.300] (-1985.004) (-1993.169) (-1983.714) -- 0:04:14
      208600 -- (-1987.352) (-1995.729) [-1985.814] (-1988.753) * (-1983.692) (-1994.801) (-1986.170) [-1982.215] -- 0:04:14
      208700 -- (-1996.178) (-1997.515) [-1987.567] (-1984.109) * (-1987.742) (-1987.381) (-1987.366) [-1982.659] -- 0:04:14
      208800 -- (-1997.465) (-2011.984) (-1989.114) [-1984.145] * (-1991.255) (-1992.071) (-1993.072) [-1982.934] -- 0:04:13
      208900 -- (-2000.278) [-1998.469] (-1988.212) (-1991.072) * (-1995.807) (-1992.660) (-1989.646) [-1979.198] -- 0:04:13
      209000 -- (-2002.915) (-1989.536) [-1987.470] (-1998.074) * (-1992.192) (-1987.780) (-1987.461) [-1981.311] -- 0:04:13

      Average standard deviation of split frequencies: 0.004378

      209100 -- (-2001.523) (-1982.083) [-1987.223] (-2008.536) * (-1994.104) (-1988.271) (-1987.341) [-1979.682] -- 0:04:13
      209200 -- (-1995.343) (-1983.006) [-1983.432] (-2006.507) * (-2007.229) [-1981.335] (-1994.281) (-1983.326) -- 0:04:13
      209300 -- (-1999.253) [-1978.387] (-1980.276) (-2002.201) * (-2009.066) (-1988.336) (-1993.052) [-1984.510] -- 0:04:13
      209400 -- (-1999.123) (-1985.705) [-1982.078] (-2002.385) * (-2004.138) (-1993.240) [-1989.895] (-1987.442) -- 0:04:12
      209500 -- (-1995.447) (-1985.791) [-1985.445] (-1988.559) * (-1997.776) (-1993.546) [-1984.427] (-1985.297) -- 0:04:12
      209600 -- (-1992.645) [-1991.183] (-1991.426) (-1994.825) * (-1996.462) (-1996.845) (-1991.790) [-1987.084] -- 0:04:12
      209700 -- (-2003.128) (-1989.634) (-1987.227) [-1983.287] * (-1991.567) (-1996.013) [-1988.134] (-1991.139) -- 0:04:12
      209800 -- (-1998.613) (-1991.161) (-1987.719) [-1987.502] * (-1988.847) (-2003.958) [-1984.907] (-1996.503) -- 0:04:12
      209900 -- (-1989.496) (-1993.216) (-1990.702) [-1983.150] * (-1985.462) (-2002.182) [-1987.884] (-1987.561) -- 0:04:12
      210000 -- (-1989.134) (-1989.195) [-1991.310] (-1984.332) * (-1989.492) (-1989.944) [-1986.661] (-1994.806) -- 0:04:12

      Average standard deviation of split frequencies: 0.004551

      210100 -- (-1990.054) (-1989.396) (-1998.137) [-1980.947] * (-1988.024) [-1989.033] (-1992.124) (-1984.720) -- 0:04:11
      210200 -- (-1988.700) (-1985.593) (-1993.119) [-1982.700] * (-1991.280) (-1985.636) [-1998.099] (-1987.962) -- 0:04:11
      210300 -- (-1985.699) [-1989.256] (-1987.897) (-1984.712) * (-1994.562) (-1992.806) (-1992.631) [-1983.681] -- 0:04:11
      210400 -- (-1999.715) [-1981.920] (-1986.278) (-1983.132) * (-1990.436) (-2005.746) (-1992.008) [-1982.937] -- 0:04:11
      210500 -- (-2003.333) (-1987.727) (-1981.272) [-1979.782] * (-1994.716) (-1998.757) (-1995.028) [-1982.942] -- 0:04:11
      210600 -- (-1996.914) (-1981.996) [-1978.766] (-1977.379) * (-1991.921) (-1998.784) (-1996.103) [-1990.281] -- 0:04:11
      210700 -- (-1996.660) (-1986.676) (-1978.767) [-1981.666] * (-1989.993) (-1991.024) [-1986.941] (-1988.796) -- 0:04:10
      210800 -- (-2001.394) (-1982.671) [-1984.257] (-1978.696) * (-1989.226) [-1988.206] (-1992.173) (-1985.657) -- 0:04:10
      210900 -- (-1997.415) [-1987.986] (-1986.166) (-1980.173) * [-1988.241] (-1995.007) (-1993.322) (-1993.424) -- 0:04:10
      211000 -- (-1991.089) (-1993.531) (-1984.705) [-1985.419] * [-1985.622] (-1990.094) (-1993.643) (-1984.989) -- 0:04:10

      Average standard deviation of split frequencies: 0.004273

      211100 -- (-1990.373) (-1992.703) (-1995.712) [-1983.198] * (-1987.377) (-1996.363) (-1994.387) [-1984.109] -- 0:04:10
      211200 -- [-1986.736] (-1993.586) (-1989.215) (-1987.412) * (-1993.808) (-1994.332) (-1985.146) [-1981.056] -- 0:04:13
      211300 -- (-1984.940) (-1999.362) (-1985.923) [-1988.652] * [-1991.830] (-1995.511) (-1986.894) (-1991.378) -- 0:04:13
      211400 -- (-1990.097) (-1993.729) (-1988.125) [-1987.638] * (-1992.699) (-2007.469) (-1991.993) [-1993.963] -- 0:04:13
      211500 -- (-1987.572) (-1987.821) [-1980.469] (-1984.711) * (-1989.596) (-2002.120) [-1984.819] (-1994.718) -- 0:04:13
      211600 -- (-1984.671) (-1990.330) (-1985.079) [-1986.851] * (-1996.115) (-1997.448) [-1986.925] (-1999.564) -- 0:04:13
      211700 -- [-1985.451] (-1992.717) (-1992.350) (-1988.287) * (-1990.145) (-1994.955) [-1984.843] (-2005.665) -- 0:04:13
      211800 -- (-1989.155) (-2002.183) (-1991.060) [-1988.544] * (-1991.829) (-2000.466) [-1983.933] (-1987.564) -- 0:04:13
      211900 -- (-1990.509) (-1988.465) [-1990.789] (-1983.812) * (-1990.735) (-2000.171) [-1984.592] (-1981.174) -- 0:04:12
      212000 -- [-1991.230] (-1985.415) (-1991.552) (-1987.713) * (-1993.820) (-2003.852) (-1990.522) [-1984.109] -- 0:04:12

      Average standard deviation of split frequencies: 0.004571

      212100 -- (-1994.804) (-1988.178) [-1982.151] (-1989.492) * (-1992.698) (-1996.462) (-1992.159) [-1985.027] -- 0:04:12
      212200 -- (-1989.882) (-1997.424) [-1981.591] (-1987.598) * (-1993.579) (-1992.354) (-1987.417) [-1984.942] -- 0:04:12
      212300 -- (-1989.022) (-1998.174) [-1982.912] (-1991.148) * (-1988.378) (-1997.389) (-1991.226) [-1989.932] -- 0:04:12
      212400 -- (-1991.841) (-1999.785) [-1976.162] (-1986.084) * [-1983.454] (-2006.097) (-1992.927) (-1987.465) -- 0:04:12
      212500 -- (-1988.056) (-1983.888) [-1978.750] (-1988.478) * (-1983.655) (-2001.245) [-1994.925] (-1984.885) -- 0:04:12
      212600 -- (-1990.459) (-1981.253) [-1979.172] (-1989.997) * [-1985.651] (-1995.130) (-2002.036) (-1988.522) -- 0:04:11
      212700 -- (-1997.704) (-1984.001) [-1982.714] (-1988.718) * (-1987.472) (-1993.350) (-2005.681) [-1989.121] -- 0:04:11
      212800 -- (-2004.444) (-1986.239) [-1979.200] (-1984.229) * [-1986.629] (-1993.734) (-2005.310) (-1986.417) -- 0:04:11
      212900 -- (-1997.594) (-1989.138) [-1979.531] (-1991.136) * (-1992.384) (-1997.615) (-2011.317) [-1985.294] -- 0:04:11
      213000 -- (-1988.533) (-1983.722) [-1981.505] (-1994.273) * [-1994.114] (-2011.920) (-2007.985) (-1985.194) -- 0:04:11

      Average standard deviation of split frequencies: 0.004675

      213100 -- (-1991.084) [-1983.382] (-1983.110) (-1994.179) * (-1994.038) (-2011.433) (-2007.599) [-1987.210] -- 0:04:11
      213200 -- (-1992.299) [-1982.421] (-1991.533) (-2008.399) * (-1995.754) (-2003.367) (-1997.253) [-1984.641] -- 0:04:10
      213300 -- (-1996.848) [-1979.723] (-1989.136) (-2005.875) * (-1998.304) (-1999.515) (-2003.264) [-1980.637] -- 0:04:10
      213400 -- (-1991.605) [-1982.098] (-1995.737) (-2002.491) * (-1995.584) (-1999.167) (-1998.150) [-1982.128] -- 0:04:10
      213500 -- [-1985.278] (-1985.168) (-1988.600) (-2007.743) * (-1997.391) (-2002.927) (-1994.772) [-1986.466] -- 0:04:10
      213600 -- (-1992.760) (-1983.964) [-1987.837] (-1996.768) * (-1997.574) (-1997.115) (-1998.994) [-1983.344] -- 0:04:10
      213700 -- (-1990.486) (-1999.171) [-1987.666] (-1992.975) * (-1995.881) (-1997.678) (-1995.744) [-1981.115] -- 0:04:10
      213800 -- [-1992.782] (-1985.293) (-1986.567) (-1993.490) * (-1991.501) (-2001.977) (-1993.590) [-1984.481] -- 0:04:10
      213900 -- (-1997.573) (-1983.767) [-1985.606] (-1988.260) * [-1989.206] (-2006.922) (-1989.436) (-1989.442) -- 0:04:09
      214000 -- (-1996.176) [-1983.585] (-1985.450) (-1996.346) * (-1996.107) (-2000.612) (-1988.410) [-1983.946] -- 0:04:09

      Average standard deviation of split frequencies: 0.004466

      214100 -- (-1995.457) (-1995.500) [-1985.838] (-1994.483) * (-1997.276) (-2004.831) (-1993.938) [-1982.851] -- 0:04:09
      214200 -- (-1991.247) (-1994.112) [-1983.789] (-1992.426) * [-1994.307] (-2001.499) (-1993.399) (-1997.702) -- 0:04:09
      214300 -- (-1988.694) (-1986.521) [-1983.548] (-1992.619) * (-1996.139) (-2000.946) [-1997.195] (-1993.552) -- 0:04:09
      214400 -- (-1985.939) (-1983.451) [-1982.245] (-1999.955) * (-1986.782) (-1996.186) (-1994.918) [-1997.527] -- 0:04:12
      214500 -- (-1992.660) [-1982.438] (-1985.992) (-1993.126) * [-1988.002] (-1999.909) (-1991.986) (-1991.440) -- 0:04:12
      214600 -- (-1991.306) [-1986.509] (-1994.496) (-1998.954) * (-2001.113) (-2007.834) (-2002.368) [-1990.869] -- 0:04:12
      214700 -- (-1996.822) [-1981.824] (-1991.556) (-2002.886) * (-2003.604) (-2003.490) (-2003.629) [-1991.380] -- 0:04:12
      214800 -- (-1994.789) [-1983.501] (-1993.736) (-1995.801) * (-1994.258) (-1995.353) (-1997.075) [-1992.635] -- 0:04:12
      214900 -- (-1996.257) [-1985.368] (-1997.456) (-1992.354) * [-1994.360] (-1996.073) (-1997.441) (-1987.958) -- 0:04:12
      215000 -- (-1995.358) (-1989.591) (-1986.952) [-1987.794] * (-1998.435) (-1991.322) (-1991.046) [-1986.475] -- 0:04:11

      Average standard deviation of split frequencies: 0.003943

      215100 -- (-1994.595) (-1989.891) (-1985.038) [-1986.756] * (-1994.113) (-1991.800) [-1984.479] (-1987.595) -- 0:04:11
      215200 -- (-1998.051) [-1988.653] (-1992.779) (-1989.320) * (-1987.861) [-1989.279] (-1996.595) (-1989.877) -- 0:04:11
      215300 -- (-1998.328) [-1983.636] (-1986.409) (-1991.558) * [-1991.735] (-1992.057) (-1995.335) (-1998.729) -- 0:04:11
      215400 -- (-1998.803) (-1983.880) [-1984.836] (-1991.835) * (-1991.089) (-1994.102) [-1986.650] (-1993.942) -- 0:04:11
      215500 -- (-1993.391) [-1981.572] (-1988.853) (-1993.450) * [-1987.282] (-2001.253) (-1986.836) (-1992.470) -- 0:04:11
      215600 -- [-1991.431] (-1986.047) (-1998.525) (-1999.321) * [-1986.997] (-2005.033) (-1985.171) (-1993.588) -- 0:04:11
      215700 -- (-1990.974) [-1987.118] (-2004.789) (-1989.560) * [-1983.914] (-2001.013) (-1988.675) (-2001.420) -- 0:04:10
      215800 -- [-1985.796] (-1992.726) (-2000.673) (-1991.709) * [-1990.337] (-2002.040) (-1987.513) (-2000.386) -- 0:04:10
      215900 -- [-1987.075] (-1990.742) (-1995.208) (-1997.889) * (-1989.640) (-2002.687) [-1983.788] (-2011.001) -- 0:04:10
      216000 -- (-1988.438) [-1985.774] (-1983.903) (-1994.747) * [-1987.597] (-2009.252) (-1983.074) (-1995.565) -- 0:04:10

      Average standard deviation of split frequencies: 0.003614

      216100 -- (-1996.222) (-1992.241) [-1985.712] (-1997.906) * [-1985.954] (-1999.102) (-1987.316) (-1992.637) -- 0:04:10
      216200 -- (-1989.470) (-1995.684) [-1988.353] (-2003.714) * [-1985.359] (-1997.658) (-1990.283) (-1998.269) -- 0:04:10
      216300 -- (-1992.869) (-1986.054) [-1979.751] (-2007.098) * [-1983.248] (-1991.712) (-1994.338) (-2001.965) -- 0:04:10
      216400 -- [-1992.273] (-1990.334) (-1986.390) (-2000.823) * (-1984.357) [-1989.786] (-1994.122) (-1999.029) -- 0:04:09
      216500 -- [-1986.819] (-1990.894) (-1990.279) (-1998.010) * (-1983.974) (-1994.626) [-1994.803] (-1999.138) -- 0:04:09
      216600 -- (-2005.268) (-1999.075) [-1986.702] (-1992.712) * [-1989.362] (-1999.666) (-1995.485) (-2001.843) -- 0:04:09
      216700 -- [-1987.511] (-1998.279) (-1996.568) (-1992.364) * (-1997.696) (-1997.084) [-1992.774] (-1997.718) -- 0:04:09
      216800 -- [-1980.401] (-1991.128) (-1985.029) (-1991.950) * (-1989.934) (-1988.050) (-1998.055) [-1987.964] -- 0:04:09
      216900 -- [-1980.409] (-1985.219) (-1989.223) (-1988.771) * (-1991.926) (-1988.307) (-2004.745) [-1986.079] -- 0:04:09
      217000 -- (-1982.345) [-1988.910] (-1984.968) (-1994.361) * (-1989.795) (-1985.891) (-2004.786) [-1992.831] -- 0:04:08

      Average standard deviation of split frequencies: 0.003783

      217100 -- [-1984.673] (-1988.320) (-1990.148) (-1984.117) * [-1994.184] (-1988.368) (-2007.070) (-1987.847) -- 0:04:08
      217200 -- (-1994.434) [-1990.015] (-1990.022) (-1988.651) * (-1991.994) [-1987.731] (-2003.124) (-1994.119) -- 0:04:08
      217300 -- (-1992.911) (-1995.611) (-1989.629) [-1983.749] * [-1989.034] (-1985.084) (-1997.069) (-1986.819) -- 0:04:08
      217400 -- (-2001.746) (-2003.212) [-1986.978] (-1984.864) * [-1988.679] (-1989.452) (-1984.012) (-1988.639) -- 0:04:08
      217500 -- (-1998.706) (-1991.631) [-1982.812] (-1984.730) * (-1992.915) (-1988.421) (-1986.291) [-1988.447] -- 0:04:11
      217600 -- (-1995.389) (-1985.485) (-1983.832) [-1986.879] * (-1992.142) (-1989.775) (-1989.620) [-1989.534] -- 0:04:11
      217700 -- (-1995.136) (-1980.805) [-1986.361] (-1992.210) * (-1991.216) (-1990.136) [-1992.083] (-1987.677) -- 0:04:11
      217800 -- (-1990.152) [-1978.248] (-1983.717) (-1993.776) * (-1995.531) (-1992.039) (-1994.031) [-1986.214] -- 0:04:11
      217900 -- [-1983.129] (-2002.981) (-1984.672) (-1995.750) * (-1998.825) (-1993.037) [-1991.276] (-1994.355) -- 0:04:11
      218000 -- (-1990.872) (-1988.841) (-1982.587) [-1989.593] * (-2002.839) (-2001.939) [-1986.023] (-1997.882) -- 0:04:11

      Average standard deviation of split frequencies: 0.004013

      218100 -- (-1987.479) [-1988.405] (-1982.727) (-1992.116) * (-2010.531) (-2008.155) [-1992.333] (-1997.470) -- 0:04:10
      218200 -- (-1990.416) (-1995.520) [-1983.146] (-1992.621) * (-2001.984) (-1998.772) [-1993.514] (-1998.281) -- 0:04:10
      218300 -- (-1994.828) (-1991.682) [-1981.625] (-1991.393) * (-2006.145) (-2001.868) [-1989.609] (-1994.339) -- 0:04:10
      218400 -- (-1991.490) (-1988.481) [-1984.758] (-1991.978) * (-2007.402) (-1997.210) (-1999.271) [-1991.941] -- 0:04:10
      218500 -- (-1999.252) (-1986.433) [-1981.428] (-1992.565) * (-2004.452) (-1993.501) [-1988.592] (-1990.340) -- 0:04:10
      218600 -- (-1999.237) (-1990.281) [-1979.400] (-1988.399) * (-1994.685) (-1999.507) (-1997.116) [-1992.116] -- 0:04:10
      218700 -- (-1993.843) (-1987.126) [-1993.419] (-1988.459) * (-1986.110) (-2001.387) [-1996.681] (-1993.335) -- 0:04:10
      218800 -- (-1989.978) (-1984.760) (-1992.409) [-1990.000] * [-1986.281] (-2005.484) (-1994.598) (-1990.666) -- 0:04:09
      218900 -- (-1997.623) [-1989.705] (-1986.966) (-1996.624) * [-1985.124] (-2006.056) (-1991.872) (-1991.719) -- 0:04:09
      219000 -- (-1996.015) [-1988.254] (-1983.827) (-1999.114) * [-1989.029] (-2001.379) (-1990.423) (-1993.885) -- 0:04:09

      Average standard deviation of split frequencies: 0.003810

      219100 -- (-1994.994) [-1981.595] (-1982.835) (-1993.091) * [-1993.594] (-1995.027) (-1989.777) (-2013.190) -- 0:04:09
      219200 -- (-1984.507) [-1983.389] (-1983.151) (-1995.503) * (-1996.092) [-1995.587] (-1987.880) (-2000.975) -- 0:04:09
      219300 -- (-1985.864) (-1987.875) [-1981.530] (-2007.306) * (-1990.493) [-1991.284] (-1988.288) (-2003.373) -- 0:04:09
      219400 -- (-1986.360) [-1984.850] (-1980.797) (-1991.002) * (-1993.871) [-1994.792] (-1995.572) (-2004.438) -- 0:04:09
      219500 -- (-1991.589) (-1987.005) [-1980.564] (-1991.459) * (-2000.221) (-1999.818) [-1989.912] (-2002.801) -- 0:04:08
      219600 -- (-1983.496) (-1986.670) [-1981.943] (-1996.802) * (-2004.942) [-1990.013] (-1987.133) (-2007.965) -- 0:04:08
      219700 -- (-1986.858) [-1981.388] (-1989.096) (-1994.746) * (-2000.434) (-1992.910) [-1992.615] (-2007.919) -- 0:04:08
      219800 -- (-1988.888) [-1981.890] (-1990.729) (-2000.201) * (-2001.435) (-1997.409) [-1987.182] (-2004.635) -- 0:04:08
      219900 -- (-1988.122) (-1983.061) (-1988.518) [-1995.321] * (-2019.978) (-2000.626) [-1988.956] (-1996.329) -- 0:04:08
      220000 -- [-1985.532] (-1982.662) (-1990.247) (-1998.826) * (-2010.587) (-1994.669) [-1985.836] (-1998.730) -- 0:04:08

      Average standard deviation of split frequencies: 0.003793

      220100 -- (-1988.192) [-1983.140] (-1993.748) (-1999.567) * (-2009.985) [-1987.618] (-1984.193) (-2001.470) -- 0:04:08
      220200 -- [-1988.962] (-1984.155) (-1993.829) (-2003.561) * (-2000.277) (-1986.484) [-1985.321] (-1994.924) -- 0:04:07
      220300 -- (-1993.310) [-1983.211] (-1993.648) (-2000.000) * (-2013.280) (-1993.099) [-1987.609] (-1987.884) -- 0:04:07
      220400 -- (-1992.860) [-1988.517] (-1995.679) (-1997.278) * (-2005.691) (-1987.899) [-1994.857] (-1995.700) -- 0:04:07
      220500 -- (-1988.257) [-1980.652] (-1997.220) (-1994.817) * (-2008.662) [-1989.294] (-1991.929) (-1995.937) -- 0:04:07
      220600 -- (-1983.555) [-1983.596] (-1996.937) (-1999.017) * (-2008.215) [-1987.508] (-1993.741) (-1987.558) -- 0:04:10
      220700 -- [-1982.559] (-1985.374) (-1982.364) (-1997.469) * (-2016.971) (-1989.263) (-1991.960) [-1985.759] -- 0:04:10
      220800 -- [-1981.383] (-1988.055) (-1982.459) (-2002.099) * (-2006.581) (-1991.156) [-1992.173] (-1985.683) -- 0:04:10
      220900 -- (-1981.846) (-1991.027) [-1983.225] (-2011.612) * (-2012.533) [-1990.739] (-1989.660) (-1993.636) -- 0:04:10
      221000 -- [-1988.088] (-1990.059) (-1981.286) (-1999.608) * (-2005.301) [-1985.999] (-1984.966) (-1996.055) -- 0:04:10

      Average standard deviation of split frequencies: 0.003897

      221100 -- [-1986.475] (-1998.174) (-1980.841) (-2003.252) * (-2000.502) (-1982.477) (-1985.820) [-1987.715] -- 0:04:10
      221200 -- (-1988.298) (-1997.054) [-1984.098] (-1990.120) * (-2012.435) (-1987.129) (-1997.717) [-1986.147] -- 0:04:09
      221300 -- (-1992.381) (-1992.126) [-1986.418] (-1994.723) * (-1993.963) (-1989.187) [-1993.978] (-1990.879) -- 0:04:09
      221400 -- (-1996.522) [-1990.506] (-1996.250) (-2002.883) * (-1995.648) (-1989.482) [-1986.514] (-1986.260) -- 0:04:09
      221500 -- [-1985.169] (-1987.922) (-1985.179) (-1996.530) * (-1991.920) (-1998.661) [-1988.476] (-1987.559) -- 0:04:09
      221600 -- [-1985.430] (-1991.066) (-1986.982) (-1997.029) * (-1996.727) (-2000.665) (-1986.401) [-1991.795] -- 0:04:09
      221700 -- (-1991.787) [-1992.214] (-1991.527) (-2001.094) * (-2011.060) (-2002.097) (-1987.903) [-1990.200] -- 0:04:09
      221800 -- (-1993.853) (-1992.156) [-1993.801] (-1999.792) * (-2013.928) (-1994.459) [-1992.868] (-1997.169) -- 0:04:09
      221900 -- (-1990.146) [-1987.724] (-1991.645) (-1998.860) * (-2005.589) [-1989.557] (-1990.467) (-1994.709) -- 0:04:08
      222000 -- [-1986.777] (-1999.813) (-1989.421) (-1996.935) * (-2005.741) [-1991.435] (-1995.751) (-2000.531) -- 0:04:08

      Average standard deviation of split frequencies: 0.003881

      222100 -- [-1988.075] (-1996.488) (-1989.058) (-1999.663) * (-2003.659) [-1994.619] (-1999.094) (-2000.217) -- 0:04:08
      222200 -- (-1990.603) (-2004.157) [-1983.865] (-1996.420) * (-2009.795) (-1992.341) (-1990.470) [-1994.704] -- 0:04:08
      222300 -- (-1984.079) (-2000.175) [-1983.338] (-1992.131) * (-2000.327) [-1990.954] (-1990.428) (-1998.582) -- 0:04:08
      222400 -- [-1989.794] (-1996.595) (-1981.836) (-1991.103) * (-1997.273) [-1988.736] (-1984.734) (-1999.088) -- 0:04:08
      222500 -- [-1986.889] (-1993.575) (-1987.957) (-1990.026) * (-1989.660) (-1992.665) [-1991.297] (-1994.790) -- 0:04:08
      222600 -- (-1985.821) (-1991.753) (-1993.926) [-1991.063] * [-1991.404] (-1992.949) (-1988.103) (-1985.491) -- 0:04:07
      222700 -- (-1984.394) (-1992.590) (-1985.199) [-1985.487] * (-1990.637) (-1992.088) (-1993.407) [-1984.725] -- 0:04:07
      222800 -- [-1988.833] (-2002.808) (-1986.617) (-1986.689) * (-1997.089) [-1984.959] (-1990.589) (-1996.313) -- 0:04:07
      222900 -- (-1986.616) (-1993.668) (-1984.019) [-1985.033] * (-1992.047) (-1986.226) [-1988.060] (-2002.908) -- 0:04:07
      223000 -- (-1992.808) (-1989.001) [-1981.083] (-1987.560) * (-1988.740) (-1999.744) [-1988.787] (-1989.562) -- 0:04:07

      Average standard deviation of split frequencies: 0.003983

      223100 -- (-1988.356) (-1985.824) [-1984.808] (-1997.833) * (-1995.750) (-2001.753) [-1982.061] (-1986.392) -- 0:04:07
      223200 -- [-1994.276] (-1989.129) (-1992.160) (-2001.155) * (-1990.617) (-1994.777) [-1983.350] (-1994.486) -- 0:04:07
      223300 -- (-1994.169) [-1985.957] (-1989.443) (-2008.852) * (-1996.549) (-1995.857) (-1983.673) [-1984.708] -- 0:04:06
      223400 -- (-1993.739) (-1984.524) [-1988.659] (-1991.935) * (-1995.764) (-2003.259) (-1984.441) [-1988.430] -- 0:04:06
      223500 -- [-1994.453] (-1986.194) (-1990.084) (-2000.527) * (-1994.969) (-2000.515) [-1984.809] (-1987.905) -- 0:04:06
      223600 -- (-2001.179) [-1983.057] (-1995.778) (-2000.971) * (-1995.988) (-1988.954) [-1982.597] (-1987.399) -- 0:04:06
      223700 -- (-2002.809) [-1980.618] (-1998.749) (-1990.400) * (-2005.340) (-1988.390) [-1987.519] (-1988.725) -- 0:04:09
      223800 -- (-1999.141) (-1982.748) (-2000.255) [-1996.258] * (-1997.771) (-1990.156) (-1992.268) [-1991.133] -- 0:04:09
      223900 -- (-1999.371) [-1979.016] (-2001.163) (-2001.644) * (-2000.743) (-1993.951) [-1985.837] (-1997.272) -- 0:04:09
      224000 -- (-2004.757) [-1981.021] (-1995.970) (-1993.073) * (-2002.361) (-1992.950) [-1984.276] (-2010.794) -- 0:04:09

      Average standard deviation of split frequencies: 0.003966

      224100 -- (-1996.490) [-1981.212] (-1991.439) (-1991.233) * (-1997.534) (-1987.854) [-1983.932] (-2014.113) -- 0:04:09
      224200 -- (-1996.208) (-1986.360) (-1990.956) [-1993.407] * (-2002.186) [-1990.326] (-1986.337) (-2006.014) -- 0:04:09
      224300 -- (-2003.324) [-1985.140] (-1988.862) (-1987.802) * (-2001.755) [-1987.318] (-1985.709) (-1996.774) -- 0:04:08
      224400 -- (-2003.796) [-1985.939] (-1988.459) (-1987.545) * (-2000.101) (-1985.309) [-1982.534] (-1997.313) -- 0:04:08
      224500 -- (-2002.118) (-1990.126) [-1984.253] (-1993.133) * (-2004.711) [-1985.085] (-1989.592) (-1997.353) -- 0:04:08
      224600 -- (-2000.908) (-1986.768) [-1984.121] (-1998.564) * (-2011.215) (-1986.362) [-1996.681] (-1995.359) -- 0:04:08
      224700 -- (-2001.901) (-1986.825) [-1982.392] (-1995.743) * (-2009.717) (-1996.832) (-1995.954) [-1994.976] -- 0:04:08
      224800 -- (-1997.422) [-1986.831] (-1988.602) (-2001.728) * (-2005.750) (-2003.566) (-1994.745) [-1989.811] -- 0:04:08
      224900 -- (-1998.005) (-1987.180) (-1992.576) [-1989.301] * (-2005.803) (-1997.459) [-1988.099] (-1989.167) -- 0:04:08
      225000 -- (-1997.307) [-1983.708] (-1999.768) (-1992.215) * (-2005.298) (-2005.500) [-1984.358] (-1986.000) -- 0:04:08

      Average standard deviation of split frequencies: 0.004187

      225100 -- (-1996.893) (-1987.033) [-1993.755] (-1999.421) * (-2004.024) (-1999.918) [-1990.687] (-1989.526) -- 0:04:07
      225200 -- (-1992.739) [-1992.252] (-2000.249) (-2002.949) * (-1998.835) (-1990.611) (-1994.201) [-1991.308] -- 0:04:07
      225300 -- (-1993.270) [-1990.580] (-2010.370) (-2004.906) * (-1995.338) [-1986.526] (-1990.821) (-1993.396) -- 0:04:07
      225400 -- (-1998.595) [-1988.044] (-2006.347) (-2007.226) * (-1991.438) [-1988.068] (-1990.705) (-1993.631) -- 0:04:07
      225500 -- [-1987.808] (-1996.032) (-2009.537) (-2010.272) * (-1997.199) (-1993.086) [-1989.440] (-1994.815) -- 0:04:07
      225600 -- [-1990.171] (-1998.666) (-1997.474) (-1998.530) * [-1999.432] (-2000.584) (-1990.376) (-1999.410) -- 0:04:07
      225700 -- (-1994.121) (-2001.875) [-1997.991] (-1991.689) * (-1993.485) (-1995.758) [-1991.069] (-2002.348) -- 0:04:07
      225800 -- [-1990.458] (-2003.148) (-1999.356) (-1992.554) * (-1997.980) (-1991.501) [-1988.934] (-1998.729) -- 0:04:06
      225900 -- [-1993.714] (-1996.591) (-1992.647) (-1996.199) * (-1992.188) (-1995.903) [-1988.138] (-1991.503) -- 0:04:06
      226000 -- (-1993.889) (-1989.009) (-1985.285) [-1989.556] * (-1990.595) (-1991.469) [-1989.974] (-1993.865) -- 0:04:06

      Average standard deviation of split frequencies: 0.004527

      226100 -- [-1987.393] (-1989.629) (-1988.403) (-1993.800) * [-1994.222] (-1996.455) (-1989.966) (-2006.459) -- 0:04:06
      226200 -- [-1984.931] (-1986.753) (-1994.286) (-1988.180) * [-1991.454] (-1995.698) (-1987.123) (-1996.016) -- 0:04:06
      226300 -- (-1983.199) (-1986.291) (-1995.350) [-1989.366] * [-1990.608] (-1994.931) (-1990.022) (-2001.624) -- 0:04:06
      226400 -- (-1990.268) (-1988.044) (-2007.144) [-1992.862] * (-1991.003) [-1991.398] (-1995.496) (-1995.408) -- 0:04:06
      226500 -- (-1988.653) [-1983.705] (-2009.854) (-1996.693) * (-1986.064) (-1991.102) (-1990.824) [-1990.517] -- 0:04:05
      226600 -- (-1994.345) [-1982.029] (-1994.168) (-2002.184) * (-1990.605) (-1993.701) [-1987.866] (-1994.540) -- 0:04:05
      226700 -- (-1986.840) [-1980.456] (-1998.888) (-2003.590) * (-1994.607) [-1995.386] (-1991.364) (-1995.003) -- 0:04:05
      226800 -- (-1992.546) [-1976.701] (-1995.730) (-2007.708) * (-1994.719) (-1990.138) (-1990.101) [-1994.885] -- 0:04:05
      226900 -- [-1990.420] (-1988.370) (-1987.132) (-2005.021) * (-1996.747) [-1990.620] (-1995.359) (-1999.863) -- 0:04:08
      227000 -- (-1986.331) (-1988.613) [-1979.226] (-2010.664) * (-1990.335) [-1996.647] (-1999.084) (-2002.851) -- 0:04:08

      Average standard deviation of split frequencies: 0.004387

      227100 -- [-1989.617] (-1982.951) (-1990.692) (-1994.640) * (-1994.846) [-1990.485] (-1994.569) (-2006.359) -- 0:04:08
      227200 -- (-1991.069) [-1985.989] (-1987.499) (-1996.691) * [-1988.302] (-1991.334) (-1992.536) (-2006.854) -- 0:04:08
      227300 -- (-1999.371) (-1982.628) [-1988.375] (-1990.276) * [-1987.419] (-1992.660) (-1997.921) (-2001.533) -- 0:04:08
      227400 -- (-1997.331) [-1980.063] (-1989.226) (-1990.217) * (-1986.279) (-1992.885) [-1989.229] (-2002.470) -- 0:04:08
      227500 -- (-2001.278) [-1977.917] (-1993.167) (-1992.382) * [-1986.518] (-1990.213) (-1994.759) (-2003.028) -- 0:04:07
      227600 -- (-1996.956) [-1977.802] (-1989.431) (-1995.943) * [-1989.092] (-2010.264) (-1996.440) (-1996.765) -- 0:04:07
      227700 -- (-2002.071) [-1976.474] (-1991.044) (-1993.609) * [-1990.788] (-2010.599) (-1997.917) (-2001.617) -- 0:04:07
      227800 -- (-2006.060) (-1976.841) (-1984.831) [-1991.862] * (-1991.418) (-2011.068) [-1995.171] (-1997.501) -- 0:04:07
      227900 -- (-1994.317) (-1979.236) [-1988.617] (-1989.434) * (-1997.765) [-2000.495] (-1994.427) (-1997.108) -- 0:04:07
      228000 -- (-1996.222) [-1979.335] (-1988.830) (-1988.920) * (-1995.581) (-1996.364) [-1990.227] (-1993.302) -- 0:04:07

      Average standard deviation of split frequencies: 0.004546

      228100 -- (-2000.403) [-1984.834] (-1984.149) (-1996.698) * (-1995.403) (-2000.780) (-1991.696) [-1995.132] -- 0:04:07
      228200 -- (-2004.406) [-1983.904] (-1990.502) (-1993.467) * [-1989.397] (-1994.878) (-1992.661) (-2003.577) -- 0:04:06
      228300 -- (-1992.102) (-1990.337) [-1990.707] (-1988.438) * [-1986.287] (-1993.092) (-1990.354) (-1996.309) -- 0:04:06
      228400 -- (-1994.400) (-1986.011) [-1986.038] (-1987.866) * [-1989.283] (-1988.004) (-1992.948) (-1989.071) -- 0:04:06
      228500 -- (-1999.729) (-1992.337) [-1982.618] (-1992.177) * (-1990.504) [-1987.748] (-1996.054) (-1991.011) -- 0:04:06
      228600 -- (-1994.072) (-1986.781) [-1983.923] (-1988.946) * (-1995.946) [-1992.148] (-1997.976) (-1994.919) -- 0:04:06
      228700 -- (-1994.734) (-1992.437) [-1982.703] (-1990.721) * (-1998.394) [-1992.584] (-1999.474) (-1993.001) -- 0:04:06
      228800 -- (-1986.785) (-1986.527) [-1982.418] (-2000.736) * (-1993.274) (-1990.767) (-1994.957) [-1988.604] -- 0:04:06
      228900 -- [-1993.616] (-1988.418) (-1993.820) (-1996.005) * (-1993.893) [-1991.976] (-1997.726) (-1987.901) -- 0:04:05
      229000 -- (-1995.205) (-1987.501) [-1985.775] (-1987.458) * (-1991.420) (-1997.111) [-1992.027] (-1992.405) -- 0:04:05

      Average standard deviation of split frequencies: 0.004877

      229100 -- (-1990.530) (-1998.112) [-1985.767] (-1988.937) * (-1992.434) (-1998.259) (-1989.537) [-1991.505] -- 0:04:05
      229200 -- (-1990.658) [-1987.190] (-1983.598) (-1987.019) * [-1983.202] (-1993.586) (-1996.254) (-1985.721) -- 0:04:05
      229300 -- (-1990.621) (-1986.971) (-1992.760) [-1994.996] * (-1985.608) (-1993.346) (-1990.782) [-1986.321] -- 0:04:05
      229400 -- (-1989.068) [-1984.081] (-1987.532) (-1995.748) * (-1995.654) (-2005.521) [-1995.375] (-1989.273) -- 0:04:05
      229500 -- (-1990.530) [-1981.336] (-1982.815) (-1989.870) * [-1988.971] (-1994.563) (-1997.089) (-2002.542) -- 0:04:05
      229600 -- (-1990.846) [-1978.514] (-1983.465) (-1995.300) * [-1983.117] (-1992.387) (-1995.347) (-2004.348) -- 0:04:04
      229700 -- (-1992.617) [-1979.884] (-1986.067) (-2007.252) * (-1983.522) [-1990.485] (-1998.444) (-1995.025) -- 0:04:04
      229800 -- [-1991.196] (-1983.731) (-1987.648) (-2016.105) * [-1979.646] (-1992.020) (-1998.282) (-1996.460) -- 0:04:04
      229900 -- (-1991.146) [-1984.470] (-1990.537) (-1996.063) * [-1983.266] (-1992.297) (-1996.490) (-1992.521) -- 0:04:04
      230000 -- (-1991.787) (-1982.230) [-1988.524] (-2002.101) * (-1986.692) [-1992.264] (-2004.085) (-1993.435) -- 0:04:07

      Average standard deviation of split frequencies: 0.004858

      230100 -- (-1998.882) [-1981.565] (-1994.430) (-2000.819) * (-1992.640) (-1986.584) [-1994.356] (-1989.560) -- 0:04:07
      230200 -- (-1994.194) [-1989.397] (-2012.641) (-2003.145) * (-1990.329) [-1986.582] (-1993.196) (-1988.364) -- 0:04:07
      230300 -- (-1988.899) [-1988.546] (-2012.932) (-1996.901) * (-1989.225) [-1986.691] (-2000.084) (-1982.477) -- 0:04:07
      230400 -- [-1984.683] (-1985.269) (-2001.249) (-1993.214) * (-1995.275) [-1986.616] (-2005.817) (-1983.820) -- 0:04:07
      230500 -- (-1990.382) [-1982.770] (-1992.146) (-1994.400) * (-1999.699) (-1986.247) (-2004.022) [-1986.489] -- 0:04:07
      230600 -- [-1987.706] (-1983.590) (-1985.900) (-1990.002) * (-1996.783) (-1990.260) (-1999.255) [-1985.071] -- 0:04:06
      230700 -- (-1988.049) (-1983.909) [-1984.379] (-1996.978) * (-1992.097) (-1987.545) (-2004.585) [-1990.545] -- 0:04:06
      230800 -- (-1995.217) (-1984.632) [-1985.351] (-1991.376) * [-1984.798] (-1985.245) (-1991.127) (-1987.220) -- 0:04:06
      230900 -- (-1999.056) (-1982.042) [-1984.621] (-1989.622) * [-1984.875] (-1986.493) (-1999.890) (-1985.442) -- 0:04:06
      231000 -- (-1991.884) [-1979.981] (-1981.908) (-1992.680) * [-1982.602] (-1989.715) (-2002.447) (-1989.102) -- 0:04:06

      Average standard deviation of split frequencies: 0.005185

      231100 -- (-1994.940) [-1979.335] (-1988.482) (-1996.625) * [-1986.521] (-1993.774) (-1997.930) (-1985.101) -- 0:04:06
      231200 -- (-1995.097) [-1978.792] (-1990.296) (-2012.718) * (-1985.277) (-2001.822) (-2006.306) [-1984.062] -- 0:04:06
      231300 -- (-1989.680) [-1980.389] (-1993.157) (-2002.436) * [-1984.888] (-2006.482) (-1996.049) (-1988.940) -- 0:04:05
      231400 -- (-1988.295) [-1977.499] (-1995.768) (-2003.250) * [-1991.152] (-1995.225) (-1995.522) (-1988.296) -- 0:04:05
      231500 -- (-1990.859) [-1977.113] (-1991.639) (-2001.925) * (-1994.143) (-1988.982) [-1990.706] (-1994.544) -- 0:04:05
      231600 -- (-1996.576) [-1978.689] (-1995.873) (-1999.621) * [-1987.237] (-1988.767) (-1992.771) (-2000.981) -- 0:04:05
      231700 -- [-1991.479] (-1980.794) (-2001.567) (-1999.340) * (-1983.403) [-1988.498] (-1988.183) (-1998.417) -- 0:04:05
      231800 -- (-1997.740) [-1980.773] (-2000.639) (-1994.486) * [-1983.720] (-1994.615) (-1992.457) (-1996.070) -- 0:04:05
      231900 -- (-1992.378) [-1985.601] (-2003.613) (-1995.509) * [-1990.284] (-1998.161) (-1995.573) (-1995.647) -- 0:04:05
      232000 -- (-2001.740) [-1984.078] (-2006.145) (-2001.067) * [-1988.841] (-2000.276) (-1990.836) (-1994.835) -- 0:04:04

      Average standard deviation of split frequencies: 0.005338

      232100 -- (-1991.097) [-1983.078] (-1992.798) (-2001.979) * (-1986.807) (-2002.576) [-1990.197] (-1997.582) -- 0:04:04
      232200 -- (-2004.562) [-1979.578] (-1994.762) (-1986.706) * (-1987.344) (-1994.911) [-1997.222] (-1994.586) -- 0:04:04
      232300 -- (-1996.508) (-1978.614) (-1987.892) [-1981.286] * [-1987.476] (-1997.489) (-1989.085) (-1989.642) -- 0:04:04
      232400 -- (-1998.259) [-1983.529] (-1992.593) (-1981.829) * (-1989.445) (-1994.130) [-1986.870] (-1989.709) -- 0:04:04
      232500 -- (-1989.171) (-1985.778) (-1995.119) [-1983.710] * (-1986.994) (-1993.291) [-1989.269] (-1988.768) -- 0:04:04
      232600 -- [-1987.426] (-1985.473) (-1996.966) (-1983.351) * (-1988.849) (-1997.138) (-1986.492) [-1986.737] -- 0:04:04
      232700 -- (-1985.048) [-1981.532] (-1989.912) (-1987.564) * [-1986.500] (-1989.864) (-1993.167) (-1987.551) -- 0:04:04
      232800 -- (-1989.920) [-1982.541] (-1996.015) (-1984.176) * (-1985.782) (-2002.242) (-1988.358) [-1983.420] -- 0:04:03
      232900 -- (-1992.317) [-1980.933] (-2001.114) (-1985.010) * (-1992.979) (-1993.751) (-1983.471) [-1984.288] -- 0:04:03
      233000 -- [-1990.965] (-1986.456) (-1993.730) (-1986.290) * (-1982.634) (-2002.591) [-1984.071] (-1995.794) -- 0:04:03

      Average standard deviation of split frequencies: 0.005545

      233100 -- [-1979.395] (-1982.973) (-1995.599) (-1993.727) * [-1981.461] (-1999.981) (-1988.752) (-1993.132) -- 0:04:06
      233200 -- [-1982.626] (-1988.354) (-2000.070) (-1996.877) * [-1990.287] (-1996.765) (-1988.523) (-1989.372) -- 0:04:06
      233300 -- (-1979.617) [-1983.792] (-2010.491) (-1997.592) * [-1991.662] (-1997.868) (-1994.287) (-1994.651) -- 0:04:06
      233400 -- (-1980.999) [-1981.301] (-1998.897) (-2008.891) * [-1988.480] (-1996.179) (-1996.238) (-1996.275) -- 0:04:06
      233500 -- (-1986.268) [-1985.509] (-1997.665) (-2010.180) * [-1985.675] (-1996.658) (-1995.167) (-1996.607) -- 0:04:06
      233600 -- [-1979.751] (-1983.106) (-1992.058) (-2002.555) * [-1989.617] (-1999.277) (-1996.417) (-1996.085) -- 0:04:06
      233700 -- [-1985.006] (-1992.098) (-1995.467) (-1991.734) * (-1989.655) (-1998.649) (-1993.686) [-1982.133] -- 0:04:05
      233800 -- (-1977.649) (-2000.049) [-1991.375] (-2002.144) * (-1988.000) (-1998.472) [-1985.422] (-1982.280) -- 0:04:05
      233900 -- (-1981.733) [-1991.499] (-1989.932) (-2002.003) * (-1987.314) (-1998.807) (-2000.459) [-1988.922] -- 0:04:05
      234000 -- [-1982.260] (-1992.944) (-1998.883) (-1993.465) * [-1986.445] (-2002.180) (-2000.022) (-1977.533) -- 0:04:05

      Average standard deviation of split frequencies: 0.005407

      234100 -- [-1979.900] (-2003.899) (-1991.305) (-1997.642) * (-1990.862) (-2006.042) (-1998.743) [-1981.453] -- 0:04:05
      234200 -- [-1980.210] (-1993.971) (-1992.518) (-1993.904) * (-1982.498) (-2002.882) (-1997.177) [-1981.543] -- 0:04:05
      234300 -- [-1986.724] (-1990.260) (-1994.867) (-1994.343) * [-1981.677] (-2001.349) (-1993.482) (-1983.609) -- 0:04:05
      234400 -- (-1991.828) [-1991.060] (-1994.905) (-1989.448) * [-1982.185] (-2005.177) (-1992.578) (-1989.095) -- 0:04:04
      234500 -- [-1984.994] (-1987.593) (-2005.156) (-1989.074) * [-1981.366] (-1998.006) (-1991.416) (-1986.616) -- 0:04:04
      234600 -- [-1980.175] (-1983.157) (-2007.409) (-1993.439) * [-1985.957] (-1991.536) (-1989.271) (-1986.311) -- 0:04:04
      234700 -- (-1982.770) (-1979.850) (-2006.618) [-1992.723] * [-1986.861] (-1990.527) (-1990.754) (-1993.842) -- 0:04:04
      234800 -- (-1989.923) [-1983.038] (-1994.986) (-1991.249) * [-1985.686] (-1989.899) (-1988.778) (-1992.574) -- 0:04:04
      234900 -- [-1980.074] (-1982.360) (-1987.809) (-1996.108) * (-1997.072) (-1990.189) [-1988.669] (-1995.598) -- 0:04:04
      235000 -- [-1981.195] (-1985.234) (-1999.562) (-2001.111) * (-1999.027) (-1997.431) (-1991.463) [-1988.852] -- 0:04:04

      Average standard deviation of split frequencies: 0.005154

      235100 -- [-1981.893] (-1983.972) (-2001.106) (-1999.517) * (-1990.530) (-1999.031) [-1993.175] (-1992.147) -- 0:04:04
      235200 -- [-1986.166] (-1985.120) (-1993.259) (-2002.688) * (-1991.706) (-1990.667) [-1990.689] (-1997.774) -- 0:04:03
      235300 -- [-1988.362] (-1986.991) (-1991.685) (-2005.673) * (-1990.096) [-1990.782] (-1989.484) (-1997.647) -- 0:04:03
      235400 -- (-1986.287) [-1980.987] (-1987.537) (-2005.881) * [-1982.172] (-1986.200) (-1985.727) (-1998.072) -- 0:04:03
      235500 -- [-1983.952] (-1983.200) (-1988.398) (-2008.002) * (-1983.069) (-1986.103) [-1984.173] (-1998.212) -- 0:04:03
      235600 -- (-1984.330) (-1988.537) [-1989.438] (-1996.321) * [-1983.840] (-1991.843) (-1981.141) (-1991.461) -- 0:04:03
      235700 -- (-1991.661) [-1991.347] (-1993.521) (-1987.165) * [-1979.029] (-1986.377) (-1986.506) (-2003.493) -- 0:04:03
      235800 -- (-1993.883) (-1996.161) (-1990.779) [-1988.492] * (-1980.272) (-1987.089) [-1987.827] (-1997.710) -- 0:04:03
      235900 -- [-1985.686] (-2002.110) (-1989.456) (-1988.627) * [-1978.741] (-1984.707) (-1992.034) (-1995.267) -- 0:04:02
      236000 -- [-1981.691] (-1998.635) (-1995.759) (-1989.632) * (-1979.870) [-1986.140] (-1992.211) (-1989.448) -- 0:04:02

      Average standard deviation of split frequencies: 0.005248

      236100 -- (-1981.213) (-2006.732) (-1996.880) [-1986.057] * [-1977.188] (-1985.580) (-1995.522) (-1988.202) -- 0:04:02
      236200 -- (-1980.297) (-1999.262) (-1998.896) [-1988.166] * [-1979.645] (-1986.488) (-1995.999) (-1989.822) -- 0:04:05
      236300 -- [-1978.622] (-1996.314) (-1996.401) (-1989.557) * [-1980.155] (-1986.964) (-1989.761) (-1998.616) -- 0:04:05
      236400 -- [-1978.849] (-2001.840) (-1995.021) (-1993.634) * (-1982.824) [-1986.164] (-1991.774) (-1998.627) -- 0:04:05
      236500 -- [-1982.397] (-2002.544) (-1996.464) (-1996.115) * (-1984.216) (-1982.249) (-1991.805) [-1988.603] -- 0:04:05
      236600 -- [-1981.640] (-1995.961) (-1994.904) (-2000.932) * (-1983.841) [-1983.082] (-1988.261) (-1993.829) -- 0:04:05
      236700 -- [-1979.108] (-1995.172) (-1990.916) (-1999.680) * [-1981.585] (-1988.627) (-1985.127) (-1993.815) -- 0:04:05
      236800 -- [-1979.026] (-1989.275) (-1991.888) (-1999.670) * (-1983.983) (-1997.010) (-1991.153) [-1984.753] -- 0:04:04
      236900 -- [-1979.764] (-2002.314) (-1995.929) (-2007.095) * [-1976.770] (-1988.784) (-1989.359) (-1985.880) -- 0:04:04
      237000 -- [-1979.936] (-1995.088) (-1991.462) (-2000.700) * [-1981.779] (-1990.671) (-1996.315) (-1982.685) -- 0:04:04

      Average standard deviation of split frequencies: 0.005110

      237100 -- (-1982.966) (-1997.474) [-1992.797] (-1988.614) * (-1986.720) (-1993.577) (-1998.641) [-1982.140] -- 0:04:04
      237200 -- [-1980.836] (-1993.318) (-1997.758) (-1983.510) * (-1987.442) (-1991.848) (-1998.471) [-1982.053] -- 0:04:04
      237300 -- [-1985.253] (-1994.077) (-1992.520) (-1988.128) * [-1980.731] (-1998.761) (-1996.322) (-1982.093) -- 0:04:04
      237400 -- (-1986.452) [-1999.534] (-2001.475) (-1990.457) * [-1979.336] (-1993.044) (-1991.569) (-1986.732) -- 0:04:04
      237500 -- (-1987.326) (-2001.317) (-1995.419) [-1991.945] * [-1977.736] (-1992.961) (-1991.757) (-1990.172) -- 0:04:04
      237600 -- (-1991.511) (-2001.834) (-1994.924) [-1987.384] * (-1984.579) (-1988.549) (-1988.924) [-1993.434] -- 0:04:03
      237700 -- (-1989.234) (-2004.026) [-1987.797] (-1990.102) * [-1992.539] (-1992.918) (-1991.263) (-1991.332) -- 0:04:03
      237800 -- (-1989.858) (-1999.690) [-1987.377] (-1991.951) * (-1995.645) (-1995.205) (-1994.092) [-1991.617] -- 0:04:03
      237900 -- (-1992.375) (-1994.958) [-1989.379] (-1990.308) * [-1987.975] (-1997.962) (-1995.671) (-1987.385) -- 0:04:03
      238000 -- (-1992.702) [-1994.246] (-1996.548) (-1998.878) * (-1993.498) (-1988.164) (-1999.281) [-1986.597] -- 0:04:03

      Average standard deviation of split frequencies: 0.005203

      238100 -- (-1991.299) (-1993.869) [-1992.871] (-2001.031) * (-1989.874) (-1991.745) (-1994.766) [-1982.664] -- 0:04:03
      238200 -- (-1986.629) (-1986.831) (-1986.605) [-1995.624] * [-1986.463] (-1991.247) (-1996.368) (-1985.468) -- 0:04:03
      238300 -- [-1987.715] (-1990.476) (-1996.055) (-2003.430) * (-1992.370) [-1995.779] (-1998.179) (-1990.241) -- 0:04:02
      238400 -- (-1991.579) (-1993.402) [-1992.339] (-1994.324) * (-1991.279) [-1987.641] (-1999.808) (-1987.691) -- 0:04:02
      238500 -- (-1993.850) (-1994.383) (-1995.018) [-1987.155] * (-1990.446) [-1994.343] (-1996.825) (-1981.375) -- 0:04:02
      238600 -- (-1994.777) (-2004.662) [-1992.747] (-1993.103) * (-1987.721) (-1992.362) (-1994.040) [-1979.198] -- 0:04:02
      238700 -- (-1993.562) (-2010.523) [-1988.388] (-1991.467) * (-1988.137) (-1996.189) (-1997.643) [-1979.328] -- 0:04:02
      238800 -- (-1992.136) (-2010.231) (-1991.651) [-1996.488] * (-1985.341) (-1996.427) (-2001.779) [-1981.673] -- 0:04:02
      238900 -- [-1986.356] (-2002.921) (-1991.425) (-1997.924) * [-1987.260] (-1990.522) (-2004.357) (-1988.501) -- 0:04:02
      239000 -- [-1983.700] (-2005.171) (-1988.396) (-1997.787) * [-1981.068] (-1991.881) (-1999.947) (-1992.580) -- 0:04:01

      Average standard deviation of split frequencies: 0.005574

      239100 -- [-1981.958] (-2007.912) (-1988.186) (-1998.483) * [-1982.770] (-1989.145) (-2002.522) (-1988.187) -- 0:04:01
      239200 -- (-1985.844) [-1986.390] (-1993.670) (-1992.252) * (-1984.141) (-1993.092) (-1996.996) [-1986.275] -- 0:04:01
      239300 -- (-1988.331) (-1988.235) [-1989.197] (-1991.828) * (-1991.270) (-1988.911) (-1999.119) [-1983.991] -- 0:04:04
      239400 -- (-1990.021) (-1996.480) (-1991.079) [-1990.127] * [-1979.435] (-1991.332) (-2000.742) (-1990.924) -- 0:04:04
      239500 -- (-1990.547) (-1992.295) (-1987.519) [-1990.815] * (-1982.600) (-1992.496) (-2003.866) [-1979.974] -- 0:04:04
      239600 -- (-2000.305) (-1986.988) (-1988.723) [-1985.518] * [-1986.883] (-1991.786) (-1999.457) (-1986.723) -- 0:04:04
      239700 -- (-1989.620) (-1987.726) [-1984.545] (-1987.521) * (-1992.619) (-1988.825) (-1998.089) [-1991.892] -- 0:04:04
      239800 -- (-1986.036) (-1993.182) [-1989.966] (-1991.858) * [-1993.208] (-1987.195) (-1992.681) (-1993.356) -- 0:04:04
      239900 -- [-1993.574] (-1998.410) (-1994.848) (-1989.299) * (-1997.359) [-1988.380] (-1993.373) (-1994.966) -- 0:04:03
      240000 -- [-1987.002] (-1995.012) (-1986.332) (-1993.285) * (-1996.770) (-1985.247) (-2009.885) [-1995.106] -- 0:04:03

      Average standard deviation of split frequencies: 0.004824

      240100 -- (-1990.985) (-1993.791) [-1985.717] (-1991.814) * (-1991.918) [-1992.454] (-1996.686) (-2001.254) -- 0:04:03
      240200 -- (-1999.404) (-1999.878) [-1987.521] (-1985.702) * (-1988.358) (-1995.454) [-1995.436] (-1999.302) -- 0:04:03
      240300 -- (-2002.057) (-1996.241) (-1987.082) [-1993.655] * (-1985.694) (-1992.379) (-1995.575) [-1988.610] -- 0:04:03
      240400 -- (-1993.993) (-1990.602) [-1986.064] (-1987.295) * [-1982.645] (-2000.180) (-1994.462) (-1985.756) -- 0:04:03
      240500 -- (-2001.933) (-1990.553) (-1996.470) [-1991.729] * (-1979.545) (-2000.662) (-1987.628) [-1986.662] -- 0:04:03
      240600 -- (-1990.341) (-2000.258) [-1991.868] (-1992.573) * [-1982.619] (-2001.541) (-1992.591) (-1987.346) -- 0:04:03
      240700 -- (-1992.521) (-1992.112) [-1991.090] (-1995.042) * [-1984.217] (-2002.201) (-1991.546) (-1985.809) -- 0:04:02
      240800 -- (-1999.517) [-1994.523] (-1985.646) (-1995.040) * [-1987.722] (-1990.524) (-1988.015) (-1988.125) -- 0:04:02
      240900 -- (-1996.060) (-1991.268) [-1987.305] (-1994.574) * [-1985.277] (-1993.815) (-1993.884) (-1984.268) -- 0:04:02
      241000 -- (-2000.851) [-1989.875] (-1993.338) (-2007.629) * (-1990.134) (-1997.446) (-1996.517) [-1984.010] -- 0:04:02

      Average standard deviation of split frequencies: 0.004746

      241100 -- (-2006.196) (-1992.216) [-1988.097] (-1998.861) * (-1987.834) (-1998.717) (-2006.594) [-1979.102] -- 0:04:02
      241200 -- (-2002.633) (-2000.668) [-1986.228] (-1991.973) * [-1983.698] (-2006.885) (-2007.990) (-1979.609) -- 0:04:02
      241300 -- [-2002.267] (-1997.420) (-1989.020) (-1994.673) * [-1980.065] (-2002.524) (-1999.453) (-1983.026) -- 0:04:02
      241400 -- (-1998.524) [-2000.415] (-1995.431) (-1996.541) * (-1984.950) (-2012.512) (-1994.556) [-1979.374] -- 0:04:01
      241500 -- (-1997.284) (-1996.867) [-1993.868] (-1994.897) * (-1984.155) (-2008.046) (-1995.708) [-1984.317] -- 0:04:01
      241600 -- (-1988.313) (-1998.149) [-1987.732] (-1990.084) * (-1981.477) (-2006.983) (-1994.318) [-1990.362] -- 0:04:01
      241700 -- (-2004.012) (-2000.865) (-1983.094) [-1987.533] * (-1982.697) (-2005.245) (-1988.185) [-1988.551] -- 0:04:01
      241800 -- (-1989.151) (-1997.159) [-1978.523] (-1988.696) * [-1982.053] (-2002.752) (-1994.012) (-1982.503) -- 0:04:01
      241900 -- (-1986.406) (-1998.734) [-1977.086] (-1985.223) * (-1989.283) (-2002.436) (-1991.517) [-1984.111] -- 0:04:01
      242000 -- (-1990.577) (-1997.888) [-1979.749] (-1989.804) * (-1983.382) (-1999.136) (-1989.291) [-1980.624] -- 0:04:01

      Average standard deviation of split frequencies: 0.004506

      242100 -- (-1985.250) (-2000.500) [-1981.096] (-1989.271) * [-1979.963] (-2006.429) (-1989.004) (-1981.901) -- 0:04:01
      242200 -- (-1987.743) (-2002.336) [-1982.013] (-1995.983) * (-1981.211) (-2001.858) (-1988.870) [-1979.825] -- 0:04:00
      242300 -- (-1992.038) (-2005.837) [-1978.495] (-2004.397) * (-1986.632) (-2005.652) (-1988.008) [-1983.033] -- 0:04:00
      242400 -- (-1991.473) (-1998.538) [-1979.755] (-2007.693) * [-1983.870] (-1997.694) (-1990.472) (-1981.214) -- 0:04:00
      242500 -- [-1981.928] (-2002.877) (-1978.498) (-2018.567) * [-1982.106] (-1996.760) (-1994.367) (-1984.634) -- 0:04:03
      242600 -- [-1982.980] (-1996.580) (-1981.345) (-2006.626) * (-1982.759) (-2002.919) (-1992.921) [-1988.467] -- 0:04:03
      242700 -- (-1984.406) (-2000.167) [-1978.053] (-2007.037) * (-1984.417) (-2002.295) (-1999.943) [-1989.020] -- 0:04:03
      242800 -- (-1996.319) (-1995.051) [-1979.582] (-2002.138) * [-1983.244] (-2003.841) (-2002.117) (-1994.554) -- 0:04:03
      242900 -- (-1992.236) (-1999.742) [-1980.603] (-1999.304) * [-1985.333] (-1992.942) (-1991.424) (-1984.057) -- 0:04:03
      243000 -- [-1983.786] (-1995.319) (-1983.547) (-1992.839) * (-1995.680) (-1994.041) (-2003.325) [-1980.074] -- 0:04:02

      Average standard deviation of split frequencies: 0.004818

      243100 -- (-1986.053) (-1996.657) [-1978.856] (-1989.573) * [-1990.897] (-1998.886) (-1995.002) (-1984.875) -- 0:04:02
      243200 -- (-1988.368) (-2000.512) [-1978.501] (-1993.375) * [-1986.473] (-2003.760) (-1999.179) (-1979.852) -- 0:04:02
      243300 -- (-1984.233) (-1996.993) [-1978.994] (-1996.428) * [-1986.922] (-2004.105) (-2000.153) (-1980.688) -- 0:04:02
      243400 -- (-1985.003) (-1990.334) [-1982.858] (-1994.267) * (-1988.820) (-2006.980) (-1988.865) [-1981.609] -- 0:04:02
      243500 -- (-1991.426) [-1986.086] (-1982.828) (-1998.753) * (-1990.574) (-1996.659) (-1985.495) [-1977.056] -- 0:04:02
      243600 -- [-1986.823] (-1987.555) (-1986.742) (-2003.744) * (-1994.807) (-1998.461) (-1987.427) [-1981.344] -- 0:04:02
      243700 -- [-1985.085] (-1991.645) (-1994.603) (-1998.320) * (-1992.303) (-1990.636) [-1989.844] (-1979.962) -- 0:04:02
      243800 -- (-1988.965) (-1988.184) (-1994.709) [-1986.099] * (-1994.019) (-1996.331) [-1993.834] (-1981.818) -- 0:04:01
      243900 -- [-1978.839] (-1989.644) (-1992.060) (-1983.132) * (-1993.160) (-1991.512) (-1995.594) [-1979.601] -- 0:04:01
      244000 -- [-1979.734] (-1995.463) (-1991.427) (-1989.025) * (-1987.764) (-1984.979) (-1997.204) [-1981.334] -- 0:04:01

      Average standard deviation of split frequencies: 0.004414

      244100 -- [-1980.494] (-1997.396) (-1987.960) (-1989.632) * (-1995.743) (-1984.053) (-1994.609) [-1977.888] -- 0:04:01
      244200 -- (-1985.432) (-1998.068) (-1981.463) [-1993.008] * (-1995.173) [-1986.079] (-1998.697) (-1984.861) -- 0:04:01
      244300 -- (-1994.798) (-1999.053) (-1982.653) [-1989.120] * (-1996.696) (-1989.562) (-1992.683) [-1985.095] -- 0:04:01
      244400 -- (-1988.664) (-1990.882) (-1986.029) [-1992.342] * (-1992.567) [-1987.002] (-1994.490) (-1983.526) -- 0:04:01
      244500 -- (-1988.034) (-1990.182) (-1996.640) [-1990.897] * (-1984.146) (-1989.489) (-1993.676) [-1982.442] -- 0:04:01
      244600 -- [-1982.346] (-1989.311) (-2001.127) (-1993.738) * (-1978.754) [-1985.668] (-1998.058) (-1993.362) -- 0:04:00
      244700 -- [-1982.804] (-2003.608) (-1994.085) (-1990.216) * [-1982.427] (-1991.219) (-1994.942) (-1988.770) -- 0:04:00
      244800 -- (-1982.915) (-1991.013) [-1990.361] (-1995.800) * [-1979.903] (-1997.466) (-1995.997) (-1980.177) -- 0:04:00
      244900 -- (-1984.371) [-1990.343] (-1988.006) (-1989.738) * (-1983.275) [-1984.727] (-2001.722) (-1984.108) -- 0:04:00
      245000 -- [-1986.748] (-1992.271) (-1986.264) (-1987.133) * [-1984.212] (-1986.332) (-2007.649) (-1990.530) -- 0:04:00

      Average standard deviation of split frequencies: 0.004504

      245100 -- [-1983.224] (-1992.875) (-1987.289) (-1993.357) * (-1983.688) (-1987.196) (-2013.297) [-1995.897] -- 0:04:00
      245200 -- [-1987.052] (-1997.209) (-1986.707) (-1989.935) * (-1987.641) [-1989.431] (-2006.657) (-1989.329) -- 0:04:00
      245300 -- [-1987.058] (-1998.529) (-1990.030) (-1984.822) * (-1983.416) (-1988.570) (-1992.755) [-1981.323] -- 0:03:59
      245400 -- (-1986.448) (-1995.384) (-1987.005) [-1988.596] * [-1980.774] (-1988.513) (-1990.059) (-1979.504) -- 0:03:59
      245500 -- (-1986.565) (-1996.497) [-1991.265] (-1991.050) * [-1983.449] (-1993.057) (-1989.329) (-1978.672) -- 0:03:59
      245600 -- (-1980.867) (-2001.985) (-1988.151) [-1990.777] * (-1982.836) (-1989.957) (-1991.289) [-1982.862] -- 0:04:02
      245700 -- [-1976.235] (-1994.459) (-1991.677) (-1989.494) * (-1984.675) (-1996.246) (-1993.794) [-1986.055] -- 0:04:02
      245800 -- [-1980.958] (-1992.731) (-1993.395) (-1995.417) * (-1979.470) (-1998.869) [-1990.995] (-1985.501) -- 0:04:02
      245900 -- [-1981.114] (-1990.308) (-2001.360) (-2003.700) * [-1986.073] (-2000.048) (-1990.202) (-1983.701) -- 0:04:02
      246000 -- (-1983.661) [-1988.574] (-1999.358) (-1992.116) * (-1989.529) (-1998.417) (-1995.097) [-1985.573] -- 0:04:02

      Average standard deviation of split frequencies: 0.004432

      246100 -- [-1981.837] (-1994.793) (-1988.761) (-1998.208) * (-1992.388) (-2017.480) [-1994.331] (-1981.802) -- 0:04:02
      246200 -- (-1984.536) [-1988.612] (-1985.504) (-1997.038) * (-1989.803) (-2018.537) (-1993.414) [-1981.470] -- 0:04:01
      246300 -- (-1989.296) (-1987.314) [-1989.448] (-2005.519) * (-1995.579) (-2000.966) (-1993.343) [-1980.803] -- 0:04:01
      246400 -- (-1994.258) [-1985.740] (-1990.120) (-2010.298) * (-1998.632) (-2000.810) (-1992.444) [-1981.937] -- 0:04:01
      246500 -- [-1982.751] (-1986.277) (-1989.965) (-2003.288) * (-2003.703) (-1998.521) (-2000.693) [-1984.261] -- 0:04:01
      246600 -- (-1980.558) [-1982.591] (-1987.681) (-2007.364) * (-1998.973) (-1997.741) (-1999.607) [-1983.678] -- 0:04:01
      246700 -- [-1980.095] (-1985.940) (-1989.836) (-2001.073) * (-2001.575) (-2003.602) [-1990.661] (-1986.447) -- 0:04:01
      246800 -- (-1987.040) [-1989.389] (-1988.004) (-1998.557) * (-1992.650) (-2003.743) [-1987.459] (-1981.564) -- 0:04:01
      246900 -- (-1990.385) [-1987.725] (-1989.275) (-2010.454) * (-1993.530) (-2009.136) [-1988.722] (-1995.254) -- 0:04:00
      247000 -- [-1983.116] (-1986.160) (-1989.959) (-2012.429) * (-1992.007) (-2008.126) [-1988.537] (-1997.079) -- 0:04:00

      Average standard deviation of split frequencies: 0.004468

      247100 -- (-1984.332) [-1984.296] (-1997.692) (-2023.201) * (-1996.713) (-2012.291) [-1990.602] (-1989.842) -- 0:04:00
      247200 -- [-1985.102] (-1984.207) (-1991.126) (-2000.574) * (-1993.089) (-2008.111) [-1985.598] (-1989.516) -- 0:04:00
      247300 -- (-1988.392) [-1985.473] (-1992.672) (-1994.004) * (-1992.117) (-2005.342) [-1985.441] (-1988.563) -- 0:04:00
      247400 -- [-1984.566] (-1994.473) (-2003.201) (-1986.333) * [-1988.747] (-2003.816) (-1986.944) (-1992.101) -- 0:04:00
      247500 -- [-1979.112] (-1995.934) (-1984.167) (-1983.711) * (-1988.635) (-2004.270) (-1994.477) [-1986.978] -- 0:04:00
      247600 -- [-1981.522] (-1996.871) (-1993.012) (-1986.250) * (-1992.486) (-2013.818) (-1996.387) [-1986.210] -- 0:04:00
      247700 -- (-1985.805) (-1992.035) (-1997.401) [-1985.506] * [-1987.265] (-2008.176) (-2009.536) (-1992.240) -- 0:03:59
      247800 -- (-1986.604) (-1985.078) (-1989.631) [-1983.956] * [-1984.276] (-1994.534) (-1996.082) (-1989.222) -- 0:03:59
      247900 -- [-1989.842] (-1993.091) (-1995.477) (-1987.951) * [-1984.418] (-1998.398) (-1992.229) (-1991.517) -- 0:03:59
      248000 -- (-1990.586) [-1991.729] (-1993.563) (-1980.206) * [-1983.129] (-2008.425) (-2001.840) (-1990.471) -- 0:03:59

      Average standard deviation of split frequencies: 0.004397

      248100 -- (-1990.159) (-1989.892) (-1995.302) [-1981.333] * [-1983.017] (-2002.458) (-2006.510) (-1987.065) -- 0:03:59
      248200 -- (-1991.263) (-1989.949) (-1998.673) [-1981.339] * [-1984.830] (-1997.309) (-2003.827) (-1988.122) -- 0:03:59
      248300 -- [-1989.070] (-1991.956) (-1989.439) (-1987.721) * [-1987.224] (-1993.550) (-2007.638) (-1983.501) -- 0:03:59
      248400 -- (-1983.599) (-1993.419) (-1988.434) [-1988.180] * (-1982.351) (-1997.840) (-2008.674) [-1987.918] -- 0:03:59
      248500 -- (-1982.101) (-1997.922) [-1989.851] (-1984.395) * [-1982.301] (-1998.390) (-2007.179) (-1991.579) -- 0:03:58
      248600 -- [-1983.369] (-2006.039) (-1993.442) (-1987.860) * [-1986.395] (-2012.282) (-2009.033) (-1990.446) -- 0:03:58
      248700 -- (-1983.131) (-2005.107) [-1985.914] (-1986.586) * (-1987.478) (-1995.825) (-1995.053) [-1990.632] -- 0:04:01
      248800 -- [-1977.990] (-2000.685) (-1987.280) (-1985.019) * [-1993.683] (-1996.910) (-1992.065) (-1992.681) -- 0:04:01
      248900 -- (-1982.848) (-1992.865) (-1997.191) [-1982.807] * (-2000.578) (-2001.613) [-1990.875] (-1996.064) -- 0:04:01
      249000 -- (-1985.517) (-1991.618) (-1992.072) [-1980.118] * (-1997.770) [-1987.552] (-1991.355) (-1991.186) -- 0:04:01

      Average standard deviation of split frequencies: 0.004162

      249100 -- [-1982.095] (-1994.219) (-1993.398) (-1980.600) * (-2005.440) (-1993.718) (-1991.171) [-1989.113] -- 0:04:01
      249200 -- [-1985.899] (-1982.476) (-1990.428) (-1988.517) * (-2002.359) (-1993.361) [-1992.099] (-2000.574) -- 0:04:01
      249300 -- (-1985.563) [-1984.777] (-1991.633) (-1984.002) * (-1991.696) (-1997.501) [-1991.139] (-1995.675) -- 0:04:00
      249400 -- (-1988.006) [-1984.621] (-2000.163) (-1984.566) * [-1992.586] (-1995.261) (-1995.072) (-1993.416) -- 0:04:00
      249500 -- (-1994.268) [-1985.417] (-2000.698) (-1984.473) * (-1992.213) (-1991.154) (-1996.037) [-1992.310] -- 0:04:00
      249600 -- (-1995.891) (-1981.855) (-1996.136) [-1979.618] * (-1992.170) (-1997.435) [-1991.629] (-1990.857) -- 0:04:00
      249700 -- (-1985.509) (-1980.440) [-1989.143] (-1996.226) * (-1987.256) (-1998.525) (-1993.727) [-1985.431] -- 0:04:00
      249800 -- (-1988.864) [-1981.906] (-1991.595) (-1988.046) * [-1986.409] (-2003.439) (-1988.217) (-1988.614) -- 0:04:00
      249900 -- (-2003.880) [-1983.146] (-1992.170) (-1982.389) * (-1991.152) (-1998.887) (-1986.698) [-1986.132] -- 0:04:00
      250000 -- (-1993.447) [-1981.887] (-1992.048) (-1982.832) * (-1993.379) (-1998.181) [-1989.026] (-1985.140) -- 0:04:00

      Average standard deviation of split frequencies: 0.004415

      250100 -- (-1998.623) (-1978.379) (-1992.549) [-1982.684] * (-1994.466) (-1996.102) (-1989.738) [-1985.775] -- 0:03:59
      250200 -- (-1998.501) [-1983.119] (-1989.817) (-1986.191) * (-1996.557) (-2000.078) (-1986.939) [-1987.010] -- 0:03:59
      250300 -- (-1992.515) (-1984.976) (-1984.478) [-1979.428] * [-1985.999] (-1992.093) (-1991.530) (-1987.766) -- 0:03:59
      250400 -- (-1999.781) (-1995.309) (-1988.347) [-1983.505] * [-1987.265] (-2008.653) (-1991.647) (-1985.213) -- 0:03:59
      250500 -- (-2004.501) (-1997.729) [-1983.417] (-1982.434) * [-1989.534] (-1999.202) (-1996.890) (-1994.382) -- 0:03:59
      250600 -- (-1994.332) (-1992.793) [-1990.507] (-1985.862) * [-1990.918] (-2005.627) (-2000.543) (-1993.505) -- 0:03:59
      250700 -- (-1989.340) (-1990.492) (-1986.917) [-1980.702] * (-1986.336) (-2005.643) [-1994.174] (-1992.094) -- 0:03:59
      250800 -- (-1989.689) (-1993.201) (-1994.420) [-1978.913] * [-1990.326] (-1999.284) (-1993.216) (-1992.478) -- 0:03:58
      250900 -- (-1987.832) (-1990.244) (-1989.893) [-1983.028] * (-1991.693) (-2002.910) [-1987.146] (-1991.648) -- 0:03:58
      251000 -- (-1984.679) (-1992.853) [-1986.217] (-1989.608) * (-1992.749) (-2005.383) (-1985.190) [-1986.457] -- 0:03:58

      Average standard deviation of split frequencies: 0.004450

      251100 -- (-1984.437) (-1993.718) (-1986.744) [-1988.820] * (-1998.519) (-2007.338) (-1988.274) [-1986.436] -- 0:03:58
      251200 -- [-1981.333] (-1996.704) (-1984.836) (-1987.356) * (-1985.198) (-1998.147) (-1990.407) [-1984.277] -- 0:03:58
      251300 -- (-1990.401) (-1995.514) (-1990.531) [-1982.503] * [-1985.700] (-1999.237) (-1987.317) (-1999.880) -- 0:03:58
      251400 -- (-1990.176) (-1989.071) (-1996.585) [-1979.337] * (-1986.772) [-1993.798] (-1989.200) (-1996.504) -- 0:03:58
      251500 -- (-1995.332) (-1994.333) (-1993.355) [-1981.377] * (-1989.978) (-1997.579) [-1985.772] (-1994.776) -- 0:03:58
      251600 -- (-1990.806) (-1990.785) (-1987.902) [-1980.448] * (-1990.633) (-1995.051) [-1988.933] (-1993.276) -- 0:03:57
      251700 -- (-1990.764) (-1992.027) (-1994.006) [-1987.565] * (-1987.899) (-1996.054) [-1982.436] (-1988.873) -- 0:03:57
      251800 -- (-1988.906) (-1993.853) (-1986.589) [-1981.911] * (-1991.364) (-1996.672) (-1991.510) [-1983.667] -- 0:04:00
      251900 -- (-1983.945) (-2002.720) (-1993.492) [-1985.605] * (-1991.865) (-2007.715) (-1987.275) [-1981.896] -- 0:04:00
      252000 -- [-1983.601] (-1999.335) (-1992.961) (-1981.688) * (-1989.364) (-2004.138) (-1993.972) [-1978.710] -- 0:04:00

      Average standard deviation of split frequencies: 0.004541

      252100 -- [-1986.112] (-1996.201) (-1995.655) (-1983.001) * (-1989.515) (-2005.800) [-1989.742] (-1983.431) -- 0:04:00
      252200 -- (-1996.551) (-1998.961) (-1992.797) [-1981.826] * (-1995.293) (-1990.317) [-1985.413] (-1985.353) -- 0:04:00
      252300 -- (-1993.715) (-1998.340) (-1989.334) [-1980.909] * (-1996.749) [-1990.925] (-1988.011) (-1995.317) -- 0:04:00
      252400 -- (-1987.538) (-2008.372) (-1997.180) [-1981.180] * [-1985.505] (-1989.887) (-1989.182) (-1997.649) -- 0:03:59
      252500 -- [-1982.820] (-1999.600) (-1997.095) (-1983.678) * (-1986.645) (-1996.361) (-1992.607) [-1992.085] -- 0:03:59
      252600 -- [-1977.475] (-1996.810) (-1993.901) (-1987.004) * [-1988.824] (-1996.505) (-1990.114) (-1994.065) -- 0:03:59
      252700 -- [-1983.497] (-1992.632) (-1999.093) (-1994.519) * (-1990.246) [-1991.613] (-1990.690) (-1991.157) -- 0:03:59
      252800 -- (-1979.290) (-1996.645) (-1996.815) [-1989.992] * (-1998.961) (-1993.335) [-1989.629] (-1990.616) -- 0:03:59
      252900 -- [-1992.937] (-1993.734) (-1993.047) (-2004.333) * (-1992.628) (-1992.915) [-1997.541] (-1988.357) -- 0:03:59
      253000 -- (-1993.999) [-1992.089] (-2000.243) (-1999.072) * [-1995.351] (-1995.194) (-2002.510) (-1988.230) -- 0:03:59

      Average standard deviation of split frequencies: 0.004628

      253100 -- (-1996.973) (-1993.153) (-2001.087) [-1985.564] * (-1999.896) [-1992.370] (-2012.541) (-1993.507) -- 0:03:59
      253200 -- (-1994.304) [-1988.264] (-1996.429) (-1981.210) * (-1993.720) [-1986.890] (-2006.121) (-1995.167) -- 0:03:58
      253300 -- (-1993.510) (-1986.442) (-1989.823) [-1982.922] * (-1984.832) [-1992.968] (-2005.212) (-1992.044) -- 0:03:58
      253400 -- (-1995.739) (-1996.232) (-1986.842) [-1981.731] * [-1983.292] (-1999.366) (-1997.735) (-1995.304) -- 0:03:58
      253500 -- (-1994.457) (-1994.714) [-1982.997] (-1981.265) * [-1983.801] (-1999.553) (-1993.474) (-1993.892) -- 0:03:58
      253600 -- (-1990.956) (-1998.083) (-1983.744) [-1983.149] * [-1979.449] (-1996.667) (-1988.310) (-1989.352) -- 0:03:58
      253700 -- (-1985.820) (-1990.273) [-1989.838] (-1987.945) * [-1977.236] (-1992.667) (-1988.202) (-1988.289) -- 0:03:58
      253800 -- [-1989.843] (-1991.338) (-1990.743) (-1988.467) * [-1980.181] (-1996.905) (-1989.986) (-1985.609) -- 0:03:58
      253900 -- (-1990.046) (-2001.731) (-1994.288) [-1987.288] * [-1983.870] (-2002.221) (-1991.733) (-1992.406) -- 0:03:58
      254000 -- [-1984.829] (-2001.476) (-1988.047) (-1988.643) * [-1982.506] (-1998.451) (-1989.169) (-1992.399) -- 0:03:57

      Average standard deviation of split frequencies: 0.004664

      254100 -- (-1983.737) (-1993.878) [-1988.876] (-1986.369) * [-1978.682] (-1993.236) (-1989.527) (-1984.866) -- 0:03:57
      254200 -- (-1983.514) (-1996.950) (-1993.725) [-1986.837] * [-1980.538] (-2003.043) (-1990.320) (-1985.997) -- 0:03:57
      254300 -- [-1984.690] (-1992.128) (-1994.840) (-1990.881) * [-1980.433] (-2007.515) (-1988.996) (-1990.463) -- 0:03:57
      254400 -- (-1989.154) (-1993.906) (-1989.733) [-1989.341] * [-1981.625] (-1997.663) (-1990.815) (-1993.427) -- 0:03:57
      254500 -- (-1982.438) (-1992.913) [-1989.339] (-1990.078) * (-1984.001) [-1994.820] (-1996.525) (-1991.583) -- 0:03:57
      254600 -- (-1982.133) (-1998.076) [-1983.335] (-2001.396) * (-1984.269) (-1996.997) (-1989.133) [-1983.366] -- 0:03:57
      254700 -- (-1980.510) (-1998.048) [-1984.411] (-1995.737) * [-1979.607] (-1988.486) (-1989.397) (-1985.515) -- 0:03:57
      254800 -- (-1982.622) (-1999.908) [-1986.560] (-2000.873) * [-1984.494] (-1986.145) (-1988.846) (-1988.968) -- 0:03:56
      254900 -- (-1984.307) (-2003.176) (-1980.112) [-1992.584] * [-1979.147] (-1998.688) (-1988.600) (-1987.566) -- 0:03:59
      255000 -- [-1986.249] (-2002.888) (-1985.056) (-1992.405) * (-1984.146) [-1991.226] (-1998.801) (-1989.829) -- 0:03:59

      Average standard deviation of split frequencies: 0.004539

      255100 -- (-1984.847) (-1997.769) [-1981.520] (-1997.285) * [-1982.037] (-1992.018) (-1997.994) (-1989.318) -- 0:03:59
      255200 -- (-1989.548) (-1994.747) [-1981.931] (-1991.125) * (-1983.342) [-1993.543] (-1996.784) (-1988.933) -- 0:03:59
      255300 -- (-1990.951) (-1997.252) [-1984.803] (-1999.965) * (-1982.251) (-2006.503) (-2004.200) [-1986.805] -- 0:03:59
      255400 -- (-1993.748) (-1987.160) (-1980.041) [-1995.769] * [-1978.044] (-2003.325) (-1999.969) (-1984.126) -- 0:03:59
      255500 -- (-1986.221) (-1991.116) [-1984.720] (-1993.933) * [-1979.140] (-2007.108) (-2001.689) (-1992.096) -- 0:03:58
      255600 -- (-1993.702) (-1991.742) [-1984.499] (-1986.034) * [-1980.786] (-1996.576) (-2000.761) (-1990.074) -- 0:03:58
      255700 -- (-2006.744) (-1989.356) [-1982.600] (-1987.653) * [-1981.282] (-2006.576) (-2005.824) (-1996.217) -- 0:03:58
      255800 -- (-1993.758) (-1982.097) [-1982.816] (-1987.374) * (-1983.097) (-1998.264) (-2003.175) [-1989.143] -- 0:03:58
      255900 -- (-1992.593) [-1982.742] (-1990.130) (-1987.068) * [-1982.093] (-1999.123) (-2010.976) (-1990.296) -- 0:03:58
      256000 -- (-1999.624) [-1981.173] (-1990.712) (-1991.544) * (-1982.848) (-2000.603) (-2000.700) [-1983.397] -- 0:03:58

      Average standard deviation of split frequencies: 0.004417

      256100 -- (-1992.568) (-1990.770) [-1989.997] (-1992.576) * [-1986.042] (-2002.828) (-2006.458) (-1979.511) -- 0:03:58
      256200 -- [-1990.571] (-1992.672) (-1990.527) (-1993.021) * (-1982.441) (-1990.198) (-2001.739) [-1979.432] -- 0:03:58
      256300 -- (-1990.658) [-1988.732] (-1987.808) (-1992.479) * [-1980.637] (-1988.250) (-2003.096) (-1979.997) -- 0:03:57
      256400 -- (-1991.527) (-1988.725) [-1983.557] (-2006.417) * [-1979.762] (-1988.293) (-1991.670) (-1980.943) -- 0:03:57
      256500 -- (-2001.247) [-1983.044] (-1982.000) (-2012.931) * (-1981.055) (-2000.269) (-1997.318) [-1978.690] -- 0:03:57
      256600 -- (-2003.387) [-1978.533] (-1986.634) (-2011.283) * [-1988.307] (-1986.506) (-2010.778) (-1979.308) -- 0:03:57
      256700 -- (-2011.918) [-1984.066] (-1982.511) (-2000.995) * (-1988.601) (-1992.902) (-2008.037) [-1978.815] -- 0:03:57
      256800 -- (-2005.339) [-1981.146] (-1981.101) (-1999.350) * [-1986.100] (-1995.827) (-2006.531) (-1981.949) -- 0:03:57
      256900 -- (-2004.568) (-1975.757) [-1982.280] (-1998.598) * [-1983.629] (-1994.357) (-1997.247) (-1983.723) -- 0:03:57
      257000 -- (-2011.229) (-1985.205) [-1983.394] (-1995.172) * [-1984.602] (-1990.604) (-2000.144) (-1985.425) -- 0:03:57

      Average standard deviation of split frequencies: 0.004504

      257100 -- (-2001.667) (-1988.688) [-1982.872] (-1984.710) * [-1981.579] (-1986.909) (-2002.596) (-1993.924) -- 0:03:56
      257200 -- (-2007.757) [-1987.870] (-1993.682) (-1984.118) * [-1985.416] (-1985.480) (-2003.769) (-1995.641) -- 0:03:56
      257300 -- (-2010.236) (-1984.220) (-1991.925) [-1979.174] * [-1987.662] (-1982.316) (-1993.127) (-1992.611) -- 0:03:56
      257400 -- (-2012.197) (-1989.474) (-1990.107) [-1982.326] * [-1988.591] (-1984.642) (-1991.132) (-1999.910) -- 0:03:56
      257500 -- (-2012.464) (-1991.098) (-1997.016) [-1978.406] * (-1985.236) (-1982.702) [-1989.677] (-1992.104) -- 0:03:56
      257600 -- (-2009.189) (-1987.195) (-1991.564) [-1984.310] * (-1981.639) [-1979.338] (-1986.423) (-1995.976) -- 0:03:56
      257700 -- (-2000.588) [-1989.215] (-1990.732) (-1984.865) * (-1983.180) [-1980.451] (-1989.602) (-1996.721) -- 0:03:56
      257800 -- (-2007.530) [-1982.954] (-1998.929) (-1985.140) * (-1990.235) (-1982.803) [-1988.500] (-2000.487) -- 0:03:56
      257900 -- (-2000.717) (-1983.318) (-2000.961) [-1985.751] * (-1982.347) [-1982.367] (-1993.801) (-2014.685) -- 0:03:55
      258000 -- (-1988.643) (-1984.989) (-2001.374) [-1984.384] * (-1982.058) [-1981.627] (-1990.312) (-2009.830) -- 0:03:58

      Average standard deviation of split frequencies: 0.004800

      258100 -- (-1987.952) (-1978.444) (-1998.726) [-1986.510] * (-1983.310) [-1982.818] (-1989.717) (-1999.094) -- 0:03:58
      258200 -- (-1997.813) (-1986.627) (-1997.682) [-1989.736] * (-1984.968) [-1980.347] (-1991.479) (-1988.137) -- 0:03:58
      258300 -- (-1997.242) (-1990.591) (-1994.709) [-1982.578] * (-1985.495) [-1981.827] (-1989.968) (-1994.748) -- 0:03:58
      258400 -- (-2003.110) (-1989.559) (-2001.127) [-1982.834] * (-1990.976) [-1982.728] (-1998.293) (-1991.264) -- 0:03:58
      258500 -- (-2005.361) [-1986.177] (-2001.874) (-1985.222) * (-1990.305) [-1983.390] (-2001.425) (-1994.344) -- 0:03:58
      258600 -- (-2005.630) (-1989.960) (-1998.626) [-1985.200] * (-1994.354) [-1983.108] (-1994.486) (-1991.006) -- 0:03:57
      258700 -- (-2000.560) (-1991.302) (-2004.296) [-1983.275] * (-1998.560) (-1984.471) [-1989.696] (-1985.988) -- 0:03:57
      258800 -- (-2009.473) (-1987.095) (-1987.175) [-1984.367] * (-1997.595) (-1982.977) (-1993.127) [-1983.019] -- 0:03:57
      258900 -- (-2004.473) (-1992.184) (-1984.228) [-1979.431] * (-1995.923) [-1980.826] (-1991.247) (-1985.400) -- 0:03:57
      259000 -- (-1994.039) (-1994.973) (-1981.848) [-1978.263] * (-1989.661) (-1979.532) (-1991.186) [-1993.118] -- 0:03:57

      Average standard deviation of split frequencies: 0.004833

      259100 -- (-1999.131) (-1999.309) [-1982.204] (-1981.388) * (-1989.301) [-1979.466] (-1990.981) (-1988.111) -- 0:03:57
      259200 -- (-1996.612) (-1996.883) (-1987.679) [-1981.565] * (-1990.129) [-1983.351] (-2002.550) (-1986.992) -- 0:03:57
      259300 -- (-1995.196) (-1988.941) (-1990.533) [-1979.961] * (-1988.850) [-1981.173] (-1997.541) (-1983.162) -- 0:03:57
      259400 -- (-1993.900) (-1978.289) (-1992.179) [-1984.013] * (-1996.194) [-1981.899] (-1998.897) (-1984.708) -- 0:03:56
      259500 -- (-1990.675) [-1977.909] (-1990.523) (-1983.514) * (-1993.019) [-1986.876] (-2000.112) (-1991.610) -- 0:03:56
      259600 -- (-1999.443) [-1976.472] (-1988.282) (-1980.670) * (-1991.048) [-1983.696] (-1990.510) (-1985.598) -- 0:03:56
      259700 -- (-2000.534) [-1978.592] (-1992.200) (-1980.416) * (-1992.041) [-1981.021] (-1997.569) (-1989.116) -- 0:03:56
      259800 -- (-1994.345) [-1993.919] (-1984.612) (-1985.488) * (-1995.822) (-1982.862) (-2001.102) [-1983.673] -- 0:03:56
      259900 -- (-1995.821) (-1993.539) (-1982.413) [-1983.136] * (-1989.119) [-1981.944] (-1995.177) (-1989.634) -- 0:03:56
      260000 -- (-2001.354) (-1989.783) (-1985.341) [-1980.105] * [-1989.371] (-1985.678) (-1994.972) (-1987.522) -- 0:03:56

      Average standard deviation of split frequencies: 0.005022

      260100 -- (-2005.747) (-1984.994) [-1984.755] (-1990.515) * (-1996.217) (-1991.384) (-1996.750) [-1987.093] -- 0:03:56
      260200 -- (-2011.649) [-1983.486] (-1982.826) (-1995.313) * (-1991.367) (-1995.414) (-1995.667) [-1989.422] -- 0:03:55
      260300 -- [-1990.307] (-1993.113) (-1986.555) (-1990.641) * (-1994.295) (-1999.089) (-1993.258) [-1986.562] -- 0:03:55
      260400 -- (-1989.595) (-1993.850) (-1987.883) [-1987.476] * (-1990.576) (-1995.157) [-1992.615] (-1990.815) -- 0:03:55
      260500 -- (-1998.336) [-1991.849] (-1988.579) (-1985.478) * (-1989.825) (-1991.984) [-1990.342] (-1990.263) -- 0:03:55
      260600 -- (-1994.631) (-1990.855) (-1991.849) [-1987.009] * [-1991.280] (-1989.054) (-1986.215) (-1989.324) -- 0:03:55
      260700 -- (-2001.996) (-1988.816) (-1997.398) [-1986.008] * (-1988.128) (-1990.490) [-1985.248] (-1994.693) -- 0:03:55
      260800 -- (-1999.375) (-1985.345) (-1995.061) [-1982.653] * [-1983.611] (-1989.707) (-1986.980) (-1996.501) -- 0:03:55
      260900 -- (-2011.579) [-1982.910] (-1998.283) (-1986.969) * (-1985.038) [-1990.067] (-1991.442) (-2002.951) -- 0:03:55
      261000 -- (-2001.388) [-1985.284] (-2003.828) (-1987.186) * (-1991.403) [-1992.793] (-1990.232) (-1995.484) -- 0:03:55

      Average standard deviation of split frequencies: 0.005053

      261100 -- (-1996.035) [-1984.368] (-2003.672) (-1987.183) * (-1988.347) (-1998.020) [-1987.120] (-1999.309) -- 0:03:57
      261200 -- (-1997.558) (-1984.476) (-1991.685) [-1985.135] * (-1992.286) (-1991.918) [-1985.938] (-1996.348) -- 0:03:57
      261300 -- (-2002.409) [-1982.545] (-1991.029) (-1983.618) * (-1994.212) (-1987.105) [-1989.157] (-1988.997) -- 0:03:57
      261400 -- (-1999.519) [-1981.103] (-1991.775) (-1991.241) * (-1995.221) [-1991.209] (-1991.477) (-1990.452) -- 0:03:57
      261500 -- (-1998.648) [-1984.023] (-1994.892) (-1986.836) * (-2009.778) [-1987.985] (-1987.882) (-1992.449) -- 0:03:57
      261600 -- (-2006.260) [-1989.601] (-1999.183) (-1987.231) * (-2009.075) [-1994.863] (-1985.587) (-1986.509) -- 0:03:57
      261700 -- (-2004.191) (-1982.845) (-1993.004) [-1982.361] * (-2009.859) (-1985.865) (-1990.107) [-1985.135] -- 0:03:56
      261800 -- (-2007.977) [-1986.926] (-1995.150) (-1982.709) * (-1993.127) [-1989.065] (-1987.173) (-1984.763) -- 0:03:56
      261900 -- (-2009.825) (-1984.128) [-1990.704] (-1986.865) * (-1995.394) (-1993.884) (-1987.220) [-1986.594] -- 0:03:56
      262000 -- (-2003.496) [-1987.409] (-1994.953) (-1979.050) * (-1994.544) (-1990.270) [-1989.540] (-1989.260) -- 0:03:56

      Average standard deviation of split frequencies: 0.005395

      262100 -- (-2004.864) (-1990.092) [-1992.563] (-1980.787) * (-1992.504) [-1987.537] (-1990.883) (-1994.882) -- 0:03:56
      262200 -- (-2011.686) (-1988.285) (-1992.038) [-1980.051] * (-1987.207) [-1985.757] (-1995.924) (-1999.328) -- 0:03:56
      262300 -- (-2006.181) (-1985.574) (-1998.759) [-1983.588] * (-1988.401) [-1992.455] (-1993.436) (-2003.511) -- 0:03:56
      262400 -- (-2008.772) (-1980.442) (-2002.147) [-1981.448] * (-1989.538) [-1990.130] (-1994.660) (-2009.190) -- 0:03:56
      262500 -- (-2002.709) (-1984.487) (-2001.221) [-1978.911] * [-1987.541] (-1990.497) (-1998.531) (-1995.503) -- 0:03:56
      262600 -- (-2002.502) (-1989.370) (-1991.380) [-1982.187] * (-1988.325) (-1987.176) (-2005.865) [-1989.851] -- 0:03:55
      262700 -- (-1999.176) (-1989.871) (-2009.064) [-1978.988] * [-1989.253] (-1990.929) (-2001.587) (-1986.845) -- 0:03:55
      262800 -- (-1998.399) (-1992.790) (-2008.373) [-1984.676] * (-1989.269) (-1987.713) (-1998.449) [-1982.305] -- 0:03:55
      262900 -- (-2003.739) [-1985.436] (-1993.633) (-1984.015) * (-1988.985) (-1991.305) (-2009.595) [-1991.886] -- 0:03:55
      263000 -- (-2002.716) [-1985.465] (-2002.504) (-1986.327) * (-1991.003) (-1992.515) (-1991.024) [-1988.000] -- 0:03:55

      Average standard deviation of split frequencies: 0.005424

      263100 -- (-1995.886) [-1984.743] (-1999.973) (-1986.538) * (-1992.778) (-1994.485) (-1995.066) [-1985.469] -- 0:03:55
      263200 -- (-1995.901) [-1984.974] (-1997.298) (-1987.161) * [-1990.754] (-2004.068) (-1995.551) (-1988.529) -- 0:03:55
      263300 -- (-2003.623) (-1983.426) (-1994.713) [-1980.616] * (-1991.456) (-2002.135) (-1999.570) [-1991.280] -- 0:03:55
      263400 -- (-2004.652) (-1982.191) (-1990.966) [-1981.188] * (-1992.807) (-2001.881) (-2008.439) [-1991.083] -- 0:03:54
      263500 -- (-2002.444) (-1986.880) (-1992.795) [-1980.433] * [-1985.210] (-1995.416) (-2005.760) (-1998.362) -- 0:03:54
      263600 -- (-1999.541) (-1987.756) (-1992.458) [-1981.194] * [-1987.495] (-1992.536) (-2008.383) (-1996.584) -- 0:03:54
      263700 -- (-1994.549) [-1988.718] (-1996.510) (-1981.180) * [-1987.058] (-1991.037) (-1998.014) (-1993.200) -- 0:03:54
      263800 -- (-1993.102) (-1989.942) (-1994.350) [-1982.877] * [-1986.250] (-1991.919) (-1988.959) (-2007.556) -- 0:03:54
      263900 -- (-1996.822) (-1990.767) (-1999.340) [-1983.802] * [-1985.080] (-1990.733) (-1987.349) (-2004.476) -- 0:03:54
      264000 -- (-1995.091) (-1990.487) (-1997.383) [-1982.973] * [-1989.342] (-1989.272) (-1987.497) (-2001.967) -- 0:03:54

      Average standard deviation of split frequencies: 0.005405

      264100 -- [-1987.690] (-1988.529) (-2003.099) (-1979.599) * [-1987.665] (-1990.509) (-1988.701) (-1996.469) -- 0:03:56
      264200 -- (-1989.585) (-1979.895) (-1997.084) [-1980.853] * [-1987.304] (-1998.202) (-1993.448) (-1999.716) -- 0:03:56
      264300 -- (-1991.075) [-1984.310] (-1998.636) (-1979.720) * (-1985.001) [-1994.834] (-1995.964) (-1999.974) -- 0:03:56
      264400 -- (-1987.991) (-1982.727) (-2003.451) [-1981.033] * [-1993.615] (-1994.897) (-1989.742) (-2006.581) -- 0:03:56
      264500 -- (-1988.345) (-1986.626) (-1998.399) [-1981.838] * (-2000.600) (-1991.425) [-1986.428] (-2006.239) -- 0:03:56
      264600 -- (-1987.183) (-1987.784) (-2017.437) [-1980.645] * (-1997.328) (-1991.209) [-1985.156] (-2001.240) -- 0:03:56
      264700 -- [-1987.672] (-1993.885) (-2014.408) (-1986.836) * (-1991.779) [-1990.548] (-1991.624) (-1996.853) -- 0:03:56
      264800 -- (-1986.196) (-1982.632) (-1998.470) [-1988.139] * (-1997.968) (-1988.834) [-1987.233] (-2005.261) -- 0:03:55
      264900 -- (-1994.243) [-1982.856] (-1998.047) (-1992.778) * (-1997.224) (-1989.697) [-1986.361] (-1995.261) -- 0:03:55
      265000 -- (-1997.750) [-1984.886] (-1995.966) (-1989.920) * (-2004.200) (-1990.880) [-1992.740] (-1996.437) -- 0:03:55

      Average standard deviation of split frequencies: 0.005790

      265100 -- (-2000.692) [-1987.524] (-1996.759) (-1998.445) * (-1996.396) (-1990.664) [-1996.936] (-2000.555) -- 0:03:55
      265200 -- (-1995.301) [-1979.760] (-1993.212) (-2003.683) * (-1993.658) [-1990.869] (-1987.763) (-2009.432) -- 0:03:55
      265300 -- (-1997.063) [-1980.372] (-1995.379) (-1996.489) * [-1994.322] (-1996.147) (-1987.904) (-2005.150) -- 0:03:55
      265400 -- (-2000.033) [-1979.386] (-1995.729) (-1992.371) * (-1990.851) (-1992.276) [-1987.627] (-2004.066) -- 0:03:55
      265500 -- (-1993.962) (-1985.322) (-1997.333) [-1987.093] * (-1994.675) [-1994.813] (-1991.876) (-1991.927) -- 0:03:55
      265600 -- (-1989.540) (-1990.950) (-1993.880) [-1993.297] * (-1995.131) (-1990.048) (-1987.798) [-1985.619] -- 0:03:55
      265700 -- (-1997.423) [-1982.509] (-1991.846) (-1994.744) * (-2003.487) (-1988.167) (-1986.865) [-1987.403] -- 0:03:54
      265800 -- (-2003.926) [-1984.186] (-1989.031) (-1991.578) * (-2002.245) (-1990.479) [-1987.020] (-1991.926) -- 0:03:54
      265900 -- (-1992.438) (-1988.134) (-1985.951) [-1981.338] * (-2002.779) (-1988.172) [-1988.279] (-1993.627) -- 0:03:54
      266000 -- (-2002.165) (-1987.010) (-1988.086) [-1986.989] * (-2000.097) (-1993.892) [-1986.707] (-1994.384) -- 0:03:54

      Average standard deviation of split frequencies: 0.006225

      266100 -- (-1998.323) [-1983.503] (-1990.845) (-1985.189) * (-1991.480) [-1988.133] (-1989.947) (-1999.842) -- 0:03:54
      266200 -- (-2002.568) (-1986.411) (-1993.159) [-1985.104] * (-1993.373) [-1988.389] (-1988.932) (-1996.108) -- 0:03:54
      266300 -- (-1998.249) (-1986.018) [-1980.092] (-1988.735) * (-2001.634) (-1995.501) [-1991.544] (-1993.189) -- 0:03:54
      266400 -- (-1997.307) (-1994.449) [-1977.593] (-1987.735) * (-1993.032) (-2003.308) [-1988.872] (-1997.989) -- 0:03:54
      266500 -- (-1994.653) (-1993.707) [-1978.642] (-1985.122) * [-1995.186] (-1999.276) (-1986.703) (-1994.828) -- 0:03:53
      266600 -- (-1985.661) (-1994.719) [-1978.870] (-1982.360) * (-1990.254) (-2002.323) (-1993.245) [-1988.257] -- 0:03:53
      266700 -- (-1993.915) (-1990.160) (-1983.105) [-1980.892] * [-1995.244] (-1994.192) (-2000.785) (-1991.818) -- 0:03:53
      266800 -- (-1992.384) (-1991.805) (-1984.810) [-1978.972] * (-1988.534) (-1989.354) (-2003.994) [-1984.789] -- 0:03:53
      266900 -- (-2001.732) (-1987.287) [-1979.622] (-1982.150) * (-1989.265) [-1986.254] (-2002.996) (-1986.785) -- 0:03:53
      267000 -- (-1999.543) (-1986.287) [-1983.045] (-1989.250) * [-1984.648] (-1991.086) (-1995.525) (-1981.669) -- 0:03:53

      Average standard deviation of split frequencies: 0.006301

      267100 -- (-1995.774) (-1989.541) [-1978.837] (-1985.908) * [-1993.798] (-1996.907) (-2003.139) (-1987.122) -- 0:03:53
      267200 -- (-1993.698) (-1994.960) [-1980.948] (-1984.964) * (-1996.732) [-1985.054] (-2001.982) (-1987.683) -- 0:03:53
      267300 -- (-1991.754) (-2000.793) [-1983.325] (-1986.523) * (-2013.044) [-1986.764] (-1993.715) (-1988.227) -- 0:03:55
      267400 -- (-1995.651) (-1993.084) [-1981.528] (-1984.254) * (-1993.184) (-1988.758) (-2000.965) [-1979.943] -- 0:03:55
      267500 -- (-1994.818) [-1990.222] (-1984.182) (-1984.333) * (-1996.227) (-1990.688) (-1997.507) [-1981.523] -- 0:03:55
      267600 -- (-1999.911) (-1987.625) (-1982.411) [-1984.532] * (-1996.623) (-1994.639) (-1995.828) [-1983.730] -- 0:03:55
      267700 -- (-1995.469) (-1990.887) [-1993.242] (-1988.754) * (-1997.432) (-1995.270) (-1993.255) [-1986.640] -- 0:03:55
      267800 -- (-1993.080) (-1982.271) [-1984.671] (-1989.606) * (-2003.199) (-1998.664) (-1994.770) [-1986.081] -- 0:03:55
      267900 -- [-1995.396] (-1992.615) (-1980.549) (-1988.587) * (-2007.463) (-1990.716) (-1989.969) [-1981.378] -- 0:03:55
      268000 -- (-1991.563) (-1994.348) [-1981.081] (-1986.338) * (-1997.564) (-1989.473) (-1996.022) [-1986.413] -- 0:03:54

      Average standard deviation of split frequencies: 0.006530

      268100 -- (-1993.176) (-1988.634) [-1985.152] (-1991.611) * (-2001.319) (-1993.250) (-1993.148) [-1982.510] -- 0:03:54
      268200 -- (-1987.869) (-1988.546) [-1980.565] (-1986.379) * (-1998.913) [-1996.575] (-1994.964) (-1981.823) -- 0:03:54
      268300 -- (-1988.711) (-2000.550) (-1987.422) [-1985.406] * (-1997.026) (-2008.950) (-2000.216) [-1985.760] -- 0:03:54
      268400 -- (-1989.380) (-1988.705) [-1982.072] (-1989.526) * (-2006.067) (-1990.723) (-1992.591) [-1982.983] -- 0:03:54
      268500 -- (-1992.117) (-1990.640) [-1985.225] (-1993.650) * (-1995.770) (-1991.086) (-1994.598) [-1985.547] -- 0:03:54
      268600 -- (-1992.942) [-1986.991] (-1984.818) (-1989.310) * (-1999.940) (-1991.197) [-1994.865] (-1991.490) -- 0:03:54
      268700 -- (-1991.858) (-1984.118) [-1979.896] (-1989.305) * (-1998.519) [-1989.457] (-1989.776) (-1989.187) -- 0:03:54
      268800 -- (-1991.526) [-1982.812] (-1982.683) (-1984.371) * (-2002.236) (-1992.158) (-1988.891) [-1985.771] -- 0:03:53
      268900 -- (-1987.671) (-2005.291) [-1981.677] (-1985.612) * (-1994.992) (-2001.763) [-1987.413] (-1995.174) -- 0:03:53
      269000 -- (-1990.746) (-1991.727) [-1981.376] (-1988.915) * (-1997.504) (-2001.826) [-1988.221] (-1996.872) -- 0:03:53

      Average standard deviation of split frequencies: 0.006554

      269100 -- (-1994.434) (-1988.796) [-1984.544] (-1996.990) * (-1995.106) (-2008.584) [-1985.162] (-1988.307) -- 0:03:53
      269200 -- (-2001.064) (-1998.901) [-1987.228] (-1998.591) * (-2001.786) (-1999.047) (-1985.287) [-1985.161] -- 0:03:53
      269300 -- (-1997.221) (-1990.085) (-1990.747) [-1990.525] * (-1993.675) (-1997.383) (-1990.936) [-1984.114] -- 0:03:53
      269400 -- [-1993.790] (-1990.871) (-1986.028) (-1994.640) * (-1992.439) [-1991.947] (-1991.184) (-1988.759) -- 0:03:53
      269500 -- (-1995.884) (-1996.725) [-1985.257] (-1993.421) * (-1992.667) (-1989.084) (-1994.128) [-1981.453] -- 0:03:53
      269600 -- (-1994.293) (-1992.911) [-1984.764] (-1997.667) * (-2001.349) (-1993.182) (-1991.397) [-1982.131] -- 0:03:52
      269700 -- (-1996.382) (-1993.211) [-1984.165] (-1989.523) * (-2011.950) [-1991.731] (-1985.550) (-1979.766) -- 0:03:52
      269800 -- (-1992.932) (-1996.461) [-1988.007] (-1990.132) * (-1995.222) (-1987.270) (-1996.777) [-1979.272] -- 0:03:52
      269900 -- (-1999.635) (-1988.022) [-1985.345] (-1992.554) * (-1993.792) (-1997.118) (-1994.086) [-1978.527] -- 0:03:52
      270000 -- (-1998.610) [-1981.307] (-1987.950) (-1998.244) * (-1995.955) (-1989.530) [-1985.339] (-1982.877) -- 0:03:52

      Average standard deviation of split frequencies: 0.006532

      270100 -- (-1994.823) [-1984.302] (-1990.099) (-1989.831) * (-1992.663) (-1991.457) (-1988.104) [-1984.233] -- 0:03:52
      270200 -- (-1993.816) (-1981.557) [-1991.098] (-2004.387) * (-1993.847) (-1989.756) (-2001.471) [-1982.590] -- 0:03:52
      270300 -- (-1984.730) [-1985.099] (-1991.350) (-1999.316) * (-1993.409) (-1994.310) (-1998.050) [-1979.706] -- 0:03:52
      270400 -- (-1989.108) [-1979.459] (-1989.192) (-2011.636) * (-2001.927) (-1997.458) (-1999.708) [-1982.900] -- 0:03:54
      270500 -- [-1992.413] (-1985.234) (-1991.061) (-1999.947) * (-1995.681) (-1988.961) (-1996.779) [-1985.894] -- 0:03:54
      270600 -- (-1992.535) [-1980.662] (-1988.545) (-2002.033) * (-1991.825) (-1996.067) [-1985.848] (-1981.619) -- 0:03:54
      270700 -- (-1994.992) (-1986.925) [-1983.897] (-1998.573) * (-2004.134) (-1989.383) [-1985.333] (-1978.783) -- 0:03:54
      270800 -- (-1989.309) (-1987.277) [-1988.725] (-1997.752) * (-1999.315) (-1989.529) (-1986.367) [-1979.713] -- 0:03:54
      270900 -- (-1990.134) [-1979.819] (-1984.143) (-2000.616) * (-2001.868) [-1992.000] (-1995.931) (-1983.623) -- 0:03:54
      271000 -- (-1990.258) (-1979.215) [-1980.371] (-2003.122) * (-2001.342) (-2000.250) (-1997.159) [-1986.420] -- 0:03:54

      Average standard deviation of split frequencies: 0.006854

      271100 -- (-2001.500) [-1981.122] (-1982.537) (-1995.162) * (-1988.357) [-1992.418] (-1994.388) (-1990.148) -- 0:03:53
      271200 -- (-1991.862) [-1982.858] (-1985.854) (-1995.692) * [-1987.074] (-1991.683) (-1998.696) (-1989.761) -- 0:03:53
      271300 -- (-1990.955) [-1984.137] (-1985.209) (-2006.018) * [-1985.401] (-1988.122) (-2000.732) (-1990.816) -- 0:03:53
      271400 -- (-1994.719) [-1983.083] (-1983.679) (-2009.633) * [-1986.330] (-1988.618) (-1998.449) (-1984.615) -- 0:03:53
      271500 -- [-1989.468] (-1981.155) (-1983.255) (-2001.417) * (-1993.309) (-1987.801) (-2003.638) [-1983.476] -- 0:03:53
      271600 -- [-1987.556] (-1984.087) (-1991.691) (-2005.437) * (-2001.595) (-1990.889) (-2010.856) [-1984.485] -- 0:03:53
      271700 -- (-1987.809) [-1980.776] (-1993.709) (-2007.270) * (-2003.484) (-1992.233) (-2010.901) [-1989.325] -- 0:03:53
      271800 -- (-1988.448) [-1984.436] (-1998.299) (-2002.089) * (-1998.045) (-1989.424) (-1994.050) [-1985.061] -- 0:03:53
      271900 -- [-1988.045] (-1988.163) (-1996.047) (-1997.855) * (-2003.102) (-1993.957) (-1994.136) [-1985.467] -- 0:03:52
      272000 -- [-1985.973] (-1989.408) (-1990.187) (-2000.421) * (-2011.213) (-1985.132) (-1990.400) [-1986.843] -- 0:03:52

      Average standard deviation of split frequencies: 0.006830

      272100 -- [-1986.500] (-1990.687) (-1992.132) (-2000.621) * (-1997.606) (-1987.761) (-1994.676) [-1986.454] -- 0:03:52
      272200 -- [-1985.969] (-1991.611) (-2002.901) (-1996.574) * (-1996.552) (-1993.804) (-1995.482) [-1984.713] -- 0:03:52
      272300 -- (-1991.866) [-1990.387] (-2000.429) (-1997.153) * [-1995.936] (-1992.873) (-1998.524) (-1988.785) -- 0:03:52
      272400 -- [-1989.094] (-1987.524) (-1994.807) (-1994.951) * [-1988.432] (-1996.768) (-1993.276) (-1986.481) -- 0:03:52
      272500 -- [-1995.959] (-1985.371) (-1990.071) (-1994.302) * [-1984.557] (-1993.894) (-1998.826) (-1989.085) -- 0:03:52
      272600 -- (-1990.161) (-1980.594) [-1991.342] (-1992.699) * (-1983.436) (-1999.229) (-1999.467) [-1986.627] -- 0:03:52
      272700 -- (-1992.535) [-1989.602] (-1989.970) (-1996.178) * [-1985.441] (-2001.514) (-2000.209) (-1982.776) -- 0:03:52
      272800 -- (-1992.666) [-1988.846] (-1990.363) (-1996.546) * [-1984.653] (-2005.974) (-1997.907) (-1987.174) -- 0:03:51
      272900 -- (-1993.333) (-1986.256) (-1994.681) [-1995.876] * [-1984.668] (-1996.153) (-1996.274) (-1986.444) -- 0:03:51
      273000 -- [-1987.532] (-1983.302) (-1992.695) (-1996.135) * (-1991.642) (-1989.912) (-2004.736) [-1984.775] -- 0:03:51

      Average standard deviation of split frequencies: 0.006853

      273100 -- [-1985.167] (-1985.200) (-1997.155) (-2001.254) * [-1990.495] (-1993.637) (-2000.601) (-1985.878) -- 0:03:51
      273200 -- (-1984.734) [-1989.885] (-2003.799) (-2003.916) * [-1988.791] (-1996.242) (-1997.092) (-1988.973) -- 0:03:51
      273300 -- (-1987.158) [-1990.033] (-2003.475) (-2002.651) * (-1991.098) (-1991.630) (-2008.445) [-1982.499] -- 0:03:51
      273400 -- [-1985.627] (-1985.679) (-2002.228) (-2000.960) * [-1990.812] (-1986.236) (-1998.265) (-1988.988) -- 0:03:51
      273500 -- (-1982.580) [-1985.443] (-1994.282) (-2000.207) * (-1990.043) (-1989.051) [-1992.165] (-1987.490) -- 0:03:53
      273600 -- (-1990.617) [-1985.281] (-1986.851) (-1996.903) * (-1994.851) [-1990.633] (-2002.479) (-1992.373) -- 0:03:53
      273700 -- [-1988.999] (-1985.413) (-1992.132) (-1993.779) * (-1990.749) (-1993.829) (-2000.726) [-1989.235] -- 0:03:53
      273800 -- (-1988.267) [-1988.746] (-2002.196) (-1994.221) * [-1991.617] (-1992.595) (-2002.700) (-1986.096) -- 0:03:53
      273900 -- (-1992.594) (-1986.938) (-2004.615) [-1992.711] * (-1989.017) (-2000.854) (-2006.224) [-1983.445] -- 0:03:53
      274000 -- (-1988.105) [-1986.333] (-2000.599) (-1994.951) * [-1989.707] (-2002.557) (-2002.880) (-1990.784) -- 0:03:53

      Average standard deviation of split frequencies: 0.006682

      274100 -- [-1988.835] (-1986.015) (-2000.555) (-2005.719) * [-1987.764] (-2005.046) (-2002.613) (-1988.141) -- 0:03:53
      274200 -- [-1989.822] (-1984.200) (-1991.007) (-2006.785) * [-1986.212] (-2003.577) (-1993.792) (-1994.807) -- 0:03:52
      274300 -- [-1989.427] (-1983.053) (-1995.141) (-2007.707) * [-1987.265] (-2000.807) (-1986.059) (-1996.569) -- 0:03:52
      274400 -- (-1998.695) (-1985.522) [-1991.822] (-2009.417) * [-1986.678] (-2005.198) (-1988.295) (-2005.699) -- 0:03:52
      274500 -- (-1992.208) [-1989.465] (-1989.025) (-2005.390) * [-1988.717] (-1998.868) (-1986.714) (-2001.549) -- 0:03:52
      274600 -- [-1985.394] (-1992.799) (-1998.018) (-2002.666) * (-1989.160) (-2004.069) [-1992.927] (-2000.503) -- 0:03:52
      274700 -- (-1985.884) [-1991.250] (-2012.029) (-2012.469) * (-1989.557) [-1993.230] (-1993.760) (-1993.217) -- 0:03:52
      274800 -- [-1989.075] (-1995.126) (-2004.877) (-1998.783) * [-1990.138] (-1989.985) (-1987.798) (-1997.898) -- 0:03:52
      274900 -- [-1988.290] (-2006.582) (-1993.362) (-1997.441) * (-1995.559) [-1989.998] (-1983.449) (-2000.364) -- 0:03:52
      275000 -- (-1986.135) [-2003.195] (-1993.270) (-1997.807) * (-1991.173) (-1992.080) [-1984.532] (-1994.774) -- 0:03:52

      Average standard deviation of split frequencies: 0.006265

      275100 -- [-1986.524] (-2010.950) (-1988.954) (-1997.859) * (-1992.693) [-1988.830] (-1988.866) (-1996.976) -- 0:03:51
      275200 -- [-1986.256] (-2005.785) (-1993.893) (-1992.017) * (-2005.151) (-1991.133) [-1986.793] (-1996.635) -- 0:03:51
      275300 -- [-1987.486] (-1998.071) (-2010.123) (-1990.700) * (-2007.405) [-1992.146] (-1984.971) (-1993.446) -- 0:03:51
      275400 -- [-1987.649] (-1995.604) (-2003.363) (-1991.017) * (-2014.046) (-1990.868) [-1981.116] (-1990.609) -- 0:03:51
      275500 -- [-1991.596] (-1989.046) (-2002.392) (-1992.530) * (-2000.223) (-1990.347) [-1985.604] (-1985.345) -- 0:03:51
      275600 -- [-1990.746] (-1993.062) (-2005.117) (-1994.841) * (-1988.377) (-1989.014) [-1984.129] (-1990.527) -- 0:03:51
      275700 -- (-1986.544) [-1991.158] (-2014.669) (-1993.834) * (-1993.211) (-1992.946) (-1987.615) [-1985.454] -- 0:03:51
      275800 -- (-1989.151) [-1987.695] (-2004.759) (-1995.242) * (-1991.374) (-1986.740) (-1987.617) [-1980.902] -- 0:03:51
      275900 -- (-1989.265) [-1988.231] (-1993.175) (-1994.612) * (-1992.583) (-1990.156) (-1997.290) [-1981.501] -- 0:03:50
      276000 -- [-1989.335] (-2005.294) (-1987.429) (-1996.707) * (-2000.978) (-1993.176) [-1990.314] (-1981.156) -- 0:03:50

      Average standard deviation of split frequencies: 0.006146

      276100 -- [-1986.715] (-2001.627) (-1997.420) (-1990.125) * (-2003.920) (-1989.594) (-1989.358) [-1983.015] -- 0:03:50
      276200 -- (-1990.757) (-2005.396) [-1989.544] (-1989.962) * (-1994.458) (-1988.752) (-1986.838) [-1979.149] -- 0:03:50
      276300 -- [-1987.219] (-1995.424) (-1993.300) (-1989.809) * (-1999.955) (-1991.283) (-1985.728) [-1980.888] -- 0:03:50
      276400 -- (-1984.699) (-1991.433) (-1991.641) [-1985.090] * (-2005.037) (-1997.517) (-1986.761) [-1980.327] -- 0:03:50
      276500 -- (-1987.349) (-1990.101) (-1985.121) [-1988.430] * (-1997.955) (-1989.069) (-1988.455) [-1981.652] -- 0:03:50
      276600 -- (-1990.475) (-2006.812) [-1987.960] (-1991.968) * (-2002.341) (-1986.110) (-1999.820) [-1980.722] -- 0:03:52
      276700 -- [-1985.089] (-2000.961) (-1988.579) (-1995.631) * (-1996.796) (-1989.081) (-1996.221) [-1979.111] -- 0:03:52
      276800 -- (-1982.772) (-1998.168) [-1991.707] (-1990.293) * (-2000.017) (-1986.628) (-2000.469) [-1982.532] -- 0:03:52
      276900 -- (-1985.118) (-1991.248) (-1998.188) [-1986.134] * (-1988.750) (-1986.221) (-1996.258) [-1985.201] -- 0:03:52
      277000 -- (-1985.553) [-1995.966] (-1996.544) (-1992.242) * (-1994.408) (-1994.487) (-2001.514) [-1976.783] -- 0:03:52

      Average standard deviation of split frequencies: 0.005831

      277100 -- (-1982.790) (-1992.561) (-2000.638) [-1987.985] * (-2002.771) (-1997.479) (-1999.005) [-1983.743] -- 0:03:52
      277200 -- (-1988.091) (-1989.318) [-1997.359] (-1989.897) * (-1994.877) (-1996.332) (-1996.026) [-1979.409] -- 0:03:52
      277300 -- (-1989.493) [-1991.157] (-2003.254) (-1989.739) * (-2003.925) (-1997.466) (-1997.034) [-1983.530] -- 0:03:51
      277400 -- [-1985.241] (-1992.706) (-1993.499) (-1994.323) * (-1997.111) (-1995.987) (-1996.272) [-1981.491] -- 0:03:51
      277500 -- [-1984.443] (-1992.711) (-1989.893) (-1998.723) * (-1993.266) (-2006.148) (-1993.752) [-1982.576] -- 0:03:51
      277600 -- [-1989.113] (-1993.396) (-1989.086) (-1999.192) * (-1988.844) (-2011.201) (-1995.714) [-1983.723] -- 0:03:51
      277700 -- (-1984.307) (-1993.865) [-1988.439] (-1995.045) * [-1988.731] (-2011.877) (-1994.947) (-1987.354) -- 0:03:51
      277800 -- (-1986.196) (-1993.040) [-1984.162] (-2001.103) * [-1987.654] (-2018.991) (-1991.986) (-1986.867) -- 0:03:51
      277900 -- [-1986.465] (-1994.569) (-1982.420) (-2003.759) * [-1985.523] (-2016.002) (-1998.827) (-1986.877) -- 0:03:51
      278000 -- (-1986.315) [-1996.622] (-1982.877) (-2002.368) * (-1990.156) (-2029.130) (-1996.013) [-1984.483] -- 0:03:51

      Average standard deviation of split frequencies: 0.005811

      278100 -- (-1985.177) (-1999.350) [-1982.808] (-2003.990) * (-1995.099) (-2020.373) (-2003.428) [-1978.917] -- 0:03:51
      278200 -- (-1989.821) (-1989.005) [-1981.801] (-1990.666) * (-1996.515) (-2014.742) (-1996.314) [-1980.933] -- 0:03:50
      278300 -- (-1994.828) (-1988.952) [-1981.457] (-1999.537) * (-1992.142) (-2004.303) (-1997.742) [-1982.833] -- 0:03:50
      278400 -- [-1985.241] (-1994.014) (-1986.851) (-1995.448) * (-1993.755) (-2004.268) (-1993.579) [-1982.231] -- 0:03:50
      278500 -- [-1985.033] (-1996.072) (-1993.750) (-2010.988) * (-1992.403) (-2010.630) (-1989.779) [-1985.403] -- 0:03:50
      278600 -- [-1980.902] (-1988.218) (-1992.732) (-2002.365) * (-1992.053) (-2005.631) (-1986.971) [-1986.378] -- 0:03:50
      278700 -- (-1982.467) [-1981.914] (-1992.127) (-1998.734) * (-1991.771) (-2003.684) (-1991.975) [-1985.481] -- 0:03:50
      278800 -- [-1980.860] (-1984.341) (-1995.562) (-1996.508) * (-1993.120) (-2001.368) (-1990.933) [-1985.958] -- 0:03:50
      278900 -- [-1981.045] (-1988.521) (-1996.045) (-1995.791) * [-1991.131] (-1999.623) (-1995.516) (-1985.514) -- 0:03:50
      279000 -- [-1989.083] (-1989.645) (-2004.535) (-1992.868) * (-1997.024) (-1998.765) (-1994.639) [-1986.238] -- 0:03:49

      Average standard deviation of split frequencies: 0.006127

      279100 -- [-1981.216] (-1998.055) (-1996.767) (-1999.072) * (-1987.029) (-2012.517) (-1997.471) [-1985.146] -- 0:03:49
      279200 -- (-1988.553) (-1993.348) (-1992.653) [-1996.885] * [-1989.658] (-1997.644) (-1999.778) (-1988.887) -- 0:03:49
      279300 -- [-1980.643] (-1987.712) (-1995.772) (-1987.943) * (-1999.112) (-1992.981) (-1999.081) [-1986.556] -- 0:03:49
      279400 -- [-1984.231] (-1991.332) (-1997.933) (-1985.945) * (-1992.254) (-1988.367) (-2002.545) [-1985.345] -- 0:03:49
      279500 -- [-1984.245] (-1995.158) (-1997.702) (-1986.752) * (-1993.138) [-1988.437] (-1996.479) (-1983.793) -- 0:03:49
      279600 -- (-1992.290) (-1991.629) (-1990.804) [-1985.379] * (-1996.798) (-1985.275) (-1996.440) [-1986.961] -- 0:03:49
      279700 -- [-1990.746] (-1996.876) (-1991.780) (-1993.705) * (-1990.833) [-1982.991] (-1993.777) (-1983.409) -- 0:03:51
      279800 -- [-1988.954] (-1993.680) (-1993.985) (-1992.391) * (-1991.372) (-1987.776) (-2001.412) [-1979.742] -- 0:03:51
      279900 -- (-1989.079) [-1987.161] (-1993.066) (-1993.606) * (-1992.266) (-1993.434) (-1997.156) [-1980.888] -- 0:03:51
      280000 -- (-1996.450) [-1986.831] (-1994.866) (-1995.605) * [-1987.475] (-1994.293) (-1994.081) (-1990.711) -- 0:03:51

      Average standard deviation of split frequencies: 0.006250

      280100 -- (-1992.084) (-1986.494) (-1991.921) [-1991.031] * [-1982.651] (-1989.973) (-1999.874) (-1991.569) -- 0:03:51
      280200 -- [-1991.446] (-1993.881) (-2000.173) (-1988.939) * (-1994.946) [-1984.964] (-1995.166) (-1990.323) -- 0:03:51
      280300 -- [-1988.148] (-1987.534) (-2005.857) (-1982.889) * (-1993.212) (-1985.476) (-2004.335) [-1986.107] -- 0:03:51
      280400 -- [-1987.500] (-1992.823) (-2003.715) (-1985.214) * (-1995.892) [-1982.672] (-1999.140) (-1989.147) -- 0:03:50
      280500 -- [-1982.495] (-1997.165) (-2007.638) (-1983.910) * (-1997.022) [-1982.466] (-2008.862) (-1984.157) -- 0:03:50
      280600 -- [-1980.248] (-1989.312) (-1999.097) (-1994.006) * (-2002.214) [-1986.416] (-2004.763) (-1981.856) -- 0:03:50
      280700 -- [-1979.201] (-1990.825) (-1993.689) (-1995.927) * (-1993.529) (-1984.578) (-2001.888) [-1980.496] -- 0:03:50
      280800 -- [-1979.889] (-1994.341) (-1995.670) (-1997.384) * (-1994.083) [-1982.516] (-1995.404) (-1983.440) -- 0:03:50
      280900 -- [-1985.738] (-1993.202) (-1995.854) (-2001.040) * (-1986.054) (-1985.978) (-1994.845) [-1982.721] -- 0:03:50
      281000 -- (-1983.949) (-2003.247) [-1989.639] (-2001.591) * (-1986.660) (-1989.852) (-1994.926) [-1983.767] -- 0:03:50

      Average standard deviation of split frequencies: 0.006083

      281100 -- [-1986.934] (-2000.434) (-1995.600) (-2001.998) * (-1985.389) (-1994.888) (-1994.487) [-1985.870] -- 0:03:50
      281200 -- [-1983.238] (-2005.711) (-2000.383) (-2001.406) * (-1988.583) (-1993.792) (-1995.249) [-1984.035] -- 0:03:50
      281300 -- [-1981.086] (-2003.522) (-2001.167) (-2004.446) * (-1990.704) [-1987.918] (-1995.577) (-1983.967) -- 0:03:49
      281400 -- [-1978.371] (-1992.223) (-1992.238) (-2006.947) * [-1990.415] (-1988.923) (-2003.174) (-1985.168) -- 0:03:49
      281500 -- [-1982.003] (-1992.080) (-1995.090) (-1997.952) * (-1991.780) (-1986.876) (-1994.362) [-1985.413] -- 0:03:49
      281600 -- [-1984.449] (-1988.813) (-1989.223) (-2003.960) * (-1999.465) (-1991.065) (-1992.265) [-1982.762] -- 0:03:49
      281700 -- (-1985.748) [-1988.324] (-1994.620) (-1992.030) * (-1992.999) [-1981.522] (-1994.668) (-1980.631) -- 0:03:49
      281800 -- [-1983.057] (-1994.399) (-1990.658) (-1994.571) * (-1999.601) (-1983.480) (-1996.233) [-1981.379] -- 0:03:49
      281900 -- [-1978.935] (-1985.964) (-2001.730) (-1995.720) * (-1993.490) (-1987.038) (-1993.090) [-1980.713] -- 0:03:49
      282000 -- [-1977.102] (-1993.907) (-2003.447) (-1993.548) * (-1993.372) [-1984.079] (-1992.244) (-1984.932) -- 0:03:49

      Average standard deviation of split frequencies: 0.006063

      282100 -- [-1982.846] (-2000.887) (-2002.080) (-1993.265) * (-1999.504) [-1979.607] (-1995.350) (-1985.359) -- 0:03:49
      282200 -- [-1984.174] (-1998.898) (-1991.886) (-1993.290) * (-1995.804) [-1975.696] (-1998.947) (-1988.212) -- 0:03:48
      282300 -- [-1985.005] (-1999.710) (-1991.669) (-1995.192) * [-1989.184] (-1980.802) (-2017.046) (-1994.832) -- 0:03:48
      282400 -- [-1984.963] (-1996.908) (-1998.846) (-1995.331) * (-1992.249) (-1981.700) (-2005.725) [-1993.100] -- 0:03:48
      282500 -- (-1995.940) (-1993.400) (-2005.106) [-1992.824] * [-1985.355] (-1976.177) (-2001.626) (-1986.313) -- 0:03:48
      282600 -- (-1988.748) (-1987.579) (-2016.046) [-1989.309] * (-1997.975) [-1983.057] (-1988.664) (-1986.988) -- 0:03:48
      282700 -- (-1992.065) (-1985.487) (-2008.094) [-1988.053] * (-1994.900) [-1997.329] (-1994.501) (-1992.573) -- 0:03:48
      282800 -- (-1990.932) [-1988.232] (-2002.611) (-1988.580) * (-2012.896) (-1992.883) [-1988.583] (-1992.170) -- 0:03:50
      282900 -- (-1991.506) [-1987.398] (-2002.503) (-1987.812) * (-2008.877) [-1992.446] (-1985.476) (-1982.933) -- 0:03:50
      283000 -- [-1984.528] (-1983.955) (-1995.775) (-1986.181) * (-1999.344) (-2000.602) (-1984.464) [-1986.711] -- 0:03:50

      Average standard deviation of split frequencies: 0.005660

      283100 -- (-1996.836) (-1985.093) (-1994.258) [-1983.943] * (-1997.648) (-1997.396) (-1985.229) [-1981.922] -- 0:03:50
      283200 -- (-1991.423) (-1986.518) (-1995.441) [-1992.422] * (-1998.306) (-1994.509) (-1994.263) [-1982.032] -- 0:03:50
      283300 -- (-1988.980) [-1989.671] (-2007.675) (-1994.849) * (-1997.922) (-1991.836) (-1985.626) [-1982.832] -- 0:03:50
      283400 -- [-1989.181] (-1988.354) (-1999.261) (-1995.571) * (-2005.991) (-1993.478) (-1991.236) [-1984.760] -- 0:03:50
      283500 -- [-1987.279] (-1992.388) (-1989.453) (-1990.894) * (-2002.943) (-1992.391) (-1989.557) [-1982.597] -- 0:03:49
      283600 -- (-1982.037) (-1992.484) (-1988.808) [-1991.877] * (-1998.756) (-1993.022) (-1988.852) [-1986.612] -- 0:03:49
      283700 -- (-1986.335) (-1992.399) [-1991.563] (-1992.883) * (-1998.835) (-1997.228) (-1995.905) [-1984.833] -- 0:03:49
      283800 -- [-1986.601] (-1990.378) (-1993.784) (-1988.976) * (-1994.723) [-1995.234] (-1990.158) (-1991.327) -- 0:03:49
      283900 -- (-1985.523) [-1987.824] (-1997.012) (-1990.240) * (-1992.346) [-1993.339] (-1992.225) (-1989.429) -- 0:03:49
      284000 -- (-1991.288) (-1991.329) [-1990.035] (-1994.023) * [-1990.700] (-1994.479) (-1990.147) (-1983.478) -- 0:03:49

      Average standard deviation of split frequencies: 0.005404

      284100 -- (-1991.334) [-1990.488] (-1990.095) (-1991.553) * (-1991.462) (-1988.196) (-1990.514) [-1980.778] -- 0:03:49
      284200 -- (-1993.100) (-1987.597) [-1993.116] (-1996.126) * (-1996.330) (-1994.495) (-1984.282) [-1983.998] -- 0:03:49
      284300 -- (-1997.295) [-1991.795] (-1988.786) (-2003.865) * (-2001.996) (-1997.178) (-1995.630) [-1982.792] -- 0:03:49
      284400 -- (-1992.818) (-1997.370) [-1991.409] (-2007.670) * (-2000.633) [-1988.365] (-1992.618) (-1982.981) -- 0:03:48
      284500 -- (-1997.903) [-1987.267] (-1994.006) (-2004.724) * (-2001.344) (-1986.208) (-1994.412) [-1984.525] -- 0:03:48
      284600 -- [-1989.786] (-1994.103) (-1996.976) (-2001.012) * (-1999.026) (-1992.922) (-1994.932) [-1981.867] -- 0:03:48
      284700 -- (-1987.751) (-1989.870) (-2006.994) [-2001.427] * (-2004.389) (-1990.078) (-1993.107) [-1981.635] -- 0:03:48
      284800 -- (-1988.355) [-1996.455] (-1995.595) (-2006.924) * (-2001.086) (-1990.561) (-1988.880) [-1983.015] -- 0:03:48
      284900 -- (-1986.711) [-1993.445] (-1997.824) (-2000.593) * (-1998.911) (-1993.903) (-1985.026) [-1984.541] -- 0:03:48
      285000 -- (-1988.179) [-1986.989] (-2003.219) (-2000.135) * (-2001.064) (-1991.336) [-1983.531] (-1986.927) -- 0:03:48

      Average standard deviation of split frequencies: 0.005431

      285100 -- (-1991.749) [-1987.476] (-1990.954) (-2002.358) * (-1996.633) (-1987.028) (-1988.099) [-1982.643] -- 0:03:48
      285200 -- (-1990.625) [-1985.276] (-1986.947) (-2007.853) * (-1993.918) [-1989.446] (-1990.902) (-1983.386) -- 0:03:48
      285300 -- (-1985.377) [-1988.124] (-1985.659) (-2006.816) * (-1994.383) [-1984.812] (-1990.852) (-1987.482) -- 0:03:47
      285400 -- [-1984.417] (-1991.314) (-1985.681) (-2001.057) * (-1993.652) [-1983.165] (-1988.161) (-1981.525) -- 0:03:47
      285500 -- (-1985.815) (-1983.334) [-1988.022] (-1996.102) * (-1996.725) (-1982.587) (-1987.427) [-1980.932] -- 0:03:47
      285600 -- [-1980.004] (-1992.002) (-1987.011) (-1999.245) * (-1997.270) (-1980.886) (-1993.324) [-1983.862] -- 0:03:47
      285700 -- [-1977.103] (-1997.957) (-1990.806) (-1991.819) * (-2000.883) (-1988.484) (-1989.811) [-1981.578] -- 0:03:47
      285800 -- [-1977.721] (-1990.171) (-1988.775) (-1995.277) * (-1999.488) [-1981.770] (-1992.420) (-1984.494) -- 0:03:47
      285900 -- [-1977.866] (-1992.412) (-1990.399) (-1995.272) * (-1996.228) [-1985.704] (-1995.968) (-1981.889) -- 0:03:49
      286000 -- [-1982.584] (-1997.489) (-1985.989) (-1992.051) * (-1997.452) (-1986.496) (-1991.601) [-1987.268] -- 0:03:49

      Average standard deviation of split frequencies: 0.005413

      286100 -- [-1979.246] (-1989.055) (-1992.638) (-1988.510) * (-1995.689) (-1990.647) (-1990.149) [-1980.857] -- 0:03:49
      286200 -- (-1982.190) (-1989.325) (-1988.346) [-1989.655] * (-1995.194) [-1982.952] (-2000.322) (-1986.308) -- 0:03:49
      286300 -- (-1988.519) (-1986.001) [-1988.673] (-1990.439) * (-1993.528) (-1983.551) (-1997.334) [-1992.745] -- 0:03:49
      286400 -- [-1983.701] (-1989.228) (-1990.385) (-1984.535) * (-1991.863) (-1990.099) (-1995.442) [-1994.997] -- 0:03:49
      286500 -- (-1986.958) (-1989.772) (-1990.968) [-1984.612] * (-1997.391) (-1987.241) (-1998.756) [-1989.136] -- 0:03:49
      286600 -- (-1992.463) (-1986.872) (-1990.852) [-1986.475] * (-1988.862) (-1993.806) (-1999.525) [-1990.744] -- 0:03:49
      286700 -- [-1990.718] (-1988.296) (-1997.653) (-1997.372) * (-1998.057) (-1985.208) (-1996.100) [-1988.021] -- 0:03:48
      286800 -- (-1992.371) (-1990.579) (-1999.614) [-1988.965] * (-1996.514) (-1986.766) (-2002.204) [-1981.677] -- 0:03:48
      286900 -- (-1990.726) (-1992.897) (-1995.509) [-1985.408] * (-1999.456) (-1990.410) (-1999.057) [-1986.097] -- 0:03:48
      287000 -- (-1986.016) (-1994.770) (-2000.541) [-1986.665] * (-1991.733) (-1993.361) (-2001.427) [-1980.488] -- 0:03:48

      Average standard deviation of split frequencies: 0.005534

      287100 -- [-1988.957] (-1996.954) (-2000.393) (-1991.027) * (-1992.015) (-1992.656) (-2005.617) [-1981.456] -- 0:03:48
      287200 -- (-1995.512) (-1998.111) [-1993.435] (-1989.231) * (-1989.477) (-1984.639) (-2008.722) [-1982.070] -- 0:03:48
      287300 -- (-1993.104) (-2002.427) (-1999.513) [-1991.821] * (-1986.572) (-1994.422) (-2009.867) [-1979.468] -- 0:03:48
      287400 -- (-1989.966) (-1994.688) (-2000.116) [-1991.734] * (-1990.742) [-1986.685] (-2006.555) (-1981.631) -- 0:03:48
      287500 -- [-1991.226] (-1993.192) (-1999.908) (-2005.214) * (-1989.911) (-1987.430) (-2001.493) [-1986.071] -- 0:03:48
      287600 -- [-1995.210] (-1997.185) (-1992.884) (-2009.113) * [-1987.425] (-1987.661) (-2003.748) (-1981.383) -- 0:03:47
      287700 -- [-1995.073] (-1990.810) (-1990.342) (-2003.796) * (-1984.340) (-2001.236) (-2002.414) [-1981.620] -- 0:03:47
      287800 -- [-1997.985] (-2001.171) (-1996.964) (-2007.175) * (-1986.280) (-1998.670) (-2006.713) [-1978.037] -- 0:03:47
      287900 -- [-1987.646] (-2001.421) (-1991.849) (-1999.460) * (-1984.905) (-2000.208) (-2004.088) [-1980.411] -- 0:03:47
      288000 -- [-1988.639] (-2009.430) (-1990.609) (-1994.646) * (-1992.195) [-1986.964] (-1997.588) (-1982.830) -- 0:03:47

      Average standard deviation of split frequencies: 0.005376

      288100 -- [-1984.926] (-2001.556) (-1991.672) (-1997.194) * (-1993.198) (-1992.511) (-1993.132) [-1981.631] -- 0:03:47
      288200 -- (-1991.393) (-1990.437) [-1992.807] (-1998.820) * (-2001.118) [-1987.184] (-1991.562) (-1984.030) -- 0:03:47
      288300 -- (-1988.473) [-1991.112] (-1991.995) (-1996.941) * (-2003.955) (-2002.216) (-1997.283) [-1982.716] -- 0:03:47
      288400 -- (-1998.613) (-1989.345) (-1990.452) [-1988.810] * [-1983.438] (-1997.443) (-1994.452) (-1986.261) -- 0:03:47
      288500 -- (-2003.069) (-1992.893) [-1987.189] (-1988.995) * (-1991.370) (-1999.230) (-1996.258) [-1985.014] -- 0:03:46
      288600 -- [-2000.396] (-1992.337) (-1988.512) (-1987.849) * (-1992.145) (-1999.487) (-1996.540) [-1979.240] -- 0:03:46
      288700 -- (-1999.276) (-1990.411) (-1997.212) [-1987.085] * (-1996.510) (-1989.083) [-1990.847] (-1981.237) -- 0:03:46
      288800 -- (-1987.432) [-1986.637] (-1992.862) (-1987.383) * (-1997.185) (-1996.847) (-1995.878) [-1977.945] -- 0:03:46
      288900 -- [-1988.989] (-1985.107) (-1996.085) (-1993.956) * (-1998.035) (-1990.972) (-1996.923) [-1980.249] -- 0:03:46
      289000 -- (-1988.236) (-1990.565) (-2001.949) [-1983.427] * (-1996.276) (-1983.917) (-1995.889) [-1981.413] -- 0:03:48

      Average standard deviation of split frequencies: 0.005216

      289100 -- (-1988.676) (-1995.714) (-1994.796) [-1983.742] * (-2000.194) [-1983.537] (-1997.447) (-1982.055) -- 0:03:48
      289200 -- (-1990.459) (-1988.981) (-1999.162) [-1981.774] * (-2006.226) (-1983.200) (-1997.824) [-1979.595] -- 0:03:48
      289300 -- (-1990.137) (-1989.360) (-1995.305) [-1981.953] * (-2009.862) [-1977.803] (-2000.839) (-1981.877) -- 0:03:48
      289400 -- (-1986.914) (-1992.018) (-1988.524) [-1983.520] * (-1995.123) (-1985.930) (-1997.426) [-1982.870] -- 0:03:48
      289500 -- (-1989.667) (-1988.908) [-1988.833] (-1985.847) * (-1992.383) (-1979.178) (-1988.876) [-1983.004] -- 0:03:48
      289600 -- (-1993.139) (-1991.270) (-1997.649) [-1983.510] * [-1990.134] (-1985.061) (-2002.590) (-1986.336) -- 0:03:48
      289700 -- (-1992.072) (-1996.088) (-1995.013) [-1990.535] * (-1998.209) (-1987.589) (-1995.555) [-1986.557] -- 0:03:48
      289800 -- (-1996.023) (-1998.373) (-2003.997) [-1985.664] * (-1998.690) (-1988.035) (-2008.643) [-1979.777] -- 0:03:47
      289900 -- (-1992.622) (-2001.323) (-1997.148) [-1984.176] * (-1995.763) (-1985.821) (-1999.954) [-1978.350] -- 0:03:47
      290000 -- (-1995.822) (-1991.060) (-2001.616) [-1987.076] * (-1996.567) (-1983.797) (-2002.675) [-1981.581] -- 0:03:47

      Average standard deviation of split frequencies: 0.005246

      290100 -- (-2008.017) (-1992.712) (-1987.340) [-1981.446] * (-1991.808) (-1981.377) (-2002.604) [-1979.160] -- 0:03:47
      290200 -- (-2004.258) (-1994.882) (-1985.718) [-1992.475] * (-1996.850) [-1981.724] (-1997.109) (-1989.788) -- 0:03:47
      290300 -- (-1995.768) (-1988.417) [-1988.741] (-2004.086) * (-2008.338) [-1982.490] (-2000.401) (-1985.800) -- 0:03:47
      290400 -- [-1992.161] (-1991.065) (-1986.546) (-1998.993) * (-1998.647) (-1983.309) (-1996.264) [-1983.697] -- 0:03:47
      290500 -- [-1993.651] (-1987.792) (-1986.205) (-1996.657) * (-1992.676) [-1988.959] (-1989.652) (-1983.991) -- 0:03:47
      290600 -- (-2003.418) (-1995.477) [-1982.124] (-1989.921) * (-2005.130) (-1994.508) (-1985.888) [-1979.769] -- 0:03:47
      290700 -- (-1998.767) (-1986.792) [-1986.367] (-1996.494) * (-2001.142) (-1996.540) (-1990.967) [-1979.918] -- 0:03:46
      290800 -- (-1999.071) [-1984.411] (-1984.147) (-2004.255) * (-2001.685) (-1988.377) (-1995.784) [-1980.527] -- 0:03:46
      290900 -- (-1993.864) [-1990.612] (-1987.773) (-1992.084) * [-1995.813] (-1990.456) (-1996.083) (-1980.344) -- 0:03:46
      291000 -- [-1990.980] (-1998.259) (-1991.302) (-1994.498) * (-1995.151) (-1990.230) (-1986.871) [-1984.597] -- 0:03:46

      Average standard deviation of split frequencies: 0.005042

      291100 -- (-1990.875) (-2006.000) (-2001.674) [-1990.235] * (-1996.161) (-1992.393) [-1986.408] (-1989.670) -- 0:03:46
      291200 -- (-1999.686) (-1991.793) [-1998.757] (-1988.339) * (-1998.981) [-1993.315] (-1995.120) (-1999.069) -- 0:03:46
      291300 -- (-1997.839) (-1989.620) [-1989.136] (-1985.012) * [-1999.844] (-1988.358) (-1992.001) (-1990.056) -- 0:03:46
      291400 -- (-1998.303) (-1996.263) [-1984.968] (-1979.425) * (-1996.242) (-1991.525) [-1991.669] (-1994.610) -- 0:03:46
      291500 -- (-1992.355) (-1997.548) (-1984.028) [-1996.029] * [-1995.625] (-1991.224) (-2003.277) (-1995.813) -- 0:03:46
      291600 -- (-2002.363) (-1994.044) (-1984.599) [-1987.791] * (-1997.445) [-1987.882] (-1995.923) (-1990.283) -- 0:03:45
      291700 -- (-2002.518) [-1990.391] (-1986.488) (-1991.197) * (-1990.395) (-1989.074) (-1990.930) [-1981.623] -- 0:03:45
      291800 -- (-1999.811) (-1989.248) [-1986.493] (-1988.635) * (-1996.733) (-1988.580) (-1995.551) [-1983.034] -- 0:03:45
      291900 -- [-2003.457] (-1987.106) (-1996.362) (-1990.751) * (-1999.185) (-1986.738) (-2007.206) [-1987.712] -- 0:03:45
      292000 -- (-2003.640) [-1990.731] (-2003.702) (-1997.897) * (-1995.677) [-1985.516] (-1991.441) (-1982.912) -- 0:03:45

      Average standard deviation of split frequencies: 0.005072

      292100 -- (-1990.834) [-1989.786] (-2004.034) (-2000.465) * (-1994.999) (-1982.997) (-1993.008) [-1980.630] -- 0:03:47
      292200 -- (-1999.013) (-1992.479) (-2003.388) [-1997.643] * (-1999.881) (-1983.062) (-1997.778) [-1986.112] -- 0:03:47
      292300 -- [-1988.608] (-1997.005) (-2003.986) (-1995.030) * (-1998.234) [-1981.061] (-1993.302) (-1992.648) -- 0:03:47
      292400 -- [-1988.395] (-2000.055) (-1999.093) (-1993.709) * (-1993.787) [-1981.436] (-1998.676) (-1988.260) -- 0:03:47
      292500 -- [-1989.973] (-1998.846) (-1997.605) (-1997.520) * (-1995.849) [-1988.408] (-1997.289) (-1985.556) -- 0:03:47
      292600 -- [-1985.701] (-1995.146) (-1997.578) (-1990.060) * (-1992.844) (-1988.482) (-1996.850) [-1981.698] -- 0:03:47
      292700 -- [-1986.179] (-1999.578) (-1998.796) (-2003.025) * (-1997.552) (-1984.111) (-1999.827) [-1987.018] -- 0:03:47
      292800 -- (-1985.759) (-1990.728) [-1994.251] (-2009.187) * (-1993.065) (-1986.723) (-1998.523) [-1984.506] -- 0:03:47
      292900 -- [-1991.238] (-1989.850) (-1989.811) (-2006.009) * (-1996.835) (-1987.451) (-1995.649) [-1988.369] -- 0:03:46
      293000 -- (-1993.831) (-1993.117) (-1994.725) [-1994.310] * (-1987.144) (-1989.727) (-1991.789) [-1988.057] -- 0:03:46

      Average standard deviation of split frequencies: 0.004869

      293100 -- (-1988.329) (-1998.908) (-1991.069) [-1983.386] * [-1983.997] (-2000.594) (-1991.949) (-1982.457) -- 0:03:46
      293200 -- (-1993.661) (-2007.139) [-1990.068] (-1985.461) * [-1983.743] (-1998.935) (-1991.905) (-1986.266) -- 0:03:46
      293300 -- [-1988.144] (-2001.768) (-1994.768) (-1991.573) * [-1989.177] (-2000.182) (-1993.908) (-1988.630) -- 0:03:46
      293400 -- [-1989.219] (-1994.142) (-1994.652) (-1996.141) * (-1989.980) (-2000.107) (-2005.683) [-1985.230] -- 0:03:46
      293500 -- (-1998.115) [-1987.059] (-2001.265) (-1990.129) * (-1994.770) [-1988.427] (-1994.521) (-1990.861) -- 0:03:46
      293600 -- (-1992.841) (-1991.986) (-1995.488) [-1984.363] * (-1998.974) [-1990.110] (-2002.859) (-1987.487) -- 0:03:46
      293700 -- (-2003.531) [-1988.655] (-1991.010) (-1989.495) * (-1993.863) (-1988.690) (-1999.696) [-1987.164] -- 0:03:46
      293800 -- (-1997.929) (-1995.879) (-1987.925) [-1989.367] * (-1995.331) (-1988.929) (-1995.937) [-1985.156] -- 0:03:45
      293900 -- [-1992.134] (-1992.747) (-1988.025) (-1994.150) * [-1984.983] (-1992.887) (-1995.327) (-1984.408) -- 0:03:45
      294000 -- (-2001.505) [-1988.549] (-1988.847) (-1998.275) * (-1990.280) (-1987.440) [-1989.917] (-1983.899) -- 0:03:45

      Average standard deviation of split frequencies: 0.004625

      294100 -- (-2002.923) (-1996.449) [-1985.994] (-1993.040) * (-1992.530) [-1990.679] (-1988.270) (-1983.215) -- 0:03:45
      294200 -- (-2001.619) (-1996.022) (-1986.552) [-1987.504] * (-1989.464) (-1995.583) (-1989.136) [-1982.759] -- 0:03:45
      294300 -- (-1996.372) (-1994.364) [-1985.373] (-1993.133) * [-1989.672] (-2006.211) (-1996.841) (-1983.909) -- 0:03:45
      294400 -- (-1995.019) (-1989.722) [-1988.028] (-1998.027) * (-1991.675) (-2002.130) (-1986.978) [-1986.874] -- 0:03:45
      294500 -- (-1994.476) (-1992.485) [-1990.465] (-1996.490) * (-1987.247) (-1998.591) (-1991.766) [-1991.263] -- 0:03:45
      294600 -- (-1992.784) (-1994.415) (-1988.863) [-1985.118] * [-1986.854] (-2004.483) (-2000.091) (-1993.628) -- 0:03:45
      294700 -- (-1992.546) (-1996.310) (-1989.230) [-1982.183] * [-1988.043] (-2001.288) (-1999.348) (-2002.999) -- 0:03:44
      294800 -- (-1992.186) (-1993.852) (-1983.835) [-1984.681] * [-1989.557] (-1995.168) (-1994.883) (-1995.694) -- 0:03:44
      294900 -- (-1997.661) (-1996.281) (-1988.873) [-1983.593] * (-1985.080) [-1993.376] (-1989.498) (-1992.791) -- 0:03:44
      295000 -- (-1998.025) (-1996.666) (-1987.751) [-1982.863] * [-1984.606] (-1987.935) (-1990.899) (-1993.752) -- 0:03:44

      Average standard deviation of split frequencies: 0.004791

      295100 -- (-2009.491) (-1990.915) (-1993.073) [-1988.558] * (-1988.111) (-1987.908) (-2001.761) [-1990.067] -- 0:03:44
      295200 -- (-2004.731) (-1986.650) [-1991.407] (-1991.741) * (-1985.168) (-1991.528) (-1990.277) [-1986.965] -- 0:03:46
      295300 -- (-2007.439) [-1994.571] (-1992.077) (-1997.138) * (-1987.352) [-1990.359] (-1989.835) (-1992.764) -- 0:03:46
      295400 -- (-2020.432) [-1987.806] (-1991.375) (-1987.032) * (-1994.999) [-1985.943] (-1997.997) (-1995.411) -- 0:03:46
      295500 -- (-2012.794) (-1989.792) (-1993.714) [-1985.839] * (-1991.112) (-1993.002) (-1997.105) [-1988.405] -- 0:03:46
      295600 -- (-2009.313) [-1987.477] (-1992.484) (-1982.666) * (-1991.626) [-1987.953] (-1994.190) (-1993.167) -- 0:03:46
      295700 -- (-2002.876) [-1989.688] (-1987.567) (-1985.117) * (-1997.067) (-1993.322) [-1990.974] (-1998.579) -- 0:03:46
      295800 -- (-1993.488) (-1992.522) [-1986.738] (-1988.710) * (-1997.116) (-1990.799) [-1985.365] (-1995.651) -- 0:03:46
      295900 -- (-1999.501) (-1996.975) (-1988.986) [-1984.525] * (-1993.792) (-1993.829) [-1982.291] (-1993.432) -- 0:03:46
      296000 -- [-1990.917] (-1996.380) (-1991.352) (-1984.359) * (-1997.821) (-1996.751) [-1982.532] (-1990.454) -- 0:03:45

      Average standard deviation of split frequencies: 0.004958

      296100 -- (-1994.553) (-1987.402) (-1992.864) [-1983.252] * (-1993.134) (-1995.859) [-1982.980] (-1990.082) -- 0:03:45
      296200 -- (-1989.755) [-1988.213] (-1990.141) (-1982.422) * (-1988.097) (-1995.879) [-1982.821] (-2001.328) -- 0:03:45
      296300 -- (-1992.731) (-1990.112) [-1991.039] (-1982.439) * (-1988.032) (-1998.894) [-1989.914] (-1991.717) -- 0:03:45
      296400 -- [-1994.785] (-1989.135) (-1990.463) (-1986.568) * (-1982.687) [-1986.700] (-1986.325) (-2006.943) -- 0:03:45
      296500 -- (-1991.021) [-1988.109] (-1992.112) (-1987.222) * [-1984.994] (-1986.996) (-1988.275) (-1999.016) -- 0:03:45
      296600 -- (-1987.549) (-1995.109) [-1992.411] (-1989.333) * [-1979.732] (-1995.577) (-1993.265) (-1993.491) -- 0:03:45
      296700 -- [-1991.181] (-2002.007) (-1995.361) (-1991.254) * [-1983.177] (-1995.566) (-1993.434) (-1994.791) -- 0:03:45
      296800 -- (-1994.143) (-2001.558) [-1987.985] (-1990.401) * (-1985.017) (-1994.654) (-2003.160) [-1990.095] -- 0:03:45
      296900 -- (-1989.306) (-1998.701) [-1992.776] (-1991.560) * (-1985.599) (-1993.754) [-1992.988] (-1991.430) -- 0:03:44
      297000 -- [-1993.641] (-2004.338) (-1992.267) (-1987.454) * (-1983.933) (-1993.308) [-1986.933] (-1991.866) -- 0:03:44

      Average standard deviation of split frequencies: 0.005121

      297100 -- [-2002.126] (-2001.181) (-1995.899) (-1987.342) * (-1989.871) (-1994.884) (-1987.899) [-1987.712] -- 0:03:44
      297200 -- (-2000.374) [-1995.056] (-1996.765) (-1992.333) * (-1988.999) (-1995.081) [-1986.316] (-1989.262) -- 0:03:44
      297300 -- (-1994.926) (-1996.803) [-1994.515] (-1984.678) * (-1993.734) (-1991.600) [-1989.133] (-1989.889) -- 0:03:44
      297400 -- (-1994.524) [-1993.230] (-1993.574) (-1990.359) * (-2001.122) (-1995.595) [-1988.510] (-1996.135) -- 0:03:44
      297500 -- (-1998.289) (-2000.912) (-1987.320) [-1989.856] * (-1996.887) (-1997.739) [-1980.933] (-1989.807) -- 0:03:44
      297600 -- (-2003.954) (-1987.888) [-1991.640] (-1990.939) * (-1995.716) (-1999.551) [-1980.100] (-1998.644) -- 0:03:44
      297700 -- (-1999.072) (-1987.869) [-1991.745] (-1993.612) * (-1997.291) (-1999.761) [-1981.262] (-2004.178) -- 0:03:44
      297800 -- (-1999.790) [-1984.008] (-1990.578) (-1995.694) * (-1996.601) (-2000.152) [-1985.927] (-1997.370) -- 0:03:44
      297900 -- (-2001.972) [-1984.433] (-1998.489) (-1991.074) * (-1992.137) (-1996.367) [-1980.355] (-2011.981) -- 0:03:43
      298000 -- (-2005.422) [-1985.601] (-1995.556) (-1989.122) * (-1991.150) (-1996.319) [-1979.848] (-1997.867) -- 0:03:43

      Average standard deviation of split frequencies: 0.005286

      298100 -- (-2004.949) (-1996.122) [-1987.152] (-1994.430) * (-1991.496) (-1990.242) [-1984.152] (-1999.097) -- 0:03:43
      298200 -- (-2002.151) (-1998.332) [-1986.160] (-1992.720) * (-1990.679) (-1995.502) [-1981.782] (-1997.025) -- 0:03:43
      298300 -- [-1984.813] (-1996.561) (-1988.585) (-1995.525) * (-1994.716) (-2000.963) [-1984.567] (-1996.857) -- 0:03:45
      298400 -- (-1988.371) (-1997.267) (-1985.726) [-1989.580] * (-1993.644) (-1992.394) [-1989.518] (-1995.859) -- 0:03:45
      298500 -- (-1992.104) (-1990.142) [-1985.984] (-1998.911) * (-1990.535) (-1988.174) [-1985.426] (-1995.207) -- 0:03:45
      298600 -- [-1989.520] (-1992.559) (-1986.775) (-2002.362) * (-1987.199) (-1995.559) [-1982.045] (-1990.410) -- 0:03:45
      298700 -- [-1985.146] (-1996.359) (-1993.232) (-2008.445) * (-1993.864) (-2008.092) [-1977.503] (-1989.783) -- 0:03:45
      298800 -- [-1991.948] (-1998.708) (-1991.428) (-2001.651) * (-1988.559) (-1999.270) [-1978.441] (-1997.859) -- 0:03:45
      298900 -- (-1986.920) [-1997.537] (-1995.001) (-1991.375) * (-1990.888) (-1993.306) [-1983.640] (-1999.355) -- 0:03:45
      299000 -- [-1988.806] (-2002.318) (-1993.553) (-1994.310) * [-1988.389] (-1991.633) (-1981.375) (-2001.230) -- 0:03:45

      Average standard deviation of split frequencies: 0.005042

      299100 -- [-1988.725] (-2000.535) (-1995.459) (-1989.185) * (-1987.381) (-1995.810) [-1982.935] (-1997.419) -- 0:03:44
      299200 -- (-1992.966) (-2005.643) [-1989.295] (-1989.959) * (-1993.910) (-1990.598) [-1982.046] (-1994.886) -- 0:03:44
      299300 -- [-1989.780] (-2002.457) (-1990.625) (-1988.709) * (-1999.276) (-1991.847) [-1981.941] (-1998.610) -- 0:03:44
      299400 -- (-1997.684) (-2004.304) (-1990.550) [-1987.705] * (-2004.818) (-1992.362) (-1991.973) [-2001.801] -- 0:03:44
      299500 -- [-1987.355] (-2002.941) (-1988.768) (-1985.208) * [-1988.501] (-2002.038) (-1991.440) (-1999.397) -- 0:03:44
      299600 -- (-1992.726) (-1999.538) (-1990.360) [-1985.037] * (-1996.562) (-1997.293) [-1992.041] (-1997.097) -- 0:03:44
      299700 -- (-1992.150) (-1999.196) [-1985.757] (-1985.604) * (-2000.264) [-1990.605] (-1994.487) (-1998.288) -- 0:03:44
      299800 -- (-1989.580) (-1996.554) (-1982.771) [-1987.360] * (-1994.015) (-1997.661) [-1987.074] (-1991.434) -- 0:03:44
      299900 -- (-1992.259) (-1992.124) (-1986.358) [-1983.979] * [-1991.038] (-1998.276) (-1991.828) (-1988.888) -- 0:03:44
      300000 -- (-1994.191) (-1995.572) (-1991.852) [-1989.318] * (-1992.315) (-1992.391) (-1994.781) [-1987.977] -- 0:03:44

      Average standard deviation of split frequencies: 0.004712

      300100 -- (-1987.963) (-1994.412) (-1991.701) [-1989.329] * (-1992.839) (-1996.443) [-1996.200] (-1986.799) -- 0:03:43
      300200 -- (-1991.991) (-1998.846) (-1992.385) [-1984.053] * (-1992.045) (-1990.333) (-1995.372) [-1985.061] -- 0:03:43
      300300 -- (-1999.739) (-1996.175) (-1995.260) [-1985.579] * (-1995.805) [-1988.091] (-2001.364) (-1992.805) -- 0:03:43
      300400 -- (-1994.124) (-2001.044) (-1989.018) [-1986.157] * (-1993.607) [-1982.135] (-1996.790) (-1989.937) -- 0:03:43
      300500 -- (-1994.191) (-1994.140) (-1998.295) [-1986.799] * (-1989.192) [-1985.170] (-1996.783) (-1984.941) -- 0:03:43
      300600 -- [-1987.096] (-1992.970) (-1999.344) (-1985.882) * (-1991.508) [-1984.752] (-1998.480) (-1986.727) -- 0:03:43
      300700 -- (-1987.105) (-1989.486) (-2000.856) [-1979.561] * (-1991.173) (-1988.597) (-1997.555) [-1988.569] -- 0:03:43
      300800 -- [-1986.073] (-1993.498) (-2006.734) (-1981.340) * (-1990.477) (-1987.144) [-1992.588] (-1993.101) -- 0:03:43
      300900 -- (-1989.852) (-1998.304) (-2025.238) [-1979.645] * (-1994.248) [-1985.340] (-1985.758) (-1995.005) -- 0:03:43
      301000 -- (-1986.361) (-1993.722) (-2004.174) [-1981.461] * (-1992.367) [-1984.756] (-1990.797) (-1989.887) -- 0:03:42

      Average standard deviation of split frequencies: 0.004516

      301100 -- [-1989.075] (-1988.953) (-2003.135) (-1984.426) * (-1997.964) (-1986.958) [-1990.283] (-1996.719) -- 0:03:42
      301200 -- [-1989.798] (-1990.320) (-2000.021) (-1990.724) * (-1988.616) [-1983.549] (-1990.274) (-1990.714) -- 0:03:42
      301300 -- [-1988.879] (-1991.120) (-2005.466) (-1983.162) * (-1989.396) [-1986.025] (-1998.689) (-1987.907) -- 0:03:42
      301400 -- [-1989.907] (-1992.689) (-2013.492) (-1988.071) * (-1992.305) [-1985.547] (-1991.129) (-1994.382) -- 0:03:44
      301500 -- (-1999.506) (-1988.713) (-2004.745) [-1990.290] * (-1997.924) [-1987.443] (-1998.194) (-1996.474) -- 0:03:44
      301600 -- (-2000.886) [-1985.867] (-1993.409) (-1995.991) * (-1995.838) (-1986.292) [-1990.749] (-1999.984) -- 0:03:44
      301700 -- (-2000.848) (-1985.743) (-1994.559) [-1994.100] * (-1995.294) [-1986.588] (-1995.563) (-1996.196) -- 0:03:44
      301800 -- [-1993.248] (-1990.002) (-1997.064) (-1986.286) * (-1992.030) [-1988.461] (-2005.661) (-1991.338) -- 0:03:44
      301900 -- (-2001.464) (-1986.882) (-1996.594) [-1990.775] * (-1996.936) (-1990.464) (-1996.258) [-1982.376] -- 0:03:44
      302000 -- (-2005.034) (-1989.188) (-2007.990) [-1990.441] * (-1990.727) (-2000.455) (-1992.008) [-1987.086] -- 0:03:44

      Average standard deviation of split frequencies: 0.003968

      302100 -- (-2003.533) [-1986.046] (-2002.134) (-1993.349) * [-1989.871] (-1992.098) (-2003.100) (-1982.869) -- 0:03:44
      302200 -- (-1992.068) (-1991.080) [-1991.642] (-1988.457) * (-1992.131) [-1985.909] (-2004.883) (-1988.497) -- 0:03:43
      302300 -- (-1985.628) (-1988.840) (-1991.556) [-1985.100] * [-1994.312] (-1990.363) (-1998.331) (-1990.007) -- 0:03:43
      302400 -- [-1989.262] (-1991.437) (-1993.656) (-1998.380) * (-1989.672) (-1992.530) (-2003.480) [-1994.336] -- 0:03:43
      302500 -- [-1988.530] (-1991.847) (-1994.288) (-1995.398) * (-1995.197) (-1999.072) (-2007.472) [-1988.664] -- 0:03:43
      302600 -- (-1987.440) (-1993.075) (-1992.922) [-1985.589] * [-1990.234] (-2002.449) (-2007.138) (-2000.073) -- 0:03:43
      302700 -- [-1994.852] (-2009.368) (-1993.024) (-1990.752) * (-1992.858) (-1998.799) (-2006.200) [-1990.465] -- 0:03:43
      302800 -- (-1997.928) (-2002.115) [-1990.680] (-1994.055) * (-1999.331) (-2007.844) (-2009.451) [-1989.790] -- 0:03:43
      302900 -- [-1993.121] (-1999.005) (-1995.778) (-1990.313) * (-1995.066) (-2005.272) (-2018.312) [-1989.364] -- 0:03:43
      303000 -- (-2000.621) (-1991.896) (-1999.151) [-1986.260] * [-1995.232] (-1999.283) (-2017.161) (-1992.755) -- 0:03:43

      Average standard deviation of split frequencies: 0.003687

      303100 -- (-1996.585) (-1994.909) (-2003.697) [-1980.570] * [-1988.306] (-1996.194) (-2003.589) (-1989.289) -- 0:03:43
      303200 -- [-1995.421] (-1995.581) (-2006.418) (-1983.944) * [-1995.370] (-1990.380) (-2002.299) (-1992.520) -- 0:03:42
      303300 -- (-1994.765) (-1990.118) (-1998.758) [-1982.463] * (-1990.607) (-1988.241) (-1995.742) [-1992.525] -- 0:03:42
      303400 -- (-1989.147) (-1991.353) [-1993.197] (-1981.862) * (-1992.499) [-1985.517] (-2001.217) (-1987.758) -- 0:03:42
      303500 -- (-1991.681) (-1998.975) (-2001.386) [-1984.458] * (-1994.379) (-1989.702) (-1996.415) [-1988.812] -- 0:03:42
      303600 -- (-1988.985) (-1999.089) (-1993.506) [-1978.696] * [-1985.469] (-1991.258) (-1995.381) (-1989.311) -- 0:03:42
      303700 -- (-1990.517) (-2000.833) (-1990.336) [-1982.424] * (-1987.989) [-1990.858] (-1994.626) (-1995.471) -- 0:03:42
      303800 -- (-1994.963) (-1997.445) [-1983.960] (-1989.854) * (-1989.359) [-1988.412] (-1991.093) (-1996.073) -- 0:03:42
      303900 -- (-1991.194) (-1993.516) [-1988.837] (-1985.977) * [-1993.153] (-1986.787) (-1989.541) (-1996.680) -- 0:03:42
      304000 -- (-1985.958) (-1999.685) [-1984.694] (-1983.463) * (-1991.109) [-1985.986] (-1987.433) (-1998.394) -- 0:03:42

      Average standard deviation of split frequencies: 0.003587

      304100 -- (-1987.895) (-1995.536) [-1985.316] (-1984.231) * (-1995.012) [-1989.112] (-1990.405) (-1994.068) -- 0:03:41
      304200 -- (-1993.243) (-1999.836) (-1987.132) [-1988.158] * (-1991.735) [-1986.010] (-1994.473) (-1990.240) -- 0:03:41
      304300 -- (-1999.575) (-1993.495) (-1987.243) [-1987.127] * (-1993.541) [-1985.845] (-1998.540) (-1993.893) -- 0:03:41
      304400 -- (-1991.212) [-1985.485] (-1986.991) (-1986.720) * (-1990.304) [-1984.946] (-1999.829) (-1994.560) -- 0:03:41
      304500 -- (-1992.612) (-1984.814) (-1991.539) [-1983.041] * (-1991.243) [-1986.394] (-1996.348) (-1986.615) -- 0:03:43
      304600 -- (-1995.569) [-1982.907] (-1992.290) (-1979.848) * (-1992.184) [-1986.270] (-2006.373) (-1986.202) -- 0:03:43
      304700 -- (-2001.331) (-1983.553) (-1989.756) [-1980.379] * (-1999.811) (-1992.406) (-2004.043) [-1986.259] -- 0:03:43
      304800 -- (-2000.542) (-1986.153) (-2002.357) [-1982.686] * (-1995.643) [-1991.029] (-2007.002) (-1990.189) -- 0:03:43
      304900 -- (-1995.217) (-1992.295) (-1996.767) [-1982.204] * (-1991.634) (-1994.534) [-1991.922] (-1989.209) -- 0:03:43
      305000 -- (-1997.045) (-1991.878) [-1997.972] (-1991.082) * (-1995.136) (-1993.945) (-1998.727) [-1984.926] -- 0:03:43

      Average standard deviation of split frequencies: 0.003663

      305100 -- [-1995.441] (-1997.380) (-1994.710) (-1988.118) * (-1989.951) (-1992.967) (-1994.447) [-1991.116] -- 0:03:43
      305200 -- (-1996.782) (-1998.319) (-1990.715) [-1981.646] * (-1990.787) (-1990.780) (-1995.394) [-1989.314] -- 0:03:43
      305300 -- (-2000.564) (-1995.634) (-1998.817) [-1982.507] * (-1993.757) [-1986.574] (-2002.941) (-1988.397) -- 0:03:42
      305400 -- (-1992.690) (-1987.859) (-1992.280) [-1985.230] * (-2003.344) [-1993.490] (-1999.562) (-1991.330) -- 0:03:42
      305500 -- (-1993.452) (-1996.408) (-1996.018) [-1981.593] * (-1997.034) (-1994.169) (-2011.212) [-1989.715] -- 0:03:42
      305600 -- (-2005.961) (-1995.903) (-1991.751) [-1978.737] * (-2002.536) [-1990.274] (-1997.026) (-1993.945) -- 0:03:42
      305700 -- (-1998.746) (-1994.198) (-1995.197) [-1979.552] * (-2001.017) [-1986.610] (-1994.361) (-2001.834) -- 0:03:42
      305800 -- (-1991.722) (-1993.365) (-1989.108) [-1979.522] * (-1996.828) [-1985.584] (-1997.806) (-1999.832) -- 0:03:42
      305900 -- (-1991.037) [-1988.377] (-1992.098) (-1988.404) * (-2000.535) [-1985.480] (-1994.017) (-1993.641) -- 0:03:42
      306000 -- (-1993.814) (-1989.155) (-1989.781) [-1994.987] * (-2003.847) [-1983.992] (-2003.535) (-1994.392) -- 0:03:42

      Average standard deviation of split frequencies: 0.003784

      306100 -- (-1992.813) (-1987.899) (-1988.293) [-1987.028] * (-1999.359) [-1987.952] (-1995.912) (-1999.325) -- 0:03:42
      306200 -- (-2000.680) (-1985.098) [-1989.527] (-1989.056) * (-1996.268) (-1984.704) [-1991.120] (-1993.416) -- 0:03:42
      306300 -- (-1990.178) [-1986.821] (-1984.644) (-1986.524) * (-1991.742) [-1984.033] (-1991.051) (-2004.142) -- 0:03:41
      306400 -- (-1993.134) (-1996.649) (-1986.443) [-1985.785] * (-1993.216) [-1986.703] (-2000.983) (-1994.845) -- 0:03:41
      306500 -- (-1989.182) (-1998.512) (-1990.580) [-1987.398] * (-1996.168) [-1987.976] (-2003.352) (-1998.292) -- 0:03:41
      306600 -- (-1990.694) (-1989.807) (-2006.646) [-1986.698] * (-2005.624) [-1991.799] (-1993.777) (-1999.609) -- 0:03:41
      306700 -- (-1994.305) [-1991.483] (-2001.185) (-1991.877) * (-1989.447) [-1986.512] (-2001.392) (-2008.390) -- 0:03:41
      306800 -- (-1998.141) [-1993.064] (-1998.753) (-1989.232) * (-1995.464) [-1984.638] (-1994.423) (-1997.963) -- 0:03:41
      306900 -- [-1989.741] (-1989.039) (-2005.994) (-1986.741) * (-1998.030) [-1982.556] (-1993.558) (-1999.286) -- 0:03:41
      307000 -- [-1988.680] (-1992.697) (-2007.163) (-1989.950) * (-2000.753) [-1987.023] (-1984.103) (-1998.174) -- 0:03:41

      Average standard deviation of split frequencies: 0.003858

      307100 -- (-1987.523) (-1995.216) (-2012.631) [-1986.045] * (-2000.859) (-1987.522) (-1982.959) [-1994.436] -- 0:03:41
      307200 -- (-1985.290) (-1998.949) (-2013.042) [-1989.053] * (-1996.718) (-1994.443) [-1987.482] (-2001.971) -- 0:03:41
      307300 -- [-1992.877] (-2003.420) (-1997.549) (-1991.894) * (-1996.177) (-1992.932) (-1991.222) [-1997.311] -- 0:03:40
      307400 -- (-2002.855) (-1999.893) (-1995.923) [-1984.168] * [-1994.621] (-1996.722) (-1988.294) (-1992.373) -- 0:03:40
      307500 -- (-1995.894) (-2004.252) (-1992.087) [-1988.788] * (-2000.358) (-1992.525) (-1994.047) [-1990.376] -- 0:03:40
      307600 -- (-2002.001) (-1999.047) [-1986.040] (-1997.000) * (-2003.172) [-1987.456] (-1987.207) (-1992.192) -- 0:03:42
      307700 -- (-2001.441) (-1997.707) [-1990.292] (-1995.490) * (-2004.411) (-1984.808) [-1985.923] (-1998.593) -- 0:03:42
      307800 -- (-1996.199) (-1996.574) (-1993.091) [-1991.584] * (-2000.862) (-1988.085) (-1989.543) [-1990.811] -- 0:03:42
      307900 -- (-1991.677) (-1991.512) (-1995.302) [-1998.146] * (-2004.432) (-1994.550) (-1993.308) [-1986.513] -- 0:03:42
      308000 -- (-1988.323) [-1989.378] (-1991.011) (-2004.160) * (-1995.956) [-1989.642] (-2005.335) (-1993.203) -- 0:03:42

      Average standard deviation of split frequencies: 0.004196

      308100 -- (-1994.467) [-1988.562] (-1994.918) (-2009.263) * (-1989.251) (-1988.677) (-2006.161) [-1989.656] -- 0:03:42
      308200 -- (-1999.177) [-1985.021] (-1995.840) (-2001.307) * (-1994.330) (-1993.357) [-2004.002] (-1992.864) -- 0:03:42
      308300 -- (-1999.847) [-1985.476] (-1995.175) (-1994.524) * [-1987.685] (-1991.800) (-1992.520) (-1997.302) -- 0:03:42
      308400 -- [-1996.199] (-1984.636) (-1999.395) (-2001.602) * (-1990.285) (-1997.844) [-1992.748] (-1994.691) -- 0:03:42
      308500 -- (-1994.541) [-1990.005] (-1994.893) (-1995.947) * (-1992.613) (-1993.412) [-1985.782] (-1986.224) -- 0:03:41
      308600 -- (-1994.971) (-1991.652) [-1989.567] (-1991.901) * (-1986.694) (-1995.981) [-1988.947] (-1989.163) -- 0:03:41
      308700 -- [-1992.307] (-1993.344) (-1987.349) (-1994.502) * (-1989.185) (-2002.459) (-1990.214) [-1989.114] -- 0:03:41
      308800 -- (-1995.294) (-1992.356) [-1988.100] (-1998.598) * [-1987.607] (-2007.681) (-1990.162) (-1992.007) -- 0:03:41
      308900 -- (-1992.553) (-1992.804) [-1991.033] (-2005.556) * [-1989.466] (-2002.677) (-1987.835) (-1986.771) -- 0:03:41
      309000 -- (-1995.189) (-1994.404) [-1985.536] (-1997.380) * (-1988.262) (-2002.959) [-1988.953] (-1985.515) -- 0:03:41

      Average standard deviation of split frequencies: 0.004138

      309100 -- (-1990.567) (-1994.148) [-1986.723] (-2002.484) * (-1992.715) (-2005.360) [-1987.952] (-1985.646) -- 0:03:41
      309200 -- [-1994.891] (-1991.654) (-1990.344) (-1995.760) * (-1995.644) (-1992.278) [-1985.823] (-1986.823) -- 0:03:41
      309300 -- (-1990.281) (-1986.987) [-1987.294] (-1988.507) * (-1998.773) (-1994.611) (-1984.951) [-1988.389] -- 0:03:41
      309400 -- (-1987.498) (-1985.348) (-1991.156) [-1988.196] * (-2000.732) (-1997.814) (-1991.927) [-1984.418] -- 0:03:40
      309500 -- (-1999.726) (-1991.929) (-1991.148) [-1983.687] * (-1999.726) (-1998.150) (-1987.200) [-1985.389] -- 0:03:40
      309600 -- (-2002.940) (-1989.169) [-1985.025] (-1985.071) * (-1995.407) (-2003.295) [-1985.407] (-1992.657) -- 0:03:40
      309700 -- (-2003.560) [-1989.371] (-1991.271) (-1988.085) * (-1994.625) (-2008.993) [-1982.340] (-1990.988) -- 0:03:40
      309800 -- (-1995.690) (-1989.348) (-1995.188) [-1987.786] * (-1998.887) (-2008.427) [-1985.501] (-1990.792) -- 0:03:40
      309900 -- (-1999.566) [-1987.242] (-2003.922) (-1988.879) * (-2006.129) [-1989.933] (-1986.605) (-1996.523) -- 0:03:40
      310000 -- (-1996.302) (-1988.090) (-2000.317) [-1990.210] * (-1998.218) (-1992.411) [-1984.537] (-1997.616) -- 0:03:40

      Average standard deviation of split frequencies: 0.004213

      310100 -- (-1996.007) (-1993.830) (-1992.343) [-1989.566] * (-1998.717) (-1995.964) [-1981.580] (-1999.183) -- 0:03:40
      310200 -- (-1993.960) (-1991.285) [-1987.295] (-1988.243) * (-2000.947) (-1997.204) [-1981.395] (-1999.985) -- 0:03:40
      310300 -- (-2000.941) (-1995.459) (-1989.723) [-1993.551] * (-1988.967) (-2000.946) [-1986.146] (-1998.900) -- 0:03:40
      310400 -- (-1995.498) [-1989.840] (-1995.634) (-1989.677) * (-1991.350) (-1998.439) [-1987.642] (-1995.320) -- 0:03:39
      310500 -- (-2002.951) (-1993.117) [-1987.362] (-1992.402) * (-1992.992) (-1992.619) [-1983.990] (-1999.845) -- 0:03:39
      310600 -- (-1999.399) [-1987.462] (-1995.466) (-1987.860) * (-2005.352) (-2002.533) [-1989.191] (-2006.785) -- 0:03:39
      310700 -- (-2000.667) [-1983.611] (-1996.704) (-1988.029) * (-1996.140) (-1999.402) [-1986.340] (-2005.467) -- 0:03:41
      310800 -- (-2008.864) [-1988.834] (-1997.963) (-1983.603) * (-1992.026) (-1995.137) [-1982.562] (-1998.161) -- 0:03:41
      310900 -- (-2002.699) (-1988.622) (-1986.859) [-1983.154] * [-1992.090] (-2005.510) (-1990.489) (-1994.982) -- 0:03:41
      311000 -- (-2009.376) [-1989.738] (-1988.503) (-1979.684) * (-1994.964) (-2008.950) [-1987.792] (-2005.446) -- 0:03:41

      Average standard deviation of split frequencies: 0.004198

      311100 -- (-2011.096) (-1990.206) (-1988.950) [-1980.729] * [-1995.139] (-2001.717) (-1989.016) (-2020.289) -- 0:03:41
      311200 -- (-2002.982) (-1996.715) [-1991.085] (-1989.517) * (-2001.026) (-1993.945) [-1991.775] (-2002.204) -- 0:03:41
      311300 -- (-1997.140) (-2004.507) (-1996.117) [-1987.753] * (-1997.278) (-1986.940) [-1990.368] (-1996.366) -- 0:03:41
      311400 -- (-1993.513) (-1999.831) (-1993.366) [-1977.890] * (-1997.264) (-1988.161) [-1986.218] (-2007.843) -- 0:03:41
      311500 -- (-2000.430) (-1998.964) (-1995.327) [-1982.374] * (-1991.725) (-1995.514) [-1990.778] (-2005.027) -- 0:03:41
      311600 -- (-1991.014) (-1999.043) (-1993.739) [-1979.651] * [-1998.627] (-1996.076) (-1994.672) (-1998.753) -- 0:03:40
      311700 -- (-2002.821) (-1993.518) (-1999.115) [-1981.518] * (-1993.318) (-1995.468) [-1985.439] (-1992.017) -- 0:03:40
      311800 -- (-2002.172) (-1992.852) (-1990.024) [-1978.724] * (-1991.364) (-1999.883) (-1987.299) [-1988.429] -- 0:03:40
      311900 -- (-1991.570) (-1994.066) (-1992.986) [-1977.048] * (-1995.086) [-1993.671] (-1988.151) (-1990.063) -- 0:03:40
      312000 -- (-1991.899) (-1999.229) (-1987.528) [-1983.859] * (-1997.028) (-1988.735) [-1987.735] (-1991.095) -- 0:03:40

      Average standard deviation of split frequencies: 0.004531

      312100 -- [-1994.210] (-1999.189) (-1986.720) (-1985.224) * (-2002.040) (-1987.704) (-1988.570) [-1993.052] -- 0:03:40
      312200 -- (-2001.470) (-1994.284) (-1989.758) [-1991.110] * (-2007.603) [-1986.508] (-2004.720) (-1992.072) -- 0:03:40
      312300 -- (-1997.722) (-1993.789) (-1987.979) [-1986.419] * (-1997.089) [-1983.181] (-2000.749) (-1996.596) -- 0:03:40
      312400 -- (-1996.564) (-1992.409) (-1985.371) [-1986.426] * (-1996.801) [-1984.147] (-1995.133) (-1996.037) -- 0:03:40
      312500 -- (-1999.597) (-1993.298) (-1996.981) [-1986.460] * (-1998.824) [-1986.366] (-2003.352) (-2004.569) -- 0:03:40
      312600 -- (-1994.103) (-1988.327) (-1998.716) [-1986.839] * [-1991.989] (-1987.006) (-2006.092) (-2002.691) -- 0:03:39
      312700 -- (-1997.582) [-1994.142] (-1994.752) (-1987.943) * (-1990.169) [-1986.358] (-1993.631) (-2012.851) -- 0:03:39
      312800 -- (-1992.621) [-1988.337] (-1996.254) (-1988.199) * [-1992.338] (-1987.363) (-1990.985) (-1996.405) -- 0:03:39
      312900 -- (-1991.021) [-1990.641] (-1997.244) (-1989.471) * [-1986.220] (-1994.853) (-1985.183) (-1998.259) -- 0:03:39
      313000 -- [-1987.243] (-1989.369) (-2016.793) (-1992.108) * (-1989.873) (-1991.214) [-1987.495] (-1996.401) -- 0:03:39

      Average standard deviation of split frequencies: 0.004601

      313100 -- (-1993.291) [-1988.161] (-2009.293) (-1982.328) * (-1993.179) (-1994.276) [-1983.536] (-1993.176) -- 0:03:39
      313200 -- (-1994.976) (-1992.087) (-2009.163) [-1980.474] * (-1985.033) (-1998.272) [-1988.077] (-1988.972) -- 0:03:39
      313300 -- (-1996.836) (-1989.647) (-1998.409) [-1986.852] * [-1988.076] (-1996.644) (-1991.141) (-2000.467) -- 0:03:39
      313400 -- [-1988.968] (-1990.268) (-1993.082) (-1984.317) * (-1986.411) (-1992.897) [-1986.408] (-2009.280) -- 0:03:39
      313500 -- (-1986.082) [-1987.470] (-1996.464) (-1987.256) * (-1991.368) (-1985.235) [-1983.636] (-1987.809) -- 0:03:38
      313600 -- (-1986.418) (-1992.154) (-1993.211) [-1985.765] * (-1989.706) [-1991.033] (-1987.664) (-1987.468) -- 0:03:38
      313700 -- (-1996.129) (-2006.809) (-1997.468) [-1980.788] * (-1989.401) [-1989.624] (-1986.428) (-1988.796) -- 0:03:38
      313800 -- (-2002.086) (-1992.869) (-1998.795) [-1981.707] * (-1991.249) [-1989.177] (-1983.371) (-1997.713) -- 0:03:40
      313900 -- (-1999.259) (-1993.242) [-1992.445] (-1986.399) * (-1988.688) [-1991.039] (-1986.903) (-1993.983) -- 0:03:40
      314000 -- (-1990.576) (-1988.647) (-2005.306) [-1984.154] * (-1991.521) (-1996.224) [-1987.634] (-1995.379) -- 0:03:40

      Average standard deviation of split frequencies: 0.004545

      314100 -- [-1990.941] (-1984.759) (-1996.255) (-1988.201) * (-1991.920) (-2003.036) [-1984.485] (-1989.561) -- 0:03:40
      314200 -- (-1992.406) [-1983.514] (-1996.593) (-1990.420) * (-1988.364) (-2004.765) (-1991.642) [-1986.764] -- 0:03:40
      314300 -- (-1986.785) [-1982.972] (-1991.097) (-1992.909) * (-1994.674) (-2001.371) (-1988.698) [-1992.248] -- 0:03:40
      314400 -- [-1989.632] (-1982.641) (-1995.138) (-1998.330) * (-1989.543) (-2002.085) (-1988.468) [-1994.777] -- 0:03:40
      314500 -- (-1988.939) (-1982.201) (-1997.972) [-1991.461] * (-1997.098) (-2010.259) (-1986.285) [-1986.457] -- 0:03:40
      314600 -- (-1991.800) (-1983.020) [-1987.620] (-1994.527) * (-1994.386) (-2007.340) [-1984.979] (-1982.646) -- 0:03:40
      314700 -- (-1991.049) [-1985.639] (-1985.726) (-1993.929) * (-1992.957) (-2003.911) [-1982.455] (-1986.087) -- 0:03:39
      314800 -- (-1985.412) (-1985.092) (-1985.330) [-1986.894] * (-1994.908) (-2006.998) [-1985.564] (-1991.118) -- 0:03:39
      314900 -- (-1988.708) (-1985.051) [-1983.025] (-1993.258) * (-1993.207) (-2001.118) [-1981.619] (-1982.684) -- 0:03:39
      315000 -- (-1985.666) [-1985.016] (-1986.438) (-1990.769) * (-1993.531) (-2000.949) (-1979.533) [-1986.517] -- 0:03:39

      Average standard deviation of split frequencies: 0.004786

      315100 -- (-1991.691) (-1990.533) [-1988.087] (-1987.664) * (-1995.377) (-2002.854) [-1980.587] (-1990.224) -- 0:03:39
      315200 -- (-1993.983) (-1986.132) [-1987.295] (-1987.306) * (-1990.330) (-2005.391) [-1979.353] (-1991.981) -- 0:03:39
      315300 -- (-1990.873) [-1981.507] (-1991.338) (-1984.841) * [-1993.400] (-2001.373) (-1986.342) (-1990.130) -- 0:03:39
      315400 -- (-1989.616) [-1984.521] (-1990.307) (-1985.826) * (-1987.708) (-2011.848) [-1981.425] (-1995.812) -- 0:03:39
      315500 -- (-1996.540) (-1990.025) (-1996.085) [-1984.796] * (-1990.737) (-2003.936) [-1982.799] (-1988.611) -- 0:03:39
      315600 -- [-1995.390] (-1986.204) (-1989.665) (-1992.826) * (-1993.871) (-1994.191) [-1982.535] (-1992.383) -- 0:03:39
      315700 -- (-2000.669) (-1984.707) (-1990.698) [-1991.607] * (-1994.023) (-1996.396) [-1982.605] (-1992.280) -- 0:03:38
      315800 -- (-1994.211) [-1981.550] (-1996.387) (-1987.821) * (-2001.521) [-1989.672] (-1987.730) (-1986.158) -- 0:03:38
      315900 -- (-1994.948) (-1981.972) (-2001.781) [-1983.561] * (-1999.933) (-1995.290) (-1983.732) [-1985.939] -- 0:03:38
      316000 -- (-1992.488) [-1991.563] (-1995.335) (-1985.620) * (-1994.687) (-1996.923) [-1980.066] (-1990.715) -- 0:03:38

      Average standard deviation of split frequencies: 0.004559

      316100 -- (-1987.828) (-1991.793) (-1994.531) [-1988.833] * (-1997.415) (-1996.737) (-1982.713) [-1989.269] -- 0:03:38
      316200 -- (-1986.869) (-1990.774) (-1991.174) [-1990.403] * (-1994.594) (-1990.997) [-1980.580] (-1992.973) -- 0:03:38
      316300 -- (-1982.917) [-1990.529] (-1999.336) (-1983.377) * (-1996.240) (-1994.344) (-1980.529) [-1996.121] -- 0:03:38
      316400 -- (-1986.079) (-1993.853) (-2000.335) [-1979.166] * (-1990.889) (-2003.289) [-1977.560] (-1998.842) -- 0:03:38
      316500 -- [-1986.891] (-1996.383) (-1997.468) (-1981.597) * (-1993.078) (-1997.108) [-1978.125] (-1994.075) -- 0:03:38
      316600 -- [-1985.403] (-1999.260) (-1989.856) (-1982.825) * (-2001.652) (-1990.447) [-1981.547] (-1993.457) -- 0:03:38
      316700 -- (-1986.687) [-1985.524] (-1988.389) (-1983.322) * (-2000.170) (-1988.230) [-1980.125] (-1984.507) -- 0:03:37
      316800 -- (-1989.739) (-1992.758) (-1984.205) [-1981.694] * (-2009.262) (-1994.421) [-1982.866] (-1983.309) -- 0:03:37
      316900 -- (-1990.476) (-1994.980) (-1986.986) [-1980.985] * (-2012.095) (-1988.083) [-1981.625] (-1981.584) -- 0:03:39
      317000 -- (-1995.944) (-1999.157) (-1985.722) [-1980.584] * (-2006.164) (-1993.670) [-1981.018] (-1998.840) -- 0:03:39

      Average standard deviation of split frequencies: 0.004246

      317100 -- (-1999.044) (-1994.256) (-1988.097) [-1982.441] * (-2015.935) [-1994.179] (-1996.527) (-1995.135) -- 0:03:39
      317200 -- (-2000.106) (-1998.849) [-1988.903] (-1986.795) * (-2007.621) [-1985.066] (-1989.149) (-1991.867) -- 0:03:39
      317300 -- (-2011.361) (-1993.332) (-1985.397) [-1986.510] * (-2011.246) (-1989.652) [-1990.293] (-1991.795) -- 0:03:39
      317400 -- (-2011.232) (-1996.440) (-1983.978) [-1985.607] * (-1997.282) (-1987.017) [-1983.911] (-1983.345) -- 0:03:39
      317500 -- (-2003.422) [-1990.910] (-1985.488) (-1990.773) * (-1996.254) (-1992.229) (-1986.063) [-1977.731] -- 0:03:39
      317600 -- [-1988.913] (-1987.058) (-1986.961) (-1982.616) * (-1999.928) (-1991.869) (-1988.065) [-1981.246] -- 0:03:39
      317700 -- (-1988.940) (-1998.626) (-1988.382) [-1980.893] * (-1998.604) (-1995.721) (-1985.038) [-1988.113] -- 0:03:39
      317800 -- (-1988.834) (-2009.210) (-1990.339) [-1981.309] * [-1998.894] (-1996.528) (-1985.329) (-1989.428) -- 0:03:38
      317900 -- (-1989.747) (-2005.742) [-1987.101] (-1982.131) * (-1989.612) (-1995.588) [-1983.725] (-1984.378) -- 0:03:38
      318000 -- (-1992.876) (-2014.379) (-1989.651) [-1985.356] * (-1999.137) (-2003.775) [-1985.895] (-1982.758) -- 0:03:38

      Average standard deviation of split frequencies: 0.004191

      318100 -- (-2001.269) (-2019.478) (-1985.175) [-1986.202] * (-1990.928) (-1999.226) (-1988.136) [-1979.651] -- 0:03:38
      318200 -- (-2005.975) (-2003.689) [-1986.359] (-1989.854) * (-1993.988) (-1997.945) [-1986.812] (-1983.719) -- 0:03:38
      318300 -- (-2003.905) (-2010.375) (-1987.831) [-1990.869] * (-2001.461) (-1998.803) [-1981.105] (-1989.590) -- 0:03:38
      318400 -- (-2002.121) (-2011.480) (-1988.184) [-1994.771] * (-2007.808) (-1997.213) (-1978.598) [-1988.595] -- 0:03:38
      318500 -- (-1996.080) (-2010.365) [-1985.459] (-1988.763) * (-1997.666) (-1990.760) [-1979.197] (-2000.212) -- 0:03:38
      318600 -- (-1997.881) (-1991.914) [-1985.131] (-1985.086) * (-1994.421) (-1991.073) [-1980.163] (-1989.951) -- 0:03:38
      318700 -- (-1996.831) [-1991.439] (-1991.477) (-1991.746) * (-1997.784) (-2000.948) [-1978.023] (-1991.078) -- 0:03:38
      318800 -- (-1994.515) [-1986.121] (-1998.195) (-1992.912) * (-1998.724) (-1998.102) [-1978.300] (-1988.981) -- 0:03:37
      318900 -- (-2000.977) (-1989.661) [-1993.937] (-1989.996) * (-1995.442) (-2001.365) [-1978.960] (-1995.995) -- 0:03:37
      319000 -- (-1994.022) (-1990.143) (-2002.041) [-1987.677] * (-1991.265) (-1988.662) [-1980.542] (-1994.636) -- 0:03:37

      Average standard deviation of split frequencies: 0.004388

      319100 -- [-1989.355] (-1988.955) (-1997.971) (-1989.604) * (-1990.510) (-1995.868) [-1981.377] (-1994.369) -- 0:03:37
      319200 -- (-1993.134) [-1984.509] (-1989.363) (-1990.364) * (-1993.123) (-1987.965) [-1980.040] (-1988.943) -- 0:03:37
      319300 -- (-1985.660) [-1988.227] (-1995.814) (-1987.699) * [-1989.524] (-1987.789) (-1978.605) (-1995.106) -- 0:03:37
      319400 -- (-1987.497) (-1991.778) (-1999.279) [-1981.170] * (-1995.682) (-1990.287) [-1984.959] (-1999.851) -- 0:03:37
      319500 -- (-1991.696) (-1992.816) (-2000.564) [-1984.839] * (-1987.081) (-1994.222) [-1983.241] (-1996.822) -- 0:03:37
      319600 -- (-1993.709) [-1985.673] (-1999.997) (-1987.696) * (-1988.223) (-1988.977) [-1982.883] (-1998.492) -- 0:03:37
      319700 -- (-1997.645) (-1987.527) (-1996.573) [-1984.029] * [-1987.067] (-1995.633) (-1986.587) (-1991.731) -- 0:03:37
      319800 -- (-1998.648) (-1994.578) (-1991.136) [-1979.417] * (-1984.090) (-1996.155) [-1983.664] (-1998.488) -- 0:03:36
      319900 -- (-1997.042) (-2002.578) (-1991.611) [-1979.910] * [-1982.545] (-1992.099) (-1988.102) (-2006.644) -- 0:03:36
      320000 -- (-1995.543) (-1995.575) (-1993.233) [-1981.510] * (-1987.134) (-1994.811) [-1981.686] (-2000.240) -- 0:03:38

      Average standard deviation of split frequencies: 0.004081

      320100 -- (-1990.491) [-1993.695] (-1998.430) (-1986.007) * (-1986.230) (-1989.807) [-1979.078] (-1999.873) -- 0:03:38
      320200 -- (-1992.794) (-1995.025) (-1992.192) [-1988.299] * (-1987.975) (-1996.236) [-1980.408] (-2000.687) -- 0:03:38
      320300 -- (-1989.475) (-1985.804) [-1990.702] (-1996.579) * (-1986.705) [-1987.873] (-1979.788) (-2004.087) -- 0:03:38
      320400 -- (-1987.452) (-1991.780) (-1992.343) [-1988.450] * (-1987.865) (-1993.001) (-1985.895) [-1993.585] -- 0:03:38
      320500 -- [-1988.633] (-1994.146) (-2003.607) (-1997.586) * [-1983.794] (-1997.546) (-1983.831) (-2007.034) -- 0:03:38
      320600 -- (-1992.611) (-1991.804) (-1994.441) [-1996.199] * (-1982.948) [-1990.061] (-1990.533) (-2000.261) -- 0:03:38
      320700 -- (-1987.715) (-1993.852) [-1992.919] (-1999.043) * [-1981.850] (-1990.354) (-1983.803) (-1994.967) -- 0:03:38
      320800 -- [-1985.114] (-1994.594) (-1991.448) (-1997.822) * (-1983.498) (-1993.582) (-1986.326) [-1984.789] -- 0:03:38
      320900 -- [-1987.401] (-2003.268) (-1997.462) (-1992.135) * (-1992.366) (-1992.558) (-1989.649) [-1985.819] -- 0:03:37
      321000 -- [-1986.345] (-2006.624) (-1997.481) (-1987.898) * (-1993.813) (-1997.627) (-1986.821) [-1983.939] -- 0:03:37

      Average standard deviation of split frequencies: 0.004487

      321100 -- (-1995.872) (-1997.584) (-2001.732) [-1980.485] * (-1991.878) (-1993.093) (-1985.662) [-1980.423] -- 0:03:37
      321200 -- (-1994.505) (-1996.943) (-1995.978) [-1985.792] * (-1991.291) (-1997.484) (-1992.956) [-1981.881] -- 0:03:37
      321300 -- (-1989.495) [-1992.141] (-2011.461) (-1985.158) * (-1987.533) (-1993.255) (-1993.781) [-1981.970] -- 0:03:37
      321400 -- (-1999.826) (-1989.073) (-2011.578) [-1983.573] * (-1988.584) (-1988.826) [-1988.200] (-1986.917) -- 0:03:37
      321500 -- (-1997.117) (-1990.099) (-2001.163) [-1980.752] * (-1991.077) (-1995.878) [-1985.136] (-1988.215) -- 0:03:37
      321600 -- (-1992.878) (-1993.723) (-1994.647) [-1980.560] * (-1982.853) (-1992.482) (-1989.497) [-1987.984] -- 0:03:37
      321700 -- [-1992.125] (-1990.554) (-1999.510) (-1983.372) * [-1982.358] (-1992.499) (-1997.359) (-1985.678) -- 0:03:37
      321800 -- (-1988.096) (-1986.470) (-1991.208) [-1982.893] * (-1980.390) (-1998.241) [-1990.258] (-1990.535) -- 0:03:37
      321900 -- (-1990.330) (-1984.144) (-1992.180) [-1981.138] * (-1988.113) (-1998.205) (-1986.007) [-1983.281] -- 0:03:36
      322000 -- (-1990.826) (-1978.341) (-1995.235) [-1989.730] * [-1987.124] (-2000.929) (-1985.212) (-1988.559) -- 0:03:36

      Average standard deviation of split frequencies: 0.004934

      322100 -- (-1997.990) (-1983.646) (-1989.693) [-1984.472] * [-1990.854] (-1998.326) (-1990.111) (-1992.592) -- 0:03:36
      322200 -- (-1994.713) [-1984.637] (-1990.060) (-1996.608) * (-1994.222) (-1995.916) [-1985.707] (-1992.724) -- 0:03:36
      322300 -- (-1996.630) [-1981.406] (-1992.231) (-1990.070) * (-1993.468) (-2002.421) [-1983.024] (-1998.304) -- 0:03:36
      322400 -- (-1989.951) [-1983.834] (-1996.969) (-1981.720) * (-1995.367) (-1998.244) [-1982.297] (-1998.181) -- 0:03:36
      322500 -- (-1988.850) (-1988.458) (-1998.020) [-1981.142] * (-2002.833) (-1989.817) (-1987.942) [-1980.875] -- 0:03:36
      322600 -- (-1995.139) (-1988.041) (-2004.296) [-1981.444] * (-1997.304) (-1992.505) [-1980.997] (-1982.116) -- 0:03:36
      322700 -- (-1994.847) (-1991.479) (-2001.382) [-1977.477] * (-1988.246) (-1993.340) [-1981.612] (-1985.740) -- 0:03:36
      322800 -- [-1993.031] (-1984.259) (-1998.700) (-1979.089) * [-1983.594] (-2001.411) (-1987.784) (-1986.875) -- 0:03:36
      322900 -- (-1994.080) (-1980.880) (-2001.154) [-1979.982] * (-1987.319) (-1992.542) [-1983.250] (-1988.982) -- 0:03:35
      323000 -- (-1995.197) (-1980.114) (-2003.215) [-1981.126] * (-1992.202) (-1989.153) [-1984.888] (-1998.362) -- 0:03:35

      Average standard deviation of split frequencies: 0.004917

      323100 -- (-1991.539) (-1984.978) (-1997.190) [-1976.657] * (-1984.247) (-1995.788) [-1983.313] (-1988.139) -- 0:03:37
      323200 -- (-1996.020) (-1980.631) (-1992.723) [-1981.409] * [-1984.719] (-1987.243) (-1986.470) (-1989.238) -- 0:03:37
      323300 -- (-1995.115) (-1980.663) (-1994.809) [-1980.959] * [-1986.895] (-1988.097) (-1988.470) (-1987.322) -- 0:03:37
      323400 -- (-1998.198) (-1983.145) (-2004.020) [-1982.843] * (-1986.257) [-1989.869] (-1986.466) (-1982.655) -- 0:03:37
      323500 -- (-1993.619) (-1988.424) (-2000.992) [-1985.577] * (-1984.362) (-1987.892) [-1986.403] (-1981.556) -- 0:03:37
      323600 -- [-1991.189] (-1983.068) (-1998.373) (-1980.675) * (-1993.939) (-1991.717) [-1991.302] (-1985.166) -- 0:03:37
      323700 -- (-1993.642) [-1982.424] (-1997.865) (-1989.609) * (-1991.744) [-1988.693] (-1987.927) (-1986.664) -- 0:03:37
      323800 -- (-1992.914) [-1984.418] (-1997.602) (-1991.015) * (-1997.730) (-1990.100) [-1983.712] (-1985.196) -- 0:03:37
      323900 -- (-1989.468) [-1982.213] (-1988.965) (-2001.269) * (-1995.323) (-2002.218) (-1993.406) [-1984.326] -- 0:03:37
      324000 -- (-1998.009) [-1991.138] (-2000.892) (-1996.086) * (-1994.825) (-1993.133) [-1988.208] (-1984.517) -- 0:03:36

      Average standard deviation of split frequencies: 0.004820

      324100 -- (-1994.751) (-1987.467) (-1994.237) [-1982.167] * [-1983.465] (-1990.691) (-1991.932) (-1982.441) -- 0:03:36
      324200 -- (-1992.190) (-1988.028) [-1988.422] (-1986.438) * (-1980.413) [-1989.907] (-1992.664) (-1979.110) -- 0:03:36
      324300 -- (-1990.178) (-1991.244) (-1997.109) [-1987.317] * (-1980.383) (-1994.420) (-1992.580) [-1981.973] -- 0:03:36
      324400 -- (-1991.410) [-1982.614] (-1993.995) (-1990.501) * (-1980.748) (-1996.313) (-1989.006) [-1984.378] -- 0:03:36
      324500 -- (-1987.786) [-1983.966] (-1992.981) (-1995.614) * [-1984.436] (-1993.184) (-1992.039) (-1987.527) -- 0:03:36
      324600 -- (-1993.962) [-1979.505] (-1989.541) (-1990.917) * (-1983.309) (-2001.337) [-1991.713] (-1992.061) -- 0:03:36
      324700 -- (-1998.536) [-1980.343] (-1989.897) (-1994.260) * [-1982.478] (-1995.063) (-1986.857) (-1991.857) -- 0:03:36
      324800 -- (-1996.203) [-1982.701] (-1994.266) (-1995.727) * [-1983.386] (-1998.834) (-1990.829) (-1999.761) -- 0:03:36
      324900 -- [-1992.309] (-1986.930) (-1996.964) (-2000.686) * [-1983.129] (-1995.458) (-1996.007) (-1995.601) -- 0:03:36
      325000 -- [-1992.708] (-1988.248) (-1995.384) (-1998.526) * [-1977.390] (-1988.332) (-1990.604) (-2005.647) -- 0:03:36

      Average standard deviation of split frequencies: 0.004680

      325100 -- (-1995.890) [-1985.590] (-1988.782) (-1985.922) * (-1982.641) (-1993.889) [-1986.464] (-1995.221) -- 0:03:35
      325200 -- (-1992.847) (-1989.306) (-2000.141) [-1981.220] * [-1986.171] (-1989.585) (-1994.040) (-1986.411) -- 0:03:35
      325300 -- (-1996.298) (-1984.449) (-1991.814) [-1980.721] * (-1989.319) [-1981.734] (-1991.604) (-1988.870) -- 0:03:35
      325400 -- (-1993.282) [-1980.954] (-1992.669) (-1979.807) * (-1990.426) [-1984.998] (-1989.715) (-1988.912) -- 0:03:35
      325500 -- (-2000.196) [-1985.781] (-1993.939) (-1984.066) * (-1987.050) [-1987.468] (-1984.279) (-1987.018) -- 0:03:35
      325600 -- (-1999.657) (-1984.193) (-1991.261) [-1983.543] * (-1985.605) (-1992.466) [-1982.782] (-1986.866) -- 0:03:35
      325700 -- (-1997.449) (-1980.320) (-1985.149) [-1980.734] * [-1983.089] (-1992.815) (-1988.668) (-1989.246) -- 0:03:35
      325800 -- (-1999.821) [-1980.991] (-1991.033) (-1989.995) * [-1980.134] (-1988.282) (-1990.275) (-1990.440) -- 0:03:35
      325900 -- (-1998.095) [-1980.059] (-1987.611) (-1994.851) * (-1984.317) (-1989.207) (-2000.612) [-1986.680] -- 0:03:35
      326000 -- (-1991.708) [-1985.335] (-1990.280) (-1995.202) * [-1980.426] (-1998.175) (-1991.945) (-1995.397) -- 0:03:35

      Average standard deviation of split frequencies: 0.004749

      326100 -- (-1991.726) [-1983.038] (-1993.707) (-2006.289) * [-1978.556] (-1988.942) (-1992.832) (-2001.144) -- 0:03:34
      326200 -- (-1994.105) [-1985.907] (-1989.824) (-1993.949) * [-1978.907] (-1986.735) (-1992.903) (-1995.100) -- 0:03:36
      326300 -- (-1993.901) (-1987.760) (-1992.466) [-1987.067] * [-1980.566] (-1994.303) (-1994.186) (-2000.673) -- 0:03:36
      326400 -- (-1991.972) (-1986.460) [-1989.674] (-1988.024) * [-1981.108] (-1990.472) (-1995.273) (-1989.498) -- 0:03:36
      326500 -- (-1991.204) (-1988.165) (-1992.341) [-1985.456] * (-1979.176) (-1994.811) (-1991.364) [-1991.189] -- 0:03:36
      326600 -- (-1993.096) [-1984.434] (-1991.626) (-1992.834) * (-1985.803) (-1980.851) [-1988.800] (-1985.763) -- 0:03:36
      326700 -- (-1994.689) [-1982.896] (-1987.515) (-1989.106) * (-1985.846) [-1979.790] (-1991.601) (-1990.467) -- 0:03:36
      326800 -- (-1993.284) (-1991.231) [-1988.053] (-1993.328) * [-1978.091] (-1985.545) (-1988.424) (-1993.566) -- 0:03:36
      326900 -- (-1993.704) (-1991.304) (-1988.008) [-1983.798] * [-1982.164] (-1999.003) (-1995.975) (-2002.731) -- 0:03:36
      327000 -- (-1998.882) [-1990.213] (-1992.957) (-1987.268) * [-1979.399] (-2010.897) (-1987.469) (-1998.352) -- 0:03:36

      Average standard deviation of split frequencies: 0.004857

      327100 -- (-2000.579) [-1983.118] (-1991.805) (-1989.715) * (-1984.682) (-2004.659) [-1992.557] (-1992.387) -- 0:03:36
      327200 -- (-2005.287) [-1981.951] (-1989.495) (-1990.325) * (-1986.749) (-2007.156) [-1990.285] (-1995.257) -- 0:03:35
      327300 -- (-1997.906) (-1983.088) (-1988.179) [-1985.684] * [-1985.811] (-1988.177) (-1992.002) (-1993.207) -- 0:03:35
      327400 -- (-1997.976) [-1987.872] (-1989.899) (-1989.384) * (-1993.396) (-1985.285) [-1991.647] (-1992.813) -- 0:03:35
      327500 -- (-2012.533) [-1993.494] (-1992.285) (-1986.429) * (-1986.580) [-1985.223] (-1995.729) (-1988.018) -- 0:03:35
      327600 -- (-2012.362) (-1995.442) (-1994.820) [-1983.196] * (-1983.630) [-1983.299] (-1995.691) (-1990.783) -- 0:03:35
      327700 -- (-2002.632) (-1987.469) (-1995.231) [-1980.369] * (-1986.694) (-1991.030) (-1993.848) [-1987.389] -- 0:03:35
      327800 -- (-2004.776) (-1986.760) (-1988.470) [-1976.903] * [-1987.704] (-1984.273) (-1991.209) (-1990.516) -- 0:03:35
      327900 -- (-1998.525) (-1985.403) (-1992.739) [-1981.087] * (-1986.673) (-1988.098) (-1990.315) [-1994.127] -- 0:03:35
      328000 -- (-1996.867) (-1985.071) (-1987.159) [-1983.925] * [-1989.808] (-1988.130) (-1988.608) (-1993.270) -- 0:03:35

      Average standard deviation of split frequencies: 0.005131

      328100 -- (-1990.019) [-1987.145] (-1986.033) (-1984.770) * (-1985.665) [-1991.702] (-1987.843) (-1996.578) -- 0:03:35
      328200 -- (-1996.472) (-1987.935) (-1988.512) [-1989.138] * (-1989.309) [-1988.797] (-1994.510) (-1996.473) -- 0:03:34
      328300 -- [-1989.570] (-1988.834) (-1990.116) (-1990.414) * (-1987.117) (-1985.105) (-2007.405) [-1982.833] -- 0:03:34
      328400 -- (-1992.616) (-1984.323) [-1987.728] (-1993.553) * (-1989.019) (-1994.901) (-1989.696) [-1980.351] -- 0:03:34
      328500 -- (-1992.840) (-1983.655) [-1987.123] (-2000.346) * (-1987.017) (-1991.158) (-1992.536) [-1982.855] -- 0:03:34
      328600 -- [-1990.375] (-1983.226) (-1985.128) (-2006.657) * (-1989.116) (-1986.255) (-1989.995) [-1986.808] -- 0:03:34
      328700 -- (-1991.359) (-1985.139) [-1988.727] (-2012.082) * [-1982.116] (-1983.023) (-1995.902) (-1989.113) -- 0:03:34
      328800 -- (-1991.020) [-1983.641] (-1984.578) (-2004.849) * (-1983.017) [-1984.472] (-1998.730) (-1991.702) -- 0:03:34
      328900 -- (-1989.397) [-1987.282] (-1990.035) (-1993.024) * [-1981.953] (-1994.962) (-2006.155) (-1987.763) -- 0:03:34
      329000 -- (-2004.743) (-1990.160) [-1992.457] (-1990.725) * [-1985.056] (-1993.623) (-2003.948) (-1991.903) -- 0:03:34

      Average standard deviation of split frequencies: 0.005114

      329100 -- (-2008.063) [-1986.050] (-1993.017) (-1996.520) * [-1983.374] (-1989.465) (-1994.179) (-1985.510) -- 0:03:34
      329200 -- (-2004.160) [-1986.278] (-1987.707) (-1993.263) * (-1992.829) (-1994.333) (-1999.546) [-1981.683] -- 0:03:33
      329300 -- (-2007.778) (-1992.942) (-1996.674) [-1992.450] * (-1989.882) (-1989.293) (-2008.688) [-1983.688] -- 0:03:35
      329400 -- (-1996.847) (-1984.609) (-1998.965) [-1988.239] * (-1993.223) [-1992.956] (-2007.841) (-1983.902) -- 0:03:35
      329500 -- (-2006.678) (-1996.508) (-2009.015) [-1990.835] * (-1990.321) (-1990.483) (-1998.536) [-1988.815] -- 0:03:35
      329600 -- [-2005.362] (-1993.325) (-2006.586) (-1985.772) * (-1994.553) (-1991.907) (-1998.986) [-1985.603] -- 0:03:35
      329700 -- (-2001.979) (-1989.240) (-1995.386) [-1989.555] * (-1995.176) (-1990.922) (-1998.372) [-1983.739] -- 0:03:35
      329800 -- (-1996.842) [-1983.464] (-1996.916) (-1996.287) * (-1988.601) [-1986.358] (-1995.510) (-1987.470) -- 0:03:35
      329900 -- (-1993.002) (-1987.481) (-1991.362) [-1985.062] * (-1987.698) [-1981.758] (-1992.951) (-1987.418) -- 0:03:35
      330000 -- (-1993.130) [-1985.741] (-1995.636) (-1985.160) * (-1996.274) [-1978.270] (-1992.758) (-1986.937) -- 0:03:35

      Average standard deviation of split frequencies: 0.004977

      330100 -- (-1994.801) (-1986.588) (-1993.964) [-1985.167] * (-1994.151) (-1978.900) (-2000.645) [-1992.567] -- 0:03:35
      330200 -- (-2004.924) (-1985.698) (-1998.923) [-1983.385] * (-1993.701) [-1977.037] (-1990.035) (-1995.987) -- 0:03:35
      330300 -- (-2003.831) (-1990.355) (-2008.153) [-1979.413] * (-1990.074) [-1980.853] (-1996.755) (-1991.386) -- 0:03:34
      330400 -- (-2010.536) (-1989.238) (-2006.271) [-1977.114] * (-1989.295) [-1986.309] (-1990.366) (-1992.002) -- 0:03:34
      330500 -- (-2010.869) (-1986.509) (-2003.218) [-1978.247] * (-1989.829) [-1980.868] (-1994.053) (-1990.846) -- 0:03:34
      330600 -- (-2000.177) (-1986.688) (-2002.917) [-1983.423] * (-1986.879) (-1978.975) (-1991.652) [-1982.813] -- 0:03:34
      330700 -- (-1995.023) (-1984.720) (-2003.209) [-1984.922] * (-1984.163) [-1979.353] (-1988.231) (-1986.666) -- 0:03:34
      330800 -- [-1993.902] (-1990.766) (-2000.546) (-1988.533) * (-1987.393) [-1976.748] (-1988.350) (-1989.467) -- 0:03:34
      330900 -- (-1992.619) [-1992.365] (-1995.296) (-1988.463) * (-1979.916) [-1977.562] (-1988.611) (-1986.344) -- 0:03:34
      331000 -- (-1990.662) [-1989.142] (-1994.264) (-1990.878) * [-1980.393] (-1982.236) (-1989.312) (-1986.639) -- 0:03:34

      Average standard deviation of split frequencies: 0.004880

      331100 -- (-1996.874) [-1986.349] (-1996.445) (-1991.181) * (-1985.326) [-1977.676] (-1989.550) (-1984.773) -- 0:03:34
      331200 -- (-1999.694) (-1986.438) (-2005.064) [-1987.319] * (-1982.894) [-1979.007] (-1992.991) (-1988.224) -- 0:03:34
      331300 -- (-1996.301) (-1992.742) (-1997.561) [-1986.887] * [-1986.580] (-1978.092) (-1988.829) (-1993.070) -- 0:03:33
      331400 -- (-2001.569) (-1989.946) (-1992.941) [-1987.412] * (-1989.111) [-1980.360] (-1993.276) (-1995.351) -- 0:03:33
      331500 -- (-2002.683) [-1988.392] (-1994.768) (-1991.393) * (-1986.637) [-1982.224] (-2000.912) (-1990.020) -- 0:03:33
      331600 -- (-1992.700) [-1982.775] (-1985.739) (-1996.646) * (-1987.446) [-1983.275] (-1996.341) (-1997.661) -- 0:03:33
      331700 -- (-1993.390) (-1984.101) [-1986.765] (-1985.788) * (-1994.065) [-1984.177] (-1998.020) (-1997.132) -- 0:03:33
      331800 -- (-1987.927) (-1980.750) (-1999.981) [-1986.809] * (-2001.660) [-1985.824] (-2003.046) (-1997.541) -- 0:03:33
      331900 -- (-1993.384) (-1984.370) (-1989.115) [-1985.334] * (-1996.526) [-1989.964] (-2000.398) (-2007.063) -- 0:03:33
      332000 -- (-1994.092) (-1991.357) [-1984.363] (-1987.165) * [-1993.424] (-1990.812) (-1994.478) (-2016.469) -- 0:03:33

      Average standard deviation of split frequencies: 0.005110

      332100 -- (-1997.493) (-1988.129) [-1983.288] (-1988.769) * (-2000.028) [-1993.264] (-1993.074) (-2011.010) -- 0:03:33
      332200 -- (-1994.242) (-1983.738) [-1986.853] (-1997.635) * (-1991.426) [-1985.742] (-1993.990) (-2000.049) -- 0:03:33
      332300 -- (-1995.823) (-1982.592) [-1993.109] (-1985.545) * (-1994.242) (-1992.105) (-2001.335) [-1992.616] -- 0:03:34
      332400 -- (-1996.654) [-1981.680] (-1992.857) (-1994.038) * [-1993.705] (-1988.846) (-2011.270) (-1987.015) -- 0:03:34
      332500 -- (-2003.163) [-1979.908] (-1991.994) (-1988.470) * (-1989.673) [-1987.809] (-2002.560) (-1985.169) -- 0:03:34
      332600 -- (-2003.448) [-1977.311] (-1995.448) (-1985.688) * (-1988.038) (-1992.806) (-2000.334) [-1991.700] -- 0:03:34
      332700 -- (-2003.934) [-1982.854] (-1990.951) (-1991.789) * [-1986.288] (-1990.477) (-1999.328) (-1990.847) -- 0:03:34
      332800 -- (-2000.805) [-1984.490] (-1988.309) (-1989.944) * (-1991.300) (-1992.314) (-2006.142) [-1986.027] -- 0:03:34
      332900 -- (-2006.035) (-1989.329) (-1987.319) [-1987.656] * [-1985.886] (-1989.481) (-1994.942) (-1986.410) -- 0:03:34
      333000 -- (-1995.345) (-1991.494) [-1990.050] (-1990.366) * [-1975.435] (-1986.794) (-1991.862) (-1982.757) -- 0:03:34

      Average standard deviation of split frequencies: 0.005336

      333100 -- (-2004.243) [-1991.275] (-1995.367) (-1986.954) * (-1980.682) [-1981.930] (-1997.155) (-1983.850) -- 0:03:34
      333200 -- (-1998.610) [-1990.149] (-1984.889) (-1989.668) * [-1981.661] (-1977.068) (-1992.666) (-1982.278) -- 0:03:34
      333300 -- (-2004.490) [-1979.818] (-1985.409) (-1989.329) * (-1982.316) [-1984.744] (-1994.049) (-1982.144) -- 0:03:34
      333400 -- (-2003.873) (-1978.051) [-1986.529] (-1984.658) * (-1981.874) (-1985.197) (-1992.094) [-1988.811] -- 0:03:33
      333500 -- (-1996.615) [-1980.129] (-1989.073) (-1986.693) * [-1983.806] (-1988.171) (-1993.482) (-1998.240) -- 0:03:33
      333600 -- (-1998.853) (-1986.581) (-1987.164) [-1987.427] * (-1982.222) [-1983.513] (-1989.209) (-1995.276) -- 0:03:33
      333700 -- (-2000.436) (-1988.468) [-1987.044] (-1985.866) * [-1979.041] (-1985.546) (-1986.483) (-1996.097) -- 0:03:33
      333800 -- (-1990.562) (-1981.397) (-1984.856) [-1980.831] * [-1982.961] (-1984.409) (-1991.560) (-1997.788) -- 0:03:33
      333900 -- (-1991.839) (-1985.498) (-1989.343) [-1980.069] * [-1979.468] (-1987.364) (-1993.227) (-1997.964) -- 0:03:33
      334000 -- (-1991.140) (-1990.462) (-1991.584) [-1981.565] * [-1987.528] (-1988.193) (-1988.716) (-1988.624) -- 0:03:33

      Average standard deviation of split frequencies: 0.005482

      334100 -- (-1988.553) (-1991.183) (-1998.812) [-1981.578] * [-1984.629] (-1991.179) (-1986.155) (-1989.930) -- 0:03:33
      334200 -- (-1988.541) (-1990.855) (-2006.717) [-1979.821] * [-1980.853] (-1990.049) (-1987.259) (-1983.598) -- 0:03:33
      334300 -- (-1991.931) [-1989.361] (-1998.206) (-1978.988) * (-1983.552) (-1988.194) (-1992.572) [-1977.435] -- 0:03:33
      334400 -- (-1991.582) (-1985.556) (-1996.941) [-1979.526] * (-1988.013) (-1995.001) (-1998.190) [-1980.871] -- 0:03:32
      334500 -- (-1987.491) [-1980.198] (-1987.069) (-1982.688) * [-1982.899] (-1986.762) (-1999.796) (-1984.219) -- 0:03:32
      334600 -- (-1995.346) [-1980.641] (-1992.364) (-1983.248) * (-1985.566) (-1987.101) (-1993.403) [-1981.723] -- 0:03:32
      334700 -- (-1992.101) [-1982.069] (-1998.900) (-1988.245) * (-1987.685) (-1986.568) [-1988.305] (-1983.167) -- 0:03:32
      334800 -- (-1987.410) (-1984.845) [-1992.641] (-1983.718) * (-1987.799) (-1985.065) (-1990.699) [-1981.756] -- 0:03:32
      334900 -- (-1984.788) (-1981.570) (-1991.315) [-1981.354] * [-1984.343] (-1987.060) (-1995.160) (-1987.575) -- 0:03:32
      335000 -- (-2005.278) [-1984.441] (-1993.161) (-1989.203) * (-1986.139) [-1981.933] (-2003.528) (-1989.057) -- 0:03:32

      Average standard deviation of split frequencies: 0.005424

      335100 -- [-1988.652] (-1990.729) (-1996.337) (-1991.817) * [-1984.860] (-1995.058) (-2002.381) (-1981.996) -- 0:03:32
      335200 -- (-1989.423) (-1985.700) (-2000.771) [-1986.236] * (-1984.394) (-2004.523) (-1999.694) [-1979.239] -- 0:03:32
      335300 -- (-1986.757) (-1988.368) (-2005.356) [-1983.591] * (-1984.694) (-2001.973) (-1996.976) [-1981.471] -- 0:03:32
      335400 -- [-1985.325] (-1986.304) (-2006.506) (-1980.294) * (-1996.203) [-1991.434] (-1988.395) (-1981.858) -- 0:03:34
      335500 -- (-1994.181) [-1983.565] (-2003.987) (-1986.495) * (-1985.884) (-1990.951) (-1989.701) [-1982.781] -- 0:03:33
      335600 -- (-1992.961) [-1983.802] (-1998.022) (-1992.395) * (-1997.146) (-1994.164) (-1992.558) [-1982.763] -- 0:03:33
      335700 -- (-1992.158) [-1986.137] (-2008.442) (-1998.388) * (-1987.977) [-1984.835] (-1996.438) (-1983.423) -- 0:03:33
      335800 -- (-1992.935) [-1982.800] (-2003.968) (-2007.388) * (-1989.660) (-1994.246) (-1995.779) [-1980.383] -- 0:03:33
      335900 -- (-1996.440) [-1981.029] (-1994.287) (-1997.683) * [-1987.746] (-1990.293) (-1991.168) (-1990.580) -- 0:03:33
      336000 -- (-1990.125) [-1980.398] (-1990.858) (-2005.425) * (-1998.427) [-1984.455] (-2001.153) (-1992.954) -- 0:03:33

      Average standard deviation of split frequencies: 0.005530

      336100 -- (-1993.402) [-1981.745] (-1990.057) (-1997.406) * (-2003.766) [-1985.948] (-1994.929) (-1988.035) -- 0:03:33
      336200 -- (-1991.381) [-1980.426] (-1995.093) (-1995.598) * (-1997.186) (-1986.423) (-2004.477) [-1985.976] -- 0:03:33
      336300 -- (-1997.969) [-1980.102] (-1991.605) (-1991.023) * (-1992.850) (-1986.376) (-2001.504) [-1985.085] -- 0:03:33
      336400 -- (-1993.801) (-1985.803) [-1987.992] (-1993.902) * [-1982.475] (-1991.581) (-1997.518) (-1983.123) -- 0:03:33
      336500 -- (-1995.478) (-1985.334) [-1984.746] (-1999.713) * (-1987.833) (-2011.763) (-1998.352) [-1981.258] -- 0:03:32
      336600 -- (-1999.037) (-1981.477) [-1989.653] (-1995.890) * (-1993.417) [-1994.700] (-1999.986) (-1981.093) -- 0:03:32
      336700 -- (-1994.801) (-1983.761) (-1999.790) [-1987.686] * [-1981.310] (-1992.812) (-2000.495) (-1981.370) -- 0:03:32
      336800 -- (-2006.684) (-1980.441) (-2000.097) [-1981.889] * [-1982.344] (-1993.121) (-2000.435) (-1987.872) -- 0:03:32
      336900 -- (-2006.530) [-1983.984] (-1998.230) (-1986.841) * [-1981.341] (-1997.593) (-1995.405) (-1984.573) -- 0:03:32
      337000 -- (-2005.599) (-1984.251) [-1992.466] (-1987.762) * (-1982.211) (-1996.908) (-2003.734) [-1982.154] -- 0:03:32

      Average standard deviation of split frequencies: 0.005432

      337100 -- (-2008.453) (-1981.000) (-1989.013) [-1991.374] * (-1983.506) (-1992.080) (-1997.336) [-1979.977] -- 0:03:32
      337200 -- (-2000.952) [-1978.109] (-1989.588) (-1998.341) * (-1985.505) (-1989.130) (-1995.984) [-1978.135] -- 0:03:32
      337300 -- (-1997.826) [-1981.765] (-1988.595) (-2003.464) * (-1989.189) [-1983.398] (-1996.492) (-1986.721) -- 0:03:32
      337400 -- (-1997.780) (-1983.366) [-1982.042] (-1997.276) * [-1981.830] (-1986.669) (-1998.793) (-1993.902) -- 0:03:32
      337500 -- (-1995.834) (-1980.009) [-1981.253] (-1996.197) * [-1981.649] (-1987.883) (-1996.049) (-1990.832) -- 0:03:32
      337600 -- (-1997.323) [-1979.816] (-1987.941) (-1998.830) * (-1988.512) [-1989.052] (-1997.011) (-1988.773) -- 0:03:31
      337700 -- (-1992.801) [-1981.337] (-1987.429) (-2001.503) * (-2002.081) (-1996.303) (-2001.490) [-1988.963] -- 0:03:31
      337800 -- (-1996.471) [-1978.776] (-1983.841) (-1999.589) * [-1989.067] (-1986.092) (-1990.529) (-2001.562) -- 0:03:31
      337900 -- (-1994.723) [-1983.317] (-1984.061) (-1997.846) * (-1987.206) [-1983.651] (-1991.865) (-1991.732) -- 0:03:31
      338000 -- (-1990.053) [-1986.963] (-1989.032) (-1998.131) * [-1985.649] (-1993.695) (-1994.105) (-1998.170) -- 0:03:31

      Average standard deviation of split frequencies: 0.005218

      338100 -- [-1987.790] (-1989.551) (-1986.475) (-1990.112) * (-1982.293) [-1993.749] (-1991.634) (-1991.222) -- 0:03:31
      338200 -- (-1994.829) (-1989.054) [-1988.953] (-1985.225) * [-1983.882] (-1993.258) (-1991.180) (-1983.106) -- 0:03:31
      338300 -- (-1985.952) (-1993.241) [-1986.052] (-1981.257) * [-1981.799] (-2003.162) (-1995.208) (-1982.526) -- 0:03:31
      338400 -- (-1994.254) (-1987.774) [-1989.222] (-1982.503) * [-1981.859] (-2009.834) (-1989.644) (-1984.060) -- 0:03:31
      338500 -- (-1992.142) (-1987.464) [-1989.260] (-1980.989) * [-1978.088] (-1999.962) (-1989.173) (-1984.982) -- 0:03:33
      338600 -- (-1998.706) (-1995.501) [-1983.297] (-1982.692) * [-1977.923] (-2000.372) (-1983.279) (-1988.255) -- 0:03:32
      338700 -- (-2001.037) [-1987.866] (-1985.096) (-1996.540) * [-1980.524] (-1996.134) (-1983.673) (-1989.779) -- 0:03:32
      338800 -- (-1995.356) (-1987.768) (-1980.132) [-1991.300] * [-1982.409] (-1990.156) (-1985.347) (-1984.747) -- 0:03:32
      338900 -- (-1995.438) (-1989.989) [-1981.203] (-1995.719) * [-1985.638] (-1995.264) (-1983.078) (-1990.968) -- 0:03:32
      339000 -- (-1993.310) (-1990.137) [-1985.297] (-1994.252) * (-1991.821) (-1999.149) (-1998.679) [-1981.014] -- 0:03:32

      Average standard deviation of split frequencies: 0.005122

      339100 -- (-1987.115) (-1995.000) [-1981.527] (-1995.082) * (-1986.981) (-1999.124) (-1986.518) [-1985.613] -- 0:03:32
      339200 -- (-1985.174) [-1988.138] (-1984.901) (-1988.822) * (-1990.136) (-1997.529) [-1985.147] (-1992.427) -- 0:03:32
      339300 -- (-1981.586) (-1991.308) (-1984.029) [-1982.287] * (-1992.297) (-1989.322) [-1982.227] (-1998.046) -- 0:03:32
      339400 -- (-1986.494) (-1993.139) (-1997.095) [-1986.261] * (-1986.429) (-1990.366) [-1980.132] (-1998.499) -- 0:03:32
      339500 -- (-1982.640) (-1994.815) [-1987.285] (-1988.628) * [-1985.793] (-1989.068) (-1979.642) (-1989.074) -- 0:03:32
      339600 -- (-1987.951) (-1998.685) (-1994.034) [-1987.074] * (-1982.733) (-1990.646) [-1979.383] (-1987.997) -- 0:03:31
      339700 -- (-1988.421) (-1988.199) [-1983.917] (-1983.091) * [-1984.041] (-2003.877) (-1984.880) (-1990.343) -- 0:03:31
      339800 -- (-2000.379) (-1993.564) (-1985.338) [-1983.893] * [-1984.697] (-2002.969) (-1982.683) (-1985.039) -- 0:03:31
      339900 -- (-1993.857) (-1982.689) (-1981.793) [-1984.976] * [-1981.781] (-2005.437) (-1981.677) (-1991.725) -- 0:03:31
      340000 -- (-1991.195) (-1990.985) [-1988.576] (-1989.539) * [-1980.723] (-1996.710) (-1988.200) (-1991.168) -- 0:03:31

      Average standard deviation of split frequencies: 0.005029

      340100 -- (-1988.770) (-1988.906) [-1991.006] (-1987.591) * [-1983.938] (-1991.461) (-1986.539) (-1987.904) -- 0:03:31
      340200 -- (-1986.377) [-1985.632] (-1990.565) (-1987.571) * (-1982.427) (-1999.090) (-1984.378) [-1993.526] -- 0:03:31
      340300 -- [-1983.451] (-1988.808) (-1988.994) (-1988.040) * [-1983.545] (-1988.674) (-1990.237) (-1986.516) -- 0:03:31
      340400 -- (-1989.045) (-1989.885) (-1983.719) [-1985.497] * (-1988.745) (-1988.238) (-1983.569) [-1986.875] -- 0:03:31
      340500 -- (-1983.941) [-1989.189] (-1982.733) (-1986.353) * [-1984.293] (-1994.427) (-1984.440) (-1987.549) -- 0:03:31
      340600 -- (-1992.836) (-2000.956) [-1983.680] (-1985.512) * (-1980.240) (-2000.479) [-1983.825] (-1988.980) -- 0:03:31
      340700 -- (-1986.106) [-1985.688] (-1986.185) (-1982.533) * [-1981.545] (-1990.582) (-1997.890) (-1988.702) -- 0:03:30
      340800 -- (-1984.016) (-1991.656) (-1982.573) [-1981.924] * (-1987.076) (-1994.443) [-1988.241] (-1999.276) -- 0:03:30
      340900 -- (-1979.764) (-1989.036) (-1984.653) [-1981.241] * (-1986.046) (-1994.180) [-1987.653] (-1995.740) -- 0:03:30
      341000 -- (-1978.036) (-1995.628) [-1978.635] (-1986.286) * (-1987.111) (-1982.159) [-1982.331] (-1990.717) -- 0:03:30

      Average standard deviation of split frequencies: 0.005092

      341100 -- (-1982.261) (-1999.574) [-1986.918] (-1987.294) * (-1989.146) (-1984.360) [-1983.483] (-1990.748) -- 0:03:30
      341200 -- [-1981.902] (-2007.319) (-1986.556) (-1989.865) * [-1983.970] (-1983.686) (-1986.904) (-1993.407) -- 0:03:30
      341300 -- (-1988.858) (-2003.373) [-1982.733] (-2001.159) * (-1996.777) [-1984.485] (-1986.401) (-1993.855) -- 0:03:30
      341400 -- (-1990.646) (-2002.047) [-1983.499] (-1995.737) * (-1989.446) (-2000.917) [-1988.599] (-1995.469) -- 0:03:30
      341500 -- [-1988.296] (-2003.291) (-1980.476) (-2001.260) * [-1989.404] (-1991.688) (-1988.163) (-1995.776) -- 0:03:30
      341600 -- (-1986.860) (-1989.836) [-1983.021] (-1994.570) * (-1992.530) [-1990.023] (-1988.604) (-1992.337) -- 0:03:32
      341700 -- [-1984.611] (-1999.982) (-1987.829) (-1992.339) * (-2000.342) [-1988.096] (-1979.782) (-2003.125) -- 0:03:31
      341800 -- [-1985.250] (-1993.884) (-1987.029) (-1990.338) * [-1989.185] (-1984.093) (-1982.766) (-2005.939) -- 0:03:31
      341900 -- [-1984.516] (-1999.297) (-1984.818) (-1991.228) * [-1984.477] (-1983.083) (-1993.200) (-2001.205) -- 0:03:31
      342000 -- [-1979.594] (-1998.964) (-1985.569) (-1992.167) * (-1989.242) [-1984.831] (-1992.435) (-2002.889) -- 0:03:31

      Average standard deviation of split frequencies: 0.005315

      342100 -- [-1981.098] (-1992.048) (-1989.783) (-1988.354) * (-1986.882) (-1985.868) [-1980.901] (-1992.302) -- 0:03:31
      342200 -- [-1983.273] (-1991.880) (-1993.897) (-1988.031) * (-1988.447) (-1982.754) [-1983.214] (-1997.148) -- 0:03:31
      342300 -- [-1983.792] (-1990.594) (-1999.691) (-1984.490) * (-1982.850) [-1984.778] (-1995.061) (-1999.719) -- 0:03:31
      342400 -- [-1982.351] (-1986.873) (-1991.746) (-1985.803) * [-1981.650] (-1989.505) (-1983.657) (-2008.856) -- 0:03:31
      342500 -- [-1979.362] (-1990.517) (-1989.011) (-1984.792) * (-1983.892) [-1980.974] (-1981.456) (-2009.822) -- 0:03:31
      342600 -- [-1978.172] (-1995.681) (-1996.698) (-1985.578) * (-1987.066) [-1981.195] (-1988.121) (-2003.601) -- 0:03:31
      342700 -- (-1983.211) (-1996.126) (-1986.891) [-1988.248] * (-1983.484) [-1981.735] (-1983.591) (-2001.258) -- 0:03:30
      342800 -- (-1979.525) (-1994.841) (-1987.664) [-1984.180] * (-1985.646) [-1981.323] (-1984.501) (-2004.810) -- 0:03:30
      342900 -- (-1982.091) (-1996.941) [-1989.627] (-1987.385) * (-1984.926) [-1985.137] (-1986.468) (-1994.505) -- 0:03:30
      343000 -- [-1984.293] (-1998.588) (-1986.302) (-1990.628) * [-1983.634] (-1980.151) (-1990.071) (-1995.319) -- 0:03:30

      Average standard deviation of split frequencies: 0.005063

      343100 -- (-1985.081) (-1991.179) (-1993.354) [-1988.241] * (-1998.991) [-1978.241] (-1983.531) (-1996.917) -- 0:03:30
      343200 -- [-1981.400] (-1989.797) (-1991.948) (-1987.563) * (-1986.960) [-1987.064] (-1986.064) (-1998.835) -- 0:03:30
      343300 -- [-1984.754] (-1987.121) (-1987.724) (-1989.251) * (-1987.848) (-1995.788) [-1990.366] (-2004.272) -- 0:03:30
      343400 -- (-1989.805) (-1985.727) [-1984.660] (-1989.067) * (-1990.536) (-2006.644) [-1986.174] (-2003.591) -- 0:03:30
      343500 -- (-1986.959) (-1991.399) [-1982.461] (-1988.330) * [-1984.997] (-1989.804) (-1994.906) (-2000.119) -- 0:03:30
      343600 -- (-1984.970) (-1990.953) [-1978.608] (-1988.377) * (-1990.480) (-2000.850) [-1987.375] (-2001.030) -- 0:03:30
      343700 -- (-1986.441) (-1988.182) [-1983.640] (-1989.041) * (-1993.320) (-2005.108) [-1986.331] (-2003.844) -- 0:03:30
      343800 -- (-1986.478) (-1986.756) [-1983.386] (-1992.093) * (-1989.930) [-1988.769] (-1986.486) (-1999.267) -- 0:03:29
      343900 -- (-1988.178) [-1986.435] (-1985.291) (-2011.226) * [-1979.584] (-1988.619) (-1988.049) (-1996.110) -- 0:03:29
      344000 -- (-1989.164) [-1986.601] (-1990.989) (-2011.205) * [-1982.795] (-1990.812) (-1987.323) (-1998.857) -- 0:03:29

      Average standard deviation of split frequencies: 0.005010

      344100 -- (-1993.236) (-1986.171) [-1987.574] (-2014.351) * [-1984.560] (-1989.516) (-1988.017) (-1992.314) -- 0:03:29
      344200 -- (-1998.247) (-1985.885) [-1988.596] (-1991.863) * (-1990.898) (-1986.547) [-1982.044] (-1999.277) -- 0:03:29
      344300 -- (-2002.280) [-1987.639] (-1994.459) (-1986.104) * [-1984.720] (-1987.861) (-1984.570) (-1991.825) -- 0:03:29
      344400 -- [-1991.529] (-1989.521) (-1986.001) (-1993.363) * (-1991.549) [-1987.449] (-1979.669) (-1986.712) -- 0:03:29
      344500 -- (-1995.106) (-1992.370) [-1989.752] (-1997.152) * [-1982.245] (-1990.429) (-1977.938) (-1986.951) -- 0:03:29
      344600 -- (-1990.464) (-1995.311) [-1983.971] (-1987.349) * (-1982.763) (-1987.689) [-1977.866] (-1989.658) -- 0:03:29
      344700 -- (-1998.973) (-1985.952) (-1979.864) [-1990.584] * (-1981.843) (-1984.692) [-1982.128] (-1995.419) -- 0:03:31
      344800 -- (-1995.396) (-1987.574) [-1977.131] (-1997.845) * [-1980.752] (-1986.142) (-1985.541) (-1985.613) -- 0:03:30
      344900 -- (-1989.651) (-1986.754) [-1980.819] (-1991.520) * [-1982.703] (-1985.397) (-1985.773) (-1988.283) -- 0:03:30
      345000 -- (-1986.471) [-1984.588] (-1983.267) (-1988.228) * [-1981.122] (-1980.177) (-1988.861) (-1991.745) -- 0:03:30

      Average standard deviation of split frequencies: 0.005033

      345100 -- (-1982.201) (-1988.211) [-1981.296] (-1986.632) * [-1983.269] (-1982.423) (-1991.808) (-1998.092) -- 0:03:30
      345200 -- (-1990.794) (-1992.842) [-1985.254] (-1988.164) * [-1984.200] (-1990.279) (-1990.931) (-1994.710) -- 0:03:30
      345300 -- (-1993.111) [-1993.860] (-1984.783) (-1994.653) * [-1980.089] (-1987.914) (-1997.391) (-1991.828) -- 0:03:30
      345400 -- [-1990.431] (-1997.458) (-1987.058) (-1991.763) * [-1983.426] (-1985.079) (-1988.465) (-1994.245) -- 0:03:30
      345500 -- (-1982.105) (-1999.357) (-1990.804) [-1989.277] * (-1983.306) [-1985.440] (-1992.170) (-1984.976) -- 0:03:30
      345600 -- (-1986.426) [-1988.347] (-1991.052) (-1992.237) * (-1990.195) [-1983.916] (-1989.131) (-1985.783) -- 0:03:30
      345700 -- [-1986.278] (-2003.137) (-1993.638) (-1993.508) * (-1990.161) [-1986.311] (-1988.728) (-1986.948) -- 0:03:30
      345800 -- (-1983.491) (-2002.649) [-1987.360] (-1994.957) * (-1989.199) (-1984.749) [-1981.850] (-1994.896) -- 0:03:29
      345900 -- [-1981.219] (-1998.543) (-1986.165) (-1993.127) * [-1985.180] (-1997.158) (-1989.140) (-1996.676) -- 0:03:29
      346000 -- (-1979.650) (-1998.946) [-1983.601] (-1998.231) * (-1989.542) [-1991.959] (-1986.616) (-2011.739) -- 0:03:29

      Average standard deviation of split frequencies: 0.005175

      346100 -- (-1982.048) (-2007.731) [-1982.136] (-2001.838) * (-1990.708) (-1990.085) [-1979.937] (-2001.222) -- 0:03:29
      346200 -- (-1982.433) (-1994.755) [-1979.462] (-2007.933) * (-1987.569) (-1991.679) [-1984.820] (-2009.992) -- 0:03:29
      346300 -- (-1993.614) (-1995.673) [-1981.428] (-2004.434) * [-1985.059] (-1989.006) (-1987.655) (-2010.959) -- 0:03:29
      346400 -- [-1992.463] (-1993.870) (-1981.895) (-1997.918) * (-1979.905) (-1990.172) [-1985.115] (-2019.268) -- 0:03:29
      346500 -- (-1984.811) (-1989.761) [-1982.062] (-2009.470) * (-1990.832) [-1987.554] (-1980.925) (-2007.787) -- 0:03:29
      346600 -- (-1989.554) (-1992.854) [-1982.299] (-1999.001) * (-1989.223) (-1988.392) [-1984.778] (-2019.311) -- 0:03:29
      346700 -- [-1989.185] (-1989.030) (-1985.517) (-1993.664) * [-1981.515] (-1989.685) (-1982.485) (-2019.646) -- 0:03:29
      346800 -- [-1991.006] (-1987.291) (-1996.223) (-1992.610) * [-1981.885] (-1986.822) (-1984.872) (-2025.297) -- 0:03:29
      346900 -- [-1985.555] (-1986.421) (-1995.083) (-1997.994) * [-1980.206] (-1994.843) (-1985.452) (-2010.116) -- 0:03:28
      347000 -- (-1982.865) [-1981.263] (-1994.211) (-1994.104) * [-1979.083] (-1996.351) (-1980.049) (-1999.452) -- 0:03:28

      Average standard deviation of split frequencies: 0.005198

      347100 -- (-1982.530) [-1985.486] (-1990.445) (-1990.002) * (-1981.621) (-1992.107) [-1978.683] (-2003.533) -- 0:03:28
      347200 -- [-1980.173] (-1987.241) (-1986.973) (-1991.833) * (-1978.709) (-1983.546) [-1982.874] (-2001.965) -- 0:03:28
      347300 -- [-1982.038] (-1990.709) (-1991.549) (-1995.389) * (-1979.206) (-1984.522) [-1981.410] (-2000.799) -- 0:03:28
      347400 -- [-1983.541] (-1990.334) (-1994.630) (-1992.247) * (-1978.581) (-1985.136) [-1982.243] (-2005.073) -- 0:03:28
      347500 -- (-1985.863) (-1991.607) (-1996.865) [-1990.266] * (-1981.554) (-1987.958) [-1980.584] (-1995.523) -- 0:03:28
      347600 -- (-1987.753) [-1990.186] (-1996.634) (-1999.568) * (-1983.907) (-1989.763) [-1980.542] (-1999.254) -- 0:03:28
      347700 -- (-1985.173) [-1994.549] (-1996.889) (-2000.129) * (-1996.357) [-1987.606] (-1981.278) (-2005.080) -- 0:03:28
      347800 -- [-1992.837] (-1998.089) (-1993.641) (-1993.017) * (-1994.499) (-1984.339) [-1985.658] (-2016.624) -- 0:03:30
      347900 -- (-1988.882) (-1991.908) (-1992.543) [-1987.403] * [-1993.104] (-1988.821) (-1988.681) (-2021.064) -- 0:03:29
      348000 -- [-1985.720] (-1991.448) (-1990.810) (-1987.115) * (-1995.582) (-1986.291) [-1984.161] (-2020.832) -- 0:03:29

      Average standard deviation of split frequencies: 0.004875

      348100 -- [-1988.790] (-1986.707) (-1990.325) (-1984.899) * (-2007.310) [-1982.659] (-1989.204) (-2003.340) -- 0:03:29
      348200 -- [-1979.621] (-1993.445) (-1985.638) (-1987.964) * (-1993.760) [-1983.351] (-1991.530) (-2002.277) -- 0:03:29
      348300 -- [-1983.069] (-2002.775) (-1980.045) (-1983.200) * [-1988.959] (-1985.028) (-1998.677) (-2007.096) -- 0:03:29
      348400 -- [-1979.321] (-1989.630) (-2000.695) (-1987.925) * (-1990.427) [-1981.174] (-1997.394) (-1998.540) -- 0:03:29
      348500 -- [-1983.252] (-1993.144) (-1994.944) (-1987.736) * [-1986.946] (-1981.413) (-1995.803) (-1994.819) -- 0:03:29
      348600 -- [-1982.729] (-1996.155) (-1997.494) (-1989.349) * (-1988.947) [-1978.553] (-1989.775) (-1997.276) -- 0:03:29
      348700 -- [-1982.024] (-1996.351) (-1989.931) (-1987.743) * (-1992.412) (-1980.895) [-1990.736] (-1995.514) -- 0:03:29
      348800 -- [-1981.894] (-1991.392) (-1998.422) (-1988.294) * (-1996.229) (-1982.861) [-1987.333] (-1995.359) -- 0:03:29
      348900 -- [-1983.043] (-1994.418) (-1998.117) (-1992.406) * (-1990.006) (-1982.825) [-1988.944] (-1996.666) -- 0:03:29
      349000 -- [-1983.947] (-1998.843) (-1993.277) (-1992.671) * [-1987.408] (-1983.990) (-1983.239) (-1995.592) -- 0:03:28

      Average standard deviation of split frequencies: 0.004744

      349100 -- [-1985.455] (-1997.235) (-1992.051) (-1996.523) * (-1987.737) [-1981.242] (-1994.792) (-1988.746) -- 0:03:28
      349200 -- (-1982.542) (-2003.211) [-1984.476] (-1997.511) * (-1988.541) [-1982.922] (-1995.991) (-1988.494) -- 0:03:28
      349300 -- (-1984.023) (-1998.709) [-1985.480] (-1999.461) * (-1991.849) [-1981.610] (-1994.246) (-1990.536) -- 0:03:28
      349400 -- [-1982.836] (-1995.616) (-1985.751) (-1993.267) * (-1990.978) [-1981.548] (-1993.683) (-1994.866) -- 0:03:28
      349500 -- [-1985.496] (-1989.321) (-1995.710) (-1991.820) * (-1994.064) [-1982.877] (-1994.388) (-1995.474) -- 0:03:28
      349600 -- [-1986.109] (-1987.767) (-1994.160) (-1998.342) * (-1989.210) [-1986.286] (-1997.338) (-1994.675) -- 0:03:28
      349700 -- (-1986.212) [-1983.134] (-1990.118) (-1990.721) * (-1987.100) [-1979.422] (-1996.504) (-1994.707) -- 0:03:28
      349800 -- [-1982.277] (-1987.289) (-1986.633) (-1992.053) * (-1989.626) [-1982.411] (-1989.254) (-2000.117) -- 0:03:28
      349900 -- (-1986.863) (-1995.409) [-1987.425] (-1992.645) * (-1991.515) [-1980.476] (-1984.618) (-1987.552) -- 0:03:28
      350000 -- (-1983.624) (-1992.093) [-1986.771] (-1997.063) * (-1985.343) [-1981.827] (-1986.423) (-1991.919) -- 0:03:28

      Average standard deviation of split frequencies: 0.004501

      350100 -- [-1983.850] (-1990.197) (-1999.965) (-1994.361) * (-1983.278) [-1980.239] (-1989.125) (-1992.545) -- 0:03:27
      350200 -- (-1983.870) (-1984.348) [-1992.849] (-1989.612) * (-1980.812) [-1981.683] (-1991.474) (-1985.160) -- 0:03:27
      350300 -- (-1982.157) (-1985.111) (-1987.193) [-1983.613] * (-1987.652) [-1978.788] (-1983.044) (-1992.645) -- 0:03:27
      350400 -- [-1982.094] (-1987.828) (-1985.917) (-1986.704) * (-1988.943) (-1979.859) [-1983.348] (-1988.032) -- 0:03:27
      350500 -- [-1985.976] (-1987.207) (-1978.140) (-1985.707) * [-1982.564] (-1983.559) (-1977.762) (-1995.056) -- 0:03:27
      350600 -- (-1992.763) [-1990.031] (-1984.279) (-1985.707) * (-1982.802) (-1981.533) [-1981.907] (-1993.844) -- 0:03:27
      350700 -- (-1994.646) (-1990.175) [-1979.689] (-1994.492) * [-1985.386] (-1987.571) (-1989.310) (-1996.352) -- 0:03:27
      350800 -- [-1992.469] (-2004.433) (-1982.633) (-1996.123) * (-1987.486) (-1999.196) (-1999.088) [-1993.761] -- 0:03:27
      350900 -- (-1982.441) (-1993.763) [-1981.647] (-1991.067) * [-1981.177] (-1994.219) (-1993.029) (-1993.320) -- 0:03:29
      351000 -- [-1981.049] (-2003.800) (-1987.988) (-1996.937) * (-1993.137) (-1982.615) [-1986.899] (-1991.794) -- 0:03:28

      Average standard deviation of split frequencies: 0.004334

      351100 -- [-1980.823] (-2001.887) (-1984.614) (-1996.421) * (-1986.783) (-1984.693) [-1984.814] (-1991.929) -- 0:03:28
      351200 -- [-1982.471] (-1988.410) (-1990.243) (-1996.022) * (-1986.316) [-1984.230] (-1993.539) (-1990.394) -- 0:03:28
      351300 -- [-1979.530] (-1985.236) (-1988.214) (-1995.770) * (-1986.558) (-1986.242) (-1999.211) [-1986.312] -- 0:03:28
      351400 -- [-1983.489] (-1986.191) (-1979.006) (-1994.297) * (-1983.774) [-1981.854] (-1990.947) (-1989.073) -- 0:03:28
      351500 -- [-1982.493] (-1992.303) (-1982.791) (-1991.847) * [-1984.561] (-1984.034) (-1988.065) (-1995.828) -- 0:03:28
      351600 -- (-1983.431) (-1997.586) [-1981.748] (-1987.199) * (-1983.825) (-1991.013) [-1991.312] (-1996.555) -- 0:03:28
      351700 -- [-1982.696] (-1985.659) (-1988.941) (-1991.132) * [-1982.389] (-1984.709) (-1988.060) (-1999.525) -- 0:03:28
      351800 -- [-1990.258] (-1987.248) (-1983.789) (-1990.329) * (-1982.133) [-1993.521] (-1987.292) (-1997.306) -- 0:03:28
      351900 -- (-1992.627) (-1994.148) [-1984.644] (-1990.250) * (-1987.780) (-1996.285) [-1985.683] (-1999.234) -- 0:03:28
      352000 -- [-1984.287] (-1993.683) (-1984.572) (-1989.193) * (-1990.747) (-2001.624) [-1989.418] (-1997.078) -- 0:03:28

      Average standard deviation of split frequencies: 0.004322

      352100 -- [-1983.604] (-1999.443) (-1981.624) (-1990.497) * [-1983.575] (-1991.792) (-1984.967) (-1999.653) -- 0:03:27
      352200 -- (-1982.324) (-1998.853) [-1985.507] (-1986.365) * (-1983.253) (-2000.605) [-1985.533] (-1994.363) -- 0:03:27
      352300 -- [-1981.532] (-2000.812) (-1993.169) (-1991.671) * (-1981.550) (-2001.341) [-1980.164] (-1995.378) -- 0:03:27
      352400 -- [-1979.943] (-1995.252) (-1988.462) (-1992.148) * (-1976.679) (-1992.385) [-1976.934] (-1991.808) -- 0:03:27
      352500 -- (-1981.827) (-1989.009) [-1985.678] (-1991.874) * (-1979.334) (-1993.720) (-1980.807) [-1988.695] -- 0:03:27
      352600 -- [-1977.452] (-1988.831) (-1988.132) (-1994.451) * [-1979.874] (-1993.252) (-1981.746) (-1988.876) -- 0:03:27
      352700 -- [-1979.859] (-1990.305) (-1992.107) (-2001.455) * [-1983.804] (-1992.248) (-1980.266) (-1999.708) -- 0:03:27
      352800 -- (-1984.570) (-2006.666) [-1985.851] (-1997.064) * (-1990.737) (-1992.660) [-1981.079] (-1990.760) -- 0:03:27
      352900 -- (-1985.493) (-2009.315) (-1987.984) [-1991.119] * (-1994.084) (-1983.114) [-1979.037] (-1991.631) -- 0:03:27
      353000 -- (-1985.727) (-2007.462) [-1987.694] (-2002.704) * (-1986.341) (-1985.148) [-1982.450] (-1996.102) -- 0:03:27

      Average standard deviation of split frequencies: 0.004309

      353100 -- [-1983.785] (-2014.460) (-1983.387) (-1997.861) * (-1983.618) [-1981.679] (-1982.805) (-2000.374) -- 0:03:27
      353200 -- [-1980.608] (-2000.119) (-1983.342) (-2003.075) * [-1982.501] (-1982.510) (-1982.437) (-1996.128) -- 0:03:26
      353300 -- [-1981.881] (-1994.793) (-1985.817) (-2002.304) * (-1983.108) (-1988.705) [-1981.423] (-1999.424) -- 0:03:26
      353400 -- [-1984.449] (-1993.583) (-1982.979) (-2008.301) * (-1985.960) [-1983.521] (-1989.806) (-1991.670) -- 0:03:26
      353500 -- [-1980.456] (-1992.427) (-1980.566) (-1995.897) * [-1988.774] (-1984.526) (-1984.421) (-1997.208) -- 0:03:26
      353600 -- (-1987.054) (-1994.829) [-1981.646] (-1994.170) * (-1981.631) (-1986.095) [-1987.566] (-1993.177) -- 0:03:26
      353700 -- (-1990.037) (-1998.481) [-1979.896] (-1994.117) * (-1987.800) (-1988.097) [-1983.333] (-1999.548) -- 0:03:26
      353800 -- (-1992.873) (-1999.323) [-1982.219] (-1996.633) * (-1993.844) (-1990.488) [-1985.154] (-1993.292) -- 0:03:26
      353900 -- (-1990.695) (-1998.178) [-1985.368] (-1993.438) * (-1989.475) (-1991.544) [-1983.225] (-1994.410) -- 0:03:26
      354000 -- (-1995.252) (-1995.365) [-1984.976] (-1994.997) * (-1995.472) [-1985.717] (-1981.350) (-1991.626) -- 0:03:28

      Average standard deviation of split frequencies: 0.004412

      354100 -- (-1996.104) (-1997.650) [-1989.953] (-2003.516) * (-1988.622) (-1988.441) [-1989.570] (-1994.721) -- 0:03:27
      354200 -- [-1993.262] (-2000.707) (-1989.592) (-2009.927) * (-1990.071) [-1983.383] (-1985.982) (-1993.246) -- 0:03:27
      354300 -- (-1994.646) (-1999.097) [-1988.621] (-2008.015) * (-1989.106) [-1987.951] (-1987.555) (-1987.325) -- 0:03:27
      354400 -- (-1989.015) (-1989.324) [-1984.129] (-2009.810) * (-1987.980) [-1986.615] (-1985.701) (-1988.145) -- 0:03:27
      354500 -- (-1986.930) (-1998.964) [-1984.716] (-2003.947) * (-1988.747) (-1990.923) (-1990.298) [-1990.797] -- 0:03:27
      354600 -- (-1994.885) (-1995.823) [-1981.351] (-2003.100) * (-2007.419) [-1995.084] (-1998.627) (-1993.854) -- 0:03:27
      354700 -- (-1996.226) (-1992.206) [-1988.062] (-2005.495) * (-1994.885) [-1990.839] (-1997.535) (-1993.043) -- 0:03:27
      354800 -- (-2000.221) [-1986.888] (-1993.859) (-1998.137) * (-1997.776) [-1983.434] (-1996.015) (-1991.310) -- 0:03:27
      354900 -- (-2005.301) [-1992.993] (-1990.233) (-2006.028) * (-1989.085) [-1989.486] (-1994.407) (-1993.165) -- 0:03:27
      355000 -- [-1989.777] (-1989.494) (-1984.616) (-2010.364) * (-1987.319) (-1988.003) (-1990.431) [-1991.618] -- 0:03:27

      Average standard deviation of split frequencies: 0.004436

      355100 -- (-1992.277) [-1986.652] (-1987.024) (-2007.318) * (-1995.754) [-1985.427] (-1990.751) (-1994.204) -- 0:03:27
      355200 -- (-1984.999) (-1990.763) [-1985.932] (-2008.387) * (-2003.074) (-1984.755) [-1989.828] (-1991.829) -- 0:03:26
      355300 -- (-1985.069) (-1997.274) [-1980.898] (-2003.622) * (-1990.954) [-1982.705] (-1990.216) (-1991.041) -- 0:03:26
      355400 -- (-1986.644) (-1994.170) [-1982.448] (-2004.074) * (-1993.046) (-1984.539) [-1988.226] (-1997.108) -- 0:03:26
      355500 -- [-1987.195] (-1996.721) (-1981.743) (-2010.779) * [-1984.192] (-1990.276) (-2001.544) (-1991.608) -- 0:03:26
      355600 -- [-1981.775] (-2008.223) (-1986.216) (-2012.629) * (-1988.934) (-1988.911) (-1997.827) [-1983.866] -- 0:03:26
      355700 -- [-1988.561] (-1996.087) (-1987.905) (-2010.600) * (-1983.968) [-1990.780] (-2000.427) (-1990.461) -- 0:03:26
      355800 -- [-1985.578] (-1991.586) (-1985.472) (-2010.521) * [-1983.421] (-1992.366) (-1994.468) (-1991.476) -- 0:03:26
      355900 -- [-1981.833] (-1988.732) (-1987.259) (-2006.702) * [-1978.814] (-1991.583) (-1993.071) (-1990.992) -- 0:03:26
      356000 -- [-1979.622] (-1998.539) (-1991.144) (-2008.913) * [-1979.495] (-1988.979) (-1991.940) (-1990.032) -- 0:03:26

      Average standard deviation of split frequencies: 0.004425

      356100 -- [-1979.276] (-1993.499) (-1997.760) (-2019.433) * [-1981.278] (-1997.877) (-1998.985) (-1985.782) -- 0:03:26
      356200 -- [-1982.242] (-1989.771) (-2005.728) (-2003.096) * [-1986.010] (-1990.707) (-2005.867) (-1990.628) -- 0:03:26
      356300 -- [-1983.096] (-1990.779) (-1997.108) (-2005.431) * (-1982.960) [-1984.441] (-1998.853) (-1991.561) -- 0:03:25
      356400 -- [-1978.160] (-1997.204) (-1989.467) (-2003.606) * [-1978.443] (-1991.770) (-1999.961) (-1998.940) -- 0:03:25
      356500 -- (-1977.361) (-1985.182) [-1993.255] (-2007.727) * [-1977.629] (-1999.391) (-2005.684) (-1997.805) -- 0:03:25
      356600 -- (-1986.294) [-1980.380] (-2002.038) (-2003.958) * [-1981.038] (-1994.263) (-2006.820) (-1990.795) -- 0:03:25
      356700 -- (-1986.379) [-1985.208] (-2002.166) (-2008.852) * [-1982.538] (-1996.154) (-2011.140) (-1997.699) -- 0:03:25
      356800 -- (-1984.669) [-1983.744] (-1995.240) (-1997.738) * (-1987.035) [-1989.223] (-2008.645) (-1992.162) -- 0:03:25
      356900 -- (-1990.616) [-1982.242] (-2000.631) (-2003.910) * [-1995.179] (-1987.769) (-2006.643) (-1989.804) -- 0:03:25
      357000 -- [-1981.847] (-1986.990) (-1989.694) (-2003.911) * (-1994.570) [-1984.166] (-2010.445) (-1990.095) -- 0:03:25

      Average standard deviation of split frequencies: 0.004487

      357100 -- [-1983.867] (-1988.807) (-1990.279) (-2001.692) * [-1989.214] (-1985.518) (-2007.572) (-1989.609) -- 0:03:27
      357200 -- [-1985.430] (-1990.110) (-1991.042) (-2004.523) * (-1991.513) (-1982.649) (-2002.541) [-1982.866] -- 0:03:26
      357300 -- (-1990.097) (-1988.451) [-1982.251] (-2009.397) * (-1990.377) (-1991.769) (-1999.235) [-1984.084] -- 0:03:26
      357400 -- (-1990.677) [-1985.122] (-1992.622) (-2004.161) * (-1990.072) (-1985.077) (-1989.199) [-1985.925] -- 0:03:26
      357500 -- (-1989.500) (-1984.888) [-1988.992] (-1998.429) * (-1989.335) [-1984.890] (-1985.975) (-1990.390) -- 0:03:26
      357600 -- (-1990.935) (-1983.292) [-1985.883] (-1998.916) * (-1986.734) (-1985.993) [-1990.536] (-1987.858) -- 0:03:26
      357700 -- (-1988.100) (-1986.116) [-1981.197] (-2006.446) * [-1985.317] (-1997.584) (-1991.653) (-1982.996) -- 0:03:26
      357800 -- (-1989.632) [-1985.663] (-1982.163) (-1992.980) * [-1992.844] (-1999.623) (-1996.749) (-1984.563) -- 0:03:26
      357900 -- (-1990.911) (-1989.416) [-1985.390] (-1996.027) * [-1987.127] (-1994.693) (-1991.262) (-1993.535) -- 0:03:26
      358000 -- (-1994.872) (-1988.741) [-1981.142] (-1996.056) * (-1987.137) (-2002.350) (-1991.805) [-1988.163] -- 0:03:26

      Average standard deviation of split frequencies: 0.004551

      358100 -- (-1995.565) [-1987.123] (-1983.771) (-1991.712) * [-1996.324] (-1996.048) (-1988.136) (-1995.612) -- 0:03:26
      358200 -- (-1994.871) (-1993.894) (-1984.708) [-1988.814] * (-1990.705) (-1994.257) [-1986.699] (-1989.896) -- 0:03:26
      358300 -- (-1989.176) (-1986.611) [-1981.083] (-1995.185) * (-1990.564) (-1990.169) [-1989.880] (-1999.768) -- 0:03:25
      358400 -- (-1992.735) [-1981.256] (-1986.328) (-1998.231) * (-1992.678) (-1997.174) [-1992.413] (-1995.139) -- 0:03:25
      358500 -- (-1990.111) (-1985.449) [-1983.129] (-2000.927) * (-1989.838) (-1988.720) [-1987.369] (-2004.647) -- 0:03:25
      358600 -- (-1999.105) (-1981.925) [-1983.840] (-2000.056) * [-1985.193] (-1987.202) (-1994.273) (-1997.698) -- 0:03:25
      358700 -- (-1990.046) [-1980.998] (-1990.064) (-1989.578) * [-1989.024] (-1986.621) (-2001.669) (-1999.542) -- 0:03:25
      358800 -- (-1984.735) [-1984.502] (-1991.940) (-1996.253) * (-1987.009) [-1982.560] (-2005.721) (-1998.543) -- 0:03:25
      358900 -- (-1989.374) [-1982.987] (-1995.232) (-1996.097) * (-1989.104) [-1979.734] (-1997.482) (-1997.174) -- 0:03:25
      359000 -- (-1987.968) [-1979.905] (-1994.455) (-1998.654) * (-1993.731) [-1984.427] (-1999.215) (-1994.845) -- 0:03:25

      Average standard deviation of split frequencies: 0.004500

      359100 -- (-1994.990) [-1979.196] (-1991.688) (-2006.129) * (-1997.798) [-1986.774] (-1998.702) (-1999.274) -- 0:03:25
      359200 -- (-1997.111) [-1979.535] (-1998.720) (-2001.581) * (-2000.992) (-1996.309) [-1994.440] (-1995.516) -- 0:03:25
      359300 -- (-1995.348) [-1977.226] (-1991.421) (-1999.710) * (-1998.952) [-1995.385] (-1990.851) (-1996.039) -- 0:03:25
      359400 -- (-1992.896) [-1980.781] (-1987.932) (-1998.477) * (-2004.373) [-1998.080] (-1994.084) (-1994.604) -- 0:03:24
      359500 -- (-1994.162) [-1980.426] (-1984.090) (-1992.760) * (-1995.104) [-1989.381] (-1988.677) (-1998.416) -- 0:03:24
      359600 -- (-1991.189) [-1985.701] (-1981.432) (-1993.503) * [-1982.435] (-1987.133) (-1995.739) (-1997.476) -- 0:03:24
      359700 -- (-1988.287) [-1982.356] (-1979.958) (-1992.711) * [-1984.282] (-1986.182) (-1995.113) (-1999.986) -- 0:03:24
      359800 -- (-1993.281) (-1991.941) [-1978.725] (-1991.831) * [-1984.186] (-1982.091) (-2003.631) (-1992.900) -- 0:03:24
      359900 -- (-1982.615) (-1997.934) [-1985.015] (-1992.387) * [-1979.791] (-1985.818) (-2000.977) (-1996.008) -- 0:03:24
      360000 -- (-1989.943) (-1996.468) [-1984.634] (-1995.214) * (-1980.205) [-1981.882] (-2003.037) (-2006.101) -- 0:03:24

      Average standard deviation of split frequencies: 0.004338

      360100 -- (-1985.991) (-1999.696) [-1984.922] (-1997.147) * [-1980.614] (-1990.765) (-1994.745) (-2001.076) -- 0:03:26
      360200 -- [-1985.131] (-1998.575) (-1982.774) (-1996.580) * [-1980.726] (-1991.071) (-1994.303) (-2004.204) -- 0:03:26
      360300 -- (-1990.792) (-1990.844) [-1988.042] (-1990.097) * [-1979.177] (-2002.759) (-1998.487) (-1997.267) -- 0:03:25
      360400 -- (-1983.840) (-1995.762) [-1989.467] (-1990.728) * [-1977.784] (-1993.554) (-1994.861) (-1993.602) -- 0:03:25
      360500 -- [-1981.431] (-1987.233) (-1984.853) (-1993.764) * [-1977.235] (-1994.967) (-1990.533) (-1994.167) -- 0:03:25
      360600 -- [-1977.597] (-1995.215) (-1991.676) (-1992.232) * [-1981.749] (-1996.616) (-1995.383) (-1999.699) -- 0:03:25
      360700 -- [-1989.713] (-1989.839) (-1990.524) (-2001.850) * (-1979.777) (-1999.865) [-1989.035] (-2004.060) -- 0:03:25
      360800 -- [-1982.708] (-1992.126) (-1993.828) (-1993.357) * [-1981.202] (-1998.125) (-1988.765) (-1991.590) -- 0:03:25
      360900 -- [-1984.542] (-2000.002) (-1990.154) (-1996.801) * [-1980.811] (-2000.501) (-1998.173) (-1999.545) -- 0:03:25
      361000 -- (-1985.210) [-1987.931] (-1985.827) (-2002.549) * [-1987.147] (-1996.722) (-1994.250) (-1992.823) -- 0:03:25

      Average standard deviation of split frequencies: 0.004027

      361100 -- (-1994.967) (-1992.985) [-1985.184] (-1998.554) * [-1978.733] (-1991.593) (-1995.838) (-1997.378) -- 0:03:25
      361200 -- (-2004.858) (-1988.960) [-1986.160] (-1988.401) * [-1984.795] (-1989.140) (-1996.219) (-2002.129) -- 0:03:25
      361300 -- (-2002.196) (-1988.992) [-1979.875] (-1992.503) * [-1982.554] (-1995.060) (-1998.578) (-2000.701) -- 0:03:25
      361400 -- (-2000.099) (-1988.794) [-1982.876] (-1998.589) * (-1980.438) [-1993.061] (-2005.368) (-1998.293) -- 0:03:24
      361500 -- (-1988.420) (-1987.400) [-1983.409] (-2000.099) * (-1985.630) [-1985.960] (-1995.908) (-1997.495) -- 0:03:24
      361600 -- (-1986.337) (-1985.690) [-1980.467] (-1997.526) * [-1984.416] (-1986.138) (-2001.974) (-1992.405) -- 0:03:24
      361700 -- (-1990.524) [-1984.316] (-1981.742) (-1990.414) * (-1987.009) [-1988.812] (-2002.733) (-1992.668) -- 0:03:24
      361800 -- (-1988.630) (-1982.116) [-1980.823] (-1996.521) * (-1992.721) [-1986.954] (-2001.711) (-1995.739) -- 0:03:24
      361900 -- (-1984.064) [-1983.379] (-1982.943) (-1989.375) * (-1988.222) [-1984.055] (-2000.164) (-1987.842) -- 0:03:24
      362000 -- [-1985.169] (-1984.194) (-1995.083) (-1996.058) * (-1986.788) [-1984.224] (-2000.228) (-1989.333) -- 0:03:24

      Average standard deviation of split frequencies: 0.003756

      362100 -- (-1987.381) [-1980.502] (-1985.237) (-1989.367) * [-1986.049] (-1984.572) (-1990.360) (-1989.613) -- 0:03:24
      362200 -- [-1984.012] (-1983.726) (-1988.238) (-1992.863) * [-1984.002] (-1991.271) (-1994.547) (-1992.405) -- 0:03:24
      362300 -- (-1981.147) [-1982.827] (-1989.660) (-1996.779) * [-1981.793] (-1991.326) (-1998.542) (-1986.875) -- 0:03:24
      362400 -- [-1985.629] (-1982.005) (-1987.645) (-1991.965) * [-1983.335] (-1987.568) (-2001.753) (-1988.923) -- 0:03:24
      362500 -- (-1996.419) (-1980.629) [-1987.647] (-1991.475) * [-1983.567] (-1984.460) (-1996.797) (-1989.629) -- 0:03:24
      362600 -- (-1990.015) (-1983.545) [-1982.351] (-1989.654) * [-1980.672] (-1993.956) (-1998.886) (-1988.592) -- 0:03:23
      362700 -- (-1985.250) [-1988.138] (-1992.157) (-1994.433) * (-1986.032) [-1996.259] (-2003.956) (-1989.020) -- 0:03:23
      362800 -- [-1981.030] (-1998.321) (-1991.173) (-1993.814) * (-1985.741) (-1985.435) (-2000.761) [-1987.637] -- 0:03:23
      362900 -- [-1987.469] (-1992.181) (-1995.446) (-1990.949) * (-1982.914) (-1995.036) [-1991.654] (-1994.145) -- 0:03:23
      363000 -- (-1985.257) [-1993.237] (-1997.429) (-1996.128) * [-1981.986] (-1997.529) (-2003.632) (-2003.000) -- 0:03:23

      Average standard deviation of split frequencies: 0.003671

      363100 -- [-1981.647] (-1989.024) (-1999.353) (-1993.868) * [-1985.964] (-1999.898) (-1994.575) (-2000.999) -- 0:03:23
      363200 -- [-1984.971] (-1988.730) (-1986.554) (-1993.536) * (-1984.709) (-1992.697) (-1994.183) [-1986.757] -- 0:03:25
      363300 -- [-1980.799] (-1988.290) (-1984.770) (-1997.696) * [-1984.732] (-1987.386) (-1998.861) (-1989.845) -- 0:03:25
      363400 -- [-1986.011] (-1992.548) (-1989.782) (-2001.098) * [-1985.921] (-1987.805) (-1991.660) (-1989.421) -- 0:03:24
      363500 -- [-1984.565] (-1989.227) (-1985.048) (-2000.121) * (-1989.746) [-1982.546] (-1994.463) (-1992.051) -- 0:03:24
      363600 -- [-1982.817] (-1988.766) (-1985.967) (-2002.851) * (-1994.641) [-1982.729] (-1993.859) (-1992.125) -- 0:03:24
      363700 -- (-1989.147) (-1994.239) [-1982.158] (-1999.865) * (-1998.119) [-1983.429] (-2006.904) (-1989.547) -- 0:03:24
      363800 -- (-1988.533) (-1994.853) [-1981.643] (-1990.771) * (-1986.045) [-1984.366] (-1996.745) (-1994.352) -- 0:03:24
      363900 -- (-1988.827) [-1990.875] (-1984.103) (-1990.677) * (-1992.595) [-1982.758] (-2009.210) (-1991.379) -- 0:03:24
      364000 -- (-2000.733) [-1988.135] (-1983.829) (-1993.912) * (-1995.359) [-1982.329] (-2000.607) (-1994.205) -- 0:03:24

      Average standard deviation of split frequencies: 0.003810

      364100 -- (-1991.289) (-1991.731) [-1983.334] (-1991.949) * (-2009.865) [-1984.425] (-2010.312) (-1992.621) -- 0:03:24
      364200 -- (-1985.846) (-1991.649) [-1987.992] (-1990.130) * (-2002.798) [-1984.237] (-2003.278) (-1990.925) -- 0:03:24
      364300 -- [-1981.156] (-1984.672) (-1987.265) (-1991.636) * (-2000.154) [-1981.772] (-1993.775) (-1985.862) -- 0:03:24
      364400 -- [-1987.218] (-1982.270) (-1985.545) (-1999.200) * [-1990.577] (-1986.725) (-1994.601) (-1990.047) -- 0:03:24
      364500 -- (-1990.386) [-1978.911] (-1992.819) (-2005.616) * [-1989.572] (-1986.959) (-1989.370) (-1990.053) -- 0:03:23
      364600 -- (-1993.001) (-1980.925) [-1985.752] (-1994.229) * (-1984.143) (-1991.684) [-1988.594] (-2005.799) -- 0:03:23
      364700 -- (-1996.838) (-1984.448) [-1983.756] (-1997.007) * [-1983.699] (-1995.593) (-1989.693) (-2008.935) -- 0:03:23
      364800 -- (-1998.769) (-1983.754) [-1985.395] (-2002.927) * [-1986.193] (-1994.858) (-1990.917) (-1999.904) -- 0:03:23
      364900 -- (-1994.812) (-1980.715) [-1988.389] (-1994.296) * [-1987.133] (-1990.831) (-1992.063) (-1995.554) -- 0:03:23
      365000 -- (-2003.230) [-1978.679] (-1984.976) (-1988.457) * (-1985.217) [-1993.722] (-1993.155) (-1997.434) -- 0:03:23

      Average standard deviation of split frequencies: 0.003946

      365100 -- (-1993.675) [-1984.880] (-1986.398) (-1992.532) * [-1992.738] (-1998.776) (-1999.967) (-2003.995) -- 0:03:23
      365200 -- (-2002.498) (-1986.887) (-1983.608) [-1983.314] * (-1992.892) [-1990.335] (-1995.608) (-2011.354) -- 0:03:23
      365300 -- (-1982.851) (-1984.996) [-1984.476] (-1989.464) * [-1992.067] (-1992.108) (-1997.180) (-1987.409) -- 0:03:23
      365400 -- [-1981.915] (-1985.677) (-1993.117) (-1996.138) * (-1984.841) [-1981.562] (-1992.279) (-1997.540) -- 0:03:23
      365500 -- [-1982.181] (-1981.618) (-1987.433) (-2001.276) * [-1987.831] (-1990.023) (-1985.397) (-1993.887) -- 0:03:23
      365600 -- [-1983.144] (-1981.680) (-1991.050) (-1990.183) * (-1986.650) (-1983.754) [-1983.541] (-1999.710) -- 0:03:23
      365700 -- [-1980.117] (-1986.227) (-1986.712) (-1996.870) * [-1987.851] (-1984.610) (-1987.816) (-1996.270) -- 0:03:22
      365800 -- [-1981.111] (-1988.373) (-1988.098) (-1998.248) * [-1985.568] (-1984.330) (-1985.744) (-1990.078) -- 0:03:22
      365900 -- [-1981.424] (-1982.715) (-1995.674) (-1993.053) * (-1996.923) (-1980.614) [-1985.339] (-1986.561) -- 0:03:22
      366000 -- (-1983.080) [-1984.396] (-1988.539) (-1985.202) * (-1992.269) (-1982.959) (-1988.503) [-1983.582] -- 0:03:22

      Average standard deviation of split frequencies: 0.004010

      366100 -- [-1982.481] (-1985.662) (-1985.292) (-1996.445) * [-1986.929] (-1989.778) (-1997.315) (-1985.003) -- 0:03:22
      366200 -- [-1982.314] (-1986.732) (-1984.245) (-1996.456) * (-1981.435) [-1981.910] (-1997.626) (-1986.140) -- 0:03:22
      366300 -- (-1991.607) (-1981.116) [-1982.241] (-1987.116) * (-1991.068) (-1986.032) (-1994.967) [-1985.352] -- 0:03:24
      366400 -- (-1993.912) [-1982.587] (-1989.578) (-1983.994) * (-1991.847) (-1983.150) [-1997.149] (-1990.900) -- 0:03:24
      366500 -- (-1992.077) (-1993.453) (-1991.313) [-1983.711] * [-1991.644] (-1985.445) (-1993.828) (-1995.728) -- 0:03:23
      366600 -- (-1985.828) (-1990.054) [-1983.111] (-1988.813) * (-1988.977) [-1983.430] (-1991.881) (-1993.505) -- 0:03:23
      366700 -- (-1985.587) (-1987.511) [-1979.300] (-1993.678) * (-1986.786) [-1982.328] (-1988.413) (-1994.655) -- 0:03:23
      366800 -- (-1982.403) [-1981.944] (-1980.968) (-1997.784) * (-1985.855) [-1982.697] (-1987.023) (-1988.498) -- 0:03:23
      366900 -- (-1979.933) (-1984.506) [-1981.788] (-1997.384) * (-1983.989) [-1977.452] (-1989.231) (-1983.174) -- 0:03:23
      367000 -- (-1994.882) (-1993.547) [-1988.386] (-2008.600) * (-1991.932) (-1980.666) [-1984.168] (-1989.659) -- 0:03:23

      Average standard deviation of split frequencies: 0.004108

      367100 -- (-1985.877) [-1984.987] (-1989.239) (-2003.660) * (-1991.489) (-1985.742) [-1986.040] (-1998.045) -- 0:03:23
      367200 -- [-1980.800] (-1980.330) (-1983.430) (-2007.769) * (-1991.942) (-1987.316) [-1987.023] (-1992.567) -- 0:03:23
      367300 -- (-1984.231) [-1983.681] (-1984.124) (-2011.106) * (-1987.019) (-1982.663) [-1987.500] (-1985.773) -- 0:03:23
      367400 -- (-1995.340) (-1988.619) [-1978.536] (-2007.380) * (-1987.657) [-1987.503] (-1985.562) (-1998.070) -- 0:03:23
      367500 -- (-1993.965) (-1985.713) [-1979.893] (-1999.152) * (-1988.231) [-1987.959] (-1985.981) (-1988.807) -- 0:03:23
      367600 -- (-1990.804) (-1989.479) [-1988.359] (-1995.944) * [-1991.301] (-1996.307) (-1985.723) (-1996.392) -- 0:03:23
      367700 -- [-1985.487] (-1982.547) (-1983.803) (-2000.790) * (-1989.188) (-2005.602) [-1984.622] (-1995.395) -- 0:03:22
      367800 -- [-1982.527] (-1981.159) (-1980.837) (-2001.117) * [-1992.592] (-1995.099) (-1988.905) (-1993.167) -- 0:03:22
      367900 -- (-1981.197) (-1984.510) [-1981.244] (-2000.147) * [-1995.523] (-1996.224) (-1994.582) (-1987.670) -- 0:03:22
      368000 -- (-1986.340) [-1984.823] (-1983.246) (-2001.370) * (-1990.368) [-1986.348] (-1988.684) (-1994.658) -- 0:03:22

      Average standard deviation of split frequencies: 0.004207

      368100 -- (-1986.175) (-1985.608) [-1982.152] (-2000.075) * [-1986.001] (-1984.650) (-1993.322) (-1997.054) -- 0:03:22
      368200 -- [-1984.670] (-1987.060) (-1995.905) (-2005.132) * (-1984.208) [-1985.190] (-1987.840) (-2005.613) -- 0:03:22
      368300 -- (-1983.360) [-1984.667] (-1988.785) (-1995.813) * [-1984.365] (-1982.980) (-1984.910) (-2002.768) -- 0:03:22
      368400 -- [-1983.800] (-1991.829) (-1992.294) (-1999.027) * [-1983.571] (-1984.394) (-1985.950) (-2004.476) -- 0:03:22
      368500 -- [-1987.087] (-1993.003) (-1985.933) (-1993.290) * (-1979.695) [-1984.525] (-1984.899) (-1997.398) -- 0:03:22
      368600 -- (-1982.456) (-1999.636) [-1982.163] (-1992.843) * (-1982.139) (-1988.936) [-1984.692] (-1997.169) -- 0:03:22
      368700 -- [-1982.257] (-1993.828) (-1989.015) (-1990.285) * [-1980.083] (-1992.646) (-1985.057) (-1992.518) -- 0:03:22
      368800 -- [-1983.550] (-1998.920) (-1989.267) (-1991.402) * (-1989.747) (-1988.338) [-1981.704] (-1986.864) -- 0:03:21
      368900 -- [-1984.050] (-1986.643) (-1983.820) (-1985.393) * (-1992.232) (-1985.439) [-1989.313] (-1988.035) -- 0:03:21
      369000 -- [-1981.236] (-1988.096) (-1989.787) (-1985.252) * (-1993.076) [-1986.392] (-1987.689) (-1990.604) -- 0:03:21

      Average standard deviation of split frequencies: 0.004049

      369100 -- (-1980.905) (-1990.813) (-1998.819) [-1980.156] * (-1994.826) [-1985.985] (-1986.823) (-1993.081) -- 0:03:21
      369200 -- (-1986.077) (-1994.884) (-1999.429) [-1984.921] * (-2001.772) [-1982.855] (-1985.628) (-1993.725) -- 0:03:21
      369300 -- [-1988.570] (-2001.093) (-1994.538) (-1994.647) * (-1998.726) (-1989.521) [-1992.902] (-1994.141) -- 0:03:21
      369400 -- [-1985.348] (-2004.268) (-1990.312) (-1990.153) * (-1994.751) [-1979.862] (-1989.351) (-1996.755) -- 0:03:23
      369500 -- (-1985.618) (-2003.717) [-1983.264] (-1993.852) * (-1993.439) [-1980.830] (-1990.925) (-1998.871) -- 0:03:23
      369600 -- (-1988.357) (-1994.874) [-1991.644] (-1988.168) * (-1990.118) [-1980.874] (-1999.870) (-1999.844) -- 0:03:22
      369700 -- [-1988.422] (-1995.054) (-1989.159) (-1986.722) * (-1994.075) [-1982.106] (-1995.698) (-1997.707) -- 0:03:22
      369800 -- (-1992.906) (-1988.397) [-1994.791] (-1985.300) * (-1997.333) [-1982.943] (-1999.440) (-1994.768) -- 0:03:22
      369900 -- (-1986.931) (-1987.810) (-1994.093) [-1986.828] * (-2001.852) [-1986.129] (-1994.947) (-1992.294) -- 0:03:22
      370000 -- (-1989.402) (-1994.930) (-1991.871) [-1988.417] * (-1994.134) [-1990.544] (-1996.180) (-1995.093) -- 0:03:22

      Average standard deviation of split frequencies: 0.004330

      370100 -- [-1986.219] (-1988.957) (-1993.021) (-1990.700) * (-1997.220) [-1983.942] (-1996.997) (-1998.985) -- 0:03:22
      370200 -- [-1986.541] (-1993.295) (-1994.696) (-1993.585) * (-1990.373) (-1987.370) (-2003.642) [-1993.332] -- 0:03:22
      370300 -- (-1984.076) [-1989.036] (-1994.484) (-2003.825) * (-1997.476) [-1985.874] (-2006.946) (-1997.024) -- 0:03:22
      370400 -- (-1982.028) [-1984.559] (-1996.125) (-2003.886) * (-1985.032) (-1985.564) (-2008.693) [-1989.683] -- 0:03:22
      370500 -- [-1984.783] (-1980.687) (-2000.812) (-2004.149) * (-1988.459) [-1982.781] (-2010.239) (-1990.006) -- 0:03:22
      370600 -- (-1987.438) [-1985.912] (-2001.547) (-2000.796) * [-1989.652] (-1985.016) (-1998.852) (-1991.581) -- 0:03:22
      370700 -- (-1979.703) [-1986.938] (-2002.850) (-1997.082) * [-1991.441] (-1985.255) (-1995.865) (-1996.272) -- 0:03:22
      370800 -- [-1983.284] (-1985.132) (-1989.617) (-1999.633) * (-1997.163) [-1981.688] (-1995.475) (-1995.428) -- 0:03:21
      370900 -- [-1984.977] (-1986.101) (-1996.239) (-2007.076) * (-1993.684) [-1978.705] (-1988.587) (-1994.642) -- 0:03:21
      371000 -- (-1993.239) (-1988.585) (-1994.405) [-1998.733] * (-1987.565) [-1977.718] (-1987.269) (-1993.078) -- 0:03:21

      Average standard deviation of split frequencies: 0.004209

      371100 -- (-2001.848) (-1988.367) (-1996.556) [-1989.590] * [-1982.526] (-1986.616) (-1991.122) (-1993.659) -- 0:03:21
      371200 -- [-1988.350] (-1995.271) (-2010.589) (-1994.571) * [-1982.126] (-1993.451) (-1990.950) (-1992.627) -- 0:03:21
      371300 -- (-1984.894) (-1996.267) (-2005.677) [-1991.902] * [-1981.573] (-1987.101) (-1992.074) (-1995.468) -- 0:03:21
      371400 -- [-1983.462] (-1992.676) (-2004.541) (-2003.837) * [-1984.037] (-1987.854) (-1992.943) (-1999.276) -- 0:03:21
      371500 -- (-1986.915) (-1993.582) [-1986.727] (-2002.674) * [-1983.387] (-1988.036) (-1989.502) (-1995.736) -- 0:03:21
      371600 -- [-1987.474] (-1994.296) (-1995.102) (-1997.324) * (-1987.925) (-1988.895) [-1988.839] (-1994.087) -- 0:03:21
      371700 -- [-1984.497] (-1996.462) (-1997.795) (-1995.606) * (-1992.326) [-1987.236] (-1990.717) (-1996.550) -- 0:03:21
      371800 -- [-1986.701] (-1999.594) (-1998.032) (-1996.692) * (-2002.803) [-1985.806] (-2001.620) (-1992.725) -- 0:03:21
      371900 -- (-1985.259) (-1995.172) (-2000.903) [-1991.464] * (-2000.743) (-1989.984) [-1987.288] (-2004.548) -- 0:03:20
      372000 -- (-1984.896) (-1997.796) (-2002.892) [-1989.517] * (-2018.708) [-1988.789] (-1985.210) (-1999.525) -- 0:03:20

      Average standard deviation of split frequencies: 0.004126

      372100 -- [-1982.783] (-1995.556) (-2003.489) (-1988.543) * (-2008.135) [-1983.315] (-1994.123) (-2003.483) -- 0:03:20
      372200 -- [-1982.250] (-1994.761) (-1994.648) (-1993.592) * (-2005.047) [-1980.114] (-1990.101) (-1996.460) -- 0:03:20
      372300 -- [-1979.695] (-1996.354) (-1997.411) (-1996.493) * (-1991.200) [-1981.296] (-1996.246) (-1993.607) -- 0:03:20
      372400 -- (-1986.310) [-1996.732] (-1997.410) (-1995.481) * [-1983.076] (-1986.634) (-1993.058) (-1996.556) -- 0:03:22
      372500 -- [-1982.517] (-2001.757) (-1996.887) (-1990.702) * (-1987.734) [-1981.494] (-1990.102) (-1993.508) -- 0:03:22
      372600 -- (-1986.720) (-1994.583) [-1990.181] (-1992.617) * (-1984.738) (-1978.239) (-1994.187) [-1986.609] -- 0:03:22
      372700 -- [-1981.303] (-1989.170) (-1991.713) (-1994.800) * (-1988.320) (-1982.723) [-2001.154] (-1987.170) -- 0:03:21
      372800 -- [-1981.014] (-1994.885) (-1993.763) (-1996.615) * [-1986.853] (-1980.062) (-1998.850) (-1991.700) -- 0:03:21
      372900 -- [-1984.545] (-1991.401) (-1993.638) (-1990.996) * (-1987.068) (-1983.271) (-1991.195) [-1993.068] -- 0:03:21
      373000 -- (-1984.000) [-1988.249] (-1993.049) (-1994.856) * (-1986.431) [-1988.266] (-1988.856) (-1989.240) -- 0:03:21

      Average standard deviation of split frequencies: 0.004114

      373100 -- (-1983.536) [-1982.636] (-1998.215) (-1994.697) * (-1984.353) [-1987.462] (-1986.847) (-1991.527) -- 0:03:21
      373200 -- (-1988.750) [-1982.891] (-1994.456) (-1987.097) * (-1988.724) [-1990.560] (-1985.929) (-1988.152) -- 0:03:21
      373300 -- (-1987.874) (-1986.780) (-1992.381) [-1995.863] * (-1984.780) (-1992.755) (-1995.836) [-1986.449] -- 0:03:21
      373400 -- (-1988.113) [-1982.444] (-1988.763) (-1997.128) * (-1986.802) [-1983.324] (-1992.048) (-1990.105) -- 0:03:21
      373500 -- (-1992.172) (-2000.951) [-1994.234] (-1995.211) * [-1980.452] (-1987.484) (-1994.750) (-1986.802) -- 0:03:21
      373600 -- [-1988.055] (-2018.004) (-2002.376) (-1999.019) * (-1983.493) [-1984.732] (-1996.554) (-1994.824) -- 0:03:21
      373700 -- (-1985.475) [-1993.997] (-2002.963) (-1999.250) * (-1987.757) [-1981.942] (-1993.288) (-1998.535) -- 0:03:21
      373800 -- (-1992.948) [-1985.677] (-1997.419) (-2001.492) * (-1991.394) [-1984.345] (-2005.614) (-1992.134) -- 0:03:21
      373900 -- (-1987.735) (-1995.698) [-1986.757] (-1998.103) * (-1986.479) [-1983.696] (-2003.329) (-1991.713) -- 0:03:20
      374000 -- (-1986.830) (-1998.110) [-1985.292] (-1995.149) * (-1986.359) [-1982.929] (-2008.138) (-1983.861) -- 0:03:20

      Average standard deviation of split frequencies: 0.003744

      374100 -- (-1992.904) (-1996.764) [-1990.305] (-1995.353) * (-1988.049) [-1985.363] (-1998.724) (-1983.652) -- 0:03:20
      374200 -- [-1989.673] (-2001.046) (-1985.196) (-2005.563) * (-1990.472) (-1987.703) (-2002.185) [-1983.018] -- 0:03:20
      374300 -- (-1982.331) (-1995.268) [-1985.129] (-2003.181) * (-1986.782) [-1980.833] (-1998.263) (-1987.010) -- 0:03:20
      374400 -- [-1984.166] (-2000.275) (-1990.746) (-2009.576) * (-1988.741) [-1979.462] (-1993.808) (-1994.201) -- 0:03:20
      374500 -- (-1991.343) (-2003.526) [-1989.459] (-1995.442) * (-1991.964) [-1983.124] (-2004.830) (-1997.762) -- 0:03:20
      374600 -- [-1989.788] (-1999.913) (-1992.041) (-1997.686) * (-1989.970) [-1980.754] (-1998.146) (-1990.936) -- 0:03:20
      374700 -- [-1990.592] (-2004.242) (-1994.534) (-2004.145) * [-1995.137] (-1985.781) (-1998.609) (-1995.835) -- 0:03:20
      374800 -- (-1988.058) (-1997.423) [-1995.893] (-1998.495) * (-1997.916) [-1987.071] (-1988.731) (-2001.698) -- 0:03:20
      374900 -- [-1987.377] (-1998.538) (-2007.614) (-1997.843) * (-2002.808) (-1984.636) [-1989.585] (-2001.561) -- 0:03:20
      375000 -- (-1987.948) (-1996.241) (-1996.854) [-1997.930] * (-2002.052) [-1981.039] (-1987.982) (-1995.673) -- 0:03:20

      Average standard deviation of split frequencies: 0.003482

      375100 -- [-1990.049] (-1989.107) (-2001.159) (-1996.300) * (-1996.952) (-1981.955) [-1987.990] (-1991.923) -- 0:03:19
      375200 -- (-1987.531) (-1992.438) (-2002.165) [-1990.327] * (-1990.130) (-1982.457) [-1993.401] (-1998.532) -- 0:03:19
      375300 -- (-1992.589) [-1989.468] (-2001.126) (-1995.584) * (-1987.416) [-1984.087] (-1992.480) (-1993.137) -- 0:03:19
      375400 -- (-1991.885) [-1990.488] (-1996.216) (-1998.197) * (-1997.335) [-1985.393] (-1998.276) (-2000.091) -- 0:03:21
      375500 -- [-1987.072] (-1988.318) (-1989.349) (-1993.959) * (-1996.638) [-1983.094] (-1997.991) (-2000.258) -- 0:03:21
      375600 -- (-1994.046) (-1987.307) (-1997.648) [-1984.049] * (-2007.377) [-1985.970] (-1994.750) (-1992.660) -- 0:03:21
      375700 -- (-1986.306) [-1989.293] (-1994.517) (-1987.832) * (-1991.926) (-1987.732) (-1992.882) [-1991.391] -- 0:03:21
      375800 -- (-1988.960) (-1987.463) [-1993.069] (-1990.704) * (-1994.301) (-1990.257) (-1990.479) [-1991.698] -- 0:03:20
      375900 -- (-1994.248) [-1983.380] (-1990.739) (-1992.385) * (-1990.681) [-1985.713] (-1991.644) (-2007.808) -- 0:03:20
      376000 -- (-1992.870) (-1992.072) (-1988.386) [-1990.279] * (-1989.960) [-1989.186] (-1994.741) (-2001.258) -- 0:03:20

      Average standard deviation of split frequencies: 0.003115

      376100 -- [-1994.999] (-1989.970) (-1998.868) (-1984.892) * (-1989.357) [-1990.105] (-1992.819) (-2000.390) -- 0:03:20
      376200 -- (-1996.485) (-1990.562) (-1985.945) [-1986.005] * [-1987.322] (-1993.650) (-2001.406) (-1996.268) -- 0:03:20
      376300 -- (-2001.330) [-1984.618] (-1989.847) (-1992.454) * [-1988.240] (-1991.091) (-2003.306) (-1999.621) -- 0:03:20
      376400 -- (-1996.507) (-1982.202) [-1988.300] (-1986.251) * [-1984.757] (-1987.438) (-1998.261) (-2000.354) -- 0:03:20
      376500 -- (-1993.197) (-1987.995) (-1986.745) [-1985.696] * [-1988.389] (-1994.056) (-1996.036) (-2003.742) -- 0:03:20
      376600 -- (-2002.417) (-2001.287) (-1993.075) [-1987.643] * [-1986.676] (-1995.566) (-1987.874) (-2005.123) -- 0:03:20
      376700 -- (-1999.381) (-1993.451) [-1989.393] (-1993.016) * [-1986.302] (-1988.349) (-1984.804) (-2003.403) -- 0:03:20
      376800 -- (-1993.236) [-1983.922] (-1989.589) (-1995.750) * (-1985.330) [-1981.358] (-1998.214) (-2002.016) -- 0:03:20
      376900 -- (-1993.990) (-1982.463) [-1987.943] (-1990.666) * (-1988.287) [-1980.697] (-1990.410) (-2003.682) -- 0:03:20
      377000 -- (-1994.440) [-1987.323] (-1987.226) (-1987.153) * (-1990.760) [-1981.994] (-1990.036) (-1990.550) -- 0:03:19

      Average standard deviation of split frequencies: 0.002785

      377100 -- (-2006.133) (-1988.914) (-1989.005) [-1983.908] * (-1993.909) [-1979.802] (-1994.934) (-1987.061) -- 0:03:19
      377200 -- (-1996.618) [-1979.773] (-1987.017) (-1997.934) * (-1989.994) (-1985.095) (-2000.121) [-1981.663] -- 0:03:19
      377300 -- (-1995.943) [-1983.953] (-1986.522) (-1991.765) * (-1994.879) (-1981.908) (-2005.576) [-1987.235] -- 0:03:19
      377400 -- (-1993.407) [-1984.783] (-1989.560) (-1991.333) * (-1998.115) [-1978.143] (-1997.700) (-1991.855) -- 0:03:19
      377500 -- (-1998.583) (-1985.624) (-1984.126) [-1986.083] * (-2001.503) [-1981.138] (-1989.231) (-1989.340) -- 0:03:19
      377600 -- (-1994.966) (-1982.402) [-1990.960] (-1994.172) * (-1993.757) [-1980.509] (-1993.913) (-1988.735) -- 0:03:19
      377700 -- (-1991.327) [-1985.645] (-1989.085) (-1997.791) * (-1985.287) (-1982.896) [-1997.734] (-1989.211) -- 0:03:19
      377800 -- [-1987.836] (-1985.825) (-1990.849) (-1995.043) * (-1984.863) [-1985.159] (-1998.859) (-1986.214) -- 0:03:19
      377900 -- (-1989.131) (-1989.486) (-1992.269) [-2000.160] * (-1986.505) [-1978.321] (-2002.722) (-1993.582) -- 0:03:19
      378000 -- [-1990.803] (-1988.167) (-2004.902) (-1995.130) * (-1989.717) [-1980.474] (-1993.969) (-1998.439) -- 0:03:19

      Average standard deviation of split frequencies: 0.002671

      378100 -- (-1994.709) [-1984.818] (-1998.492) (-1995.587) * (-1992.448) [-1983.316] (-1999.472) (-2008.746) -- 0:03:19
      378200 -- (-1991.425) [-1982.963] (-1999.609) (-1993.445) * (-1994.993) [-1981.812] (-1993.937) (-2010.982) -- 0:03:18
      378300 -- (-1987.851) [-1987.610] (-1990.902) (-2000.978) * (-1991.652) [-1981.988] (-1996.723) (-2001.295) -- 0:03:18
      378400 -- (-1990.690) [-1988.122] (-1995.760) (-2001.891) * (-1985.503) [-1985.464] (-1997.731) (-2002.559) -- 0:03:18
      378500 -- (-1994.344) [-1985.142] (-1997.869) (-2003.966) * (-1988.226) (-1987.937) (-1999.811) [-1994.658] -- 0:03:20
      378600 -- (-1999.631) [-1983.062] (-1992.343) (-2004.191) * (-1992.492) [-1986.127] (-2003.544) (-2001.184) -- 0:03:20
      378700 -- (-2002.907) (-1982.038) [-1988.756] (-2003.980) * (-1987.444) [-1984.323] (-1997.555) (-2002.886) -- 0:03:20
      378800 -- (-1997.663) [-1981.588] (-1995.750) (-2005.775) * (-1987.226) [-1980.498] (-1996.667) (-2005.826) -- 0:03:20
      378900 -- (-1999.920) [-1982.822] (-1994.441) (-2015.596) * (-1990.181) [-1980.429] (-1996.262) (-2009.084) -- 0:03:19
      379000 -- (-2003.623) [-1990.596] (-1988.166) (-2002.830) * (-1990.220) [-1980.416] (-1994.604) (-2004.600) -- 0:03:19

      Average standard deviation of split frequencies: 0.002451

      379100 -- (-1997.101) (-1987.591) [-1990.993] (-1995.829) * [-1984.064] (-1986.414) (-1984.141) (-1992.203) -- 0:03:19
      379200 -- (-1994.317) [-1988.748] (-1990.316) (-1992.572) * [-1984.315] (-1992.843) (-1989.476) (-2004.739) -- 0:03:19
      379300 -- [-1985.878] (-1994.073) (-1987.912) (-1990.193) * (-1994.054) (-1995.889) [-1985.811] (-1997.130) -- 0:03:19
      379400 -- (-1985.073) (-1993.484) [-1989.527] (-1991.327) * (-1992.344) (-1994.277) [-1988.000] (-2002.398) -- 0:03:19
      379500 -- [-1984.351] (-1998.130) (-1987.048) (-2000.027) * (-1994.456) (-2000.019) [-1990.658] (-2004.231) -- 0:03:19
      379600 -- (-1985.370) (-1987.247) [-1987.874] (-1998.955) * (-1993.726) [-1993.196] (-1989.306) (-2001.188) -- 0:03:19
      379700 -- [-1983.645] (-1993.190) (-1987.990) (-1995.842) * [-1988.495] (-1993.782) (-1984.900) (-2000.100) -- 0:03:19
      379800 -- (-1986.004) (-1990.939) [-1986.106] (-1990.830) * (-1999.799) [-1986.973] (-1999.205) (-1993.196) -- 0:03:19
      379900 -- [-1993.213] (-1989.782) (-1989.049) (-2001.670) * (-1998.386) [-1985.642] (-1989.947) (-1992.813) -- 0:03:19
      380000 -- (-1982.738) [-1982.926] (-1987.705) (-1999.396) * (-1997.749) [-1988.716] (-1990.578) (-1993.760) -- 0:03:19

      Average standard deviation of split frequencies: 0.002374

      380100 -- (-1986.764) (-1987.034) [-1987.891] (-1995.985) * (-1992.982) [-1979.608] (-1982.574) (-1999.090) -- 0:03:18
      380200 -- (-1997.320) (-1987.166) (-1992.147) [-1995.370] * (-1986.589) [-1982.510] (-1990.731) (-2012.121) -- 0:03:18
      380300 -- (-1994.315) [-1982.010] (-1990.850) (-1997.842) * (-1988.109) (-1989.316) [-1984.691] (-2001.417) -- 0:03:18
      380400 -- (-1997.679) [-1981.910] (-1988.274) (-1991.579) * (-1985.254) [-1982.538] (-1984.250) (-1999.409) -- 0:03:18
      380500 -- (-1995.017) [-1979.357] (-1985.500) (-2001.682) * (-1985.183) (-1981.503) [-1986.762] (-1992.614) -- 0:03:18
      380600 -- (-2000.816) (-1981.236) (-1998.982) [-1986.216] * [-1992.310] (-1980.065) (-1983.651) (-1999.345) -- 0:03:18
      380700 -- (-1998.529) [-1982.775] (-2002.189) (-1988.822) * [-1985.448] (-1983.328) (-1983.372) (-1998.780) -- 0:03:18
      380800 -- (-2000.210) (-1982.013) (-1997.094) [-1987.201] * (-1989.467) (-1989.193) [-1978.062] (-1995.628) -- 0:03:18
      380900 -- (-1993.187) (-1990.177) [-1991.138] (-1998.199) * (-1987.020) (-1989.078) [-1983.565] (-1989.005) -- 0:03:18
      381000 -- [-1987.344] (-1989.908) (-1993.508) (-1993.269) * (-1998.478) (-1986.071) [-1986.439] (-1990.994) -- 0:03:18

      Average standard deviation of split frequencies: 0.002509

      381100 -- (-1994.610) (-1992.967) (-1999.080) [-1994.252] * (-2000.050) (-1983.132) [-1985.471] (-1997.341) -- 0:03:18
      381200 -- [-1992.696] (-1994.763) (-2001.773) (-1995.422) * [-1990.153] (-1984.357) (-1982.410) (-1993.900) -- 0:03:18
      381300 -- (-1987.516) (-1991.784) (-1999.584) [-1984.975] * (-1990.047) [-1983.111] (-1986.801) (-1999.351) -- 0:03:17
      381400 -- (-1986.180) (-1986.456) (-2007.860) [-1985.870] * (-1986.613) (-1989.828) [-1982.809] (-1989.095) -- 0:03:17
      381500 -- (-1989.888) (-1988.221) (-2000.851) [-1986.579] * (-1987.106) (-1996.725) (-1989.125) [-1989.240] -- 0:03:17
      381600 -- (-1992.147) (-1988.133) (-1997.274) [-1986.878] * (-1991.424) (-2001.226) (-1986.145) [-1990.386] -- 0:03:19
      381700 -- (-1994.538) (-1985.872) (-1999.286) [-1988.903] * (-1988.313) (-2000.899) (-1984.474) [-1991.372] -- 0:03:19
      381800 -- [-1988.770] (-1989.570) (-1996.570) (-1994.039) * (-1993.417) (-2002.014) [-1977.604] (-1988.091) -- 0:03:19
      381900 -- (-1987.878) (-1989.333) [-1988.563] (-1991.874) * (-1995.512) (-2001.640) [-1983.351] (-1991.818) -- 0:03:19
      382000 -- (-1991.721) (-1992.435) [-1989.033] (-1989.496) * (-1998.362) (-1999.189) [-1986.512] (-1993.254) -- 0:03:18

      Average standard deviation of split frequencies: 0.002432

      382100 -- [-1983.188] (-1997.130) (-1989.741) (-1992.208) * (-1986.398) (-2004.815) [-1984.811] (-1997.161) -- 0:03:18
      382200 -- (-1992.087) (-1998.007) [-1985.361] (-1992.687) * [-1988.185] (-2002.254) (-1982.879) (-2000.584) -- 0:03:18
      382300 -- (-1990.483) (-1993.681) [-1990.276] (-1994.848) * [-1988.982] (-1997.855) (-1980.745) (-1992.878) -- 0:03:18
      382400 -- [-1984.445] (-1999.802) (-1995.940) (-1998.558) * (-1986.278) (-1993.457) (-1980.450) [-1985.813] -- 0:03:18
      382500 -- (-1981.843) (-1997.357) (-1990.032) [-1992.518] * (-1994.523) (-1988.384) [-1983.629] (-1985.785) -- 0:03:18
      382600 -- [-1995.054] (-2009.482) (-1997.670) (-1998.013) * (-1990.172) (-1992.023) (-1981.821) [-1982.410] -- 0:03:18
      382700 -- [-1993.450] (-1998.116) (-1991.989) (-1997.218) * (-1994.339) (-1990.855) [-1981.899] (-1982.489) -- 0:03:18
      382800 -- (-1989.839) (-2000.639) [-1990.994] (-1994.068) * (-1986.098) (-1988.862) [-1981.160] (-1980.997) -- 0:03:18
      382900 -- (-1994.315) (-1995.529) [-1989.777] (-1993.309) * (-1991.912) (-1990.381) [-1982.872] (-1979.486) -- 0:03:18
      383000 -- [-1986.453] (-1994.187) (-1988.502) (-1993.044) * (-1993.283) (-1990.955) [-1981.870] (-1987.977) -- 0:03:18

      Average standard deviation of split frequencies: 0.002531

      383100 -- [-1986.642] (-1988.422) (-1989.484) (-1996.370) * (-1994.179) [-1988.710] (-1994.208) (-1980.379) -- 0:03:18
      383200 -- [-1985.826] (-1988.001) (-1991.052) (-2000.323) * (-2003.604) (-1985.642) (-1986.220) [-1976.368] -- 0:03:17
      383300 -- [-1987.041] (-1994.690) (-1992.468) (-2005.018) * (-1995.325) [-1987.682] (-1993.083) (-1981.403) -- 0:03:17
      383400 -- [-1983.133] (-1985.776) (-1991.105) (-2009.129) * (-1989.907) [-1986.257] (-1991.925) (-1984.973) -- 0:03:17
      383500 -- (-1984.523) [-1982.753] (-1990.175) (-1996.263) * (-1996.205) (-1986.349) (-1996.328) [-1983.081] -- 0:03:17
      383600 -- (-1982.320) [-1984.571] (-1990.593) (-1999.120) * (-2000.538) (-1987.517) (-1994.601) [-1987.192] -- 0:03:17
      383700 -- (-1980.469) (-1991.263) [-1992.538] (-2008.650) * (-1992.458) (-1988.349) (-1990.765) [-1983.709] -- 0:03:17
      383800 -- [-1980.824] (-1990.682) (-1984.210) (-1996.330) * (-1991.036) [-1989.107] (-1988.510) (-1987.852) -- 0:03:17
      383900 -- [-1985.640] (-1987.285) (-1985.334) (-1993.147) * (-1999.108) [-1985.255] (-1995.230) (-1986.146) -- 0:03:17
      384000 -- (-1992.692) (-1985.560) [-1989.258] (-1997.781) * (-1997.852) [-1988.344] (-1992.257) (-1983.859) -- 0:03:17

      Average standard deviation of split frequencies: 0.002630

      384100 -- [-1990.385] (-1992.235) (-1994.863) (-1992.570) * (-2000.619) (-1986.747) (-1996.729) [-1978.002] -- 0:03:17
      384200 -- (-1989.540) (-1989.624) (-1996.260) [-1991.218] * (-1997.528) (-1994.179) (-1991.678) [-1979.585] -- 0:03:17
      384300 -- (-1990.215) [-1986.842] (-1996.163) (-1993.522) * (-2003.738) (-1998.827) (-1990.549) [-1980.652] -- 0:03:17
      384400 -- (-1989.699) (-1988.520) (-1986.865) [-1988.924] * (-1993.406) (-1995.884) (-1996.796) [-1983.479] -- 0:03:16
      384500 -- [-1987.944] (-1996.790) (-1988.366) (-1990.013) * (-1996.341) (-1997.448) (-2000.764) [-1983.764] -- 0:03:16
      384600 -- [-1980.460] (-1998.521) (-1986.385) (-1991.628) * (-1996.096) [-1989.969] (-1992.681) (-1981.053) -- 0:03:18
      384700 -- [-1983.840] (-2005.043) (-1990.420) (-1990.144) * (-1993.282) (-1986.725) [-1992.237] (-1985.120) -- 0:03:18
      384800 -- (-1980.387) (-1994.205) [-1994.452] (-1993.997) * (-1993.114) (-1995.991) (-1993.299) [-1986.254] -- 0:03:18
      384900 -- (-1983.985) [-1989.548] (-1996.159) (-1990.295) * (-1990.768) (-1993.241) (-1997.890) [-1982.307] -- 0:03:18
      385000 -- [-1984.571] (-1989.922) (-1991.691) (-1996.747) * (-1987.976) (-1987.223) (-1991.140) [-1977.408] -- 0:03:18

      Average standard deviation of split frequencies: 0.002413

      385100 -- (-1988.604) [-1989.922] (-1996.052) (-2008.562) * (-1992.163) (-1989.867) (-1993.429) [-1978.949] -- 0:03:17
      385200 -- [-1982.157] (-1995.817) (-1992.429) (-1996.539) * (-1996.056) (-1986.665) (-1988.362) [-1979.818] -- 0:03:17
      385300 -- (-1982.116) [-1990.667] (-1993.887) (-1997.067) * (-1996.703) [-1988.506] (-1998.709) (-1985.430) -- 0:03:17
      385400 -- [-1980.279] (-1993.754) (-1986.903) (-1996.180) * (-1993.483) (-1987.210) (-1993.523) [-1991.273] -- 0:03:17
      385500 -- [-1981.114] (-1998.773) (-1984.561) (-1993.279) * [-1984.156] (-1986.590) (-1992.068) (-1988.550) -- 0:03:17
      385600 -- (-1979.808) (-1998.142) (-1988.607) [-1983.544] * [-1986.271] (-1987.855) (-1988.560) (-1986.813) -- 0:03:17
      385700 -- [-1979.243] (-1999.923) (-1990.683) (-1988.286) * (-1984.651) (-1984.689) (-1990.856) [-1985.324] -- 0:03:17
      385800 -- [-1977.259] (-2007.510) (-1983.285) (-1987.531) * (-1987.295) (-1994.155) [-1993.869] (-1989.403) -- 0:03:17
      385900 -- [-1980.330] (-2001.390) (-1986.504) (-1989.326) * (-1992.032) (-1994.719) (-1991.078) [-1988.640] -- 0:03:17
      386000 -- [-1977.372] (-2001.709) (-1992.933) (-1990.717) * (-1992.896) (-1992.978) (-1996.676) [-1988.184] -- 0:03:17

      Average standard deviation of split frequencies: 0.002546

      386100 -- [-1978.575] (-2004.264) (-1988.166) (-1986.666) * (-1993.081) (-1991.962) (-1989.798) [-1985.605] -- 0:03:17
      386200 -- [-1980.443] (-1999.313) (-1994.064) (-1989.464) * (-1993.531) (-1991.788) (-1989.817) [-1982.451] -- 0:03:17
      386300 -- [-1985.847] (-1998.207) (-2003.184) (-1991.200) * (-1992.260) (-1998.040) (-1997.420) [-1986.418] -- 0:03:16
      386400 -- (-1989.683) [-1992.693] (-2010.619) (-1992.875) * (-1993.927) (-1991.877) (-2005.894) [-1981.213] -- 0:03:16
      386500 -- (-1983.636) [-1990.297] (-2001.435) (-1990.752) * (-1992.501) (-1995.487) (-2003.696) [-1980.784] -- 0:03:16
      386600 -- (-1984.540) (-1990.446) (-2004.267) [-1989.379] * (-1985.408) (-1988.872) [-1989.021] (-1985.920) -- 0:03:16
      386700 -- (-1984.543) [-1985.800] (-2002.156) (-1994.264) * [-1985.156] (-1995.637) (-1987.967) (-1992.213) -- 0:03:16
      386800 -- [-1979.579] (-1985.689) (-1996.423) (-1990.697) * [-1989.357] (-1996.280) (-1989.663) (-1992.713) -- 0:03:16
      386900 -- (-1983.199) [-1984.267] (-1997.052) (-1991.569) * (-1984.894) (-1994.291) (-1986.496) [-1981.276] -- 0:03:16
      387000 -- [-1985.021] (-1989.294) (-2000.957) (-1993.465) * [-1987.992] (-1993.856) (-1986.706) (-1985.444) -- 0:03:16

      Average standard deviation of split frequencies: 0.002609

      387100 -- (-1984.261) [-1990.378] (-2007.788) (-1991.455) * [-1985.452] (-1989.927) (-1994.066) (-1984.249) -- 0:03:16
      387200 -- (-1982.857) [-1986.114] (-2001.309) (-1988.471) * (-1991.963) [-1987.564] (-1994.894) (-1988.427) -- 0:03:16
      387300 -- (-1985.346) (-1996.084) (-2007.352) [-1987.334] * (-1994.560) (-1993.060) (-1992.329) [-1991.493] -- 0:03:16
      387400 -- (-1984.497) (-1987.466) (-2004.442) [-1990.923] * (-1996.507) (-1993.842) (-1985.178) [-1984.093] -- 0:03:16
      387500 -- [-1986.727] (-1987.987) (-2001.464) (-1995.331) * (-2002.624) (-1999.604) [-1983.520] (-1982.446) -- 0:03:16
      387600 -- [-1986.329] (-1987.435) (-1990.913) (-1996.763) * (-1993.922) (-1992.194) [-1981.832] (-1985.715) -- 0:03:15
      387700 -- (-1988.370) (-1983.321) [-1987.209] (-1992.733) * (-1997.098) (-1993.857) [-1986.905] (-1987.684) -- 0:03:17
      387800 -- (-1986.255) (-1991.407) [-1987.771] (-1985.962) * (-2001.593) (-1997.984) (-1990.758) [-1988.377] -- 0:03:17
      387900 -- [-1987.212] (-1994.977) (-1987.646) (-1986.019) * (-1992.190) (-1992.768) (-1992.575) [-1983.745] -- 0:03:17
      388000 -- [-1982.262] (-1990.259) (-1987.759) (-1990.467) * [-1986.268] (-1993.993) (-1986.468) (-1981.841) -- 0:03:17

      Average standard deviation of split frequencies: 0.002498

      388100 -- [-1982.312] (-1997.271) (-1990.181) (-1992.983) * [-1985.400] (-1991.906) (-1986.552) (-1984.286) -- 0:03:17
      388200 -- [-1981.748] (-1992.713) (-1995.920) (-1986.034) * [-1987.907] (-1996.432) (-1990.176) (-1984.972) -- 0:03:16
      388300 -- [-1980.728] (-1997.328) (-1994.610) (-1989.670) * (-1989.381) (-1999.389) (-1994.268) [-1984.524] -- 0:03:16
      388400 -- [-1985.178] (-1990.824) (-1996.877) (-1992.199) * (-1989.605) (-1995.768) (-2005.972) [-1984.471] -- 0:03:16
      388500 -- [-1983.000] (-1983.221) (-2000.570) (-1995.697) * (-1989.297) (-1993.854) [-1989.313] (-1984.275) -- 0:03:16
      388600 -- (-1984.742) [-1982.376] (-2011.040) (-1995.144) * [-1988.224] (-2000.368) (-1987.165) (-1987.605) -- 0:03:16
      388700 -- (-1985.051) [-1981.439] (-2003.530) (-1993.019) * (-1991.410) (-1993.729) (-1996.353) [-1980.625] -- 0:03:16
      388800 -- [-1989.250] (-1980.305) (-2008.292) (-1992.512) * (-1988.851) (-1996.932) (-1994.995) [-1982.855] -- 0:03:16
      388900 -- (-1995.636) [-1981.192] (-1991.969) (-1990.220) * (-1987.058) (-1998.059) (-2006.178) [-1982.476] -- 0:03:16
      389000 -- (-1989.772) [-1985.770] (-1988.088) (-1989.938) * (-2002.749) (-2003.237) (-1988.046) [-1982.667] -- 0:03:16

      Average standard deviation of split frequencies: 0.002353

      389100 -- (-1986.531) [-1982.221] (-1992.096) (-1989.395) * (-1999.748) (-1998.394) (-1984.575) [-1986.163] -- 0:03:16
      389200 -- (-1989.708) [-1981.658] (-1991.977) (-1998.743) * (-1998.786) (-2000.693) (-1988.018) [-1983.056] -- 0:03:16
      389300 -- (-1990.865) [-1978.400] (-1986.730) (-2001.909) * (-1996.368) (-1997.207) (-1983.016) [-1981.533] -- 0:03:16
      389400 -- (-1991.833) [-1981.854] (-1984.845) (-2000.323) * (-1991.587) (-1997.578) [-1982.211] (-1982.067) -- 0:03:16
      389500 -- (-1985.686) [-1983.364] (-1990.538) (-1998.373) * (-1993.816) (-1987.493) [-1983.418] (-1985.623) -- 0:03:15
      389600 -- [-1984.225] (-1989.141) (-1987.152) (-1992.184) * (-1987.371) (-1988.219) [-1981.177] (-1993.341) -- 0:03:15
      389700 -- (-1982.200) [-1981.514] (-1991.076) (-1987.692) * (-1992.811) (-1997.410) (-1983.057) [-1980.525] -- 0:03:15
      389800 -- [-1983.287] (-1983.084) (-1995.606) (-1987.832) * (-1993.119) (-1998.117) (-1983.125) [-1985.191] -- 0:03:15
      389900 -- (-1988.140) [-1978.124] (-1999.381) (-1990.576) * (-1988.464) (-1994.477) [-1982.212] (-1987.050) -- 0:03:15
      390000 -- (-1987.131) [-1981.651] (-2005.450) (-1995.216) * (-1991.062) (-1993.735) [-1979.181] (-1985.283) -- 0:03:15

      Average standard deviation of split frequencies: 0.002209

      390100 -- [-1985.044] (-1979.872) (-2003.991) (-1997.011) * (-1990.297) (-1982.967) [-1979.034] (-1983.826) -- 0:03:15
      390200 -- (-1986.446) [-1976.359] (-2001.471) (-1996.784) * (-1989.784) (-1992.597) [-1981.662] (-1986.259) -- 0:03:15
      390300 -- (-1986.607) [-1981.065] (-2005.787) (-1995.394) * (-1991.242) (-1989.372) (-1981.647) [-1980.557] -- 0:03:15
      390400 -- [-1985.952] (-1978.549) (-2009.701) (-1999.970) * (-1990.332) (-1989.653) [-1984.962] (-1983.520) -- 0:03:15
      390500 -- [-1981.493] (-1979.816) (-2003.324) (-1994.224) * (-1996.819) [-1990.463] (-1991.476) (-1996.895) -- 0:03:15
      390600 -- [-1988.345] (-1985.212) (-2011.685) (-2001.795) * (-2004.247) (-1984.055) (-1987.186) [-1988.183] -- 0:03:15
      390700 -- (-1984.547) [-1984.973] (-2000.295) (-1998.378) * (-2000.647) [-1981.904] (-1991.201) (-1992.058) -- 0:03:14
      390800 -- (-1992.026) (-1985.810) [-1997.750] (-2003.337) * (-1999.989) [-1984.568] (-1989.609) (-1989.332) -- 0:03:16
      390900 -- (-1988.445) [-1989.894] (-2005.052) (-1994.596) * (-1996.682) [-1982.325] (-1979.319) (-1984.887) -- 0:03:16
      391000 -- (-1990.155) (-1979.825) (-1993.879) [-1985.238] * (-1993.618) (-1986.015) (-1981.157) [-1988.062] -- 0:03:16

      Average standard deviation of split frequencies: 0.002100

      391100 -- (-1987.114) [-1985.377] (-1995.228) (-1988.460) * (-1997.677) (-1985.822) (-1983.499) [-1984.298] -- 0:03:16
      391200 -- [-1976.158] (-1985.055) (-1997.241) (-1995.857) * (-1984.291) (-1980.050) (-1989.180) [-1982.032] -- 0:03:16
      391300 -- (-1979.631) [-1981.624] (-1994.637) (-1987.199) * (-1988.296) (-1981.807) (-1990.303) [-1984.157] -- 0:03:16
      391400 -- (-1995.523) (-1984.723) (-1994.629) [-1987.436] * (-1992.056) [-1980.484] (-1992.713) (-1983.790) -- 0:03:15
      391500 -- [-1987.688] (-1993.136) (-1995.317) (-1988.838) * (-1989.655) (-1976.492) [-1985.241] (-1989.338) -- 0:03:15
      391600 -- (-1994.268) (-2001.948) (-1996.130) [-1992.352] * (-1991.966) [-1978.262] (-1990.943) (-1988.765) -- 0:03:15
      391700 -- [-1991.007] (-1990.052) (-1992.800) (-1990.306) * (-1999.931) (-1983.017) [-1989.936] (-1992.043) -- 0:03:15
      391800 -- (-1999.116) (-1998.007) (-1990.900) [-1990.832] * (-2001.942) [-1980.954] (-1995.067) (-1987.432) -- 0:03:15
      391900 -- [-1984.610] (-1995.907) (-1991.865) (-1990.642) * (-2005.585) [-1980.175] (-2000.115) (-1991.476) -- 0:03:15
      392000 -- (-1982.964) (-2000.333) [-1987.881] (-1986.689) * (-1989.747) [-1984.931] (-2001.728) (-1986.017) -- 0:03:15

      Average standard deviation of split frequencies: 0.002095

      392100 -- (-1981.934) (-2002.467) (-1988.318) [-1989.574] * (-1994.732) [-1980.098] (-1989.592) (-1993.525) -- 0:03:15
      392200 -- (-1983.584) (-2013.866) (-1995.335) [-1987.673] * (-1999.006) [-1985.894] (-1982.673) (-1997.631) -- 0:03:15
      392300 -- [-1981.240] (-2005.897) (-1991.561) (-1990.869) * (-2000.077) (-1985.013) [-1979.804] (-2006.228) -- 0:03:15
      392400 -- (-1986.916) (-2000.356) (-1992.168) [-1988.956] * (-1993.501) (-1986.751) [-1983.755] (-1992.572) -- 0:03:15
      392500 -- (-1994.847) (-2004.756) [-1994.666] (-1989.911) * (-2003.522) (-1994.694) [-1982.402] (-1997.119) -- 0:03:15
      392600 -- [-1985.244] (-2011.690) (-1992.129) (-1988.648) * (-2007.176) (-1993.437) [-1985.432] (-1999.387) -- 0:03:14
      392700 -- [-1981.376] (-2002.201) (-1998.100) (-1990.840) * (-1997.292) (-1984.448) [-1980.649] (-2007.797) -- 0:03:14
      392800 -- [-1981.033] (-2003.758) (-1996.272) (-1996.100) * (-1995.144) (-1985.023) [-1980.301] (-2001.041) -- 0:03:14
      392900 -- [-1976.551] (-1999.037) (-1992.790) (-1997.514) * (-1987.514) [-1980.300] (-1982.380) (-1995.211) -- 0:03:14
      393000 -- [-1977.685] (-1991.800) (-1991.043) (-1992.070) * (-1985.802) [-1980.630] (-1983.329) (-1997.062) -- 0:03:14

      Average standard deviation of split frequencies: 0.002089

      393100 -- [-1979.533] (-2013.842) (-1987.162) (-1989.923) * (-1987.922) [-1981.941] (-1980.977) (-2000.301) -- 0:03:14
      393200 -- (-1980.869) (-2010.660) [-1985.196] (-1995.133) * (-1992.111) [-1980.159] (-1988.969) (-2001.002) -- 0:03:14
      393300 -- [-1981.242] (-2007.231) (-1984.575) (-1992.436) * (-1993.334) [-1984.354] (-1991.420) (-1994.478) -- 0:03:14
      393400 -- (-1986.505) (-1996.696) [-1987.621] (-1994.554) * (-1992.395) [-1985.677] (-1989.581) (-1987.900) -- 0:03:14
      393500 -- (-1993.113) (-1996.436) [-1987.365] (-1986.918) * (-1995.847) (-1986.617) [-1986.939] (-1987.952) -- 0:03:14
      393600 -- [-1985.135] (-2001.069) (-1989.437) (-1986.891) * (-1994.764) [-1983.509] (-1987.854) (-1989.455) -- 0:03:14
      393700 -- [-1984.013] (-2005.587) (-1991.819) (-1982.433) * (-1995.257) [-1983.843] (-1988.656) (-1990.732) -- 0:03:14
      393800 -- [-1983.925] (-2003.181) (-1993.600) (-1990.247) * (-1995.981) [-1987.959] (-1992.621) (-1993.417) -- 0:03:13
      393900 -- (-1986.615) (-1998.379) (-1998.750) [-1984.803] * (-1993.476) [-1982.444] (-1989.747) (-1990.921) -- 0:03:15
      394000 -- [-1983.051] (-2008.813) (-2000.364) (-1989.996) * (-1994.916) [-1983.516] (-1986.586) (-1996.185) -- 0:03:15

      Average standard deviation of split frequencies: 0.001880

      394100 -- [-1982.360] (-2005.458) (-1997.686) (-2001.073) * [-1989.955] (-1987.089) (-1984.829) (-1993.035) -- 0:03:15
      394200 -- [-1980.405] (-2012.326) (-1992.042) (-2002.275) * [-1991.105] (-1987.733) (-1986.323) (-1994.274) -- 0:03:15
      394300 -- [-1985.550] (-2009.244) (-1991.127) (-1993.111) * (-1989.286) [-1980.254] (-1994.010) (-1999.278) -- 0:03:15
      394400 -- (-1980.565) (-2005.016) (-1984.225) [-1986.538] * (-1984.429) [-1979.493] (-1984.804) (-2002.290) -- 0:03:15
      394500 -- (-1983.455) (-2008.443) [-1982.977] (-1986.630) * (-1992.604) (-1982.014) [-1980.911] (-2000.339) -- 0:03:14
      394600 -- [-1985.116] (-2002.141) (-1986.041) (-1986.680) * (-1985.809) (-1987.527) [-1982.716] (-1999.266) -- 0:03:14
      394700 -- (-1995.711) (-2001.143) [-1987.615] (-1992.233) * (-1992.940) (-1988.270) [-1980.156] (-1996.175) -- 0:03:14
      394800 -- [-1983.499] (-1993.605) (-1989.099) (-1990.135) * (-1994.268) (-1984.406) [-1978.890] (-1995.848) -- 0:03:14
      394900 -- (-1990.673) [-1991.285] (-1988.619) (-1992.679) * (-1993.647) (-1982.468) [-1981.262] (-1998.474) -- 0:03:14
      395000 -- (-1983.371) (-1990.098) (-1989.971) [-1988.657] * (-1996.369) [-1985.499] (-1980.950) (-2005.766) -- 0:03:14

      Average standard deviation of split frequencies: 0.001806

      395100 -- [-1981.219] (-1995.851) (-1991.313) (-1996.281) * (-1992.439) (-1988.720) [-1978.570] (-2000.391) -- 0:03:14
      395200 -- [-1980.993] (-1993.218) (-1990.881) (-1987.040) * (-1991.959) (-1991.029) [-1977.799] (-1996.894) -- 0:03:14
      395300 -- [-1981.139] (-1991.249) (-1996.693) (-1992.248) * (-1996.893) (-1985.127) (-1985.863) [-1988.723] -- 0:03:14
      395400 -- (-1982.798) (-1994.165) [-1993.266] (-1990.746) * (-1994.498) (-1994.210) [-1987.186] (-1992.578) -- 0:03:14
      395500 -- [-1990.037] (-1996.923) (-1992.177) (-1991.814) * (-1994.772) (-1995.123) [-1985.729] (-1994.287) -- 0:03:14
      395600 -- [-1988.183] (-1993.556) (-2004.850) (-1993.425) * (-2000.921) (-1996.419) (-1991.981) [-1992.915] -- 0:03:14
      395700 -- (-1987.237) [-1990.426] (-2003.423) (-1999.140) * (-2002.719) (-1995.546) [-1990.225] (-1990.950) -- 0:03:13
      395800 -- [-1986.198] (-1997.420) (-1998.405) (-1988.443) * (-1998.109) (-1995.080) (-1991.348) [-1988.645] -- 0:03:13
      395900 -- (-1992.346) (-1992.225) [-1994.644] (-1986.765) * (-1993.275) [-1992.082] (-2001.717) (-1986.609) -- 0:03:13
      396000 -- [-1986.233] (-1993.122) (-1996.359) (-1990.981) * [-1986.892] (-1988.642) (-2001.968) (-1988.542) -- 0:03:13

      Average standard deviation of split frequencies: 0.001700

      396100 -- [-1984.697] (-1995.911) (-1999.849) (-1989.296) * (-1994.009) (-1992.222) (-2000.059) [-1991.618] -- 0:03:13
      396200 -- [-1984.630] (-1990.953) (-1996.049) (-1984.732) * [-1992.919] (-1995.940) (-2000.024) (-1998.699) -- 0:03:13
      396300 -- (-1985.385) (-1995.192) (-1998.970) [-1987.624] * (-1990.735) [-1990.104] (-1996.278) (-1992.556) -- 0:03:13
      396400 -- (-2000.632) [-1991.269] (-1991.683) (-1987.992) * (-1980.573) [-1983.363] (-1995.140) (-1988.237) -- 0:03:13
      396500 -- (-1998.271) (-1996.539) [-1991.783] (-1987.508) * (-1983.657) [-1992.057] (-1995.256) (-1992.227) -- 0:03:13
      396600 -- [-1994.493] (-1991.824) (-1991.130) (-1989.846) * (-1979.444) [-1986.313] (-1998.540) (-2005.932) -- 0:03:13
      396700 -- (-1997.854) [-1989.836] (-1990.910) (-1993.076) * [-1984.211] (-1984.490) (-1992.018) (-2004.123) -- 0:03:13
      396800 -- (-1998.640) (-1984.852) (-2003.872) [-1987.185] * [-1984.348] (-1982.524) (-2000.402) (-2008.368) -- 0:03:13
      396900 -- (-1988.230) [-1989.154] (-1992.212) (-1989.184) * (-1985.820) [-1981.275] (-2000.459) (-1997.438) -- 0:03:12
      397000 -- (-1991.165) [-1990.375] (-2002.160) (-1990.629) * (-1982.811) [-1984.108] (-1999.680) (-2011.318) -- 0:03:14

      Average standard deviation of split frequencies: 0.001628

      397100 -- [-1990.639] (-1998.216) (-1990.131) (-1989.755) * (-1990.366) [-1982.401] (-2000.584) (-2010.589) -- 0:03:14
      397200 -- [-1984.860] (-1999.903) (-1989.326) (-1987.328) * (-1989.690) [-1988.834] (-2002.544) (-2003.542) -- 0:03:14
      397300 -- [-1984.518] (-1996.026) (-1988.668) (-1985.459) * (-1981.869) [-1980.819] (-1998.454) (-1997.624) -- 0:03:14
      397400 -- [-1983.372] (-1999.096) (-1989.102) (-1987.711) * (-1984.278) [-1978.532] (-1995.512) (-2000.285) -- 0:03:14
      397500 -- [-1985.440] (-2009.929) (-1989.031) (-1993.371) * [-1981.053] (-1977.757) (-1997.796) (-1994.054) -- 0:03:14
      397600 -- (-1983.860) (-2004.896) (-1989.518) [-1990.039] * (-1986.301) [-1977.444] (-1990.953) (-1992.907) -- 0:03:13
      397700 -- [-1981.044] (-1997.687) (-1998.925) (-1993.232) * (-1987.969) [-1979.853] (-1992.271) (-1998.426) -- 0:03:13
      397800 -- [-1981.716] (-2000.307) (-1993.978) (-1997.659) * (-1987.928) [-1975.969] (-1991.224) (-2004.480) -- 0:03:13
      397900 -- [-1982.327] (-2010.524) (-1992.209) (-1994.575) * [-1996.372] (-1976.045) (-1986.675) (-1998.986) -- 0:03:13
      398000 -- [-1985.852] (-2001.970) (-1995.733) (-1997.610) * (-1991.381) [-1983.350] (-1985.831) (-1988.444) -- 0:03:13

      Average standard deviation of split frequencies: 0.001658

      398100 -- [-1985.492] (-2001.948) (-1989.850) (-2001.442) * (-1990.445) (-1988.880) (-1987.318) [-1986.475] -- 0:03:13
      398200 -- [-1981.675] (-2005.616) (-1993.471) (-2005.148) * (-1995.693) [-1979.813] (-1979.875) (-1993.693) -- 0:03:13
      398300 -- [-1983.112] (-2000.181) (-1994.774) (-2005.397) * (-1995.904) [-1979.518] (-1984.575) (-2000.425) -- 0:03:13
      398400 -- [-1981.768] (-2000.758) (-1991.822) (-1995.516) * (-1990.890) [-1982.493] (-1988.073) (-1987.418) -- 0:03:13
      398500 -- [-1982.492] (-1998.633) (-1989.723) (-1995.959) * (-1990.798) (-1987.036) [-1985.240] (-1989.762) -- 0:03:13
      398600 -- (-1986.382) (-1998.106) [-1991.497] (-1995.837) * (-1988.379) [-1986.967] (-1985.398) (-1988.462) -- 0:03:13
      398700 -- (-1981.195) (-1989.183) [-1990.020] (-1994.710) * (-1990.287) [-1985.947] (-1990.713) (-1988.900) -- 0:03:13
      398800 -- [-1977.075] (-1993.655) (-1988.717) (-1992.146) * (-1991.682) (-1989.610) [-1983.153] (-1993.378) -- 0:03:12
      398900 -- [-1978.763] (-1987.218) (-1990.493) (-1996.344) * [-1998.529] (-1987.288) (-1987.279) (-1994.128) -- 0:03:12
      399000 -- [-1977.058] (-1991.968) (-1991.632) (-1998.402) * (-1995.129) (-1995.858) [-1985.920] (-1986.604) -- 0:03:12

      Average standard deviation of split frequencies: 0.001788

      399100 -- [-1982.725] (-1987.956) (-1993.912) (-1991.132) * (-1986.231) (-1989.308) [-1987.305] (-1987.592) -- 0:03:12
      399200 -- [-1982.282] (-1985.359) (-1990.362) (-1994.519) * (-1983.372) (-1985.195) [-1978.454] (-2000.855) -- 0:03:12
      399300 -- (-1985.245) [-1984.349] (-1989.201) (-2000.834) * (-1993.291) [-1982.906] (-1983.156) (-1998.198) -- 0:03:12
      399400 -- (-1998.632) [-1983.894] (-1994.826) (-1996.542) * (-2005.983) [-1978.808] (-1983.993) (-1997.969) -- 0:03:12
      399500 -- [-1988.278] (-1988.074) (-1987.178) (-2006.056) * (-1994.862) [-1979.440] (-1984.492) (-1993.243) -- 0:03:12
      399600 -- (-1986.923) (-1988.468) (-1987.497) [-1995.061] * (-1999.178) (-1978.508) [-1986.316] (-1995.467) -- 0:03:12
      399700 -- [-1986.213] (-1988.795) (-1994.817) (-1997.767) * (-2003.768) [-1977.023] (-1993.546) (-1997.381) -- 0:03:12
      399800 -- [-1980.024] (-1995.472) (-1999.115) (-1996.011) * (-1999.361) [-1977.403] (-1983.577) (-1992.217) -- 0:03:12
      399900 -- [-1983.424] (-1991.775) (-1997.548) (-1993.315) * (-2011.042) (-1982.826) [-1983.522] (-1994.618) -- 0:03:12
      400000 -- [-1981.734] (-1993.576) (-1995.135) (-2000.647) * (-2005.141) (-1986.727) [-1990.265] (-1992.555) -- 0:03:12

      Average standard deviation of split frequencies: 0.001717

      400100 -- (-1988.759) [-1990.672] (-2001.568) (-1999.065) * (-1994.077) (-1986.310) (-1992.220) [-1991.097] -- 0:03:13
      400200 -- (-1993.832) [-1990.433] (-1995.929) (-1994.513) * (-1999.422) (-1986.334) [-1986.265] (-1990.485) -- 0:03:13
      400300 -- (-1992.411) (-1987.850) [-1992.788] (-1994.369) * (-1991.582) (-1982.989) [-1980.136] (-1993.610) -- 0:03:13
      400400 -- (-1995.856) [-1988.567] (-1992.954) (-1995.023) * (-1996.610) [-1983.471] (-1990.598) (-1989.106) -- 0:03:13
      400500 -- [-1990.159] (-1992.006) (-1990.205) (-1993.004) * (-1990.098) (-1986.517) (-1982.844) [-1988.880] -- 0:03:13
      400600 -- [-1994.971] (-1993.231) (-2001.472) (-1992.341) * (-1999.925) (-1989.213) (-1987.766) [-1983.830] -- 0:03:13
      400700 -- (-1996.687) (-1986.532) (-2000.053) [-1989.854] * (-2000.866) (-1990.500) [-1985.863] (-1985.203) -- 0:03:12
      400800 -- (-2002.383) [-1986.797] (-1997.588) (-1987.232) * (-1995.540) (-1993.142) [-1983.782] (-1987.044) -- 0:03:12
      400900 -- (-2005.941) (-1987.222) [-1987.421] (-1987.205) * [-1985.543] (-1996.365) (-1986.751) (-1987.802) -- 0:03:12
      401000 -- (-2001.379) [-1988.500] (-1998.431) (-1987.338) * [-1982.178] (-1989.916) (-1990.035) (-1987.584) -- 0:03:12

      Average standard deviation of split frequencies: 0.001880

      401100 -- (-2003.320) (-1991.977) (-1997.161) [-1986.193] * [-1980.892] (-1985.401) (-1983.499) (-1989.440) -- 0:03:12
      401200 -- (-1999.133) (-1988.693) (-1999.425) [-1984.341] * [-1979.195] (-1988.332) (-1989.629) (-1989.362) -- 0:03:12
      401300 -- (-1990.146) (-1996.028) [-1990.132] (-1996.073) * [-1985.406] (-1989.190) (-1997.788) (-1998.023) -- 0:03:12
      401400 -- [-1985.706] (-1987.811) (-1985.306) (-1993.285) * (-1983.008) [-1986.505] (-1991.941) (-1995.915) -- 0:03:12
      401500 -- [-1985.820] (-1989.866) (-1992.432) (-1989.110) * [-1986.359] (-1983.535) (-1986.397) (-1995.291) -- 0:03:12
      401600 -- [-1984.529] (-1988.554) (-1991.836) (-1991.217) * [-1984.265] (-1988.035) (-1986.945) (-2013.323) -- 0:03:12
      401700 -- (-1982.586) [-1990.906] (-2005.909) (-1988.788) * (-1990.565) (-1989.213) [-1993.372] (-2000.822) -- 0:03:12
      401800 -- [-1982.515] (-1995.038) (-2013.723) (-1990.157) * [-1990.791] (-1984.307) (-1993.989) (-1998.104) -- 0:03:12
      401900 -- [-1987.660] (-1991.586) (-1995.170) (-1990.160) * (-1989.392) [-1991.261] (-1994.680) (-2001.659) -- 0:03:11
      402000 -- (-1989.195) (-1996.292) [-1991.687] (-1987.701) * (-1986.451) (-1986.119) (-1999.218) [-1991.822] -- 0:03:11

      Average standard deviation of split frequencies: 0.001708

      402100 -- (-1990.478) (-1997.562) [-1992.999] (-1995.045) * (-1991.430) (-1991.854) (-1991.792) [-1986.056] -- 0:03:11
      402200 -- (-1994.323) (-2005.115) (-1994.514) [-1991.163] * (-1993.989) [-1983.803] (-1996.861) (-1985.934) -- 0:03:11
      402300 -- (-1990.375) (-2006.676) (-1997.776) [-1989.487] * (-2002.221) (-1988.078) (-1992.537) [-1988.193] -- 0:03:11
      402400 -- (-1992.356) (-1998.377) [-1994.874] (-1992.465) * (-2004.490) (-1991.155) [-1986.859] (-1995.121) -- 0:03:11
      402500 -- (-1996.894) (-1998.731) [-1989.964] (-1989.787) * (-1999.371) [-1986.087] (-1988.331) (-1990.125) -- 0:03:11
      402600 -- [-1993.375] (-1994.313) (-1989.961) (-1990.440) * (-1991.463) [-1979.562] (-1988.393) (-1998.904) -- 0:03:11
      402700 -- (-1998.603) (-1999.570) (-1991.457) [-1986.945] * (-1991.426) (-1982.781) [-1987.138] (-1991.398) -- 0:03:11
      402800 -- (-1998.417) (-1988.794) (-1997.426) [-1986.247] * (-1989.183) (-1982.272) (-1989.830) [-1984.344] -- 0:03:11
      402900 -- (-1998.901) (-1992.729) (-1994.582) [-1994.421] * [-1987.566] (-1981.085) (-1991.982) (-1989.176) -- 0:03:11
      403000 -- (-1991.032) (-1989.581) (-1995.860) [-1991.988] * (-1989.311) [-1978.169] (-1997.843) (-1988.113) -- 0:03:11

      Average standard deviation of split frequencies: 0.001637

      403100 -- (-1994.400) (-2001.494) (-1993.811) [-1989.789] * (-1990.291) [-1977.846] (-1992.806) (-1992.473) -- 0:03:12
      403200 -- (-1994.719) (-1999.536) (-1998.121) [-1992.697] * (-1989.017) [-1977.207] (-1987.560) (-1994.994) -- 0:03:12
      403300 -- (-1987.585) [-1992.797] (-1993.490) (-1993.653) * [-1988.287] (-1981.545) (-1995.214) (-1998.252) -- 0:03:12
      403400 -- (-1988.805) [-1992.418] (-1999.152) (-1998.323) * (-1986.616) [-1979.540] (-1990.608) (-1993.218) -- 0:03:12
      403500 -- (-1987.033) (-2007.414) (-2000.051) [-1997.259] * (-1986.018) [-1983.643] (-1994.344) (-1992.623) -- 0:03:12
      403600 -- (-1991.013) (-1988.842) (-2000.955) [-1993.679] * [-1982.047] (-1981.077) (-2000.546) (-1997.601) -- 0:03:12
      403700 -- (-1983.500) (-1994.960) [-1991.582] (-1990.917) * [-1982.441] (-1981.221) (-1996.280) (-1992.239) -- 0:03:12
      403800 -- [-1983.383] (-1997.359) (-1996.644) (-1996.331) * [-1983.773] (-1983.155) (-1996.709) (-1992.413) -- 0:03:11
      403900 -- (-1988.106) (-2008.510) [-1997.533] (-1993.836) * (-1985.728) (-1985.302) [-1983.729] (-1990.523) -- 0:03:11
      404000 -- [-1989.354] (-2001.464) (-1997.188) (-1992.107) * (-1993.416) [-1982.060] (-1989.439) (-1985.946) -- 0:03:11

      Average standard deviation of split frequencies: 0.001800

      404100 -- (-1983.096) (-1999.276) [-1992.094] (-1987.859) * (-1999.803) (-1980.195) [-1987.339] (-1992.165) -- 0:03:11
      404200 -- [-1980.942] (-1987.618) (-1991.129) (-1993.038) * (-1996.308) [-1983.162] (-1991.493) (-1999.223) -- 0:03:11
      404300 -- (-1975.526) [-1987.316] (-1994.593) (-1999.011) * (-1991.602) [-1984.003] (-1989.427) (-1995.197) -- 0:03:11
      404400 -- [-1975.535] (-1984.852) (-1992.503) (-1998.008) * (-1999.161) [-1978.603] (-1990.550) (-1997.023) -- 0:03:11
      404500 -- [-1978.024] (-1993.354) (-1994.219) (-1989.728) * (-1992.689) (-1979.250) [-1991.062] (-1999.392) -- 0:03:11
      404600 -- [-1982.871] (-1996.942) (-1999.793) (-1989.370) * (-1987.041) [-1981.028] (-1992.214) (-2001.266) -- 0:03:11
      404700 -- (-1982.570) [-1986.206] (-2004.949) (-1987.916) * (-1989.599) (-1979.158) (-1996.077) [-1990.817] -- 0:03:11
      404800 -- (-1982.477) (-1997.324) (-2001.032) [-1989.307] * (-1993.402) [-1982.289] (-1996.388) (-1988.771) -- 0:03:11
      404900 -- [-1975.835] (-1993.585) (-1996.308) (-1987.852) * (-1992.104) [-1980.254] (-1984.477) (-1992.946) -- 0:03:11
      405000 -- [-1976.920] (-2000.372) (-1996.811) (-1987.668) * (-1990.831) [-1986.090] (-1989.280) (-1987.324) -- 0:03:10

      Average standard deviation of split frequencies: 0.001728

      405100 -- [-1981.073] (-2002.751) (-2007.022) (-1993.516) * (-1990.104) [-1985.497] (-1986.342) (-1986.337) -- 0:03:10
      405200 -- [-1982.218] (-1998.146) (-2013.272) (-1995.699) * (-1992.319) (-1989.856) [-1986.938] (-2000.761) -- 0:03:10
      405300 -- [-1982.421] (-1993.200) (-2004.633) (-1994.081) * (-1991.008) (-1985.447) [-1987.696] (-2003.826) -- 0:03:10
      405400 -- [-1978.717] (-1999.252) (-2007.078) (-1991.937) * (-1991.366) [-1981.369] (-1982.197) (-1997.883) -- 0:03:10
      405500 -- [-1980.625] (-1992.742) (-1993.664) (-2001.982) * [-1990.428] (-1990.470) (-1979.914) (-2000.518) -- 0:03:10
      405600 -- [-1978.826] (-1987.776) (-1991.220) (-1992.833) * (-1988.929) [-1987.270] (-1980.411) (-1999.836) -- 0:03:10
      405700 -- [-1981.453] (-1986.618) (-1988.109) (-2001.830) * (-1983.572) [-1985.602] (-1987.282) (-2007.022) -- 0:03:10
      405800 -- [-1976.323] (-1988.298) (-1984.103) (-2002.671) * [-1985.347] (-1985.123) (-1988.622) (-2002.132) -- 0:03:10
      405900 -- [-1978.446] (-1995.972) (-1989.448) (-2002.365) * [-1986.596] (-1982.931) (-1990.367) (-1994.649) -- 0:03:10
      406000 -- [-1990.550] (-1994.779) (-1987.734) (-2001.150) * (-1990.476) (-1984.306) [-1986.091] (-1994.765) -- 0:03:11

      Average standard deviation of split frequencies: 0.001592

      406100 -- (-1985.584) (-1990.210) [-1988.343] (-1993.838) * (-1987.339) (-1993.430) [-1983.045] (-2000.728) -- 0:03:11
      406200 -- [-1981.497] (-1998.948) (-1992.421) (-1991.362) * (-1993.372) (-1988.958) [-1980.968] (-2003.119) -- 0:03:11
      406300 -- [-1978.072] (-1988.014) (-1988.806) (-1993.324) * (-1998.059) (-1990.469) [-1981.288] (-1997.829) -- 0:03:11
      406400 -- (-1983.533) (-1985.841) [-1985.582] (-1992.775) * (-1994.776) [-1983.728] (-1986.789) (-1992.326) -- 0:03:11
      406500 -- (-1982.728) (-1991.654) [-1986.657] (-1994.342) * (-1990.298) [-1983.166] (-1986.486) (-2006.095) -- 0:03:11
      406600 -- [-1987.989] (-1996.947) (-1992.146) (-2000.671) * [-1988.594] (-1991.101) (-1986.422) (-1987.311) -- 0:03:11
      406700 -- (-1985.653) (-1995.757) (-1989.686) [-1992.600] * [-1989.054] (-1986.692) (-1991.616) (-1989.125) -- 0:03:11
      406800 -- (-1981.634) (-1990.968) [-1984.581] (-1993.940) * [-1984.938] (-1981.345) (-1997.983) (-1992.020) -- 0:03:11
      406900 -- [-1983.626] (-1988.778) (-1993.401) (-1987.916) * (-1984.822) [-1985.704] (-2008.369) (-2005.980) -- 0:03:10
      407000 -- (-1985.258) [-1986.570] (-1994.773) (-1998.579) * [-1985.204] (-1989.534) (-2002.075) (-2003.847) -- 0:03:10

      Average standard deviation of split frequencies: 0.001588

      407100 -- (-1980.843) (-1985.609) (-1987.089) [-1988.759] * (-1979.637) [-1982.469] (-2010.302) (-1996.707) -- 0:03:10
      407200 -- [-1982.183] (-1984.872) (-1989.210) (-1989.841) * (-1980.365) (-1993.341) (-1999.288) [-1993.598] -- 0:03:10
      407300 -- [-1981.851] (-1987.456) (-1990.670) (-1991.877) * (-1983.958) (-1991.597) (-2005.271) [-1991.777] -- 0:03:10
      407400 -- (-1981.383) [-1984.672] (-1988.767) (-1999.444) * [-1988.998] (-1995.210) (-2000.590) (-1985.496) -- 0:03:10
      407500 -- [-1981.116] (-1993.459) (-1996.296) (-1988.179) * [-1989.842] (-1989.613) (-2001.666) (-1991.340) -- 0:03:10
      407600 -- [-1978.847] (-1991.646) (-1997.014) (-1989.675) * (-1993.136) [-1985.855] (-1993.622) (-1990.133) -- 0:03:10
      407700 -- [-1980.556] (-1983.924) (-1997.750) (-1997.006) * (-1998.204) [-1979.684] (-1995.091) (-1990.275) -- 0:03:10
      407800 -- (-1985.411) [-1983.768] (-2003.806) (-1992.669) * (-1998.842) [-1983.950] (-1995.617) (-1990.582) -- 0:03:10
      407900 -- (-1983.013) (-1986.815) (-2001.540) [-1984.229] * (-2005.064) [-1986.844] (-1985.567) (-1999.498) -- 0:03:10
      408000 -- [-1979.495] (-1985.399) (-2002.807) (-1991.772) * (-2004.188) [-1988.635] (-1985.806) (-1996.549) -- 0:03:10

      Average standard deviation of split frequencies: 0.001848

      408100 -- [-1982.422] (-1988.261) (-2006.356) (-1996.511) * (-2005.858) (-1989.045) [-1984.350] (-1993.432) -- 0:03:09
      408200 -- [-1982.748] (-1994.084) (-2002.505) (-1997.858) * (-1993.262) [-1986.298] (-1983.558) (-1997.624) -- 0:03:09
      408300 -- [-1983.027] (-1994.702) (-1995.090) (-1997.892) * (-1991.761) (-1986.886) [-1987.024] (-1993.902) -- 0:03:09
      408400 -- [-1984.737] (-1991.446) (-2000.565) (-1993.805) * (-1996.039) [-1982.596] (-1991.867) (-1994.615) -- 0:03:09
      408500 -- (-1986.389) [-1985.672] (-2003.279) (-2005.891) * (-1996.156) [-1978.262] (-1993.283) (-1993.282) -- 0:03:09
      408600 -- [-1981.573] (-1987.860) (-1997.363) (-2009.886) * (-1998.672) [-1979.686] (-1997.685) (-1993.561) -- 0:03:09
      408700 -- [-1980.610] (-1991.800) (-1993.241) (-2002.879) * (-1994.400) [-1985.320] (-2001.130) (-1995.993) -- 0:03:09
      408800 -- [-1988.643] (-1997.405) (-1994.961) (-1995.442) * [-1991.798] (-1987.060) (-1994.930) (-1992.665) -- 0:03:09
      408900 -- [-1983.316] (-1991.003) (-1997.184) (-2002.896) * (-1993.881) [-1987.014] (-1999.349) (-1991.623) -- 0:03:09
      409000 -- [-1981.900] (-1984.890) (-1993.616) (-2000.094) * [-1986.346] (-1991.274) (-1999.162) (-1994.272) -- 0:03:10

      Average standard deviation of split frequencies: 0.001744

      409100 -- (-1979.914) (-1987.396) (-1994.100) [-1992.891] * (-1987.634) [-1986.637] (-1999.572) (-1991.706) -- 0:03:10
      409200 -- [-1980.445] (-1988.403) (-1996.876) (-1998.923) * [-1988.093] (-1994.823) (-1994.043) (-2000.369) -- 0:03:10
      409300 -- (-1980.326) [-1983.360] (-2002.545) (-1998.772) * [-1991.081] (-1994.086) (-2002.538) (-2002.871) -- 0:03:10
      409400 -- [-1982.736] (-1984.091) (-1993.508) (-1997.482) * (-2006.866) (-1983.988) [-1988.128] (-2007.916) -- 0:03:10
      409500 -- (-1989.196) [-1981.487] (-2000.889) (-1991.214) * (-2012.287) (-1985.532) [-1986.843] (-2017.899) -- 0:03:10
      409600 -- (-1998.337) [-1982.477] (-1998.043) (-1996.251) * (-2001.588) [-1983.070] (-1991.664) (-2008.421) -- 0:03:10
      409700 -- (-1996.798) [-1979.576] (-1989.402) (-2007.163) * (-1999.058) [-1981.390] (-1990.415) (-2009.086) -- 0:03:10
      409800 -- (-1997.880) [-1977.934] (-1994.186) (-1995.043) * (-2004.229) [-1976.224] (-1993.743) (-2013.445) -- 0:03:10
      409900 -- (-2000.013) [-1980.891] (-1999.591) (-1989.341) * (-1998.707) (-1978.005) [-1989.156] (-2004.709) -- 0:03:10
      410000 -- (-1996.044) [-1980.542] (-1994.478) (-1988.788) * (-2002.483) (-1984.959) (-1992.566) [-1993.415] -- 0:03:09

      Average standard deviation of split frequencies: 0.001708

      410100 -- (-1998.435) [-1980.827] (-1991.915) (-1989.345) * (-1995.156) [-1984.076] (-1990.919) (-1997.207) -- 0:03:09
      410200 -- (-1994.522) [-1983.212] (-2005.892) (-1991.911) * (-1996.247) [-1980.272] (-1986.363) (-1996.000) -- 0:03:09
      410300 -- (-2003.247) [-1985.353] (-2016.390) (-1996.641) * (-1992.275) [-1984.314] (-1996.097) (-1999.119) -- 0:03:09
      410400 -- (-1996.935) [-1988.535] (-2002.625) (-2004.617) * [-1986.522] (-1993.768) (-1994.008) (-1997.703) -- 0:03:09
      410500 -- (-1989.843) [-1984.355] (-2007.025) (-2002.859) * (-1984.131) [-1981.773] (-1987.879) (-1995.721) -- 0:03:09
      410600 -- (-1987.788) [-1990.280] (-2003.272) (-1999.158) * (-1984.936) [-1988.385] (-1986.340) (-1992.529) -- 0:03:09
      410700 -- [-1984.785] (-1990.795) (-1994.045) (-1994.973) * (-1982.752) (-1993.682) [-1985.890] (-1994.557) -- 0:03:09
      410800 -- (-1992.132) (-1990.688) (-1993.462) [-1989.888] * (-1985.849) (-1997.482) (-1982.545) [-1986.223] -- 0:03:09
      410900 -- (-1997.983) (-1994.794) (-1992.850) [-1993.970] * [-1987.906] (-2004.191) (-1994.348) (-1993.073) -- 0:03:09
      411000 -- (-1996.175) [-1984.048] (-2001.330) (-1992.030) * (-1988.364) (-2002.870) (-1999.361) [-1993.574] -- 0:03:09

      Average standard deviation of split frequencies: 0.001900

      411100 -- (-1991.910) [-1986.639] (-2003.214) (-1997.278) * (-1991.727) (-2006.571) (-1992.535) [-1985.495] -- 0:03:09
      411200 -- [-1987.324] (-1982.214) (-2000.363) (-2002.563) * (-1987.130) (-2003.856) [-1979.743] (-1980.815) -- 0:03:09
      411300 -- (-1991.818) [-1984.885] (-1993.817) (-1998.666) * (-1995.004) (-2005.145) (-1986.806) [-1985.152] -- 0:03:08
      411400 -- (-1986.839) [-1980.615] (-1993.554) (-1993.532) * (-1992.429) (-1999.813) (-1989.970) [-1983.379] -- 0:03:08
      411500 -- [-1987.628] (-1983.618) (-1993.513) (-1991.985) * (-1991.006) (-1995.199) (-1987.699) [-1984.468] -- 0:03:08
      411600 -- (-1992.350) [-1981.371] (-1995.226) (-1993.589) * (-1989.168) (-2000.924) (-1987.833) [-1986.407] -- 0:03:08
      411700 -- (-1998.726) (-1982.102) [-1996.402] (-2000.351) * [-2002.174] (-1995.379) (-1996.492) (-1984.690) -- 0:03:08
      411800 -- (-1988.904) [-1979.257] (-1997.214) (-1996.666) * (-2002.204) [-1988.724] (-1989.579) (-1993.505) -- 0:03:08
      411900 -- (-1994.553) [-1976.789] (-1993.125) (-1994.436) * (-1986.590) [-1991.592] (-1987.697) (-1994.172) -- 0:03:08
      412000 -- (-2006.505) (-1980.024) (-1992.770) [-1987.099] * [-1985.729] (-1987.710) (-1991.911) (-1990.890) -- 0:03:09

      Average standard deviation of split frequencies: 0.001895

      412100 -- (-1994.513) [-1982.433] (-1998.380) (-1991.331) * (-1990.586) [-1988.073] (-1996.317) (-1998.555) -- 0:03:09
      412200 -- (-1991.794) [-1983.035] (-2006.686) (-1992.374) * (-1991.296) [-1989.820] (-1998.702) (-1987.049) -- 0:03:09
      412300 -- [-1990.148] (-1982.894) (-1995.693) (-1989.723) * [-1989.316] (-1990.470) (-1999.817) (-1993.390) -- 0:03:09
      412400 -- (-1997.497) [-1984.663] (-1991.814) (-1998.624) * (-1990.217) (-1995.115) (-2002.161) [-1991.215] -- 0:03:09
      412500 -- (-1999.611) [-1986.777] (-1992.095) (-1996.314) * [-1985.843] (-1998.592) (-1998.763) (-1991.094) -- 0:03:09
      412600 -- (-1990.786) (-1987.299) (-1992.347) [-1991.342] * (-1983.469) [-1988.277] (-1993.673) (-1991.781) -- 0:03:09
      412700 -- [-1990.369] (-1985.956) (-1987.371) (-1996.299) * (-1987.957) [-1989.301] (-1998.699) (-1987.983) -- 0:03:09
      412800 -- (-1985.990) [-1985.930] (-1989.560) (-1997.112) * [-1984.381] (-1991.923) (-1993.367) (-1996.487) -- 0:03:09
      412900 -- (-1989.015) (-1987.557) [-1994.565] (-1998.237) * (-1982.595) (-2000.164) [-1988.565] (-1990.112) -- 0:03:09
      413000 -- (-1989.453) [-1982.880] (-1992.880) (-1993.294) * (-1988.668) (-2000.486) (-1993.934) [-1990.245] -- 0:03:09

      Average standard deviation of split frequencies: 0.002151

      413100 -- (-1991.040) (-1989.110) [-1988.777] (-1987.162) * [-1981.531] (-2002.925) (-1991.632) (-1989.985) -- 0:03:08
      413200 -- (-2004.492) [-1982.247] (-1987.376) (-1985.143) * [-1979.909] (-1997.286) (-1998.093) (-1992.393) -- 0:03:08
      413300 -- (-1993.289) [-1981.135] (-1995.230) (-1988.399) * (-1984.189) (-1998.185) [-1993.842] (-1994.526) -- 0:03:08
      413400 -- (-1995.175) [-1979.967] (-1994.653) (-1993.435) * [-1986.327] (-1996.909) (-1987.084) (-1992.634) -- 0:03:08
      413500 -- (-1990.938) (-1982.650) (-2006.526) [-1992.869] * (-1985.828) (-2005.782) (-1993.690) [-1990.207] -- 0:03:08
      413600 -- (-1990.263) [-1986.697] (-2007.625) (-1992.052) * (-1993.843) (-1994.629) (-1995.769) [-1987.093] -- 0:03:08
      413700 -- (-1994.734) [-1981.923] (-2009.767) (-1996.298) * (-1989.028) (-1992.309) (-1998.533) [-1992.391] -- 0:03:08
      413800 -- (-2005.617) (-1989.277) (-1999.198) [-1984.804] * [-1985.177] (-1994.180) (-1999.050) (-1997.425) -- 0:03:08
      413900 -- (-1996.253) (-1986.834) (-2004.313) [-1986.656] * [-1987.978] (-1994.677) (-1986.117) (-1992.086) -- 0:03:08
      414000 -- (-1997.017) (-1986.303) (-2005.368) [-1989.031] * [-1988.115] (-1999.213) (-1986.706) (-1994.762) -- 0:03:08

      Average standard deviation of split frequencies: 0.002016

      414100 -- (-1995.279) [-1988.349] (-1995.279) (-1984.603) * (-1983.623) (-1999.322) [-1984.682] (-1992.411) -- 0:03:08
      414200 -- [-1989.693] (-1994.077) (-1987.349) (-1988.013) * (-1980.784) (-1992.362) [-1985.785] (-1990.687) -- 0:03:08
      414300 -- (-1998.708) (-1991.308) [-1987.735] (-1986.475) * [-1979.869] (-1990.332) (-1991.182) (-1992.228) -- 0:03:08
      414400 -- [-1989.866] (-1985.028) (-1985.822) (-1992.184) * [-1982.462] (-1993.034) (-1993.833) (-1986.202) -- 0:03:07
      414500 -- [-1985.786] (-1986.562) (-1992.226) (-1990.276) * [-1982.047] (-1991.146) (-1993.066) (-1988.979) -- 0:03:07
      414600 -- (-1991.304) (-1982.752) (-1993.323) [-1990.213] * [-1983.765] (-1989.789) (-1989.757) (-1986.032) -- 0:03:07
      414700 -- (-1989.993) [-1982.111] (-1990.336) (-1993.285) * (-1986.708) (-1995.190) (-1985.376) [-1985.583] -- 0:03:07
      414800 -- (-1993.333) [-1982.766] (-2007.268) (-1994.175) * [-1979.200] (-1992.788) (-1989.490) (-1991.180) -- 0:03:07
      414900 -- (-1987.228) (-1987.360) (-1996.660) [-1992.191] * [-1979.269] (-1993.571) (-1991.283) (-1992.623) -- 0:03:07
      415000 -- [-1986.677] (-1985.733) (-1990.714) (-1999.770) * [-1986.099] (-1993.638) (-1990.664) (-1994.852) -- 0:03:07

      Average standard deviation of split frequencies: 0.001752

      415100 -- [-1988.327] (-1987.635) (-1998.644) (-2000.495) * (-1987.613) (-1988.680) [-1996.862] (-2002.640) -- 0:03:08
      415200 -- [-1985.549] (-1997.056) (-1998.501) (-1997.336) * [-1983.440] (-1985.710) (-1991.884) (-2002.804) -- 0:03:08
      415300 -- [-1984.332] (-1998.835) (-2013.820) (-1994.808) * [-1979.125] (-1985.071) (-1990.979) (-2004.141) -- 0:03:08
      415400 -- [-1990.319] (-1992.620) (-2013.856) (-2002.979) * [-1979.781] (-1988.303) (-1991.511) (-1994.445) -- 0:03:08
      415500 -- (-1990.336) [-1990.181] (-2003.678) (-2003.721) * [-1978.685] (-1986.516) (-1992.917) (-1993.433) -- 0:03:08
      415600 -- (-1987.211) [-1986.378] (-1997.536) (-1996.047) * [-1978.497] (-1988.762) (-1988.083) (-1993.231) -- 0:03:08
      415700 -- [-1984.144] (-1994.570) (-2000.586) (-1992.269) * (-1979.160) (-1997.221) (-1991.663) [-1990.598] -- 0:03:08
      415800 -- (-1983.040) [-1982.561] (-1994.929) (-1990.252) * [-1983.158] (-1994.559) (-2005.543) (-1992.397) -- 0:03:08
      415900 -- (-1986.836) [-1980.884] (-1993.541) (-1989.020) * [-1980.778] (-2000.472) (-2007.567) (-1996.539) -- 0:03:08
      416000 -- (-1985.658) (-1985.378) (-1997.858) [-1987.736] * [-1980.074] (-1994.193) (-1998.801) (-1988.799) -- 0:03:08

      Average standard deviation of split frequencies: 0.001780

      416100 -- (-1996.450) [-1984.461] (-1995.290) (-1990.812) * [-1986.908] (-2003.781) (-1987.837) (-1997.506) -- 0:03:08
      416200 -- (-1990.318) [-1980.858] (-1989.644) (-1986.476) * (-1992.365) (-2002.130) [-1984.830] (-1994.327) -- 0:03:07
      416300 -- [-1987.972] (-1992.207) (-1986.442) (-1988.055) * (-1994.468) (-1996.579) [-1984.267] (-1985.437) -- 0:03:07
      416400 -- (-1990.846) (-1992.182) [-1987.979] (-1985.310) * [-1989.294] (-1997.447) (-1984.037) (-1983.213) -- 0:03:07
      416500 -- (-1987.206) (-1992.529) (-1994.121) [-1987.795] * (-1985.883) (-2008.992) [-1984.118] (-1983.767) -- 0:03:07
      416600 -- (-1988.790) (-1996.083) (-1997.456) [-1993.425] * [-1985.846] (-2008.901) (-1978.780) (-1991.055) -- 0:03:07
      416700 -- (-1995.943) [-1982.980] (-1990.866) (-1990.357) * (-1992.692) (-2008.132) [-1977.382] (-1984.219) -- 0:03:07
      416800 -- (-1995.758) [-1978.771] (-1987.278) (-1991.446) * (-1985.478) (-2011.999) [-1977.357] (-1988.869) -- 0:03:07
      416900 -- (-2002.905) [-1980.587] (-1992.017) (-1995.088) * (-1982.092) (-2000.658) [-1976.614] (-1990.180) -- 0:03:07
      417000 -- (-1996.928) (-1996.016) (-1986.922) [-1990.133] * (-1980.396) (-2000.758) (-1982.202) [-1986.407] -- 0:03:07

      Average standard deviation of split frequencies: 0.001808

      417100 -- (-1997.357) [-1989.724] (-1989.548) (-1991.091) * [-1979.504] (-2000.202) (-1984.833) (-1991.007) -- 0:03:07
      417200 -- (-1995.964) (-1991.786) (-1994.414) [-1995.462] * [-1987.729] (-2000.304) (-1984.690) (-1986.361) -- 0:03:07
      417300 -- (-2001.745) (-1983.482) (-1996.803) [-1999.110] * (-1990.128) (-1996.138) (-1986.173) [-1983.921] -- 0:03:07
      417400 -- (-2002.638) [-1980.382] (-1996.449) (-1999.117) * (-1987.866) (-2004.157) [-1983.782] (-1987.295) -- 0:03:07
      417500 -- (-1996.707) [-1979.973] (-1998.992) (-1993.701) * (-1993.606) (-1997.995) (-1988.740) [-1982.430] -- 0:03:06
      417600 -- (-1996.406) [-1981.136] (-2000.641) (-1996.190) * (-1989.478) (-2000.141) (-1989.782) [-1982.938] -- 0:03:06
      417700 -- (-1994.202) (-1983.559) (-2003.393) [-1992.259] * (-1991.783) (-1986.625) [-1999.134] (-1983.835) -- 0:03:06
      417800 -- (-1990.943) [-1981.261] (-1993.731) (-1999.035) * [-1986.026] (-1994.758) (-1994.677) (-1984.279) -- 0:03:06
      417900 -- (-1988.646) (-1982.982) [-1992.343] (-1993.411) * [-1990.928] (-1987.385) (-1989.761) (-1986.326) -- 0:03:06
      418000 -- (-1992.643) [-1983.806] (-1994.319) (-1990.868) * [-1985.127] (-1988.132) (-1987.433) (-1992.365) -- 0:03:06

      Average standard deviation of split frequencies: 0.002190

      418100 -- (-1995.745) (-1987.369) (-1993.752) [-1992.470] * (-1991.876) [-1985.805] (-1985.197) (-1992.031) -- 0:03:06
      418200 -- [-1984.085] (-1990.995) (-1992.029) (-1998.478) * (-1982.517) (-1985.238) (-1983.136) [-1983.188] -- 0:03:07
      418300 -- (-1986.689) (-1994.641) [-1985.233] (-2006.448) * [-1982.806] (-1990.936) (-1984.678) (-1981.262) -- 0:03:07
      418400 -- (-1986.066) (-1994.380) [-1985.775] (-1994.543) * (-1984.992) (-1990.515) [-1978.635] (-1982.389) -- 0:03:07
      418500 -- (-1988.990) (-1992.369) [-1983.983] (-1991.389) * (-1987.712) [-1987.925] (-1981.329) (-1984.855) -- 0:03:07
      418600 -- (-1992.475) [-1988.455] (-1981.791) (-1996.735) * (-1991.108) (-1982.903) [-1979.735] (-1989.166) -- 0:03:07
      418700 -- (-1995.112) (-1984.018) [-1979.632] (-1995.089) * (-1988.980) (-1993.754) [-1978.092] (-1997.101) -- 0:03:07
      418800 -- (-1995.528) [-1985.851] (-1980.093) (-1989.292) * (-1988.666) (-1989.762) (-1981.525) [-1983.561] -- 0:03:07
      418900 -- (-1990.190) (-1997.387) [-1980.074] (-1988.097) * (-1991.127) (-1991.154) (-1985.402) [-1987.621] -- 0:03:07
      419000 -- (-1999.248) (-1987.912) [-1982.865] (-1990.601) * [-1986.231] (-2003.267) (-1990.409) (-1982.526) -- 0:03:07

      Average standard deviation of split frequencies: 0.002185

      419100 -- (-1993.984) (-1983.660) [-1987.335] (-1992.384) * (-1991.957) (-1991.402) (-1989.307) [-1980.197] -- 0:03:07
      419200 -- (-1991.836) [-1980.902] (-1986.151) (-1995.786) * [-1983.897] (-1995.841) (-1994.106) (-1981.276) -- 0:03:07
      419300 -- (-1987.383) (-1983.332) [-1985.690] (-1989.428) * [-1982.957] (-1992.969) (-1988.844) (-1982.556) -- 0:03:06
      419400 -- (-1986.619) (-1980.765) [-1984.553] (-1987.786) * [-1983.604] (-1983.391) (-2003.923) (-1985.692) -- 0:03:06
      419500 -- (-1985.922) [-1984.011] (-1997.431) (-1991.576) * (-1987.301) (-1987.326) (-1994.377) [-1986.852] -- 0:03:06
      419600 -- (-1987.276) [-1983.574] (-1995.440) (-1996.208) * (-1985.457) (-1983.452) (-2000.366) [-1981.554] -- 0:03:06
      419700 -- (-1993.334) [-1984.912] (-1994.634) (-2000.734) * [-1982.936] (-1985.369) (-2001.373) (-1982.127) -- 0:03:06
      419800 -- (-2000.638) (-1984.805) [-1989.970] (-1997.866) * (-1989.555) (-1990.257) (-2008.052) [-1980.681] -- 0:03:06
      419900 -- (-1989.997) [-1984.236] (-1985.557) (-2000.272) * [-1987.195] (-1990.678) (-2000.830) (-1984.937) -- 0:03:06
      420000 -- (-1990.768) [-1979.312] (-1988.477) (-2003.235) * (-2000.385) (-1987.156) (-1995.110) [-1985.799] -- 0:03:06

      Average standard deviation of split frequencies: 0.002180

      420100 -- (-1990.441) [-1982.259] (-1990.160) (-1997.222) * (-2007.177) [-1990.295] (-2005.823) (-1984.521) -- 0:03:06
      420200 -- (-1992.528) [-1985.199] (-1989.452) (-1992.004) * (-2005.046) (-1990.003) (-2008.900) [-1983.697] -- 0:03:06
      420300 -- (-1989.666) (-1988.112) [-1992.930] (-1999.493) * (-1993.676) (-1989.790) (-2006.598) [-1989.175] -- 0:03:06
      420400 -- (-1988.227) [-1983.636] (-1995.218) (-1995.134) * (-1993.284) [-1980.185] (-2000.175) (-1994.812) -- 0:03:06
      420500 -- (-1986.741) [-1986.817] (-2002.972) (-1992.627) * (-1990.443) [-1980.616] (-2008.288) (-1997.037) -- 0:03:06
      420600 -- (-1984.987) [-1982.297] (-1989.385) (-1990.776) * (-1988.716) [-1981.544] (-2014.903) (-1998.733) -- 0:03:05
      420700 -- (-1991.804) (-1985.623) [-1987.713] (-2001.338) * (-1991.502) (-1981.867) (-2013.796) [-1990.508] -- 0:03:05
      420800 -- (-1988.745) [-1981.947] (-1989.354) (-2000.811) * (-1990.260) [-1981.010] (-1998.836) (-1996.493) -- 0:03:05
      420900 -- [-1983.258] (-1988.818) (-1983.879) (-1997.358) * (-1998.249) [-1984.299] (-1993.039) (-1998.543) -- 0:03:05
      421000 -- (-1988.999) [-1985.350] (-1995.902) (-1996.797) * (-1991.186) [-1981.475] (-1992.051) (-1998.558) -- 0:03:05

      Average standard deviation of split frequencies: 0.002206

      421100 -- [-1985.527] (-1982.388) (-1999.670) (-1991.825) * (-1991.505) [-1981.802] (-1995.949) (-2001.525) -- 0:03:05
      421200 -- (-1994.941) [-1981.260] (-1985.890) (-1987.296) * (-1998.026) [-1980.294] (-1995.639) (-2010.469) -- 0:03:06
      421300 -- (-1990.320) [-1981.489] (-1984.204) (-1984.157) * (-2005.280) [-1983.994] (-1993.236) (-2002.853) -- 0:03:06
      421400 -- (-1990.172) (-1989.559) [-1978.473] (-1991.602) * (-1997.573) [-1980.809] (-1990.977) (-1994.373) -- 0:03:06
      421500 -- (-1984.568) (-1998.949) [-1979.039] (-1986.816) * (-1997.583) [-1979.685] (-1994.330) (-1989.328) -- 0:03:06
      421600 -- (-1992.500) (-1990.704) [-1977.485] (-1990.360) * (-1999.542) [-1982.943] (-2000.134) (-1991.874) -- 0:03:06
      421700 -- (-1995.781) (-1996.993) [-1976.647] (-1992.163) * (-1994.922) (-1987.594) (-2002.699) [-1986.549] -- 0:03:06
      421800 -- (-1995.326) (-1986.893) [-1981.054] (-1989.143) * (-1998.693) [-1981.262] (-1990.321) (-1985.271) -- 0:03:06
      421900 -- (-1994.702) (-1987.924) [-1983.662] (-1990.460) * (-1992.969) (-1983.672) (-1991.146) [-1984.261] -- 0:03:06
      422000 -- (-1994.393) (-1984.544) [-1980.121] (-1989.965) * (-1984.949) (-1980.066) (-1996.078) [-1981.636] -- 0:03:06

      Average standard deviation of split frequencies: 0.002170

      422100 -- (-1993.986) (-1983.027) [-1981.038] (-1989.659) * (-1995.566) (-1986.348) (-1998.797) [-1984.530] -- 0:03:06
      422200 -- (-2006.487) [-1990.027] (-1988.676) (-1993.269) * (-2001.323) (-1983.863) (-1998.060) [-1982.472] -- 0:03:06
      422300 -- (-1995.747) (-1988.472) [-1983.198] (-1992.786) * (-1998.355) (-1981.094) (-1992.932) [-1983.481] -- 0:03:06
      422400 -- (-1999.794) (-1988.893) (-1981.218) [-1996.120] * (-1989.257) (-1983.570) (-1992.593) [-1988.800] -- 0:03:05
      422500 -- (-1991.393) (-1990.661) [-1979.313] (-1992.570) * (-1992.170) [-1979.115] (-1989.292) (-1986.810) -- 0:03:05
      422600 -- (-1987.613) (-1994.776) [-1981.238] (-1990.726) * (-1989.948) [-1985.161] (-1986.056) (-1985.261) -- 0:03:05
      422700 -- (-1993.941) (-1999.961) [-1983.181] (-1995.309) * (-2007.472) (-1995.784) (-1987.426) [-1980.110] -- 0:03:05
      422800 -- [-1989.479] (-1989.483) (-1989.332) (-1994.478) * (-2002.516) (-1986.848) [-1987.380] (-1982.751) -- 0:03:05
      422900 -- (-1987.864) [-1989.679] (-1982.876) (-1989.461) * (-1995.967) (-1994.152) (-1990.350) [-1985.823] -- 0:03:05
      423000 -- [-1986.678] (-1988.328) (-1990.639) (-1988.597) * (-2000.023) (-1993.304) [-1992.144] (-1987.665) -- 0:03:05

      Average standard deviation of split frequencies: 0.002355

      423100 -- (-1987.967) (-1991.511) [-1983.912] (-1992.792) * (-1996.795) [-2000.606] (-1985.365) (-1987.389) -- 0:03:05
      423200 -- (-1993.826) (-1979.934) [-1981.095] (-1994.710) * (-1992.265) (-1994.384) [-1987.282] (-1984.461) -- 0:03:05
      423300 -- (-1989.049) [-1981.827] (-1985.668) (-1988.825) * (-1995.663) (-1994.767) (-1989.451) [-1983.184] -- 0:03:05
      423400 -- [-1992.505] (-1981.343) (-1991.239) (-1988.033) * (-2002.955) (-1999.979) (-1994.534) [-1980.270] -- 0:03:05
      423500 -- (-1990.320) [-1982.769] (-1987.620) (-1986.796) * (-1995.152) [-1986.804] (-1992.824) (-1979.442) -- 0:03:05
      423600 -- [-1988.235] (-1982.252) (-1989.545) (-1990.438) * (-1995.382) (-1988.113) (-1994.701) [-1982.832] -- 0:03:05
      423700 -- (-1992.771) [-1984.864] (-1992.871) (-1990.081) * (-1996.097) (-1989.229) (-1999.635) [-1980.508] -- 0:03:04
      423800 -- [-1983.588] (-1981.259) (-1996.199) (-1985.843) * (-1994.176) (-1993.295) (-1992.917) [-1981.488] -- 0:03:04
      423900 -- (-1987.474) [-1982.639] (-1990.692) (-1989.812) * (-1998.059) (-1996.994) (-1993.074) [-1983.836] -- 0:03:04
      424000 -- (-1997.869) (-1988.365) [-1987.938] (-1993.201) * (-2001.283) (-1994.528) (-1995.608) [-1978.361] -- 0:03:04

      Average standard deviation of split frequencies: 0.002413

      424100 -- (-1995.772) [-1984.306] (-1984.069) (-1996.256) * (-1993.822) (-1991.020) (-1990.165) [-1976.633] -- 0:03:04
      424200 -- (-1990.219) (-1991.258) [-1984.530] (-1996.724) * (-1991.444) (-2000.902) (-1990.381) [-1980.404] -- 0:03:04
      424300 -- (-1991.269) (-1984.819) [-1985.020] (-1999.839) * (-1995.110) (-1998.066) [-1990.071] (-1981.088) -- 0:03:05
      424400 -- [-1986.836] (-1992.612) (-1983.427) (-1991.498) * (-1994.093) (-2006.089) [-1988.656] (-1983.246) -- 0:03:05
      424500 -- (-1994.623) (-1986.270) [-1988.674] (-1989.681) * (-1987.056) (-2000.047) [-1985.181] (-1984.388) -- 0:03:05
      424600 -- (-1995.333) [-1986.140] (-1984.329) (-1994.783) * [-1981.370] (-1993.954) (-1996.703) (-1984.027) -- 0:03:05
      424700 -- [-1996.474] (-1990.655) (-1986.558) (-1996.971) * (-1986.623) (-1989.736) (-1993.192) [-1985.154] -- 0:03:05
      424800 -- (-1990.044) (-1988.896) [-1983.110] (-1998.307) * (-1978.990) (-1992.090) (-1993.818) [-1983.906] -- 0:03:05
      424900 -- (-1994.434) [-1984.262] (-1980.147) (-1991.856) * (-1975.108) (-2001.882) (-1992.084) [-1986.153] -- 0:03:05
      425000 -- (-1999.262) (-1986.523) [-1980.211] (-1988.765) * (-1985.422) (-1995.452) [-1993.509] (-1992.003) -- 0:03:05

      Average standard deviation of split frequencies: 0.002439

      425100 -- (-1989.764) (-1986.553) [-1980.605] (-1993.021) * (-1984.105) [-1993.700] (-1987.023) (-1992.121) -- 0:03:05
      425200 -- (-1989.384) [-1980.678] (-1979.655) (-1998.017) * [-1983.476] (-1998.083) (-1984.390) (-1992.597) -- 0:03:05
      425300 -- (-1994.049) (-1983.717) [-1978.800] (-1998.455) * (-1984.747) (-2004.634) [-1986.936] (-1991.260) -- 0:03:05
      425400 -- (-1990.257) [-1984.539] (-1979.122) (-1999.271) * [-1990.605] (-1989.263) (-1990.400) (-1996.041) -- 0:03:05
      425500 -- (-1992.550) (-1992.878) [-1978.543] (-2001.779) * (-1994.144) (-1992.809) (-1989.045) [-1988.169] -- 0:03:04
      425600 -- (-1988.768) (-1984.736) [-1979.785] (-1996.757) * [-1992.061] (-1997.511) (-1990.613) (-1999.100) -- 0:03:04
      425700 -- (-1988.313) [-1985.827] (-1990.468) (-1993.572) * (-1994.336) (-1991.739) [-1993.231] (-2002.891) -- 0:03:04
      425800 -- (-1987.164) [-1985.895] (-1989.707) (-1989.833) * (-1997.177) (-2007.862) [-1985.248] (-1993.778) -- 0:03:04
      425900 -- (-1984.801) (-1983.833) [-1988.394] (-1989.357) * (-1998.754) (-2000.152) (-1983.159) [-1986.568] -- 0:03:04
      426000 -- (-1997.793) [-1986.738] (-1987.981) (-1995.098) * (-1995.207) (-2001.434) [-1987.198] (-1989.021) -- 0:03:04

      Average standard deviation of split frequencies: 0.002655

      426100 -- (-1992.605) [-1979.731] (-1985.471) (-1985.720) * (-1996.370) (-1997.247) [-1992.632] (-1990.904) -- 0:03:04
      426200 -- (-1992.074) [-1979.831] (-1983.280) (-1985.943) * (-1990.459) (-1998.472) (-1990.694) [-1987.825] -- 0:03:04
      426300 -- (-1992.579) (-1981.380) [-1985.645] (-1987.950) * (-1985.583) (-1988.057) [-1989.303] (-1983.808) -- 0:03:04
      426400 -- (-1989.086) [-1982.559] (-1980.826) (-1988.089) * [-1984.095] (-1996.658) (-1991.032) (-1989.793) -- 0:03:04
      426500 -- (-1993.758) (-1987.253) [-1981.116] (-1984.445) * [-1982.271] (-2001.796) (-1989.837) (-1993.199) -- 0:03:04
      426600 -- (-1988.312) (-1997.587) [-1979.809] (-1996.152) * [-1983.191] (-1998.585) (-1990.892) (-1992.204) -- 0:03:04
      426700 -- (-1987.778) (-2001.313) [-1981.501] (-2004.439) * [-1986.973] (-1997.774) (-1992.577) (-1986.182) -- 0:03:04
      426800 -- (-1991.990) (-1988.876) (-1984.221) [-1993.784] * [-1991.541] (-1994.654) (-1996.688) (-1986.452) -- 0:03:03
      426900 -- (-1990.007) [-1986.713] (-1990.133) (-1993.844) * (-1993.042) (-1987.043) (-1992.319) [-1986.646] -- 0:03:03
      427000 -- (-1989.830) (-1989.619) [-1987.995] (-2001.399) * (-1991.674) (-2006.340) (-1996.098) [-1982.497] -- 0:03:03

      Average standard deviation of split frequencies: 0.002491

      427100 -- [-1990.086] (-1991.206) (-1987.518) (-2001.360) * (-1988.282) (-2007.206) (-1993.058) [-1981.676] -- 0:03:03
      427200 -- [-1986.790] (-1996.477) (-1987.605) (-2004.896) * (-1982.571) (-1992.575) (-1998.275) [-1983.825] -- 0:03:03
      427300 -- (-1990.310) [-1987.740] (-1992.131) (-1994.655) * (-1991.542) (-1995.310) (-2003.786) [-1987.523] -- 0:03:03
      427400 -- (-1994.028) [-1986.197] (-2004.022) (-1995.298) * (-1987.459) [-1983.800] (-1996.146) (-1987.781) -- 0:03:04
      427500 -- [-1987.957] (-1984.524) (-1991.825) (-1998.965) * (-1998.300) (-1984.686) (-1997.741) [-1987.141] -- 0:03:04
      427600 -- (-1988.708) (-1992.009) (-1995.219) [-1990.533] * [-1985.467] (-1982.618) (-1995.421) (-1985.103) -- 0:03:04
      427700 -- [-1985.877] (-1983.337) (-1997.596) (-1990.010) * (-1993.259) (-1982.920) (-2004.498) [-1982.990] -- 0:03:04
      427800 -- [-1986.502] (-1988.232) (-2000.139) (-1989.610) * (-1990.830) [-1984.556] (-2008.391) (-1987.815) -- 0:03:04
      427900 -- [-1990.824] (-1991.648) (-2008.307) (-1989.447) * [-1990.969] (-1990.546) (-2011.813) (-1993.662) -- 0:03:04
      428000 -- [-1995.720] (-1990.779) (-2011.122) (-1992.409) * [-1987.455] (-1989.135) (-1997.074) (-2002.691) -- 0:03:04

      Average standard deviation of split frequencies: 0.002517

      428100 -- (-2001.475) (-2002.861) (-2011.619) [-1987.542] * (-1986.829) [-1987.027] (-2011.169) (-1993.936) -- 0:03:04
      428200 -- (-1996.606) (-1997.333) (-2015.965) [-1984.593] * [-1982.942] (-1987.369) (-1991.413) (-2009.584) -- 0:03:04
      428300 -- (-1996.315) (-1989.699) (-2013.276) [-1987.440] * [-1986.548] (-1992.425) (-1993.635) (-1997.989) -- 0:03:04
      428400 -- (-1991.982) (-1993.037) (-2000.905) [-1986.671] * (-1984.473) (-1994.719) (-1987.645) [-1985.924] -- 0:03:04
      428500 -- (-1992.061) (-1992.386) (-2005.953) [-1986.482] * (-1987.840) (-1997.480) (-1989.032) [-1984.635] -- 0:03:04
      428600 -- [-1989.079] (-2002.340) (-2010.538) (-1985.267) * (-1995.964) (-1986.952) (-1990.439) [-1990.366] -- 0:03:03
      428700 -- (-1991.717) (-2004.810) [-1989.680] (-1995.490) * (-1996.690) (-1990.821) (-1992.843) [-1986.346] -- 0:03:03
      428800 -- (-1994.005) (-2004.392) (-1996.222) [-1990.278] * (-1993.659) (-1988.133) [-1988.658] (-1987.527) -- 0:03:03
      428900 -- (-1999.034) (-2009.515) [-1986.532] (-1992.944) * (-1991.143) (-1983.815) [-1987.132] (-1985.679) -- 0:03:03
      429000 -- (-1998.063) (-2002.071) [-1988.877] (-1993.860) * (-1990.305) (-1987.260) [-1987.892] (-1993.540) -- 0:03:03

      Average standard deviation of split frequencies: 0.002510

      429100 -- (-1997.048) (-1992.791) [-1990.751] (-1994.141) * (-1988.380) [-1986.444] (-1984.550) (-1989.526) -- 0:03:03
      429200 -- (-1997.189) (-1998.876) (-1999.796) [-1989.271] * (-1989.777) [-1983.803] (-1982.860) (-1985.504) -- 0:03:03
      429300 -- (-1993.583) (-2000.579) (-1995.959) [-1986.795] * (-1988.786) (-1982.423) (-1987.675) [-1980.414] -- 0:03:03
      429400 -- (-1997.604) (-1997.979) [-1988.455] (-1995.522) * (-1993.249) [-1981.025] (-1988.175) (-1986.744) -- 0:03:03
      429500 -- (-1999.353) (-1999.720) [-1979.829] (-2006.893) * (-1999.749) (-1982.614) [-1987.807] (-1986.783) -- 0:03:03
      429600 -- (-1999.086) (-2000.933) [-1983.257] (-1999.944) * (-1997.898) (-1983.718) (-1984.908) [-1990.443] -- 0:03:03
      429700 -- (-1991.013) (-1998.401) [-1980.849] (-1994.153) * (-1996.023) (-1992.648) [-1986.400] (-1988.341) -- 0:03:03
      429800 -- (-2004.563) [-1992.718] (-1987.720) (-1995.459) * (-1994.255) (-1991.829) (-1991.381) [-1983.338] -- 0:03:03
      429900 -- (-2000.884) (-1985.502) [-1985.337] (-1999.652) * (-1986.070) [-1990.426] (-1988.208) (-1983.621) -- 0:03:03
      430000 -- (-2010.282) (-1985.256) [-1983.985] (-1992.728) * (-1989.621) (-1986.519) (-1986.925) [-1981.773] -- 0:03:02

      Average standard deviation of split frequencies: 0.002442

      430100 -- (-2004.300) (-1985.400) [-1984.034] (-1990.169) * (-1995.161) (-1984.881) (-1993.573) [-1979.011] -- 0:03:02
      430200 -- (-1999.871) [-1989.854] (-1982.512) (-1996.035) * (-1998.920) [-1984.579] (-2001.170) (-1987.809) -- 0:03:02
      430300 -- (-1999.441) (-1993.576) [-1986.676] (-2004.334) * (-1997.759) (-1984.860) (-2000.917) [-1988.320] -- 0:03:04
      430400 -- (-1999.324) (-1997.894) [-1982.385] (-1991.254) * (-1996.879) (-1987.558) (-2001.190) [-1984.203] -- 0:03:03
      430500 -- (-1996.199) (-1996.608) (-1982.980) [-1985.024] * (-1992.713) (-1983.241) (-2002.376) [-1985.390] -- 0:03:03
      430600 -- (-1999.869) (-1998.348) [-1984.377] (-1985.224) * (-1987.420) [-1980.603] (-1995.682) (-1986.885) -- 0:03:03
      430700 -- (-2001.200) (-1991.783) [-1982.164] (-1982.792) * (-1984.204) [-1979.941] (-1989.158) (-1985.523) -- 0:03:03
      430800 -- (-1997.428) (-1993.560) [-1981.083] (-1986.842) * (-1979.697) [-1979.498] (-1991.359) (-1986.995) -- 0:03:03
      430900 -- (-1994.623) (-1995.998) [-1985.540] (-1985.287) * [-1980.284] (-1981.183) (-1996.119) (-1987.603) -- 0:03:03
      431000 -- [-1985.447] (-1987.237) (-1980.941) (-1985.890) * [-1983.924] (-1984.711) (-1993.947) (-1992.821) -- 0:03:03

      Average standard deviation of split frequencies: 0.002530

      431100 -- (-1990.063) (-2000.480) (-1990.288) [-1986.633] * (-1985.269) [-1984.445] (-1995.481) (-1990.206) -- 0:03:03
      431200 -- (-1996.300) (-2000.886) (-1986.680) [-1982.361] * (-1984.365) [-1983.225] (-1991.874) (-1994.155) -- 0:03:03
      431300 -- (-2002.934) (-1996.352) (-1991.503) [-1987.016] * (-1987.228) (-1988.929) [-1992.151] (-1997.987) -- 0:03:03
      431400 -- (-1996.318) (-1999.012) (-1986.480) [-1982.804] * (-1988.401) [-1979.034] (-1995.704) (-1987.517) -- 0:03:03
      431500 -- (-1999.279) (-1994.815) [-1985.374] (-1982.822) * [-1989.195] (-1983.254) (-1993.480) (-1987.408) -- 0:03:03
      431600 -- (-1995.402) (-1992.919) [-1980.874] (-1984.371) * (-1988.167) (-1983.221) (-1993.748) [-1980.702] -- 0:03:03
      431700 -- (-1998.656) [-1988.863] (-1980.924) (-1985.372) * (-1993.016) [-1983.904] (-1993.585) (-1985.443) -- 0:03:02
      431800 -- (-1992.845) (-1990.554) [-1983.482] (-1987.723) * (-1989.311) [-1984.413] (-1993.709) (-1980.530) -- 0:03:02
      431900 -- (-1993.411) (-1990.242) [-1986.490] (-1985.385) * (-1994.224) (-1986.842) (-1987.329) [-1978.629] -- 0:03:02
      432000 -- (-1992.884) (-1989.296) (-1982.420) [-1982.204] * (-1993.150) (-1983.761) (-1991.468) [-1979.093] -- 0:03:02

      Average standard deviation of split frequencies: 0.002462

      432100 -- (-1993.633) [-1983.638] (-1994.187) (-1987.668) * (-1998.060) [-1983.441] (-1997.340) (-1980.998) -- 0:03:02
      432200 -- (-1992.221) [-1982.812] (-1985.511) (-1993.018) * (-1996.143) [-1981.811] (-1992.855) (-1986.340) -- 0:03:02
      432300 -- (-1994.287) [-1982.422] (-1984.218) (-1984.932) * (-1988.251) [-1984.597] (-1993.557) (-1981.079) -- 0:03:02
      432400 -- (-1993.277) (-1995.028) (-1996.167) [-1985.304] * (-2002.705) (-1986.011) (-1997.418) [-1981.415] -- 0:03:02
      432500 -- [-1994.255] (-2000.494) (-1994.009) (-1986.973) * (-1990.902) (-1989.341) (-1989.119) [-1986.884] -- 0:03:02
      432600 -- (-2002.571) [-1985.859] (-1991.653) (-1991.713) * (-1995.153) [-1983.154] (-1986.553) (-1994.468) -- 0:03:02
      432700 -- (-2000.757) (-1983.416) [-1981.952] (-1998.412) * (-1991.842) [-1988.423] (-1987.778) (-1990.792) -- 0:03:02
      432800 -- (-1994.972) (-1979.978) [-1981.273] (-2000.031) * (-1994.196) [-1984.475] (-2000.917) (-1986.338) -- 0:03:02
      432900 -- (-1999.520) [-1980.816] (-1987.492) (-1999.246) * (-1988.962) [-1982.686] (-1997.055) (-1994.868) -- 0:03:02
      433000 -- (-2000.497) (-1979.078) [-1988.804] (-1996.469) * (-1999.169) [-1984.039] (-1993.810) (-1990.478) -- 0:03:02

      Average standard deviation of split frequencies: 0.002518

      433100 -- (-2000.013) [-1983.850] (-1984.049) (-1999.130) * (-1995.597) [-1984.268] (-1992.613) (-1994.798) -- 0:03:01
      433200 -- (-1991.335) [-1983.916] (-1984.922) (-1993.340) * (-1998.789) [-1983.145] (-1993.113) (-1992.499) -- 0:03:01
      433300 -- [-1986.019] (-1988.942) (-1985.039) (-1995.465) * (-1992.405) (-1988.670) (-1988.625) [-1988.429] -- 0:03:01
      433400 -- (-1988.239) (-1987.106) [-1982.070] (-2004.046) * (-1996.525) [-1986.432] (-1992.546) (-1989.564) -- 0:03:03
      433500 -- (-1986.453) (-1983.496) [-1982.512] (-1998.785) * [-1983.544] (-1993.516) (-1998.521) (-1991.290) -- 0:03:02
      433600 -- (-1987.936) (-1979.694) [-1982.481] (-2003.254) * (-1981.335) (-1994.236) (-2006.206) [-1988.373] -- 0:03:02
      433700 -- [-1988.175] (-1985.850) (-1984.445) (-2004.422) * [-1981.832] (-1995.836) (-2001.220) (-1992.626) -- 0:03:02
      433800 -- (-1990.457) (-1986.230) [-1984.371] (-1998.088) * [-1983.437] (-1994.233) (-1985.572) (-1994.357) -- 0:03:02
      433900 -- (-1994.869) (-1981.631) [-1988.110] (-1999.204) * (-1989.149) (-1998.484) [-1989.972] (-1996.143) -- 0:03:02
      434000 -- (-1998.727) (-1982.988) [-1980.261] (-1999.146) * [-1985.723] (-2001.317) (-1985.615) (-1992.628) -- 0:03:02

      Average standard deviation of split frequencies: 0.002513

      434100 -- (-1994.151) (-1991.275) [-1982.670] (-1993.541) * (-1986.014) (-2001.682) [-1984.251] (-1991.403) -- 0:03:02
      434200 -- (-1997.744) (-1991.220) [-1980.310] (-1996.828) * (-1986.199) (-2007.634) [-1987.730] (-1989.178) -- 0:03:02
      434300 -- (-2002.187) (-1991.667) [-1981.555] (-1994.099) * (-1984.591) (-2003.136) [-1984.069] (-1988.724) -- 0:03:02
      434400 -- (-2001.964) (-2001.699) [-1985.637] (-1991.127) * [-1983.375] (-2007.883) (-1988.697) (-2004.778) -- 0:03:02
      434500 -- (-2008.718) [-1996.617] (-1990.012) (-1993.212) * [-1983.689] (-1997.319) (-1998.176) (-1998.376) -- 0:03:02
      434600 -- (-1995.022) (-1998.842) (-2000.157) [-1985.188] * [-1983.475] (-2003.329) (-1996.649) (-2002.271) -- 0:03:02
      434700 -- [-1994.132] (-1996.882) (-1992.586) (-1990.610) * [-1991.116] (-1998.541) (-2003.651) (-2012.266) -- 0:03:02
      434800 -- (-1999.534) [-1991.961] (-1995.911) (-1988.012) * [-1990.305] (-1991.688) (-1992.295) (-2007.648) -- 0:03:01
      434900 -- (-1993.468) (-1994.114) (-1989.950) [-1991.429] * [-1988.723] (-1991.921) (-1991.586) (-2000.916) -- 0:03:01
      435000 -- (-1991.834) (-1998.966) [-1984.842] (-1999.779) * (-1978.600) [-1989.939] (-1987.894) (-1996.627) -- 0:03:01

      Average standard deviation of split frequencies: 0.002445

      435100 -- [-1984.970] (-1998.369) (-1986.719) (-1988.323) * [-1980.957] (-1990.102) (-1987.882) (-1996.549) -- 0:03:01
      435200 -- (-1986.448) (-2000.073) [-1983.728] (-1985.395) * (-1985.862) [-1989.497] (-1985.569) (-1993.688) -- 0:03:01
      435300 -- [-1982.185] (-1992.547) (-1982.663) (-1997.990) * [-1982.574] (-1986.395) (-1992.957) (-2002.542) -- 0:03:01
      435400 -- (-1987.323) (-1994.801) [-1983.598] (-2004.421) * [-1982.670] (-1988.383) (-1995.005) (-2004.645) -- 0:03:01
      435500 -- (-1985.994) (-1997.304) [-1984.812] (-2009.627) * (-1982.220) (-1991.944) [-1993.043] (-1998.209) -- 0:03:01
      435600 -- (-1986.119) (-2001.538) [-1984.082] (-2005.234) * [-1981.936] (-1988.294) (-1998.229) (-1999.044) -- 0:03:01
      435700 -- [-1989.510] (-1994.781) (-1990.516) (-2000.341) * (-1991.309) [-1990.110] (-1996.639) (-2004.864) -- 0:03:01
      435800 -- (-1993.208) (-1990.525) [-1981.079] (-1998.157) * (-1996.421) (-1996.287) [-1993.790] (-2007.549) -- 0:03:01
      435900 -- (-1987.036) (-1992.503) [-1985.750] (-1996.581) * (-1986.348) [-1989.647] (-1989.435) (-2009.072) -- 0:03:01
      436000 -- (-1994.066) (-1989.577) [-1984.183] (-2010.499) * (-1984.632) (-1990.838) [-1997.322] (-2013.690) -- 0:03:01

      Average standard deviation of split frequencies: 0.002316

      436100 -- (-1998.864) (-1987.276) [-1985.377] (-2001.394) * [-1978.766] (-1993.279) (-2000.159) (-2004.990) -- 0:03:01
      436200 -- [-1985.650] (-1986.820) (-1999.651) (-1999.168) * [-1982.853] (-1989.203) (-1992.721) (-2001.700) -- 0:03:00
      436300 -- [-1984.973] (-1990.962) (-1983.608) (-2006.174) * [-1983.589] (-1989.593) (-1985.066) (-1992.074) -- 0:03:00
      436400 -- (-1985.530) [-1985.150] (-1987.361) (-2004.089) * [-1982.533] (-1995.030) (-1986.972) (-1999.039) -- 0:03:00
      436500 -- (-1990.938) [-1989.736] (-1987.861) (-1993.833) * [-1982.821] (-1993.308) (-1989.529) (-2005.330) -- 0:03:02
      436600 -- (-1987.888) (-1982.103) [-1986.213] (-1996.920) * (-1987.534) (-2003.721) [-1988.315] (-1997.789) -- 0:03:01
      436700 -- [-1988.869] (-1987.003) (-1985.631) (-1992.006) * [-1981.412] (-2009.193) (-1992.723) (-1992.005) -- 0:03:01
      436800 -- (-1985.291) [-1988.119] (-1986.263) (-2001.915) * [-1979.580] (-2001.718) (-2004.525) (-1994.824) -- 0:03:01
      436900 -- (-1987.800) (-1988.096) (-1984.226) [-1995.138] * [-1985.489] (-1991.275) (-2003.199) (-1993.143) -- 0:03:01
      437000 -- (-1987.253) (-1990.697) (-1985.911) [-1990.478] * [-1983.493] (-1999.737) (-1998.321) (-1988.754) -- 0:03:01

      Average standard deviation of split frequencies: 0.002218

      437100 -- (-1988.251) (-1997.579) [-1987.784] (-1990.404) * [-1982.708] (-1996.732) (-1997.873) (-1985.745) -- 0:03:01
      437200 -- (-1988.466) (-1994.644) (-1989.299) [-1995.565] * (-1983.994) [-1999.324] (-2003.322) (-1986.793) -- 0:03:01
      437300 -- (-1983.544) (-1989.830) [-1986.149] (-2009.123) * [-1985.097] (-1991.849) (-1998.205) (-1992.499) -- 0:03:01
      437400 -- [-1984.138] (-1983.716) (-1986.387) (-2007.327) * (-1984.314) [-1988.393] (-1996.215) (-2000.104) -- 0:03:01
      437500 -- (-1987.359) [-1984.364] (-1982.418) (-2010.550) * (-1987.049) [-1995.531] (-1995.321) (-1996.969) -- 0:03:01
      437600 -- [-1987.038] (-1987.165) (-1985.199) (-2008.817) * (-1986.184) (-1993.172) [-1991.213] (-1989.781) -- 0:03:01
      437700 -- (-1984.107) (-1988.155) [-1990.662] (-1995.648) * [-1981.839] (-1984.411) (-1991.009) (-1995.516) -- 0:03:01
      437800 -- (-1985.213) (-1988.531) [-1989.053] (-1989.490) * (-1981.981) (-1989.927) [-1990.450] (-2003.324) -- 0:03:01
      437900 -- (-1984.297) [-1983.976] (-1985.009) (-1988.922) * [-1980.632] (-1986.231) (-1992.508) (-1997.779) -- 0:03:00
      438000 -- [-1981.524] (-1989.379) (-1985.977) (-1989.723) * [-1985.707] (-1986.970) (-1992.079) (-1992.904) -- 0:03:00

      Average standard deviation of split frequencies: 0.002121

      438100 -- [-1982.985] (-1990.463) (-1984.911) (-1997.292) * (-1992.291) (-1988.306) (-1995.225) [-1989.254] -- 0:03:00
      438200 -- (-1988.840) (-1983.292) [-1988.975] (-1995.768) * (-1992.973) [-1985.707] (-1989.356) (-1996.885) -- 0:03:00
      438300 -- (-1984.261) [-1983.217] (-1992.635) (-2006.111) * (-1990.255) (-1991.839) [-1990.980] (-1988.261) -- 0:03:00
      438400 -- (-1986.263) [-1983.985] (-1993.318) (-2002.777) * (-1983.476) (-1993.437) (-2001.579) [-1985.862] -- 0:03:00
      438500 -- (-1993.724) [-1988.009] (-1991.995) (-2001.440) * (-1988.244) [-1994.439] (-1997.831) (-1994.878) -- 0:03:00
      438600 -- (-1992.058) (-1985.056) [-1987.134] (-1994.673) * [-1985.908] (-2005.206) (-1993.515) (-1999.494) -- 0:03:00
      438700 -- (-1990.583) [-1979.980] (-1985.779) (-1996.779) * [-1982.757] (-1999.104) (-1993.748) (-1990.883) -- 0:03:00
      438800 -- (-1985.885) (-1985.900) (-1989.345) [-1989.994] * (-1984.458) (-2005.240) (-1994.513) [-1991.618] -- 0:03:00
      438900 -- (-1995.192) [-1986.111] (-1993.255) (-1994.445) * (-1984.074) (-1997.049) (-2001.479) [-1987.224] -- 0:03:00
      439000 -- (-1989.873) (-1986.196) [-1986.597] (-1992.938) * (-1990.137) (-1997.814) (-1991.769) [-1987.881] -- 0:03:00

      Average standard deviation of split frequencies: 0.001840

      439100 -- (-1986.194) (-1982.597) [-1993.467] (-1992.095) * (-1995.157) (-1998.369) [-1991.863] (-1995.466) -- 0:03:00
      439200 -- [-1987.287] (-1986.348) (-1992.870) (-1991.205) * [-1990.325] (-1993.356) (-1992.989) (-1994.887) -- 0:03:00
      439300 -- (-1988.804) [-1985.778] (-1983.778) (-1989.880) * (-1982.961) (-1992.288) (-1991.100) [-1990.460] -- 0:02:59
      439400 -- [-1993.453] (-1992.436) (-1982.912) (-1999.211) * [-1979.955] (-1996.583) (-1989.501) (-2002.147) -- 0:02:59
      439500 -- (-1993.802) (-1990.697) [-1985.215] (-1991.767) * [-1983.749] (-1994.574) (-1988.102) (-2004.134) -- 0:03:01
      439600 -- (-1992.126) (-1991.837) [-1984.144] (-1993.516) * [-1978.987] (-1994.143) (-1987.615) (-2009.278) -- 0:03:01
      439700 -- (-1986.588) (-1999.176) [-1981.523] (-1992.766) * [-1982.868] (-2001.912) (-1990.025) (-1997.891) -- 0:03:00
      439800 -- (-1982.025) (-1996.418) [-1984.640] (-1990.513) * [-1983.274] (-2014.379) (-1987.785) (-1992.686) -- 0:03:00
      439900 -- (-1982.739) (-1995.739) [-1984.121] (-1990.064) * (-1985.643) (-1997.533) (-1991.911) [-1987.804] -- 0:03:00
      440000 -- [-1979.301] (-1992.078) (-1983.744) (-1983.905) * [-1982.689] (-1996.742) (-1991.900) (-1990.904) -- 0:03:00

      Average standard deviation of split frequencies: 0.001775

      440100 -- [-1980.605] (-1991.922) (-1984.536) (-1988.609) * [-1986.875] (-1996.016) (-1997.019) (-1990.052) -- 0:03:00
      440200 -- (-1980.568) (-1994.957) [-1981.805] (-1988.942) * [-1983.181] (-1990.996) (-2003.807) (-1994.401) -- 0:03:00
      440300 -- [-1980.118] (-1986.305) (-1981.511) (-1992.760) * [-1982.723] (-1989.801) (-1995.337) (-1995.395) -- 0:03:00
      440400 -- [-1980.433] (-1991.652) (-1982.467) (-1990.087) * [-1984.236] (-1990.622) (-1989.312) (-1987.781) -- 0:03:00
      440500 -- [-1982.948] (-1996.032) (-1989.279) (-1990.183) * [-1982.921] (-1991.514) (-1988.259) (-1986.323) -- 0:03:00
      440600 -- [-1984.206] (-1991.247) (-1984.612) (-1986.204) * (-1988.100) (-1991.204) (-1993.141) [-1987.001] -- 0:03:00
      440700 -- [-1983.195] (-1998.114) (-1981.569) (-1985.484) * (-1991.646) [-1989.232] (-1991.424) (-1986.784) -- 0:03:00
      440800 -- (-1984.313) (-2000.201) [-1982.750] (-1988.681) * (-1997.451) (-1992.756) (-1999.266) [-1992.161] -- 0:03:00
      440900 -- (-1982.873) (-1991.133) [-1985.172] (-1992.802) * (-1990.280) (-1994.392) (-2005.042) [-1989.702] -- 0:03:00
      441000 -- (-1982.247) (-1994.195) [-1984.868] (-1989.066) * (-1984.990) (-1992.596) (-1999.780) [-1992.595] -- 0:02:59

      Average standard deviation of split frequencies: 0.001771

      441100 -- (-1989.994) (-2004.588) [-1981.456] (-1989.125) * [-1986.409] (-1999.816) (-2008.825) (-1996.349) -- 0:02:59
      441200 -- (-1993.634) (-1986.918) (-1982.506) [-1988.970] * [-1988.013] (-2002.442) (-2010.716) (-1991.856) -- 0:02:59
      441300 -- (-1994.194) (-1993.935) [-1985.824] (-2001.533) * [-1988.709] (-1998.666) (-1998.121) (-1990.594) -- 0:02:59
      441400 -- (-1985.305) [-1987.917] (-1992.664) (-1995.078) * (-1990.143) (-2009.689) (-1991.152) [-1987.819] -- 0:02:59
      441500 -- [-1982.518] (-1989.777) (-1982.052) (-2001.402) * (-1989.968) (-2000.169) [-1989.165] (-1988.927) -- 0:02:59
      441600 -- [-1985.447] (-1995.055) (-1984.499) (-1987.070) * [-1984.377] (-1997.817) (-1995.250) (-1984.588) -- 0:02:59
      441700 -- [-1982.130] (-1987.830) (-1986.689) (-1987.114) * [-1988.491] (-1998.745) (-1996.152) (-1993.675) -- 0:02:59
      441800 -- (-1986.180) (-1986.865) [-1984.687] (-1985.777) * [-1983.556] (-1997.424) (-1988.400) (-2000.568) -- 0:02:59
      441900 -- (-1988.449) (-1986.190) [-1984.242] (-1987.468) * (-1989.788) (-2001.710) [-1991.643] (-1995.231) -- 0:02:59
      442000 -- (-1995.225) (-1988.907) [-1984.542] (-1994.842) * [-1984.461] (-1995.246) (-1984.410) (-1995.643) -- 0:02:59

      Average standard deviation of split frequencies: 0.001767

      442100 -- (-1991.573) (-1985.530) [-1986.544] (-1996.214) * (-1995.745) (-2000.257) [-1986.842] (-1993.363) -- 0:02:59
      442200 -- (-1991.122) (-1986.445) [-1979.085] (-1988.627) * (-2001.393) (-1998.692) [-1987.053] (-1995.541) -- 0:02:59
      442300 -- (-1992.657) [-1986.104] (-1986.793) (-1992.057) * (-2003.321) (-1995.556) (-1990.577) [-1987.983] -- 0:02:59
      442400 -- (-1992.437) [-1985.089] (-1992.737) (-1990.727) * (-2001.020) [-1990.524] (-1994.573) (-1991.804) -- 0:03:00
      442500 -- [-1989.442] (-1983.526) (-1995.663) (-1992.683) * (-2000.975) [-1982.207] (-1990.246) (-1987.170) -- 0:03:00
      442600 -- (-1991.176) [-1982.075] (-1990.637) (-1992.481) * (-1998.224) (-1984.930) (-1991.886) [-1988.115] -- 0:03:00
      442700 -- (-1994.941) [-1985.843] (-1986.098) (-1990.519) * (-1991.957) (-1988.324) (-1990.994) [-1988.520] -- 0:03:00
      442800 -- (-1999.202) (-1985.409) [-1983.226] (-1987.375) * (-1996.100) (-1994.091) [-1993.377] (-1990.666) -- 0:02:59
      442900 -- (-2003.150) [-1984.992] (-1986.626) (-1987.711) * (-1991.038) (-1997.880) (-1995.400) [-1990.865] -- 0:02:59
      443000 -- (-2008.120) [-1987.940] (-1983.686) (-1997.314) * (-1992.913) [-1989.420] (-1988.987) (-1988.579) -- 0:02:59

      Average standard deviation of split frequencies: 0.001884

      443100 -- (-2007.070) (-1993.239) [-1979.299] (-1994.353) * (-1992.868) [-1984.694] (-1992.644) (-1988.131) -- 0:02:59
      443200 -- (-2000.458) (-1992.377) [-1980.842] (-1990.236) * (-2009.923) [-1988.687] (-1995.695) (-1992.973) -- 0:02:59
      443300 -- (-2002.898) [-1987.240] (-1985.744) (-1991.190) * (-2003.925) (-1987.875) (-1993.038) [-1996.407] -- 0:02:59
      443400 -- (-1995.798) (-1991.473) [-1988.680] (-1988.463) * (-2008.085) [-1989.882] (-1988.637) (-1996.979) -- 0:02:59
      443500 -- (-2001.561) [-1991.898] (-1989.737) (-1987.287) * (-2004.413) [-1990.533] (-1986.508) (-1991.638) -- 0:02:59
      443600 -- (-1999.847) (-1992.761) (-1990.289) [-1985.030] * (-2010.134) [-1989.097] (-1990.702) (-1996.619) -- 0:02:59
      443700 -- (-1994.448) [-1988.311] (-1992.780) (-1987.418) * (-1999.211) [-1987.714] (-1991.258) (-1998.114) -- 0:02:59
      443800 -- (-1996.896) (-1989.042) [-1989.507] (-1991.140) * (-1994.179) [-1990.673] (-1996.729) (-1997.471) -- 0:02:59
      443900 -- (-2002.022) (-1994.511) [-1986.907] (-1990.928) * [-1994.076] (-1997.425) (-1992.603) (-2001.257) -- 0:02:59
      444000 -- (-1997.345) (-1995.304) (-1982.347) [-1985.574] * [-1990.515] (-1996.635) (-2000.423) (-1997.909) -- 0:02:59

      Average standard deviation of split frequencies: 0.002062

      444100 -- (-2010.787) (-1992.618) [-1981.226] (-1988.749) * [-1992.083] (-1994.148) (-1991.831) (-2001.936) -- 0:02:58
      444200 -- (-2005.321) (-1993.731) [-1984.862] (-1988.908) * [-1994.176] (-1994.756) (-1993.014) (-1997.255) -- 0:02:58
      444300 -- (-2001.706) [-1992.231] (-1990.329) (-1988.334) * [-1990.109] (-2001.237) (-2000.892) (-1993.857) -- 0:02:58
      444400 -- (-2000.645) (-1988.569) (-1986.651) [-1989.054] * [-1987.541] (-2001.201) (-1995.993) (-1991.236) -- 0:02:58
      444500 -- (-2009.841) (-1995.664) [-1984.820] (-1985.064) * (-1989.529) (-1994.199) (-1994.174) [-1993.274] -- 0:02:58
      444600 -- (-2008.679) (-1996.393) [-1987.512] (-1993.441) * (-1994.165) (-2002.370) [-1995.757] (-2003.397) -- 0:02:58
      444700 -- (-1999.272) [-2001.079] (-1985.667) (-1988.190) * [-1991.348] (-2005.506) (-1986.127) (-1990.479) -- 0:02:58
      444800 -- (-1996.981) (-1999.994) (-1986.368) [-1985.953] * (-1992.444) (-2004.071) [-1988.974] (-1999.402) -- 0:02:58
      444900 -- (-1991.505) (-1997.774) [-1983.978] (-1985.476) * (-1992.737) (-1994.886) [-1990.316] (-1992.871) -- 0:02:58
      445000 -- [-1986.109] (-2001.465) (-1986.233) (-1987.653) * (-1994.889) (-1990.822) [-1987.477] (-1988.732) -- 0:02:58

      Average standard deviation of split frequencies: 0.002057

      445100 -- [-1987.500] (-2010.339) (-1986.436) (-1988.821) * (-1996.396) [-1989.317] (-1988.271) (-1997.154) -- 0:02:58
      445200 -- (-1988.700) (-1994.629) [-1984.323] (-1991.934) * (-1993.685) (-1989.990) (-1997.766) [-1986.347] -- 0:02:58
      445300 -- (-1987.569) (-1993.184) [-1977.318] (-1989.002) * (-1994.679) (-1986.769) (-2002.610) [-1990.872] -- 0:02:59
      445400 -- (-1988.669) (-1992.201) [-1981.179] (-1990.153) * [-1987.433] (-1990.075) (-2000.395) (-1992.524) -- 0:02:59
      445500 -- (-1992.329) (-1993.607) [-1982.564] (-1985.722) * (-2009.872) (-1997.813) (-1994.467) [-1989.257] -- 0:02:59
      445600 -- (-1992.024) (-1991.210) [-1984.344] (-1994.168) * (-1996.100) (-2008.874) [-1992.939] (-1992.133) -- 0:02:59
      445700 -- (-1992.727) (-1991.295) [-1991.362] (-1991.388) * (-1993.471) (-2003.706) [-1993.325] (-1996.428) -- 0:02:59
      445800 -- (-2000.190) (-1986.534) [-1992.657] (-1992.246) * (-1986.554) (-2005.311) [-1985.927] (-1987.190) -- 0:02:59
      445900 -- (-1993.910) (-1987.398) [-1980.466] (-1992.840) * [-1991.769] (-1999.600) (-1986.564) (-1989.579) -- 0:02:58
      446000 -- (-1988.159) [-1981.391] (-1981.357) (-1990.314) * [-1984.649] (-2003.614) (-1990.159) (-1990.741) -- 0:02:58

      Average standard deviation of split frequencies: 0.002355

      446100 -- (-1994.213) (-1986.253) [-1980.745] (-1991.110) * (-1987.037) (-1991.306) [-1986.035] (-1991.209) -- 0:02:58
      446200 -- (-2001.564) (-1991.054) [-1979.186] (-2001.412) * [-1982.816] (-1994.940) (-1986.978) (-1995.583) -- 0:02:58
      446300 -- (-1994.221) (-1996.893) [-1984.259] (-1990.459) * [-1984.378] (-1997.981) (-1989.234) (-2002.300) -- 0:02:58
      446400 -- (-1992.310) (-2002.259) [-1983.537] (-1991.678) * (-1986.779) (-2002.537) [-1990.347] (-1997.008) -- 0:02:58
      446500 -- (-1991.863) (-2001.869) [-1983.832] (-1993.911) * [-1979.690] (-1996.759) (-1992.330) (-1989.661) -- 0:02:58
      446600 -- [-1989.600] (-2013.945) (-1986.078) (-1992.156) * (-1982.046) [-1990.277] (-2000.930) (-1991.822) -- 0:02:58
      446700 -- (-1988.106) (-2009.286) (-1983.620) [-1987.475] * [-1981.351] (-1994.162) (-1996.088) (-1996.265) -- 0:02:58
      446800 -- [-1991.356] (-2003.052) (-1982.511) (-1986.794) * [-1985.700] (-1999.615) (-1990.578) (-2002.438) -- 0:02:58
      446900 -- (-1986.761) (-2002.497) [-1994.248] (-1987.099) * (-1989.169) (-1993.315) [-1988.256] (-1995.458) -- 0:02:58
      447000 -- (-1992.124) (-2006.408) (-1992.864) [-1984.069] * (-1994.860) [-1991.932] (-1984.973) (-1990.143) -- 0:02:58

      Average standard deviation of split frequencies: 0.002500

      447100 -- [-1985.010] (-2008.785) (-1991.832) (-1991.594) * (-1991.994) (-1994.078) [-1988.108] (-1997.056) -- 0:02:58
      447200 -- [-1984.473] (-2009.147) (-1995.018) (-1989.642) * (-1990.781) (-1995.569) [-1986.803] (-1997.509) -- 0:02:58
      447300 -- [-1990.573] (-1996.469) (-1996.030) (-1991.841) * [-1988.956] (-1994.579) (-1988.431) (-1993.622) -- 0:02:57
      447400 -- (-1987.542) (-1993.702) (-1986.705) [-1987.025] * [-1992.306] (-1999.275) (-1991.804) (-1993.354) -- 0:02:57
      447500 -- [-1989.952] (-1993.545) (-1990.075) (-1996.428) * [-1985.102] (-1991.230) (-1993.076) (-1999.928) -- 0:02:57
      447600 -- [-1986.706] (-1991.509) (-1991.557) (-1993.600) * [-1988.085] (-1986.966) (-1993.230) (-1990.111) -- 0:02:57
      447700 -- [-1990.992] (-1990.908) (-1991.813) (-1992.358) * [-1989.259] (-1985.815) (-1992.009) (-1989.037) -- 0:02:57
      447800 -- (-1994.511) [-1987.785] (-1997.027) (-1991.018) * (-1990.526) [-1988.062] (-1991.409) (-1986.413) -- 0:02:57
      447900 -- (-1989.041) (-1988.718) (-1992.429) [-1986.480] * (-1991.293) (-1985.759) [-1985.392] (-1989.615) -- 0:02:57
      448000 -- (-1984.148) (-1989.983) (-2003.721) [-1984.357] * (-1994.665) [-1986.001] (-1984.901) (-1994.914) -- 0:02:57

      Average standard deviation of split frequencies: 0.002495

      448100 -- (-1987.832) (-2002.281) (-1994.422) [-1986.973] * (-1989.109) [-1981.913] (-1982.985) (-1999.836) -- 0:02:57
      448200 -- [-1986.932] (-2005.307) (-1983.553) (-1983.907) * (-1980.821) (-1986.521) [-1983.850] (-1996.977) -- 0:02:57
      448300 -- (-1985.835) (-2001.883) (-1982.728) [-1987.063] * [-1984.845] (-1981.984) (-1989.704) (-1999.081) -- 0:02:58
      448400 -- (-1986.803) (-1997.401) [-1984.353] (-1984.147) * [-1983.824] (-1983.115) (-1987.902) (-2000.290) -- 0:02:58
      448500 -- (-1993.593) (-1994.690) (-1984.956) [-1979.019] * [-1983.297] (-1982.862) (-2001.922) (-1997.667) -- 0:02:58
      448600 -- (-1992.802) (-1991.733) (-1986.585) [-1983.529] * (-1985.806) [-1981.135] (-2003.362) (-1999.986) -- 0:02:58
      448700 -- (-1993.399) (-1988.995) [-1989.699] (-1986.776) * (-1987.560) [-1979.789] (-2001.081) (-1998.296) -- 0:02:58
      448800 -- [-1988.929] (-1997.764) (-1988.142) (-1989.704) * (-1995.080) [-1981.578] (-2002.621) (-1997.949) -- 0:02:58
      448900 -- (-1989.406) (-1996.902) [-1984.348] (-1983.190) * [-1986.768] (-1984.732) (-1993.015) (-1997.739) -- 0:02:58
      449000 -- (-2008.491) (-2000.580) (-1987.026) [-1983.063] * [-1983.244] (-1983.362) (-2000.631) (-1993.535) -- 0:02:57

      Average standard deviation of split frequencies: 0.002399

      449100 -- (-2000.884) (-1998.945) (-1981.991) [-1987.385] * (-1986.942) [-1986.406] (-1997.788) (-1991.822) -- 0:02:57
      449200 -- [-1989.883] (-2004.447) (-1979.036) (-1987.067) * [-1986.679] (-1987.113) (-1992.747) (-1995.867) -- 0:02:57
      449300 -- (-1988.231) (-2012.733) [-1984.342] (-1995.460) * (-1981.097) [-1979.446] (-1995.032) (-1992.864) -- 0:02:57
      449400 -- [-1984.657] (-2007.381) (-1981.413) (-1997.563) * (-1986.169) [-1987.034] (-1999.791) (-1996.825) -- 0:02:57
      449500 -- (-1983.466) (-2009.304) [-1980.191] (-2001.688) * [-1983.839] (-1987.345) (-1996.261) (-1999.295) -- 0:02:57
      449600 -- (-1986.346) (-2007.518) [-1983.694] (-1994.753) * (-1985.920) (-1985.167) (-1998.260) [-1988.924] -- 0:02:57
      449700 -- (-1989.285) (-1999.715) [-1982.051] (-1992.651) * [-1983.881] (-1991.263) (-1990.633) (-2001.683) -- 0:02:57
      449800 -- (-1992.860) (-1999.151) [-1980.443] (-1989.898) * [-1985.926] (-1987.631) (-2001.378) (-1995.822) -- 0:02:57
      449900 -- (-1989.864) (-1993.053) [-1985.263] (-1986.977) * [-1984.489] (-1987.810) (-1996.866) (-1996.208) -- 0:02:57
      450000 -- (-1990.341) (-1997.114) [-1985.885] (-1987.698) * [-1984.972] (-1993.947) (-1996.912) (-2000.201) -- 0:02:57

      Average standard deviation of split frequencies: 0.002214

      450100 -- (-1991.751) (-1994.855) [-1985.863] (-1993.343) * [-1985.177] (-1991.341) (-1997.156) (-2007.266) -- 0:02:57
      450200 -- (-1991.460) (-1995.136) [-1987.028] (-1993.018) * [-1988.785] (-1992.611) (-2000.459) (-2007.182) -- 0:02:57
      450300 -- (-2002.104) (-2003.034) [-1984.292] (-1990.504) * (-1984.653) [-1992.219] (-1998.046) (-2002.004) -- 0:02:57
      450400 -- (-2006.249) (-1996.135) [-1985.900] (-1998.473) * [-1980.585] (-1988.098) (-1993.713) (-1996.144) -- 0:02:56
      450500 -- (-2000.496) (-1991.303) [-1979.629] (-1989.525) * (-1984.813) [-1989.624] (-2001.556) (-1997.778) -- 0:02:56
      450600 -- (-2010.111) (-1992.788) [-1985.588] (-1996.249) * (-1981.311) (-1990.400) (-1992.966) [-1992.883] -- 0:02:56
      450700 -- (-1999.123) [-1983.117] (-1985.098) (-1993.439) * [-1980.963] (-1995.312) (-1997.043) (-1989.711) -- 0:02:56
      450800 -- (-1992.960) (-1999.321) [-1985.387] (-1986.036) * [-1984.727] (-1997.370) (-1992.442) (-1987.676) -- 0:02:56
      450900 -- (-2002.500) (-1993.306) [-1986.408] (-1988.967) * [-1982.718] (-2001.723) (-1998.951) (-1987.313) -- 0:02:56
      451000 -- (-2002.346) (-1993.691) [-1986.837] (-1983.833) * (-1979.414) (-1994.423) (-1995.504) [-1992.607] -- 0:02:56

      Average standard deviation of split frequencies: 0.002388

      451100 -- [-1986.808] (-1990.088) (-1989.594) (-1999.297) * [-1979.334] (-1987.537) (-1987.425) (-1995.420) -- 0:02:56
      451200 -- [-1988.798] (-1992.617) (-1998.541) (-1999.219) * (-1981.338) [-1990.668] (-1990.291) (-1992.644) -- 0:02:56
      451300 -- (-1993.933) (-1988.545) (-1990.389) [-1990.304] * (-1982.030) (-1991.317) [-1983.900] (-1996.310) -- 0:02:56
      451400 -- (-2009.565) (-1987.219) (-1984.753) [-1986.069] * (-1988.366) (-1991.111) [-1981.018] (-1990.228) -- 0:02:57
      451500 -- (-1993.378) (-1987.875) [-1985.925] (-1985.663) * (-1984.145) (-1998.130) [-1976.964] (-1992.423) -- 0:02:57
      451600 -- [-1991.260] (-1990.931) (-1988.427) (-1985.678) * (-1984.303) (-1990.491) [-1977.303] (-2001.914) -- 0:02:57
      451700 -- (-1998.015) (-2000.307) (-1992.986) [-1986.923] * (-1992.600) (-1988.866) [-1981.602] (-1995.615) -- 0:02:57
      451800 -- (-1991.181) (-2003.582) (-1994.276) [-1981.109] * (-1990.502) [-1990.456] (-1985.034) (-1998.109) -- 0:02:57
      451900 -- (-1985.138) (-1998.137) (-1990.172) [-1985.618] * (-1995.438) (-1994.384) [-1981.255] (-1996.701) -- 0:02:57
      452000 -- (-1987.065) (-1997.987) (-1985.888) [-1982.905] * (-1996.742) (-1986.361) [-1983.619] (-1995.507) -- 0:02:57

      Average standard deviation of split frequencies: 0.002532

      452100 -- (-1993.166) (-2003.832) (-1987.841) [-1984.554] * (-2003.308) (-1985.200) [-1979.781] (-1993.130) -- 0:02:56
      452200 -- (-1998.860) (-2006.452) (-1986.852) [-1986.398] * (-2003.553) (-1993.722) [-1978.125] (-1995.037) -- 0:02:56
      452300 -- (-1991.660) (-2007.508) [-1981.205] (-1984.754) * (-1991.822) (-1985.769) [-1979.129] (-1985.552) -- 0:02:56
      452400 -- (-1992.807) (-2010.245) (-1987.383) [-1978.098] * (-1987.654) (-1989.906) [-1981.273] (-1985.312) -- 0:02:56
      452500 -- (-1991.282) (-2017.699) (-1984.170) [-1984.888] * [-1992.512] (-1994.763) (-1977.208) (-1992.721) -- 0:02:56
      452600 -- (-1993.288) (-2005.359) (-1984.719) [-1990.206] * [-1984.764] (-2003.058) (-1978.647) (-1988.351) -- 0:02:56
      452700 -- (-1991.717) (-2001.731) [-1980.706] (-1982.895) * [-1988.061] (-1997.339) (-1975.968) (-1998.092) -- 0:02:56
      452800 -- (-1992.811) (-2002.656) [-1980.314] (-1985.090) * (-1985.208) (-1990.540) [-1979.467] (-1992.007) -- 0:02:56
      452900 -- (-1992.003) (-2002.336) [-1978.581] (-1990.850) * (-1983.932) (-1992.604) [-1981.083] (-1989.525) -- 0:02:56
      453000 -- (-1988.279) (-2002.797) [-1981.060] (-1990.869) * (-1985.381) (-1993.361) [-1982.739] (-1988.535) -- 0:02:56

      Average standard deviation of split frequencies: 0.002526

      453100 -- (-1986.997) (-2007.098) [-1977.853] (-1988.204) * (-1991.301) (-1990.299) [-1985.131] (-1986.510) -- 0:02:56
      453200 -- (-1991.569) (-2004.083) [-1982.283] (-1988.181) * (-1996.646) (-1996.146) [-1982.390] (-1991.539) -- 0:02:56
      453300 -- (-1995.071) (-1999.772) (-1980.097) [-1986.173] * (-1998.178) (-1990.307) [-1984.811] (-1993.983) -- 0:02:56
      453400 -- (-1986.812) (-1999.533) [-1978.407] (-1982.131) * (-1998.031) (-1991.600) [-1981.467] (-1991.071) -- 0:02:56
      453500 -- (-1985.221) (-1998.731) [-1983.334] (-1983.084) * (-1996.499) [-1987.620] (-1987.755) (-1993.953) -- 0:02:55
      453600 -- (-1989.425) (-1990.638) (-1984.187) [-1981.745] * (-1994.919) [-1988.542] (-1995.188) (-1989.403) -- 0:02:55
      453700 -- (-1995.343) (-1993.422) (-1983.953) [-1986.184] * (-1990.338) (-1987.713) (-1996.505) [-1986.697] -- 0:02:55
      453800 -- [-1988.788] (-1997.140) (-1988.324) (-1989.100) * (-1997.864) [-1983.960] (-1993.101) (-1985.641) -- 0:02:55
      453900 -- (-1994.040) (-1999.135) (-1985.863) [-1985.441] * (-1992.557) [-1983.819] (-1989.308) (-1994.619) -- 0:02:55
      454000 -- (-1998.009) (-2002.488) (-1985.021) [-1988.931] * (-1992.552) (-1986.533) [-1987.489] (-1996.776) -- 0:02:55

      Average standard deviation of split frequencies: 0.002640

      454100 -- [-1988.103] (-1995.091) (-1986.822) (-1986.669) * (-1995.815) [-1986.621] (-1983.499) (-1990.253) -- 0:02:55
      454200 -- (-1990.147) (-1999.812) [-1983.413] (-1979.663) * (-1993.272) (-1987.242) [-1987.189] (-1998.098) -- 0:02:55
      454300 -- (-1989.071) (-1999.872) (-1988.069) [-1981.211] * (-1999.917) (-1987.328) [-1989.555] (-1999.371) -- 0:02:55
      454400 -- (-1997.605) (-1998.519) [-1986.451] (-1984.985) * (-1996.112) [-1987.288] (-1985.862) (-1998.709) -- 0:02:55
      454500 -- (-1998.030) (-1997.269) [-1984.953] (-1986.518) * (-1996.755) (-1987.051) (-1979.918) [-1987.192] -- 0:02:56
      454600 -- (-1992.272) (-1992.366) (-1986.320) [-1986.052] * (-1997.541) (-1985.171) (-1982.621) [-1991.236] -- 0:02:56
      454700 -- (-1995.391) (-1985.427) (-1987.575) [-1983.207] * (-1999.127) [-1987.196] (-1982.227) (-1997.287) -- 0:02:56
      454800 -- (-1989.350) [-1986.581] (-1989.992) (-1983.878) * (-2005.139) [-1984.743] (-1981.351) (-1992.590) -- 0:02:56
      454900 -- (-1992.976) (-1985.217) [-1988.713] (-1981.279) * (-2008.531) (-1990.175) [-1983.143] (-1988.845) -- 0:02:56
      455000 -- (-1990.925) [-1986.627] (-1994.664) (-1986.107) * (-2001.197) (-1992.541) [-1982.550] (-1993.771) -- 0:02:56

      Average standard deviation of split frequencies: 0.002604

      455100 -- (-1987.962) [-1986.407] (-1993.797) (-1992.007) * (-1996.679) (-1986.621) [-1981.867] (-1998.900) -- 0:02:56
      455200 -- (-1999.951) [-1984.745] (-1996.285) (-1990.455) * (-1995.435) (-1990.403) (-1981.531) [-1993.147] -- 0:02:55
      455300 -- (-1996.760) (-1987.130) [-1987.272] (-1994.412) * (-1992.686) (-1995.231) [-1983.372] (-1992.017) -- 0:02:55
      455400 -- [-1992.977] (-1987.894) (-1989.018) (-1991.913) * (-1996.621) (-1996.688) (-1984.907) [-1986.541] -- 0:02:55
      455500 -- (-1993.846) [-1988.941] (-1986.150) (-1986.955) * (-1995.790) (-1994.053) [-1981.905] (-1986.427) -- 0:02:55
      455600 -- (-1995.957) (-1994.608) [-1983.018] (-1987.762) * [-1985.139] (-1988.982) (-1985.256) (-1986.954) -- 0:02:55
      455700 -- (-1997.489) (-1996.671) [-1984.485] (-1983.557) * (-1984.963) (-1986.436) [-1984.613] (-1999.272) -- 0:02:55
      455800 -- (-1995.657) (-2009.520) (-1985.825) [-1985.254] * (-1987.078) (-1982.435) [-1983.745] (-1995.517) -- 0:02:55
      455900 -- (-1992.241) (-2001.610) (-1983.590) [-1979.752] * (-1991.776) (-1988.861) [-1982.380] (-1992.083) -- 0:02:55
      456000 -- (-1995.150) (-2001.293) [-1983.508] (-1983.756) * (-1992.592) [-1986.408] (-1985.998) (-1998.197) -- 0:02:55

      Average standard deviation of split frequencies: 0.002598

      456100 -- (-1993.486) (-2008.021) (-1983.927) [-1985.957] * (-2000.222) (-1985.651) [-1982.371] (-1992.919) -- 0:02:55
      456200 -- (-1993.133) (-2010.321) (-1983.864) [-1985.944] * (-2002.833) (-1984.453) (-1982.279) [-1997.938] -- 0:02:55
      456300 -- (-1993.215) (-2015.270) (-1989.616) [-1989.601] * (-2004.684) [-1990.409] (-1986.591) (-1993.238) -- 0:02:55
      456400 -- (-1998.665) (-2003.245) [-1992.562] (-1990.848) * (-1996.105) (-1992.872) [-1984.586] (-1995.730) -- 0:02:55
      456500 -- [-1995.346] (-1997.667) (-1996.920) (-1991.700) * (-1992.548) (-1992.580) [-1984.049] (-2001.339) -- 0:02:55
      456600 -- [-1991.262] (-1989.754) (-1989.810) (-1991.278) * (-1997.697) (-1988.607) [-1978.960] (-1990.786) -- 0:02:54
      456700 -- (-1992.141) (-1994.375) [-1985.485] (-1990.361) * (-1991.755) (-1994.471) [-1980.763] (-1988.348) -- 0:02:54
      456800 -- (-1993.651) (-1990.475) [-1988.427] (-1993.570) * (-1984.432) [-1990.707] (-1985.261) (-1989.383) -- 0:02:54
      456900 -- (-2004.119) (-1998.258) [-1990.725] (-2005.057) * (-1989.111) (-1989.484) [-1981.245] (-1993.338) -- 0:02:54
      457000 -- (-1997.737) (-2004.996) [-1982.714] (-2002.899) * (-1995.449) (-1991.756) [-1980.679] (-1994.122) -- 0:02:54

      Average standard deviation of split frequencies: 0.002327

      457100 -- (-1991.365) (-1998.080) [-1981.164] (-2003.403) * (-1990.091) (-1984.070) (-1980.163) [-1991.335] -- 0:02:54
      457200 -- (-2001.980) (-1998.818) [-1979.484] (-2008.697) * (-1992.713) (-1981.480) [-1982.633] (-1989.843) -- 0:02:54
      457300 -- (-1993.827) (-1994.905) [-1984.529] (-2001.736) * (-1988.911) [-1983.059] (-1985.305) (-1992.156) -- 0:02:54
      457400 -- (-1991.316) (-1991.446) [-1985.580] (-2010.174) * [-1985.912] (-1987.627) (-1990.961) (-1989.308) -- 0:02:54
      457500 -- (-1993.387) (-1996.338) [-1980.963] (-1997.001) * (-1991.396) [-1984.657] (-1991.219) (-1988.506) -- 0:02:55
      457600 -- (-1991.807) [-1989.175] (-1986.637) (-1994.649) * [-1990.994] (-1987.173) (-1988.086) (-1991.055) -- 0:02:55
      457700 -- (-1995.824) (-1996.079) [-1981.980] (-1995.767) * (-1992.903) [-1986.666] (-1986.398) (-1985.073) -- 0:02:55
      457800 -- (-1990.655) (-1998.859) [-1978.118] (-2001.784) * (-1993.578) [-1983.921] (-1982.015) (-1990.991) -- 0:02:55
      457900 -- (-1996.309) (-1999.358) [-1977.297] (-1995.163) * (-1991.911) [-1977.760] (-1995.910) (-1990.735) -- 0:02:55
      458000 -- (-1998.865) (-1992.668) [-1978.731] (-1997.344) * (-1991.383) [-1983.259] (-1999.866) (-1997.047) -- 0:02:55

      Average standard deviation of split frequencies: 0.002381

      458100 -- (-1992.929) [-1988.065] (-1982.981) (-1994.807) * (-1992.448) [-1981.564] (-1990.979) (-1990.495) -- 0:02:55
      458200 -- (-1998.488) (-1990.443) [-1982.128] (-1992.987) * (-1991.268) [-1977.736] (-1984.994) (-1999.689) -- 0:02:55
      458300 -- (-1994.896) (-1988.868) [-1981.112] (-1999.089) * (-1992.596) [-1985.255] (-1988.890) (-1994.710) -- 0:02:54
      458400 -- (-2005.875) (-1987.098) [-1981.886] (-1992.221) * (-1990.912) [-1984.749] (-1991.819) (-1995.211) -- 0:02:54
      458500 -- (-1996.777) (-1989.626) (-1984.162) [-1987.106] * (-1991.982) (-1990.182) (-1991.280) [-1985.668] -- 0:02:54
      458600 -- (-1997.373) (-1991.551) [-1984.574] (-1986.349) * (-1991.603) (-1993.939) (-1991.946) [-1987.770] -- 0:02:54
      458700 -- (-1995.975) (-1983.323) [-1985.704] (-1991.713) * [-1991.457] (-1984.308) (-1994.398) (-2001.212) -- 0:02:54
      458800 -- (-1994.889) [-1985.398] (-1997.264) (-1987.609) * (-1992.336) (-1989.808) [-1992.753] (-1995.056) -- 0:02:54
      458900 -- (-1993.314) (-1983.575) (-1986.832) [-1992.862] * [-1986.228] (-1996.332) (-1985.252) (-1991.088) -- 0:02:54
      459000 -- (-1994.470) (-1991.842) [-1987.393] (-1996.981) * (-1991.065) (-1986.208) [-1984.618] (-1993.613) -- 0:02:54

      Average standard deviation of split frequencies: 0.002229

      459100 -- (-1999.377) (-1994.273) [-1991.563] (-1990.408) * (-1994.265) [-1990.699] (-1991.025) (-1990.625) -- 0:02:54
      459200 -- (-2000.490) [-1987.843] (-1995.914) (-1985.293) * (-1998.458) (-1986.717) [-1982.456] (-1995.108) -- 0:02:54
      459300 -- (-1989.575) (-1992.023) (-1997.288) [-1983.225] * (-2002.177) (-1993.803) [-1981.407] (-1992.781) -- 0:02:54
      459400 -- (-1989.736) (-1997.095) (-2000.792) [-1984.960] * (-2002.246) [-1995.405] (-1987.348) (-1993.343) -- 0:02:54
      459500 -- [-1984.774] (-1998.429) (-1999.587) (-1985.672) * (-1996.910) (-1995.011) (-1984.360) [-1992.984] -- 0:02:54
      459600 -- (-1995.818) (-1997.655) [-1985.586] (-1991.737) * (-1993.704) [-1994.111] (-1988.094) (-1996.751) -- 0:02:54
      459700 -- (-1991.428) (-2002.948) [-1989.225] (-1988.024) * (-1998.190) (-1993.907) [-1988.209] (-2000.847) -- 0:02:53
      459800 -- (-1995.265) (-2001.686) [-1985.592] (-1995.887) * (-2003.510) (-2001.469) [-1984.103] (-1995.451) -- 0:02:53
      459900 -- (-1997.710) (-2010.865) [-1983.126] (-1992.450) * (-2001.053) (-1996.313) [-1982.691] (-2006.747) -- 0:02:53
      460000 -- (-1995.278) (-2000.124) [-1990.210] (-1991.564) * (-2002.382) (-1987.393) [-1982.779] (-2015.452) -- 0:02:53

      Average standard deviation of split frequencies: 0.002342

      460100 -- (-1991.901) (-1998.782) (-1997.900) [-1991.911] * (-1999.389) (-1987.337) [-1981.899] (-2018.314) -- 0:02:53
      460200 -- (-1990.936) (-1999.886) (-1989.809) [-1987.569] * (-1995.793) [-1994.015] (-1991.047) (-2004.094) -- 0:02:53
      460300 -- (-1997.872) (-1997.653) (-1993.075) [-1983.679] * (-1993.868) (-1986.314) [-1987.442] (-1995.131) -- 0:02:53
      460400 -- (-2001.565) (-1997.189) (-1984.943) [-1983.816] * (-1989.368) (-1986.415) [-1990.382] (-1994.073) -- 0:02:53
      460500 -- (-1996.834) (-2002.787) (-1979.489) [-1983.069] * (-2006.492) (-1986.167) [-1988.667] (-2003.422) -- 0:02:53
      460600 -- (-1996.855) (-2000.765) (-1983.834) [-1982.709] * (-1999.429) [-1983.332] (-1999.617) (-2003.661) -- 0:02:54
      460700 -- (-1989.974) (-1998.499) (-1979.690) [-1983.382] * (-1990.404) [-1985.755] (-1992.149) (-1995.517) -- 0:02:54
      460800 -- [-1987.362] (-1994.958) (-1983.169) (-1988.788) * (-2001.973) (-1985.263) [-1983.613] (-1996.143) -- 0:02:54
      460900 -- [-1985.758] (-1998.141) (-1982.364) (-1994.499) * (-2007.197) [-1990.261] (-1984.089) (-1994.884) -- 0:02:54
      461000 -- [-1985.159] (-1993.831) (-1988.349) (-1991.580) * (-2005.439) [-1989.543] (-1986.854) (-1985.947) -- 0:02:54

      Average standard deviation of split frequencies: 0.002482

      461100 -- (-1990.871) (-1996.670) [-1983.805] (-1996.690) * (-1991.536) (-1985.831) (-1991.223) [-1992.089] -- 0:02:54
      461200 -- [-1989.567] (-1991.660) (-1984.909) (-1997.802) * (-1997.050) [-1983.477] (-1987.686) (-2004.000) -- 0:02:54
      461300 -- (-1991.775) (-2009.602) (-1986.262) [-1993.708] * (-2003.083) (-1986.253) [-1988.359] (-1996.741) -- 0:02:54
      461400 -- (-1992.293) (-1999.714) [-1984.180] (-1987.034) * (-1995.615) [-1982.677] (-1984.868) (-1992.134) -- 0:02:53
      461500 -- (-1992.469) (-1995.913) [-1985.852] (-1984.630) * [-1990.353] (-1983.383) (-1986.591) (-1991.928) -- 0:02:53
      461600 -- (-1996.842) (-1988.889) (-1994.042) [-1981.502] * (-1995.426) [-1986.175] (-1991.670) (-1998.503) -- 0:02:53
      461700 -- (-1992.186) (-1986.771) (-1995.068) [-1980.537] * (-1995.871) (-1988.867) (-1997.930) [-1987.555] -- 0:02:53
      461800 -- (-1987.505) (-1986.915) (-1988.950) [-1980.347] * (-1998.655) (-1982.121) (-2000.797) [-1990.196] -- 0:02:53
      461900 -- (-1984.267) (-1986.283) (-1993.952) [-1985.002] * (-2005.592) [-1981.772] (-1991.874) (-1994.611) -- 0:02:53
      462000 -- (-1991.313) (-1982.410) [-1990.815] (-1984.764) * (-2000.812) [-1984.221] (-1989.628) (-2000.113) -- 0:02:53

      Average standard deviation of split frequencies: 0.002623

      462100 -- (-1990.694) [-1982.640] (-1988.256) (-1986.169) * (-2006.700) [-1988.499] (-1988.959) (-1999.555) -- 0:02:53
      462200 -- (-1986.776) [-1984.436] (-1987.595) (-1984.801) * (-2009.221) [-1978.610] (-1997.315) (-2003.463) -- 0:02:53
      462300 -- [-1990.795] (-1993.751) (-1989.918) (-1988.816) * (-2006.826) [-1982.473] (-1995.446) (-2002.692) -- 0:02:53
      462400 -- (-1989.549) (-1998.326) [-1987.719] (-1984.533) * (-2014.370) [-1986.777] (-1991.751) (-1997.694) -- 0:02:53
      462500 -- [-1991.457] (-1999.013) (-1987.994) (-1995.684) * (-2005.814) [-1984.277] (-1994.293) (-1992.447) -- 0:02:53
      462600 -- [-1994.433] (-1993.159) (-1986.558) (-1991.877) * (-1995.301) (-1985.782) (-1993.051) [-1993.492] -- 0:02:53
      462700 -- (-1997.209) (-1992.593) [-1986.892] (-2002.699) * (-1992.301) [-1984.264] (-1990.890) (-1994.478) -- 0:02:53
      462800 -- (-2003.129) (-1998.880) [-1986.841] (-2001.388) * (-1991.580) (-1990.416) [-1993.867] (-1997.063) -- 0:02:52
      462900 -- (-1998.417) (-1996.282) [-1979.964] (-2000.419) * (-1991.212) [-1985.835] (-1998.461) (-1993.744) -- 0:02:52
      463000 -- (-2005.466) (-1998.904) [-1981.897] (-2001.334) * [-1994.004] (-1982.189) (-1996.110) (-1997.153) -- 0:02:52

      Average standard deviation of split frequencies: 0.002413

      463100 -- (-2012.524) (-1999.143) [-1978.954] (-2006.982) * (-1991.843) [-1979.991] (-1986.039) (-1991.153) -- 0:02:52
      463200 -- (-2005.424) (-2003.228) [-1986.569] (-1993.339) * [-1994.585] (-1982.193) (-1989.357) (-1998.508) -- 0:02:52
      463300 -- (-2003.130) (-1994.248) [-1985.988] (-1992.969) * (-1988.234) [-1983.298] (-1990.367) (-2000.144) -- 0:02:52
      463400 -- (-1996.796) (-1997.439) [-1983.193] (-1995.070) * (-1989.502) [-1979.080] (-1995.702) (-1994.300) -- 0:02:52
      463500 -- (-1995.268) (-1995.203) [-1981.724] (-1995.029) * [-1988.767] (-1982.883) (-1995.324) (-1992.897) -- 0:02:52
      463600 -- (-1988.883) (-1991.588) [-1985.921] (-1987.986) * [-1990.830] (-1988.377) (-1993.970) (-2001.072) -- 0:02:52
      463700 -- (-1990.935) (-1990.073) [-1986.223] (-1987.382) * (-1992.172) [-1979.891] (-1985.671) (-2002.342) -- 0:02:53
      463800 -- (-1994.919) (-1986.182) (-1987.539) [-1986.211] * (-1990.045) [-1980.842] (-1992.571) (-1996.880) -- 0:02:53
      463900 -- (-2002.473) (-1987.078) (-1987.605) [-1986.660] * [-1989.496] (-1981.077) (-1994.205) (-1991.136) -- 0:02:53
      464000 -- (-1993.882) (-1987.760) [-1986.473] (-1986.293) * (-1985.102) [-1980.282] (-1994.712) (-1990.555) -- 0:02:53

      Average standard deviation of split frequencies: 0.002467

      464100 -- (-1999.186) (-1990.745) (-1987.206) [-1986.225] * (-1989.027) [-1978.624] (-1993.525) (-1990.749) -- 0:02:53
      464200 -- (-1994.372) (-1986.472) (-1982.317) [-1986.686] * (-1989.439) [-1978.253] (-1991.097) (-1991.149) -- 0:02:53
      464300 -- (-1994.273) [-1985.388] (-1990.576) (-1983.535) * (-1995.107) [-1985.712] (-1988.776) (-1995.575) -- 0:02:53
      464400 -- (-2002.182) (-1993.153) (-1989.994) [-1984.120] * (-1998.361) [-1981.373] (-1993.372) (-1995.555) -- 0:02:52
      464500 -- (-2004.529) (-1989.569) [-1984.386] (-1991.196) * (-1992.570) [-1978.861] (-1995.796) (-2000.629) -- 0:02:52
      464600 -- (-2001.858) (-1998.038) [-1988.313] (-1992.669) * [-1998.152] (-1989.936) (-1993.870) (-2006.972) -- 0:02:52
      464700 -- (-1998.569) (-1994.462) (-1987.961) [-1989.550] * (-1991.343) [-1990.736] (-1994.711) (-1999.446) -- 0:02:52
      464800 -- (-1997.031) (-1988.026) (-1991.989) [-1986.121] * (-2000.577) (-1987.576) (-2001.794) [-1993.301] -- 0:02:52
      464900 -- (-2000.311) [-1988.526] (-1995.479) (-1991.428) * (-1993.595) (-1989.746) (-1994.341) [-1987.114] -- 0:02:52
      465000 -- (-2006.484) [-1985.463] (-2001.584) (-1983.051) * (-1990.698) (-1991.402) (-1986.169) [-1987.345] -- 0:02:52

      Average standard deviation of split frequencies: 0.002635

      465100 -- (-1996.490) [-1984.249] (-1999.210) (-1982.255) * (-2000.181) [-1986.251] (-1985.650) (-1992.461) -- 0:02:52
      465200 -- (-1994.008) (-1984.397) (-1997.534) [-1979.088] * [-1998.404] (-1992.401) (-1986.743) (-1987.719) -- 0:02:52
      465300 -- (-1991.970) (-1981.966) (-1986.853) [-1984.906] * (-1989.890) (-1987.151) [-1990.073] (-1987.236) -- 0:02:52
      465400 -- (-1985.928) (-1992.018) [-1984.109] (-1986.601) * (-1986.380) [-1985.953] (-1995.878) (-1993.010) -- 0:02:52
      465500 -- [-1980.386] (-1991.709) (-1988.456) (-1993.005) * [-1987.631] (-1983.838) (-1991.286) (-1992.703) -- 0:02:52
      465600 -- [-1984.058] (-1986.884) (-1988.114) (-1995.579) * (-1999.417) [-1983.484] (-1983.367) (-1994.054) -- 0:02:52
      465700 -- (-1991.632) [-1989.226] (-1990.049) (-1994.721) * [-1992.399] (-1988.577) (-1984.566) (-1996.943) -- 0:02:52
      465800 -- (-1991.918) (-1990.261) [-1987.650] (-1986.575) * (-1994.750) (-1982.562) [-1986.204] (-1999.799) -- 0:02:52
      465900 -- (-1994.722) [-1997.112] (-1997.749) (-1992.027) * (-1995.262) (-1984.770) [-1985.945] (-1996.507) -- 0:02:51
      466000 -- [-1989.279] (-1998.408) (-1983.691) (-1992.557) * (-2003.486) (-1987.327) [-1989.146] (-1994.221) -- 0:02:51

      Average standard deviation of split frequencies: 0.002832

      466100 -- (-1997.042) (-1993.303) [-1985.196] (-1995.674) * (-1998.459) (-1996.328) [-1986.279] (-1989.661) -- 0:02:51
      466200 -- (-1993.471) (-1990.089) [-1990.439] (-1995.112) * [-1989.480] (-1987.454) (-1984.532) (-1988.731) -- 0:02:51
      466300 -- (-1987.810) (-1988.382) (-1987.799) [-1985.205] * (-2001.899) (-1986.725) [-1984.499] (-1992.525) -- 0:02:51
      466400 -- (-1993.931) (-1988.324) [-1980.988] (-1982.819) * (-1997.489) [-1986.991] (-1990.387) (-1989.576) -- 0:02:51
      466500 -- (-1997.039) (-1992.286) [-1978.533] (-1986.441) * (-1991.210) [-1991.101] (-1986.777) (-1989.485) -- 0:02:51
      466600 -- (-2002.394) (-2001.182) [-1979.983] (-1983.828) * (-1994.398) [-1986.126] (-1990.152) (-2000.926) -- 0:02:51
      466700 -- (-1992.485) (-1996.354) [-1981.010] (-1989.726) * (-1995.030) [-1986.895] (-1988.329) (-1996.606) -- 0:02:52
      466800 -- (-1991.666) (-2002.735) [-1977.358] (-1989.427) * (-2000.391) [-1987.243] (-1985.566) (-1996.228) -- 0:02:52
      466900 -- (-1990.999) (-2003.736) [-1977.375] (-1990.835) * (-1998.493) (-1997.294) [-1985.443] (-2008.359) -- 0:02:52
      467000 -- (-1992.038) (-1996.495) [-1979.953] (-1993.200) * (-1999.047) (-1990.982) [-1987.380] (-2008.282) -- 0:02:52

      Average standard deviation of split frequencies: 0.002969

      467100 -- (-1995.132) (-1992.974) [-1983.645] (-1992.526) * (-2007.995) [-1993.190] (-1989.698) (-2002.268) -- 0:02:52
      467200 -- (-1996.598) (-1988.368) [-1985.482] (-1993.855) * (-2004.844) [-1991.775] (-1999.647) (-2002.752) -- 0:02:52
      467300 -- (-1993.578) (-1991.295) [-1983.979] (-1995.290) * [-2000.021] (-1987.385) (-1996.871) (-1997.724) -- 0:02:52
      467400 -- [-1994.871] (-1992.258) (-1984.416) (-1996.334) * (-1993.578) [-1982.106] (-1999.821) (-2006.101) -- 0:02:52
      467500 -- (-2000.934) [-1990.491] (-1986.383) (-1997.438) * [-1986.802] (-1981.048) (-2006.137) (-2013.676) -- 0:02:51
      467600 -- (-1997.670) (-1990.769) [-1989.489] (-1987.100) * (-1996.443) [-1977.825] (-2007.396) (-2009.611) -- 0:02:51
      467700 -- (-1992.767) (-1999.821) (-1989.520) [-1991.541] * (-1990.351) [-1981.482] (-1998.779) (-2001.576) -- 0:02:51
      467800 -- (-1992.654) (-1997.286) [-1986.291] (-1994.276) * [-1991.044] (-1982.925) (-1997.766) (-2007.608) -- 0:02:51
      467900 -- (-1994.502) (-1995.473) [-1986.551] (-2002.025) * [-1988.803] (-1982.555) (-1990.762) (-2024.637) -- 0:02:51
      468000 -- (-1994.913) (-1988.673) [-1990.281] (-2000.560) * (-1996.672) [-1988.031] (-1992.942) (-2021.877) -- 0:02:51

      Average standard deviation of split frequencies: 0.002848

      468100 -- (-1992.634) [-1986.224] (-1987.937) (-1993.819) * (-1997.454) (-1988.506) [-1987.257] (-2015.352) -- 0:02:51
      468200 -- (-1994.986) [-1984.891] (-1991.607) (-1994.260) * (-1994.241) (-1998.738) [-1990.237] (-2018.415) -- 0:02:51
      468300 -- (-1992.149) [-1992.105] (-1991.444) (-1991.867) * [-1988.141] (-1994.859) (-1991.682) (-2011.252) -- 0:02:51
      468400 -- (-1993.835) (-1994.783) [-1991.880] (-2001.503) * [-1990.282] (-1995.292) (-1989.741) (-2015.346) -- 0:02:51
      468500 -- (-1996.910) [-1999.312] (-2000.433) (-1996.305) * [-1991.323] (-1999.111) (-1992.297) (-1997.360) -- 0:02:51
      468600 -- (-1994.341) (-2001.123) (-1999.997) [-1990.691] * (-1989.786) (-2000.060) [-1990.326] (-1995.347) -- 0:02:51
      468700 -- (-1991.412) (-1996.493) (-2001.909) [-1988.670] * (-1997.252) (-2008.987) (-1990.162) [-1990.588] -- 0:02:51
      468800 -- (-1998.554) (-1992.034) (-2010.620) [-1989.521] * (-1992.765) (-2001.681) [-1983.508] (-1994.068) -- 0:02:51
      468900 -- (-1996.954) (-1999.986) (-2004.771) [-1987.994] * (-1989.011) (-1998.851) [-1984.954] (-1999.399) -- 0:02:51
      469000 -- (-1996.008) (-1992.382) (-2008.770) [-1983.643] * (-1989.293) (-1999.327) [-1985.829] (-1996.434) -- 0:02:50

      Average standard deviation of split frequencies: 0.003014

      469100 -- (-1997.040) (-1991.719) (-1998.467) [-1985.488] * (-2003.022) (-2000.334) [-1986.548] (-1992.293) -- 0:02:50
      469200 -- (-2000.741) (-1990.916) (-2004.904) [-1981.297] * (-1996.368) (-1994.458) [-1989.059] (-1997.746) -- 0:02:50
      469300 -- (-1992.721) (-1992.886) (-1990.261) [-1980.942] * (-1995.984) [-1993.078] (-1987.895) (-1991.967) -- 0:02:50
      469400 -- (-1988.811) (-1995.100) (-1995.424) [-1984.754] * (-1998.821) (-1994.997) (-1988.991) [-1986.919] -- 0:02:50
      469500 -- (-1985.451) (-1997.918) (-1995.954) [-1984.581] * (-2001.968) (-1997.073) [-1992.931] (-1984.942) -- 0:02:50
      469600 -- (-1984.646) (-2001.231) (-1999.005) [-1986.659] * [-1986.555] (-1997.005) (-1989.720) (-1987.676) -- 0:02:50
      469700 -- (-1985.794) (-1996.500) (-1990.632) [-1987.529] * (-1989.306) (-1990.928) [-1991.168] (-1993.862) -- 0:02:50
      469800 -- (-1987.806) (-1990.700) [-1991.183] (-1988.627) * [-1988.340] (-1987.143) (-2001.457) (-1996.472) -- 0:02:51
      469900 -- (-1985.637) (-1995.405) [-1988.390] (-1982.779) * (-1987.143) [-1985.242] (-1996.098) (-1992.371) -- 0:02:51
      470000 -- (-1987.462) (-1988.319) (-1994.833) [-1986.857] * (-1991.978) [-1984.743] (-1994.244) (-1990.960) -- 0:02:51

      Average standard deviation of split frequencies: 0.002779

      470100 -- (-1982.192) (-1991.222) [-1978.387] (-1982.418) * (-1996.640) (-1991.279) (-1993.205) [-1990.165] -- 0:02:51
      470200 -- (-1984.562) (-1997.495) (-1981.687) [-1979.284] * (-1996.686) [-1991.380] (-1998.299) (-1984.135) -- 0:02:51
      470300 -- (-1987.769) (-1990.861) [-1982.498] (-1977.918) * (-1993.694) (-1991.365) (-1995.261) [-1986.127] -- 0:02:51
      470400 -- [-1994.952] (-1988.693) (-1982.599) (-1977.049) * (-1996.182) (-1986.173) (-2006.690) [-1986.057] -- 0:02:51
      470500 -- (-1996.538) (-1986.024) (-1981.894) [-1983.780] * (-1991.390) (-1987.397) [-1992.148] (-2002.406) -- 0:02:51
      470600 -- (-1994.635) (-1984.534) [-1983.908] (-1987.546) * [-1989.382] (-1990.164) (-1998.232) (-2002.499) -- 0:02:50
      470700 -- (-1993.596) (-1984.828) [-1982.304] (-1986.966) * [-1989.322] (-1982.001) (-1994.984) (-2000.752) -- 0:02:50
      470800 -- (-1994.641) (-1987.866) [-1982.748] (-1988.096) * (-1993.357) [-1982.540] (-2002.517) (-2003.511) -- 0:02:50
      470900 -- (-2002.715) [-1987.975] (-1985.527) (-1985.305) * (-1992.848) [-1981.678] (-2001.321) (-1993.906) -- 0:02:50
      471000 -- (-1999.251) (-1988.753) (-1990.999) [-1985.706] * (-1998.026) [-1980.285] (-1989.638) (-2002.700) -- 0:02:50

      Average standard deviation of split frequencies: 0.002630

      471100 -- (-1992.237) (-1993.533) [-1985.155] (-1982.295) * (-1992.282) [-1988.464] (-1993.585) (-1996.782) -- 0:02:50
      471200 -- (-1992.451) (-1990.551) (-1983.524) [-1983.808] * (-1990.662) [-1991.271] (-1989.822) (-1997.471) -- 0:02:50
      471300 -- (-1989.866) (-1993.017) [-1982.849] (-1984.418) * (-1992.595) [-1987.459] (-1993.013) (-1992.601) -- 0:02:50
      471400 -- (-1991.009) (-2005.405) (-1991.564) [-1984.783] * (-2004.340) [-1985.021] (-1990.267) (-1992.912) -- 0:02:50
      471500 -- (-1988.780) (-1994.364) (-1988.932) [-1983.229] * (-1998.130) [-1984.541] (-1993.695) (-1999.778) -- 0:02:50
      471600 -- (-1987.661) (-1992.370) (-1989.174) [-1984.310] * (-2003.726) (-1988.409) [-1987.212] (-1998.743) -- 0:02:50
      471700 -- [-1987.566] (-1990.490) (-1994.375) (-1982.492) * (-1994.788) (-1990.037) [-1987.800] (-1996.274) -- 0:02:50
      471800 -- (-1983.979) (-1988.931) (-1990.992) [-1985.379] * (-1999.857) (-1990.083) (-1989.580) [-1994.831] -- 0:02:50
      471900 -- (-1985.457) (-1992.138) (-1982.943) [-1977.918] * (-1993.264) [-1982.951] (-1999.711) (-1993.338) -- 0:02:50
      472000 -- (-1986.692) (-1993.282) [-1978.148] (-1984.904) * (-1999.777) [-1981.249] (-1999.050) (-1993.503) -- 0:02:50

      Average standard deviation of split frequencies: 0.002625

      472100 -- (-1987.234) (-1996.322) [-1977.931] (-1986.170) * (-2000.412) [-1985.016] (-1998.645) (-1989.995) -- 0:02:49
      472200 -- (-1992.700) (-2004.312) (-1977.929) [-1981.582] * (-1992.533) [-1982.292] (-1993.648) (-1989.727) -- 0:02:49
      472300 -- (-1985.937) (-2000.309) (-1978.894) [-1979.263] * (-1992.953) [-1986.478] (-1986.845) (-1988.246) -- 0:02:49
      472400 -- (-1994.175) (-1997.686) [-1977.792] (-1983.678) * (-1995.015) (-1985.559) (-1991.136) [-1987.684] -- 0:02:49
      472500 -- (-1989.821) (-1998.294) (-1983.916) [-1979.691] * (-1999.395) (-1989.677) [-1982.632] (-1988.795) -- 0:02:49
      472600 -- (-1990.564) (-1993.237) [-1985.706] (-1988.008) * (-1997.453) (-1989.431) [-1984.114] (-1992.145) -- 0:02:49
      472700 -- [-1991.741] (-1999.225) (-1983.815) (-1985.822) * (-1998.896) (-1985.119) [-1983.678] (-1994.400) -- 0:02:49
      472800 -- (-1992.451) (-1990.073) [-1981.761] (-1982.256) * (-1995.327) [-1978.982] (-1986.092) (-1994.056) -- 0:02:50
      472900 -- (-1999.512) (-1993.995) (-1982.739) [-1980.779] * (-1999.101) [-1981.874] (-1988.658) (-1998.674) -- 0:02:50
      473000 -- (-1994.328) (-1992.651) (-1981.277) [-1984.023] * (-1993.212) [-1984.152] (-1988.008) (-1999.512) -- 0:02:50

      Average standard deviation of split frequencies: 0.002732

      473100 -- (-1992.427) (-1993.938) [-1985.220] (-1990.099) * (-1991.116) [-1981.924] (-1991.737) (-1993.184) -- 0:02:50
      473200 -- (-1993.413) [-1990.492] (-1991.276) (-1991.502) * (-1994.313) [-1982.402] (-1991.014) (-1995.231) -- 0:02:50
      473300 -- (-1991.649) (-1990.379) (-1986.777) [-1991.625] * (-1995.585) [-1982.558] (-1995.771) (-2001.123) -- 0:02:50
      473400 -- (-1988.836) (-1988.821) [-1987.894] (-1994.611) * (-1995.347) [-1982.365] (-1993.498) (-1995.064) -- 0:02:50
      473500 -- (-1993.733) (-1991.546) [-1982.634] (-1999.641) * (-1992.807) [-1990.294] (-1995.948) (-1993.771) -- 0:02:50
      473600 -- (-1995.566) (-1989.023) [-1982.480] (-2000.988) * [-1986.927] (-1989.303) (-1990.368) (-1996.381) -- 0:02:50
      473700 -- (-1986.854) (-1989.386) [-1983.178] (-1998.984) * [-1985.475] (-1986.381) (-1990.250) (-1996.282) -- 0:02:49
      473800 -- [-1984.045] (-1987.979) (-1986.824) (-1995.708) * (-1984.365) [-1982.449] (-2001.774) (-1993.514) -- 0:02:49
      473900 -- (-1991.482) [-1989.618] (-1999.652) (-1995.754) * (-1985.592) [-1985.529] (-2003.994) (-1987.388) -- 0:02:49
      474000 -- (-1988.829) [-1990.338] (-1996.127) (-1985.735) * (-1990.549) (-1988.924) (-1996.460) [-1989.914] -- 0:02:49

      Average standard deviation of split frequencies: 0.002727

      474100 -- (-1996.764) [-1984.963] (-1991.672) (-1987.098) * (-1991.903) (-1989.956) (-1992.641) [-1990.723] -- 0:02:49
      474200 -- (-1993.879) (-1986.256) (-1992.376) [-1987.554] * (-1997.302) [-1993.351] (-1998.836) (-1987.210) -- 0:02:49
      474300 -- (-1996.712) (-1990.116) [-1986.122] (-1996.087) * (-1993.542) (-1993.386) (-2005.032) [-1989.822] -- 0:02:49
      474400 -- (-1994.846) (-1990.994) [-1980.919] (-1998.638) * (-1993.663) (-1987.740) [-2007.317] (-1993.077) -- 0:02:49
      474500 -- (-1992.168) (-1993.086) [-1980.625] (-1995.612) * (-2001.815) [-1984.103] (-2005.626) (-1988.558) -- 0:02:49
      474600 -- [-1990.476] (-1986.994) (-1977.031) (-1989.643) * (-2004.704) (-1987.926) (-2000.731) [-1986.724] -- 0:02:49
      474700 -- (-1984.715) (-1987.725) [-1982.598] (-1997.288) * (-1998.076) (-1997.997) [-2001.232] (-1984.507) -- 0:02:49
      474800 -- (-1988.611) [-1985.525] (-1982.716) (-2001.251) * [-1988.086] (-1999.916) (-1997.741) (-1986.438) -- 0:02:49
      474900 -- (-1991.856) (-1992.247) [-1986.624] (-1997.246) * (-1996.370) [-1984.550] (-2005.609) (-1988.993) -- 0:02:49
      475000 -- (-1993.282) (-1994.011) (-1990.262) [-1986.640] * (-1999.241) (-1985.068) (-2004.749) [-1991.726] -- 0:02:49

      Average standard deviation of split frequencies: 0.002664

      475100 -- (-2002.074) (-1984.037) (-1990.348) [-1996.954] * (-1992.673) [-1990.242] (-1995.677) (-1993.209) -- 0:02:49
      475200 -- (-2003.066) [-1985.823] (-1990.468) (-1996.142) * (-1993.925) (-1991.898) (-1997.708) [-1990.336] -- 0:02:48
      475300 -- (-1996.486) (-1988.881) [-1980.664] (-1993.991) * (-1993.005) (-1990.578) (-1992.287) [-1989.495] -- 0:02:48
      475400 -- (-1996.194) (-1991.526) [-1983.723] (-1993.520) * (-1998.638) (-1983.716) [-1989.991] (-1991.978) -- 0:02:48
      475500 -- (-1994.231) [-1991.099] (-1982.230) (-1988.325) * (-2000.759) (-1983.172) [-1992.112] (-1992.722) -- 0:02:48
      475600 -- (-1992.558) (-1997.364) [-1985.587] (-1986.993) * (-1992.017) [-1981.391] (-1987.555) (-1992.063) -- 0:02:48
      475700 -- (-1995.342) [-1987.877] (-1994.623) (-1987.417) * (-1994.032) [-1978.469] (-1992.021) (-1996.785) -- 0:02:48
      475800 -- (-1993.184) [-1988.348] (-1994.708) (-1986.737) * (-2000.698) [-1986.755] (-1986.204) (-2000.344) -- 0:02:48
      475900 -- (-1991.860) [-1985.162] (-1990.225) (-1984.034) * (-2004.811) [-1985.102] (-1986.699) (-1994.728) -- 0:02:49
      476000 -- (-1995.211) (-1981.976) [-1990.272] (-1986.731) * (-1997.759) [-1983.980] (-1990.573) (-2000.730) -- 0:02:49

      Average standard deviation of split frequencies: 0.002772

      476100 -- (-1999.551) (-1986.141) [-1986.444] (-1984.886) * (-1999.697) [-1984.130] (-1991.534) (-2005.762) -- 0:02:49
      476200 -- (-1998.459) (-1992.957) [-1980.445] (-1978.198) * (-1993.953) [-1980.148] (-1992.794) (-2004.674) -- 0:02:49
      476300 -- (-1999.221) [-1991.690] (-1976.346) (-1979.218) * (-1997.598) [-1987.403] (-1988.242) (-1997.826) -- 0:02:49
      476400 -- (-1996.542) (-1992.971) (-1979.103) [-1978.280] * (-2000.048) [-1987.696] (-1988.073) (-1999.253) -- 0:02:49
      476500 -- (-1998.568) (-1991.149) (-1985.733) [-1979.826] * (-1998.713) [-1982.486] (-1989.527) (-1992.110) -- 0:02:49
      476600 -- (-2002.616) (-1987.845) (-1984.649) [-1984.551] * (-1990.863) [-1979.536] (-1999.184) (-1996.230) -- 0:02:49
      476700 -- (-2003.480) [-1980.286] (-1991.036) (-1984.766) * (-1985.144) [-1978.185] (-1989.215) (-2000.358) -- 0:02:49
      476800 -- (-1997.994) [-1981.848] (-1992.075) (-1986.692) * (-1988.503) (-1978.746) [-1989.673] (-1997.329) -- 0:02:48
      476900 -- (-2004.440) (-1985.502) (-1991.159) [-1987.447] * (-1992.701) [-1975.527] (-1994.896) (-1997.596) -- 0:02:48
      477000 -- (-2008.591) (-1986.044) [-1979.897] (-1995.685) * (-1989.959) [-1980.322] (-2003.015) (-2002.660) -- 0:02:48

      Average standard deviation of split frequencies: 0.002710

      477100 -- (-2005.210) [-1979.065] (-1988.855) (-1984.592) * [-1988.436] (-1981.864) (-1995.576) (-1989.973) -- 0:02:48
      477200 -- (-1996.143) (-1980.001) [-1979.999] (-1981.845) * (-1989.204) [-1981.692] (-1999.349) (-1990.202) -- 0:02:48
      477300 -- (-2005.324) (-1979.380) (-1982.900) [-1983.094] * (-1991.292) [-1981.397] (-2006.018) (-1997.841) -- 0:02:48
      477400 -- (-2001.436) [-1981.462] (-1985.210) (-1987.197) * (-1989.912) [-1979.169] (-1997.880) (-1995.100) -- 0:02:48
      477500 -- (-2007.180) [-1980.610] (-1983.479) (-1981.252) * (-1991.146) [-1983.868] (-1999.147) (-1992.656) -- 0:02:48
      477600 -- (-1999.100) [-1984.952] (-1988.531) (-1985.666) * [-1989.585] (-1981.382) (-1991.456) (-1991.127) -- 0:02:48
      477700 -- (-1988.059) (-1984.903) (-1987.926) [-1986.801] * [-1987.853] (-1986.683) (-1992.876) (-1988.797) -- 0:02:48
      477800 -- (-1990.400) (-1985.358) (-1993.634) [-1988.825] * (-1989.980) (-1987.592) [-1988.490] (-1993.079) -- 0:02:48
      477900 -- (-1994.068) [-1981.638] (-1982.574) (-1985.620) * (-1993.440) (-1990.887) [-1991.029] (-1990.132) -- 0:02:48
      478000 -- (-1995.268) (-1984.507) [-1982.295] (-1987.673) * [-1989.309] (-1992.119) (-1997.557) (-1983.716) -- 0:02:48

      Average standard deviation of split frequencies: 0.002732

      478100 -- (-1990.670) (-1986.767) (-1985.817) [-1984.616] * (-1994.309) (-1997.074) (-1997.724) [-1988.545] -- 0:02:48
      478200 -- (-1986.577) (-1990.078) [-1982.682] (-1990.297) * [-1987.012] (-1997.160) (-1997.800) (-1993.419) -- 0:02:48
      478300 -- (-1988.123) [-1986.805] (-1993.216) (-1991.588) * (-1988.573) [-1993.562] (-1991.978) (-1993.754) -- 0:02:47
      478400 -- [-1985.314] (-1989.619) (-1989.298) (-1993.888) * [-1987.484] (-1989.295) (-1998.660) (-1990.917) -- 0:02:47
      478500 -- (-1986.480) [-1987.639] (-1991.583) (-1994.580) * (-1994.132) (-1987.772) (-2007.583) [-1984.800] -- 0:02:47
      478600 -- (-1992.860) [-1987.320] (-1990.706) (-1984.059) * (-2007.494) (-1982.344) (-2003.607) [-1989.561] -- 0:02:47
      478700 -- (-1986.898) (-1997.321) (-1987.796) [-1983.594] * (-1994.685) [-1984.883] (-2000.666) (-1990.461) -- 0:02:47
      478800 -- (-1993.129) (-1996.016) [-1988.060] (-1985.415) * (-1990.166) [-1990.372] (-1998.743) (-1997.232) -- 0:02:47
      478900 -- (-2000.803) (-1983.102) [-1981.065] (-1985.137) * (-1989.988) [-1985.878] (-1996.950) (-1991.011) -- 0:02:47
      479000 -- (-1992.709) [-1978.026] (-1989.410) (-1988.274) * (-1989.237) [-1985.494] (-1991.013) (-1994.751) -- 0:02:48

      Average standard deviation of split frequencies: 0.002698

      479100 -- (-1997.312) (-1980.394) [-1984.616] (-1998.489) * (-1995.186) [-1981.691] (-1990.570) (-1992.909) -- 0:02:48
      479200 -- (-2000.707) [-1980.366] (-1989.165) (-2000.654) * (-2009.648) [-1985.558] (-1996.620) (-1990.301) -- 0:02:48
      479300 -- (-1993.822) [-1981.983] (-1996.046) (-1993.718) * (-2004.159) (-1984.615) (-2005.738) [-1987.440] -- 0:02:48
      479400 -- (-1994.512) [-1984.980] (-1987.600) (-1993.201) * (-2003.103) [-1981.541] (-1993.549) (-1988.079) -- 0:02:48
      479500 -- (-1993.171) (-1983.988) (-1990.229) [-1988.501] * (-2006.784) (-1980.740) (-1988.898) [-1986.637] -- 0:02:48
      479600 -- (-1990.271) (-1987.084) [-1984.041] (-1983.068) * (-2005.227) [-1988.063] (-1987.294) (-1990.655) -- 0:02:48
      479700 -- (-1989.453) (-1989.768) [-1981.894] (-1987.379) * (-2005.458) (-1990.197) [-1986.028] (-1996.146) -- 0:02:48
      479800 -- (-1994.347) [-1984.804] (-1982.982) (-1986.205) * (-1999.111) (-1987.386) [-1983.797] (-1996.246) -- 0:02:48
      479900 -- (-1998.245) (-1986.503) [-1979.059] (-1980.500) * (-2000.596) (-1987.885) [-1982.034] (-1996.363) -- 0:02:47
      480000 -- (-2004.713) (-1984.026) (-1985.124) [-1982.607] * (-2000.128) (-1982.394) [-1986.946] (-1992.555) -- 0:02:47

      Average standard deviation of split frequencies: 0.002609

      480100 -- (-1997.974) [-1981.931] (-1989.880) (-1990.718) * (-1997.660) (-1981.135) [-1988.628] (-1993.800) -- 0:02:47
      480200 -- (-1992.139) (-1979.961) (-1989.992) [-1981.522] * (-1992.698) [-1982.052] (-1993.067) (-1992.455) -- 0:02:47
      480300 -- (-1992.636) (-1992.182) (-1991.968) [-1986.916] * (-1987.525) [-1979.071] (-1993.891) (-1991.792) -- 0:02:47
      480400 -- (-1995.902) (-1989.852) (-1994.442) [-1990.765] * (-1998.072) [-1980.367] (-1989.558) (-1988.548) -- 0:02:47
      480500 -- (-1989.198) [-1989.858] (-1992.526) (-1994.085) * (-2003.772) [-1977.618] (-1991.006) (-1985.257) -- 0:02:47
      480600 -- (-1992.779) [-1983.511] (-1993.629) (-1988.334) * (-2000.333) (-1979.419) (-1993.767) [-1988.482] -- 0:02:47
      480700 -- (-1998.377) (-1985.395) (-1991.087) [-1983.644] * (-1992.149) [-1982.357] (-1992.162) (-1990.702) -- 0:02:47
      480800 -- (-1998.509) (-1986.827) (-1998.278) [-1986.207] * (-1998.389) [-1989.694] (-1996.516) (-1986.614) -- 0:02:47
      480900 -- (-1994.946) [-1987.002] (-1999.518) (-1986.357) * [-1989.483] (-1990.718) (-1994.943) (-1987.829) -- 0:02:47
      481000 -- (-1992.108) (-1992.536) (-1994.413) [-1988.131] * (-1987.279) [-1982.610] (-1996.171) (-1999.357) -- 0:02:47

      Average standard deviation of split frequencies: 0.002603

      481100 -- (-1991.131) [-1989.181] (-1989.410) (-1990.850) * (-1994.868) [-1983.442] (-2002.133) (-1992.174) -- 0:02:47
      481200 -- (-2000.200) (-1991.936) (-1990.616) [-1990.856] * (-1997.326) [-1979.265] (-1992.688) (-1985.091) -- 0:02:47
      481300 -- (-2005.984) (-1988.050) (-1989.603) [-1983.357] * (-2002.910) [-1979.452] (-2000.736) (-1984.097) -- 0:02:47
      481400 -- (-2000.511) (-1987.803) (-1994.167) [-1983.521] * (-1995.290) [-1982.412] (-1993.980) (-1987.091) -- 0:02:46
      481500 -- (-2006.271) (-1987.037) (-1988.172) [-1982.543] * (-1988.482) [-1985.867] (-1990.024) (-1988.936) -- 0:02:46
      481600 -- (-1998.029) (-1991.765) (-1990.925) [-1985.336] * (-1986.227) (-1990.534) [-1984.456] (-1995.848) -- 0:02:46
      481700 -- (-1997.260) [-1989.522] (-1989.806) (-1984.237) * [-1984.363] (-1986.646) (-1987.276) (-1988.655) -- 0:02:46
      481800 -- (-1995.509) (-1993.747) (-1993.552) [-1982.693] * (-1984.996) (-1990.848) [-1982.687] (-1995.206) -- 0:02:46
      481900 -- (-1995.033) (-1996.237) (-1992.071) [-1981.356] * (-1988.947) [-1985.399] (-1985.685) (-1988.728) -- 0:02:46
      482000 -- (-1991.537) (-1992.089) (-1986.474) [-1983.558] * (-1990.603) [-1987.796] (-1984.030) (-1986.462) -- 0:02:46

      Average standard deviation of split frequencies: 0.002514

      482100 -- (-1995.505) (-2003.300) (-1987.701) [-1982.594] * [-1989.372] (-1989.140) (-1991.661) (-1991.785) -- 0:02:47
      482200 -- (-1994.677) (-2001.062) (-1985.182) [-1985.411] * [-1988.276] (-1989.417) (-1992.232) (-1992.356) -- 0:02:47
      482300 -- (-1996.647) (-2000.553) (-1990.270) [-1983.155] * (-1986.565) [-1982.888] (-1987.956) (-1987.536) -- 0:02:47
      482400 -- (-1995.261) (-2006.286) (-1990.678) [-1986.116] * (-1989.103) [-1978.307] (-1990.668) (-1995.813) -- 0:02:47
      482500 -- (-1992.632) (-1997.841) (-1989.372) [-1979.782] * (-1992.113) [-1980.982] (-1995.482) (-1994.326) -- 0:02:47
      482600 -- (-1992.270) (-1990.355) (-1993.920) [-1980.926] * (-1996.920) [-1984.062] (-1996.011) (-1994.005) -- 0:02:47
      482700 -- [-1991.093] (-1991.055) (-1987.546) (-1989.874) * (-1999.418) (-1983.843) [-1991.545] (-1993.526) -- 0:02:47
      482800 -- (-1993.800) [-1986.253] (-1987.010) (-1989.999) * (-1997.137) [-1984.688] (-1991.121) (-1985.289) -- 0:02:47
      482900 -- (-1990.935) (-1996.490) (-1991.304) [-1993.824] * (-1988.486) [-1987.795] (-1990.565) (-1987.899) -- 0:02:47
      483000 -- (-1995.908) (-1984.117) [-1989.282] (-1992.977) * (-1990.406) [-1984.044] (-1995.239) (-1993.540) -- 0:02:46

      Average standard deviation of split frequencies: 0.002620

      483100 -- (-1994.296) [-1982.313] (-1988.126) (-1991.525) * (-1992.650) [-1984.373] (-1991.010) (-2000.049) -- 0:02:46
      483200 -- (-1991.741) [-1982.286] (-1985.609) (-1990.813) * [-1985.266] (-1986.609) (-1997.558) (-1996.594) -- 0:02:46
      483300 -- [-1991.270] (-1993.970) (-1983.573) (-1986.495) * [-1991.531] (-1989.901) (-1995.385) (-1994.237) -- 0:02:46
      483400 -- (-1997.481) (-1990.183) [-1983.278] (-1986.628) * (-1996.934) (-1983.727) [-1993.101] (-1999.472) -- 0:02:46
      483500 -- (-2002.336) (-1987.465) [-1980.364] (-1985.940) * (-1992.873) [-1985.772] (-1993.439) (-1995.631) -- 0:02:46
      483600 -- (-2018.053) (-1988.058) (-1980.029) [-1985.281] * (-1990.692) [-1983.851] (-1996.212) (-2001.708) -- 0:02:46
      483700 -- (-2002.919) (-1990.862) (-1982.673) [-1985.575] * (-1983.554) [-1986.672] (-1998.674) (-1992.600) -- 0:02:46
      483800 -- (-1997.262) (-1990.719) (-1985.378) [-1982.313] * (-1983.317) [-1983.252] (-2002.436) (-1989.360) -- 0:02:46
      483900 -- (-1995.613) (-1999.961) (-1985.487) [-1983.666] * (-1986.893) (-1988.068) (-2007.586) [-1992.218] -- 0:02:46
      484000 -- (-1989.794) (-2000.684) (-1988.382) [-1981.337] * (-1987.904) [-1985.667] (-1994.335) (-2000.183) -- 0:02:46

      Average standard deviation of split frequencies: 0.002671

      484100 -- (-1995.077) (-2000.072) [-1986.208] (-1982.795) * (-1990.557) (-1988.878) (-2001.538) [-1980.780] -- 0:02:46
      484200 -- (-1994.053) (-1990.862) [-1987.915] (-1988.231) * (-1990.304) [-1992.551] (-1993.060) (-1980.195) -- 0:02:46
      484300 -- [-1985.442] (-1985.088) (-1992.137) (-1983.703) * (-1990.795) (-1989.712) (-1997.844) [-1979.997] -- 0:02:46
      484400 -- (-1988.862) (-1987.177) (-2003.171) [-1991.526] * (-1995.058) (-1984.010) (-1997.694) [-1982.363] -- 0:02:46
      484500 -- (-1990.012) (-1987.054) (-2004.511) [-1988.070] * (-1992.348) [-1985.890] (-2000.969) (-1984.394) -- 0:02:45
      484600 -- (-1987.662) [-1984.451] (-2006.516) (-1987.088) * (-1990.897) [-1984.242] (-1999.410) (-1981.720) -- 0:02:45
      484700 -- (-1988.573) (-1992.480) (-1999.502) [-1982.512] * (-1999.831) [-1986.292] (-1993.980) (-1986.082) -- 0:02:45
      484800 -- (-1987.111) (-1991.905) (-1996.279) [-1978.768] * (-2002.633) (-1985.320) (-1996.648) [-1989.814] -- 0:02:45
      484900 -- [-1984.119] (-1987.899) (-1993.199) (-1977.845) * (-2003.960) (-1992.081) (-2002.653) [-1987.149] -- 0:02:45
      485000 -- (-1985.750) [-1982.560] (-1986.735) (-1984.954) * (-2004.301) (-1986.790) (-1993.090) [-1990.291] -- 0:02:45

      Average standard deviation of split frequencies: 0.002804

      485100 -- (-1988.813) [-1985.707] (-1989.550) (-1989.254) * (-1997.870) [-1985.946] (-1989.419) (-2003.893) -- 0:02:46
      485200 -- (-1991.401) (-1984.104) (-1982.354) [-1983.295] * (-1996.868) (-1982.821) [-1993.817] (-2014.703) -- 0:02:46
      485300 -- (-1995.717) (-1992.097) (-1985.287) [-1987.119] * (-2000.683) [-1984.451] (-1987.826) (-2005.772) -- 0:02:46
      485400 -- (-1998.572) [-1989.061] (-1983.995) (-1990.957) * (-1993.428) [-1986.064] (-1993.549) (-2003.431) -- 0:02:46
      485500 -- (-2003.267) (-1994.783) [-1979.852] (-1988.637) * (-1992.418) [-1990.397] (-2005.896) (-2001.941) -- 0:02:46
      485600 -- (-1992.808) (-2010.750) (-1979.864) [-1988.316] * (-1992.458) [-1987.686] (-1997.876) (-1996.641) -- 0:02:46
      485700 -- (-1995.846) (-1997.604) [-1985.075] (-1991.504) * (-1997.677) [-1993.130] (-1990.764) (-1990.391) -- 0:02:46
      485800 -- (-1994.829) (-1998.955) [-1984.055] (-1990.987) * (-1995.333) (-1987.553) (-1999.826) [-1989.675] -- 0:02:46
      485900 -- (-1997.473) (-1993.205) [-1985.286] (-1993.072) * (-1989.312) [-1986.728] (-1995.390) (-1991.998) -- 0:02:46
      486000 -- (-2002.647) (-1994.798) [-1984.391] (-1989.740) * (-1990.096) [-1984.255] (-1992.780) (-1993.960) -- 0:02:46

      Average standard deviation of split frequencies: 0.002798

      486100 -- (-2003.494) (-1991.425) [-1983.473] (-1991.702) * (-1996.049) [-1985.370] (-1991.876) (-1991.568) -- 0:02:45
      486200 -- (-2003.351) (-1992.268) [-1987.465] (-1993.950) * (-1998.286) [-1983.289] (-1992.773) (-1993.716) -- 0:02:45
      486300 -- (-2005.288) (-1996.003) [-1984.333] (-1991.773) * [-1990.940] (-1984.572) (-1993.544) (-1997.147) -- 0:02:45
      486400 -- (-2000.544) (-1989.952) (-1989.652) [-1984.087] * (-1989.954) [-1982.871] (-1992.476) (-1995.308) -- 0:02:45
      486500 -- (-1999.771) (-1989.582) [-1988.260] (-1984.644) * (-1995.532) [-1983.418] (-1994.317) (-1992.034) -- 0:02:45
      486600 -- (-2006.546) (-1991.662) [-1985.415] (-1988.990) * (-2000.552) (-1982.393) [-1992.835] (-1988.092) -- 0:02:45
      486700 -- (-2006.758) (-1993.716) [-1983.032] (-1988.604) * (-1993.951) [-1987.524] (-1997.387) (-1988.718) -- 0:02:45
      486800 -- [-1995.047] (-1994.468) (-1986.241) (-1985.073) * [-1991.927] (-1984.473) (-2001.188) (-1998.341) -- 0:02:45
      486900 -- (-2004.104) (-2001.190) (-1989.125) [-1980.880] * [-1992.036] (-1981.874) (-2004.464) (-2001.195) -- 0:02:45
      487000 -- (-2006.263) (-1992.590) (-1986.707) [-1985.170] * (-1985.094) [-1983.874] (-1993.193) (-2008.794) -- 0:02:45

      Average standard deviation of split frequencies: 0.003013

      487100 -- (-1998.844) (-1988.970) [-1983.689] (-1991.068) * [-1990.247] (-1982.699) (-1996.080) (-2002.827) -- 0:02:45
      487200 -- (-2000.049) (-1989.415) (-1984.842) [-1988.733] * (-2003.893) [-1986.112] (-1995.917) (-2007.405) -- 0:02:45
      487300 -- (-1998.085) [-1981.468] (-1989.444) (-1981.810) * (-1994.579) [-1989.912] (-1992.608) (-2008.052) -- 0:02:45
      487400 -- [-1994.303] (-1982.757) (-1987.587) (-1982.355) * (-1995.516) [-1982.166] (-1998.467) (-2001.841) -- 0:02:45
      487500 -- (-1989.533) [-1983.334] (-1989.900) (-1981.395) * (-1989.741) [-1983.051] (-2003.500) (-2005.959) -- 0:02:45
      487600 -- (-1990.019) [-1983.075] (-1994.032) (-1988.389) * (-1987.454) [-1989.785] (-1991.789) (-2001.475) -- 0:02:44
      487700 -- (-1995.881) [-1980.989] (-1994.743) (-1989.892) * (-1993.705) [-1983.319] (-1988.205) (-1999.053) -- 0:02:44
      487800 -- (-1989.050) [-1981.184] (-1994.694) (-1989.409) * (-1995.292) (-1983.908) [-1991.064] (-1997.811) -- 0:02:44
      487900 -- (-1992.505) [-1982.191] (-2000.502) (-1992.837) * (-2005.794) [-1982.004] (-1988.800) (-2000.871) -- 0:02:44
      488000 -- (-1991.856) [-1981.030] (-2004.898) (-1990.774) * (-2009.420) [-1983.294] (-1989.819) (-2005.208) -- 0:02:44

      Average standard deviation of split frequencies: 0.002870

      488100 -- (-1995.294) [-1984.625] (-1993.810) (-1991.590) * (-1999.096) (-1982.655) [-1990.228] (-1990.801) -- 0:02:45
      488200 -- (-1995.264) [-1981.941] (-1992.394) (-1994.095) * (-1999.345) [-1987.220] (-1988.764) (-1991.462) -- 0:02:45
      488300 -- (-1991.194) (-1987.701) (-1990.144) [-1986.786] * (-2000.791) [-1989.512] (-1989.002) (-1990.387) -- 0:02:45
      488400 -- (-1993.023) [-1982.235] (-1987.698) (-1988.583) * (-1995.182) (-2004.433) (-1992.722) [-1986.249] -- 0:02:45
      488500 -- (-1992.669) (-1981.959) [-1990.600] (-1990.272) * (-1992.303) (-1999.525) [-1989.417] (-1984.738) -- 0:02:45
      488600 -- [-1990.274] (-1982.264) (-2001.939) (-1989.617) * [-1996.572] (-2001.308) (-1988.120) (-1980.860) -- 0:02:45
      488700 -- [-1993.414] (-1985.699) (-2009.255) (-1987.842) * (-2004.104) (-1993.616) (-1989.874) [-1983.287] -- 0:02:45
      488800 -- [-1988.196] (-1987.773) (-1995.443) (-1992.715) * (-1995.951) (-1991.998) (-1987.217) [-1983.630] -- 0:02:45
      488900 -- (-1990.700) [-1988.353] (-1993.433) (-1986.990) * (-1994.914) (-2007.535) [-1985.789] (-1984.798) -- 0:02:45
      489000 -- (-2005.214) [-1984.788] (-1983.182) (-1998.583) * (-1986.489) (-2009.745) (-1980.761) [-1981.412] -- 0:02:45

      Average standard deviation of split frequencies: 0.002973

      489100 -- (-1999.089) (-1987.333) [-1978.687] (-1991.427) * (-1988.541) (-1998.723) (-1990.783) [-1980.886] -- 0:02:45
      489200 -- (-2003.851) (-1999.288) [-1977.420] (-1985.951) * [-1989.751] (-2001.168) (-1990.709) (-1985.325) -- 0:02:44
      489300 -- (-1995.743) (-1991.369) [-1976.799] (-1987.278) * (-1990.022) (-2003.453) (-1987.571) [-1990.539] -- 0:02:44
      489400 -- (-1997.721) (-1981.688) [-1980.841] (-1990.288) * (-1991.169) (-2003.590) (-1989.319) [-1987.742] -- 0:02:44
      489500 -- (-1997.016) (-1982.590) [-1979.625] (-1996.047) * (-1989.171) (-2009.289) (-1990.204) [-1989.986] -- 0:02:44
      489600 -- (-1991.276) (-1995.405) [-1981.872] (-1992.781) * [-1990.707] (-2004.127) (-1989.804) (-1982.581) -- 0:02:44
      489700 -- (-1994.363) (-1984.479) [-1987.874] (-1997.578) * (-1991.324) (-2009.376) (-1995.296) [-1983.895] -- 0:02:44
      489800 -- (-1993.340) [-1982.785] (-1995.052) (-1989.216) * (-1996.465) (-2007.566) [-1986.471] (-1987.011) -- 0:02:44
      489900 -- (-1994.562) (-1980.833) [-1986.383] (-1989.596) * (-1992.885) (-1994.576) (-1986.202) [-1984.207] -- 0:02:44
      490000 -- (-1989.935) (-1987.055) [-1984.971] (-1992.535) * (-1992.093) (-1988.407) (-1986.742) [-1984.906] -- 0:02:44

      Average standard deviation of split frequencies: 0.003188

      490100 -- (-1990.550) (-1986.925) [-1984.361] (-1991.754) * (-1991.738) (-1990.900) [-1989.777] (-1983.553) -- 0:02:44
      490200 -- (-1990.763) [-1986.057] (-1993.099) (-1994.345) * (-1992.934) (-1994.498) (-1992.293) [-1983.894] -- 0:02:44
      490300 -- (-1998.934) [-1980.253] (-2005.043) (-1996.514) * [-1991.319] (-1983.671) (-1992.142) (-1995.641) -- 0:02:44
      490400 -- (-1994.622) [-1984.455] (-1999.678) (-1994.956) * (-1992.654) [-1985.210] (-1993.269) (-1992.987) -- 0:02:44
      490500 -- (-2000.346) [-1979.801] (-1998.120) (-1986.358) * (-1992.631) [-1982.790] (-1986.777) (-1998.681) -- 0:02:44
      490600 -- (-2002.888) [-1983.664] (-1993.219) (-1985.584) * (-1996.394) (-1982.744) [-1986.897] (-1997.292) -- 0:02:44
      490700 -- (-2006.716) [-1983.258] (-1992.451) (-1983.762) * (-1987.691) (-1983.253) [-1987.725] (-1996.645) -- 0:02:43
      490800 -- (-2012.274) (-1983.018) (-1985.978) [-1986.941] * (-1987.389) [-1982.026] (-1999.331) (-1995.956) -- 0:02:43
      490900 -- (-2000.395) [-1986.933] (-1984.513) (-1987.944) * [-1984.524] (-1984.094) (-1997.202) (-1988.563) -- 0:02:43
      491000 -- (-1993.844) (-1990.310) [-1984.739] (-1984.031) * (-1989.144) [-1985.830] (-2004.016) (-1994.749) -- 0:02:43

      Average standard deviation of split frequencies: 0.003016

      491100 -- (-1991.735) (-1994.913) [-1989.334] (-1990.054) * (-1985.713) [-1982.738] (-2003.110) (-1990.025) -- 0:02:43
      491200 -- (-2000.887) (-1988.389) [-1987.755] (-1981.708) * [-1986.939] (-1984.343) (-2002.308) (-1989.566) -- 0:02:44
      491300 -- (-2003.551) (-1990.111) [-1987.594] (-1983.694) * (-1989.917) (-1991.622) (-1995.913) [-1985.521] -- 0:02:44
      491400 -- (-2010.228) (-1981.236) [-1980.159] (-1980.046) * (-1986.913) (-1988.640) (-1991.466) [-1984.749] -- 0:02:44
      491500 -- (-1992.469) (-1982.995) [-1979.264] (-1980.334) * (-1991.216) (-1990.678) (-1986.674) [-1986.196] -- 0:02:44
      491600 -- (-1993.747) (-1987.595) [-1980.558] (-1988.315) * (-1991.316) [-1985.966] (-1994.651) (-1992.993) -- 0:02:44
      491700 -- (-2005.328) (-1984.950) (-1979.527) [-1987.243] * (-1993.305) [-1988.567] (-2000.333) (-1988.387) -- 0:02:44
      491800 -- (-1999.905) (-1990.225) [-1979.823] (-1985.718) * (-1994.315) (-1984.778) [-1989.642] (-1989.042) -- 0:02:44
      491900 -- (-1998.042) (-1989.033) [-1980.929] (-1983.936) * (-1994.060) (-2001.468) (-1992.444) [-1992.861] -- 0:02:44
      492000 -- (-1998.504) [-1988.314] (-1982.114) (-1978.311) * (-1986.051) (-1986.543) (-1992.484) [-1992.914] -- 0:02:44

      Average standard deviation of split frequencies: 0.002956

      492100 -- (-2006.852) [-1985.164] (-1989.367) (-1981.851) * [-1987.264] (-1987.771) (-1992.522) (-1985.933) -- 0:02:44
      492200 -- (-2010.065) [-1988.237] (-1985.319) (-1982.488) * (-1991.892) [-1986.763] (-1992.216) (-1985.685) -- 0:02:44
      492300 -- (-2025.893) (-1987.292) (-1986.833) [-1983.950] * (-1996.252) [-1984.707] (-1987.390) (-1994.057) -- 0:02:43
      492400 -- (-2013.822) (-1988.121) (-1988.704) [-1988.997] * (-1997.889) (-1987.303) (-1997.240) [-1983.273] -- 0:02:43
      492500 -- (-2000.223) (-1982.209) (-1984.244) [-1979.809] * (-2003.329) [-1980.842] (-1989.799) (-1987.728) -- 0:02:43
      492600 -- (-2003.842) (-1990.182) [-1980.926] (-1982.870) * (-2004.964) (-1983.413) [-1987.540] (-1987.397) -- 0:02:43
      492700 -- (-1993.567) (-1993.855) [-1987.720] (-1981.798) * (-1999.484) (-1983.088) (-1991.578) [-1980.304] -- 0:02:43
      492800 -- (-1993.757) [-1989.196] (-1988.155) (-1986.230) * (-1991.984) (-1985.724) (-1994.213) [-1980.958] -- 0:02:43
      492900 -- (-1992.554) (-1993.070) (-1992.493) [-1984.819] * (-1994.199) [-1990.000] (-1996.765) (-1985.285) -- 0:02:43
      493000 -- (-1997.234) [-1993.833] (-2002.453) (-1985.600) * (-1992.865) (-1991.555) (-1994.705) [-1988.352] -- 0:02:43

      Average standard deviation of split frequencies: 0.002867

      493100 -- (-1990.105) (-1993.030) (-1999.381) [-1985.645] * (-1992.454) [-1991.261] (-1999.350) (-1989.354) -- 0:02:43
      493200 -- (-1986.836) (-1993.690) (-2000.877) [-1984.549] * (-1996.101) (-1995.083) (-1990.458) [-1989.372] -- 0:02:43
      493300 -- (-1992.162) (-1990.862) (-1994.828) [-1983.002] * (-1994.876) (-1987.738) [-1992.362] (-1988.921) -- 0:02:43
      493400 -- (-1992.899) (-1991.481) (-1990.096) [-1982.372] * (-1990.735) (-1987.639) (-1991.204) [-1986.192] -- 0:02:43
      493500 -- (-1998.446) (-1991.863) (-1991.407) [-1980.727] * (-1995.240) (-1988.254) (-1988.683) [-1985.550] -- 0:02:43
      493600 -- (-2005.964) (-1995.643) (-1986.102) [-1981.106] * (-1992.680) [-1993.788] (-1994.432) (-1988.022) -- 0:02:43
      493700 -- (-2005.086) (-1997.331) [-1983.486] (-1982.003) * (-1996.345) (-1990.380) [-1988.729] (-1989.241) -- 0:02:43
      493800 -- (-2006.472) (-2003.621) [-1979.992] (-1984.190) * (-1994.344) [-1988.893] (-1988.974) (-1994.744) -- 0:02:42
      493900 -- (-2002.562) (-1998.512) (-1979.623) [-1980.153] * (-1987.447) [-1986.920] (-1991.808) (-1990.549) -- 0:02:42
      494000 -- (-2000.188) [-1988.048] (-1984.475) (-1985.727) * (-1989.044) [-1991.113] (-2000.526) (-1980.427) -- 0:02:42

      Average standard deviation of split frequencies: 0.002998

      494100 -- (-1997.190) (-1990.884) [-1981.597] (-1987.732) * (-1987.177) [-1986.367] (-2001.447) (-1988.547) -- 0:02:42
      494200 -- (-2004.376) [-1986.936] (-1982.303) (-1993.492) * (-1992.731) (-1990.676) [-1990.909] (-1990.989) -- 0:02:43
      494300 -- (-1991.716) [-1987.613] (-1983.455) (-1994.123) * [-1988.596] (-1991.555) (-1992.183) (-1991.005) -- 0:02:43
      494400 -- (-2006.141) (-1997.399) (-1979.992) [-1984.584] * [-1990.047] (-1999.197) (-1996.248) (-1988.709) -- 0:02:43
      494500 -- (-2001.396) (-1992.016) [-1980.824] (-1991.831) * [-1991.674] (-1995.364) (-1994.806) (-1993.742) -- 0:02:43
      494600 -- (-2004.643) (-1992.197) [-1980.624] (-1989.065) * [-1990.227] (-1998.385) (-1991.344) (-1986.439) -- 0:02:43
      494700 -- (-2001.510) (-1988.496) [-1979.355] (-1992.688) * (-1988.201) (-2008.895) (-1993.630) [-1987.186] -- 0:02:43
      494800 -- (-2002.672) (-1998.242) [-1986.578] (-1987.111) * (-1990.044) (-2005.807) (-1999.868) [-1982.845] -- 0:02:43
      494900 -- (-2004.657) [-1997.544] (-1986.619) (-1991.041) * [-1998.379] (-2002.273) (-1995.818) (-1985.698) -- 0:02:43
      495000 -- (-1997.240) (-1998.677) [-1984.429] (-1997.217) * (-1993.872) (-2000.563) [-2001.394] (-1992.547) -- 0:02:43

      Average standard deviation of split frequencies: 0.003101

      495100 -- (-2004.025) (-1989.493) [-1980.546] (-1998.801) * [-1994.920] (-1996.387) (-1998.204) (-1998.455) -- 0:02:43
      495200 -- (-1996.202) (-1993.414) [-1986.740] (-1994.597) * (-2000.294) [-1992.773] (-1991.840) (-2013.486) -- 0:02:43
      495300 -- (-1992.141) (-1991.974) [-1984.559] (-1988.239) * (-1997.135) [-1989.666] (-1987.276) (-2008.058) -- 0:02:43
      495400 -- (-1993.469) (-1999.892) [-1981.828] (-1989.398) * (-2002.017) [-1984.983] (-1990.073) (-1995.817) -- 0:02:42
      495500 -- (-2000.777) (-1998.039) (-1986.762) [-1987.032] * (-1992.538) [-1990.048] (-1989.086) (-1995.485) -- 0:02:42
      495600 -- (-1998.637) (-2003.601) (-1987.439) [-1985.273] * [-1992.306] (-1988.037) (-1992.205) (-1996.738) -- 0:02:42
      495700 -- (-1995.873) (-1999.062) (-1989.926) [-1985.289] * [-1989.436] (-1987.430) (-1991.581) (-2003.347) -- 0:02:42
      495800 -- (-1988.785) (-2013.660) [-1988.834] (-1984.886) * (-1986.331) [-1985.912] (-1994.555) (-1995.640) -- 0:02:42
      495900 -- (-1990.343) (-2009.393) [-1983.327] (-1981.848) * [-1985.898] (-1999.238) (-1990.202) (-2001.358) -- 0:02:42
      496000 -- (-1992.724) (-2007.507) [-1985.651] (-1981.128) * [-1991.061] (-1994.029) (-1990.444) (-2001.466) -- 0:02:42

      Average standard deviation of split frequencies: 0.003095

      496100 -- (-1991.565) (-2010.556) [-1985.484] (-1982.582) * [-1989.997] (-1989.969) (-1991.354) (-2001.704) -- 0:02:42
      496200 -- (-1996.775) (-1999.576) [-1980.582] (-1981.269) * (-1991.509) [-1982.670] (-1990.194) (-2001.674) -- 0:02:42
      496300 -- (-1994.326) (-2009.388) (-1985.039) [-1980.521] * (-1992.429) [-1982.445] (-1998.144) (-2003.772) -- 0:02:42
      496400 -- (-1996.455) (-2003.558) (-1985.600) [-1986.857] * (-1996.123) [-1984.727] (-2009.075) (-2003.619) -- 0:02:42
      496500 -- (-1994.335) (-2018.954) [-1984.664] (-1981.816) * (-1990.915) [-1978.649] (-2004.102) (-1998.973) -- 0:02:42
      496600 -- [-1982.840] (-2008.109) (-1988.509) (-1984.763) * (-1999.622) [-1985.822] (-1996.903) (-1989.132) -- 0:02:42
      496700 -- [-1986.431] (-1999.320) (-1988.506) (-1993.435) * [-1997.265] (-1985.277) (-1997.631) (-1995.953) -- 0:02:42
      496800 -- (-1990.726) (-2003.447) (-1993.598) [-1992.988] * (-2001.281) [-1990.394] (-1998.563) (-1996.465) -- 0:02:42
      496900 -- (-1990.047) (-1987.744) [-1987.310] (-1991.638) * (-1995.624) [-1988.605] (-1997.830) (-1999.092) -- 0:02:41
      497000 -- [-1988.326] (-1992.328) (-1991.659) (-1991.966) * [-1988.372] (-1992.262) (-1999.484) (-2002.150) -- 0:02:41

      Average standard deviation of split frequencies: 0.003251

      497100 -- (-1989.659) (-1990.748) [-1984.960] (-1987.970) * (-1985.406) [-1986.942] (-2001.763) (-1997.951) -- 0:02:41
      497200 -- (-1995.199) (-2002.022) [-1982.319] (-1990.179) * [-1983.902] (-1986.645) (-1988.370) (-1989.540) -- 0:02:41
      497300 -- (-1988.851) (-1997.182) [-1983.806] (-1990.610) * [-1988.913] (-1984.983) (-1988.656) (-1989.321) -- 0:02:42
      497400 -- (-1992.937) (-2003.358) [-1980.303] (-1991.515) * (-1996.712) (-1983.018) [-1988.962] (-1987.338) -- 0:02:42
      497500 -- (-1993.469) (-2000.012) (-1987.313) [-1984.964] * (-1993.993) (-1995.073) [-1987.875] (-1990.049) -- 0:02:42
      497600 -- (-1991.899) (-2009.549) (-1983.790) [-1983.680] * (-1995.116) [-1991.495] (-1986.691) (-1992.435) -- 0:02:42
      497700 -- (-1990.605) (-1999.964) [-1981.489] (-1981.087) * (-1997.961) (-2016.790) [-1985.347] (-1993.173) -- 0:02:42
      497800 -- (-1993.448) (-2003.118) (-1989.596) [-1978.971] * (-1996.378) (-2011.845) [-1989.299] (-1989.928) -- 0:02:42
      497900 -- (-1993.591) (-1997.799) (-1996.356) [-1978.566] * (-1999.489) (-1994.455) [-1986.149] (-1993.596) -- 0:02:42
      498000 -- (-1997.236) (-2003.493) (-2000.591) [-1980.508] * (-2001.487) (-1990.544) [-1986.294] (-1990.195) -- 0:02:42

      Average standard deviation of split frequencies: 0.003136

      498100 -- (-1994.004) (-1998.333) (-1988.471) [-1981.792] * (-2000.372) [-1991.634] (-1984.885) (-1986.384) -- 0:02:42
      498200 -- (-1989.103) (-1992.727) (-1990.803) [-1983.686] * (-2001.652) (-1986.669) (-1992.012) [-1988.833] -- 0:02:42
      498300 -- (-1987.355) (-1997.110) (-1986.401) [-1987.223] * (-2010.025) (-1991.115) (-1992.362) [-1991.191] -- 0:02:42
      498400 -- (-1997.259) (-1996.295) [-1979.910] (-1986.886) * (-2012.597) [-1991.441] (-1993.599) (-1992.897) -- 0:02:42
      498500 -- (-1997.735) (-1990.863) [-1977.335] (-1983.592) * (-2001.572) (-1983.609) (-1995.053) [-1989.625] -- 0:02:41
      498600 -- (-1996.077) (-1993.378) [-1985.397] (-1986.881) * (-2008.203) (-1985.127) [-1990.991] (-1994.948) -- 0:02:41
      498700 -- (-1988.822) (-1997.961) [-1984.634] (-1985.396) * (-2010.456) [-1982.487] (-1993.078) (-2003.152) -- 0:02:41
      498800 -- (-1991.445) (-1992.057) (-1984.258) [-1981.660] * (-2001.564) [-1983.559] (-1999.626) (-1997.157) -- 0:02:41
      498900 -- (-1993.306) (-1992.400) (-1987.112) [-1980.297] * (-1991.098) (-1979.795) [-1984.493] (-1996.775) -- 0:02:41
      499000 -- (-1991.595) (-1991.709) (-1988.787) [-1989.929] * (-1995.954) [-1983.427] (-1993.718) (-2002.744) -- 0:02:41

      Average standard deviation of split frequencies: 0.003480

      499100 -- (-1984.574) (-1991.420) [-1987.523] (-1991.537) * (-1991.927) [-1982.710] (-1995.747) (-1997.149) -- 0:02:41
      499200 -- [-1986.092] (-1993.520) (-1987.851) (-1989.159) * (-1991.137) [-1987.073] (-1994.244) (-1993.831) -- 0:02:41
      499300 -- (-1984.967) (-1998.325) (-1981.431) [-1988.197] * [-1989.757] (-1991.092) (-2001.540) (-1993.202) -- 0:02:41
      499400 -- (-1985.679) (-1991.823) [-1979.867] (-1993.430) * (-1999.370) [-1987.422] (-1996.055) (-1993.501) -- 0:02:41
      499500 -- (-1986.852) (-1996.344) [-1979.763] (-1997.718) * (-1999.106) [-1984.902] (-1997.395) (-1989.673) -- 0:02:41
      499600 -- (-1989.883) (-1998.795) [-1980.179] (-1998.558) * (-1994.591) [-1987.417] (-2000.725) (-1993.904) -- 0:02:41
      499700 -- (-1992.796) (-1995.374) [-1982.555] (-1997.185) * (-1988.925) [-1985.073] (-2000.774) (-1998.967) -- 0:02:41
      499800 -- (-1986.851) (-1996.268) [-1986.174] (-1991.921) * [-1983.276] (-1996.124) (-2003.462) (-1996.439) -- 0:02:41
      499900 -- (-1988.965) (-1993.435) [-1981.603] (-2007.406) * [-1982.538] (-2000.337) (-1993.026) (-1996.675) -- 0:02:41
      500000 -- [-1986.045] (-1994.247) (-1986.060) (-2012.157) * [-1987.335] (-1992.825) (-1995.938) (-1998.015) -- 0:02:41

      Average standard deviation of split frequencies: 0.003474

      500100 -- (-1988.356) (-1995.595) [-1978.370] (-2006.832) * [-1984.789] (-1991.010) (-2000.246) (-2006.520) -- 0:02:40
      500200 -- (-1996.101) (-1996.330) [-1978.480] (-2004.624) * [-1988.583] (-1981.749) (-1998.593) (-2001.610) -- 0:02:40
      500300 -- (-1994.117) (-1992.379) [-1977.130] (-2001.652) * [-1981.876] (-1983.856) (-1997.712) (-2000.242) -- 0:02:41
      500400 -- (-1993.660) (-2000.550) [-1979.446] (-1996.140) * (-1982.418) (-1987.598) (-1995.292) [-2000.636] -- 0:02:41
      500500 -- (-1993.158) (-1995.724) [-1982.729] (-1999.473) * [-1985.400] (-1991.894) (-1999.782) (-1994.979) -- 0:02:41
      500600 -- (-1991.138) (-1998.485) [-1980.779] (-1998.250) * (-1986.652) [-1986.237] (-1993.114) (-1992.245) -- 0:02:41
      500700 -- (-1988.334) (-1997.657) (-1983.935) [-1989.642] * (-1987.065) [-1983.884] (-1989.753) (-1991.090) -- 0:02:41
      500800 -- (-1996.334) (-1995.243) [-1983.314] (-1988.472) * [-1988.845] (-1982.829) (-1992.676) (-1986.965) -- 0:02:41
      500900 -- (-1995.869) (-2001.041) (-1980.968) [-1986.140] * (-1990.287) [-1984.453] (-1992.416) (-1993.058) -- 0:02:41
      501000 -- (-1994.089) (-1992.633) [-1983.240] (-1985.836) * (-1993.810) (-1989.491) (-1997.905) [-1987.188] -- 0:02:41

      Average standard deviation of split frequencies: 0.003278

      501100 -- (-1997.815) (-1988.436) (-1984.754) [-1984.169] * (-1997.917) [-1988.667] (-2000.921) (-1984.666) -- 0:02:41
      501200 -- (-2004.914) (-1987.670) [-1985.382] (-1984.696) * (-1993.839) (-2000.012) [-1998.346] (-1984.596) -- 0:02:41
      501300 -- (-2004.633) [-1988.441] (-1985.176) (-1989.472) * (-1992.958) (-2009.244) (-1998.868) [-1985.350] -- 0:02:41
      501400 -- (-1998.842) (-1991.808) (-1989.036) [-1985.532] * (-1988.567) (-2000.975) (-1997.802) [-1985.867] -- 0:02:41
      501500 -- (-1992.368) (-1999.826) (-1992.183) [-1984.593] * (-1990.647) [-1981.620] (-2001.698) (-1985.346) -- 0:02:41
      501600 -- (-1997.316) (-1994.549) [-1986.284] (-1989.315) * (-1990.821) (-1983.496) (-2003.563) [-1986.168] -- 0:02:40
      501700 -- (-1995.815) (-1998.769) [-1986.784] (-1994.791) * (-1985.392) [-1983.899] (-1993.204) (-1990.831) -- 0:02:40
      501800 -- (-2000.520) (-2002.587) [-1981.107] (-1997.654) * (-1995.582) [-1985.264] (-2001.985) (-1992.215) -- 0:02:40
      501900 -- (-1998.390) (-2005.543) [-1982.876] (-1986.923) * (-1995.200) [-1985.585] (-1997.310) (-1997.249) -- 0:02:40
      502000 -- (-1996.578) (-2007.273) [-1989.722] (-1992.041) * (-1993.926) [-1985.511] (-1995.702) (-1998.164) -- 0:02:40

      Average standard deviation of split frequencies: 0.003326

      502100 -- (-2000.038) (-1995.030) [-1983.659] (-1988.170) * [-1984.658] (-1986.934) (-1990.229) (-1995.929) -- 0:02:40
      502200 -- (-1998.427) (-1990.815) [-1982.320] (-1987.932) * [-1979.491] (-1986.441) (-1992.826) (-1996.787) -- 0:02:40
      502300 -- (-1999.639) [-1991.274] (-1987.497) (-1989.937) * (-1993.431) [-1989.024] (-1987.098) (-2002.254) -- 0:02:40
      502400 -- (-1998.983) [-1988.472] (-1994.093) (-1986.155) * (-1985.710) (-2000.284) [-1989.772] (-2000.929) -- 0:02:40
      502500 -- (-2000.559) (-1985.856) (-2002.571) [-1983.695] * (-1987.668) (-2004.194) [-1988.395] (-2002.284) -- 0:02:40
      502600 -- (-2001.490) (-1994.412) (-1994.629) [-1982.587] * [-1992.531] (-2004.833) (-1994.485) (-2007.129) -- 0:02:40
      502700 -- (-2001.256) (-1987.807) (-1996.416) [-1984.561] * [-1981.763] (-1996.850) (-1988.001) (-2012.263) -- 0:02:40
      502800 -- (-1995.858) [-1985.860] (-1985.750) (-1986.083) * (-1980.040) (-1995.967) [-1986.962] (-2006.326) -- 0:02:40
      502900 -- [-1991.366] (-1993.773) (-1990.509) (-1991.675) * (-1983.614) (-1994.374) [-1987.232] (-2007.202) -- 0:02:40
      503000 -- (-1992.627) (-2001.840) (-1992.447) [-1982.356] * (-1983.825) (-1999.998) [-1985.517] (-1996.735) -- 0:02:40

      Average standard deviation of split frequencies: 0.003373

      503100 -- (-1991.790) (-1995.950) (-1991.296) [-1983.420] * [-1982.608] (-1992.748) (-1987.968) (-1994.990) -- 0:02:40
      503200 -- (-1990.778) (-1993.577) (-1979.959) [-1982.671] * (-1985.301) [-1993.046] (-1994.483) (-2001.412) -- 0:02:39
      503300 -- (-1997.242) (-1991.076) [-1978.894] (-1983.247) * [-1983.148] (-1993.054) (-1986.366) (-2004.342) -- 0:02:39
      503400 -- (-2001.326) (-1990.318) [-1986.310] (-1986.571) * [-1981.872] (-1985.948) (-1987.076) (-1997.059) -- 0:02:40
      503500 -- (-1987.046) (-1992.490) [-1983.748] (-1991.655) * (-1985.526) [-1982.491] (-1986.003) (-2000.806) -- 0:02:40
      503600 -- (-1986.873) (-1993.794) [-1987.078] (-1991.092) * (-1980.978) [-1979.164] (-1993.260) (-2002.067) -- 0:02:40
      503700 -- [-1988.334] (-1993.511) (-1987.071) (-1991.814) * (-1986.534) [-1983.126] (-1997.221) (-2009.868) -- 0:02:40
      503800 -- (-1987.803) (-1989.537) [-1982.284] (-1996.591) * (-1988.104) (-1994.701) [-1993.805] (-2002.787) -- 0:02:40
      503900 -- (-1989.116) (-1995.951) [-1982.446] (-1997.551) * [-1982.636] (-1990.785) (-1996.144) (-2010.438) -- 0:02:40
      504000 -- [-1987.354] (-1990.175) (-1988.582) (-1993.766) * [-1980.824] (-1992.729) (-1993.508) (-1988.703) -- 0:02:40

      Average standard deviation of split frequencies: 0.003420

      504100 -- [-1985.044] (-1992.309) (-1991.998) (-1997.315) * (-1979.876) [-1989.852] (-2010.710) (-1987.848) -- 0:02:40
      504200 -- [-1985.024] (-1989.432) (-1995.369) (-1997.057) * (-1985.176) [-1989.043] (-2000.400) (-1993.827) -- 0:02:40
      504300 -- [-1984.639] (-1988.559) (-1995.562) (-1990.270) * (-1987.596) [-1994.049] (-2000.821) (-1993.590) -- 0:02:40
      504400 -- (-1988.517) (-1987.936) [-1984.873] (-1985.331) * [-1983.649] (-1992.903) (-1993.827) (-1995.970) -- 0:02:40
      504500 -- (-1992.187) (-1990.588) (-1988.325) [-1986.682] * (-1984.207) (-1999.321) [-1985.750] (-1993.444) -- 0:02:40
      504600 -- (-1996.044) (-1991.660) [-1981.676] (-1988.923) * [-1980.922] (-1992.035) (-1988.898) (-1984.099) -- 0:02:40
      504700 -- (-1995.483) (-1994.455) [-1979.363] (-1991.781) * (-1988.229) (-1992.246) (-1993.485) [-1985.942] -- 0:02:39
      504800 -- [-1992.289] (-1993.494) (-1990.249) (-1989.744) * [-1989.659] (-1987.269) (-1992.828) (-1990.462) -- 0:02:39
      504900 -- (-2006.287) (-1990.103) [-1983.961] (-1990.936) * (-1986.797) [-1985.844] (-1984.843) (-1990.691) -- 0:02:39
      505000 -- (-2010.926) (-1987.450) [-1984.607] (-1996.693) * [-1992.881] (-1982.511) (-1987.680) (-1993.394) -- 0:02:39

      Average standard deviation of split frequencies: 0.003519

      505100 -- (-2006.200) (-1994.381) [-1986.565] (-1991.722) * (-2004.125) [-1982.425] (-1991.503) (-1997.240) -- 0:02:39
      505200 -- (-1994.265) (-1997.995) [-1983.442] (-1988.843) * (-1994.765) [-1983.785] (-1993.067) (-2004.549) -- 0:02:39
      505300 -- (-1994.312) (-1997.181) [-1983.235] (-1983.043) * (-1986.949) [-1982.469] (-1985.611) (-2008.519) -- 0:02:39
      505400 -- (-1992.716) (-2002.398) [-1982.492] (-1984.031) * (-1998.597) [-1980.323] (-1988.094) (-2008.608) -- 0:02:39
      505500 -- (-1991.602) (-1990.374) (-1983.403) [-1983.078] * (-1994.831) [-1985.363] (-1994.717) (-2003.683) -- 0:02:39
      505600 -- (-1990.062) (-1991.818) [-1981.636] (-1986.205) * (-1991.565) (-1988.439) [-1986.402] (-2000.802) -- 0:02:39
      505700 -- (-2002.387) (-1996.134) [-1983.697] (-1990.782) * (-1991.225) [-1988.775] (-1987.576) (-2000.526) -- 0:02:39
      505800 -- (-2006.482) (-1997.780) [-1987.843] (-1986.419) * (-1989.626) (-1987.363) [-1987.738] (-1999.962) -- 0:02:39
      505900 -- (-2005.622) (-1994.312) (-1990.512) [-1986.828] * (-1995.873) [-1988.592] (-1991.364) (-1993.480) -- 0:02:39
      506000 -- (-1994.663) (-1997.056) (-1992.950) [-1990.027] * (-1993.421) [-1982.433] (-1992.146) (-1994.184) -- 0:02:39

      Average standard deviation of split frequencies: 0.003726

      506100 -- (-1996.139) (-1999.525) (-1996.933) [-1985.871] * (-1988.751) [-1979.760] (-1997.035) (-2001.486) -- 0:02:39
      506200 -- (-1991.935) (-1998.838) [-1989.046] (-1986.815) * (-1987.705) [-1977.055] (-1995.890) (-1994.607) -- 0:02:39
      506300 -- (-1993.477) (-1997.940) (-1984.797) [-1989.733] * (-1990.661) [-1984.196] (-1993.566) (-2003.507) -- 0:02:38
      506400 -- (-1987.532) (-1987.931) [-1985.506] (-1993.843) * (-1997.427) (-1984.453) [-1990.583] (-2005.575) -- 0:02:38
      506500 -- (-1986.539) (-1992.979) [-1980.057] (-1988.358) * [-1989.405] (-1985.554) (-1987.261) (-2005.190) -- 0:02:39
      506600 -- (-1984.525) (-1991.371) [-1988.724] (-1989.983) * (-1994.574) [-1988.712] (-1988.269) (-1999.351) -- 0:02:39
      506700 -- [-1981.699] (-1994.034) (-1984.460) (-1988.008) * (-1997.032) (-1993.512) [-1988.865] (-1991.299) -- 0:02:39
      506800 -- (-1993.063) (-1996.187) (-1985.195) [-1984.103] * [-1986.584] (-1992.621) (-1991.525) (-1989.057) -- 0:02:39
      506900 -- (-1995.505) (-1990.347) (-1986.068) [-1982.496] * [-1985.687] (-1987.442) (-1989.926) (-1993.224) -- 0:02:39
      507000 -- (-1994.767) (-1985.225) [-1982.346] (-1984.426) * (-1985.964) (-1989.447) [-1985.202] (-1992.421) -- 0:02:39

      Average standard deviation of split frequencies: 0.003558

      507100 -- (-1994.746) (-1995.919) (-1981.040) [-1989.635] * [-1983.097] (-1988.759) (-1986.771) (-1989.406) -- 0:02:39
      507200 -- (-2002.998) (-1985.881) [-1979.205] (-1987.426) * [-1982.253] (-1994.722) (-1996.412) (-1985.632) -- 0:02:39
      507300 -- (-2007.440) (-1989.902) [-1983.586] (-1994.355) * (-1984.627) (-1995.586) (-1989.481) [-1990.063] -- 0:02:39
      507400 -- (-2010.508) (-1997.856) (-1990.499) [-1993.499] * [-1981.767] (-1981.021) (-1991.706) (-1994.884) -- 0:02:39
      507500 -- (-2016.834) (-1992.474) [-1990.573] (-1982.947) * (-1983.344) (-1978.749) (-1984.937) [-1986.669] -- 0:02:39
      507600 -- (-2004.976) (-1985.922) (-1983.372) [-1983.761] * (-1984.753) (-1982.981) (-1990.934) [-1985.950] -- 0:02:39
      507700 -- (-2001.074) (-1985.640) [-1980.736] (-1988.325) * (-1982.958) [-1979.240] (-1985.869) (-1986.671) -- 0:02:39
      507800 -- (-2004.391) (-1985.490) [-1978.670] (-1994.235) * [-1981.091] (-1992.523) (-1991.331) (-1990.361) -- 0:02:38
      507900 -- (-2004.047) [-1987.657] (-1989.615) (-1990.643) * [-1980.278] (-1991.705) (-1990.863) (-1989.351) -- 0:02:38
      508000 -- (-2006.656) (-1995.836) (-1989.078) [-1992.395] * [-1978.770] (-1995.069) (-1999.018) (-1989.350) -- 0:02:38

      Average standard deviation of split frequencies: 0.003446

      508100 -- (-1997.447) (-1993.044) [-1983.163] (-1991.135) * (-1982.923) (-1991.541) (-1990.247) [-1988.823] -- 0:02:38
      508200 -- (-2002.471) [-1987.761] (-1990.224) (-1994.677) * [-1984.927] (-1991.767) (-1986.510) (-1987.982) -- 0:02:38
      508300 -- (-1998.396) (-1993.085) (-1985.944) [-1987.106] * [-1981.310] (-1992.056) (-1986.187) (-1988.979) -- 0:02:38
      508400 -- (-2002.182) [-1990.945] (-1984.118) (-1993.940) * (-1980.475) (-1995.660) [-1987.690] (-1990.566) -- 0:02:38
      508500 -- (-2002.956) (-1992.564) (-1986.984) [-1988.388] * [-1979.350] (-1999.692) (-1985.328) (-1986.071) -- 0:02:38
      508600 -- (-1999.801) (-1993.207) (-1995.711) [-1988.009] * [-1984.029] (-1997.224) (-1985.049) (-1991.576) -- 0:02:38
      508700 -- (-1995.853) (-1992.259) [-1986.772] (-1994.766) * (-1983.120) (-2002.941) (-1988.726) [-1990.310] -- 0:02:38
      508800 -- [-1992.128] (-1993.385) (-1990.206) (-1993.463) * [-1982.405] (-1995.841) (-1988.127) (-1991.972) -- 0:02:38
      508900 -- [-1984.647] (-1994.646) (-1987.039) (-1991.564) * (-1987.124) [-1988.865] (-1992.796) (-1994.176) -- 0:02:38
      509000 -- (-1984.959) (-1992.012) [-1987.532] (-1990.771) * (-1985.851) [-1987.878] (-1994.034) (-1990.589) -- 0:02:38

      Average standard deviation of split frequencies: 0.003386

      509100 -- [-1983.623] (-1995.707) (-1994.374) (-1992.045) * (-1988.450) (-1994.267) [-1988.975] (-1991.235) -- 0:02:38
      509200 -- (-1982.021) (-1993.542) (-1992.891) [-1987.413] * (-1987.271) (-1990.912) [-1987.758] (-1993.866) -- 0:02:38
      509300 -- (-1986.923) (-1991.902) [-1983.791] (-1994.209) * [-1993.938] (-1992.135) (-1993.974) (-1998.659) -- 0:02:38
      509400 -- (-1987.726) [-1994.891] (-1986.776) (-1992.539) * (-1987.572) (-1997.726) (-1989.013) [-1992.338] -- 0:02:37
      509500 -- (-1986.851) (-1988.700) [-1983.385] (-1997.641) * (-1987.309) (-1996.382) [-1986.969] (-1986.044) -- 0:02:38
      509600 -- [-1991.294] (-1988.989) (-1984.942) (-1997.112) * [-1989.689] (-1996.957) (-1988.620) (-1988.117) -- 0:02:38
      509700 -- [-1983.814] (-1990.838) (-1984.046) (-2003.037) * [-1986.920] (-1992.919) (-1987.407) (-1991.317) -- 0:02:38
      509800 -- (-1982.298) (-1990.570) [-1989.359] (-1994.779) * (-1988.481) [-1989.389] (-1987.075) (-1994.052) -- 0:02:38
      509900 -- (-1981.196) (-1997.099) [-1976.792] (-2001.199) * [-1990.907] (-1992.874) (-1990.560) (-1994.972) -- 0:02:38
      510000 -- (-1982.942) (-2003.457) [-1979.958] (-1999.713) * (-1994.506) [-1990.929] (-1991.628) (-1986.301) -- 0:02:38

      Average standard deviation of split frequencies: 0.003591

      510100 -- [-1983.217] (-2004.426) (-1982.358) (-1986.282) * (-1992.423) (-1991.676) (-1996.444) [-1990.979] -- 0:02:38
      510200 -- (-1988.610) (-2004.998) [-1980.401] (-1989.843) * [-1981.347] (-1998.980) (-1995.198) (-1992.289) -- 0:02:38
      510300 -- (-1995.846) (-2006.052) [-1982.828] (-1992.981) * [-1981.713] (-2002.575) (-1994.432) (-1999.354) -- 0:02:38
      510400 -- (-1987.615) (-2000.142) [-1982.738] (-1991.283) * (-1985.466) [-1995.596] (-1999.312) (-1998.737) -- 0:02:38
      510500 -- (-1991.061) (-1997.127) [-1979.797] (-1987.449) * (-1992.096) (-1993.478) (-1996.927) [-1995.025] -- 0:02:38
      510600 -- (-1993.579) (-2007.650) (-1985.272) [-1986.187] * [-1989.813] (-1993.848) (-1993.404) (-2001.862) -- 0:02:38
      510700 -- (-1987.454) (-2007.016) [-1989.052] (-1992.856) * [-1980.510] (-1988.872) (-1993.829) (-2003.917) -- 0:02:38
      510800 -- (-1983.245) (-1999.250) [-1980.658] (-1994.684) * (-1985.253) (-1989.905) [-1992.652] (-1994.070) -- 0:02:38
      510900 -- [-1984.226] (-2009.120) (-1979.941) (-1993.292) * [-1990.090] (-1989.763) (-1986.947) (-1996.479) -- 0:02:37
      511000 -- [-1981.167] (-2010.960) (-1980.026) (-1995.591) * [-1985.421] (-1993.631) (-1989.814) (-1992.935) -- 0:02:37

      Average standard deviation of split frequencies: 0.003583

      511100 -- (-1981.545) (-2003.699) [-1987.549] (-1993.652) * (-1985.297) (-1998.247) (-1991.512) [-1992.136] -- 0:02:37
      511200 -- (-1986.056) (-1995.511) [-1988.715] (-1995.318) * [-1985.925] (-1995.462) (-1990.296) (-1996.109) -- 0:02:37
      511300 -- [-1984.057] (-1988.872) (-1984.874) (-1994.887) * [-1985.208] (-1996.242) (-1991.676) (-1997.971) -- 0:02:37
      511400 -- (-1983.098) (-1990.415) [-1980.066] (-1999.327) * [-1984.346] (-2007.159) (-1991.715) (-1995.077) -- 0:02:37
      511500 -- (-1985.782) (-1989.059) [-1977.119] (-1994.620) * [-1984.745] (-1999.736) (-1999.071) (-1998.589) -- 0:02:37
      511600 -- [-1981.298] (-1988.382) (-1978.167) (-1990.704) * [-1983.497] (-2001.401) (-1997.402) (-1995.029) -- 0:02:37
      511700 -- [-1982.577] (-1992.047) (-1980.853) (-1993.139) * [-1985.563] (-2003.109) (-1995.792) (-1990.682) -- 0:02:37
      511800 -- [-1979.516] (-1993.241) (-1984.214) (-1988.753) * [-1989.614] (-1992.680) (-1997.342) (-1986.620) -- 0:02:37
      511900 -- [-1977.095] (-1994.605) (-1989.860) (-1991.403) * [-1982.424] (-1994.225) (-1993.176) (-1993.135) -- 0:02:37
      512000 -- [-1976.312] (-1990.365) (-1983.908) (-1994.041) * (-1984.321) (-1995.599) (-2000.989) [-1993.071] -- 0:02:37

      Average standard deviation of split frequencies: 0.003603

      512100 -- [-1979.956] (-1997.058) (-1981.942) (-1991.295) * [-1982.980] (-1989.952) (-2013.603) (-1993.849) -- 0:02:37
      512200 -- [-1984.964] (-1995.485) (-1982.427) (-1995.279) * [-1982.208] (-1992.750) (-2007.163) (-1990.090) -- 0:02:37
      512300 -- (-1984.463) (-1995.473) [-1982.241] (-2000.394) * [-1986.794] (-1999.934) (-1997.547) (-1987.799) -- 0:02:37
      512400 -- [-1978.629] (-2003.659) (-1987.712) (-2001.708) * [-1981.706] (-2001.632) (-1991.487) (-1988.694) -- 0:02:37
      512500 -- [-1981.143] (-1994.061) (-1984.798) (-1997.043) * (-1984.929) (-2004.362) (-1995.948) [-1983.916] -- 0:02:36
      512600 -- [-1976.476] (-1990.957) (-1992.259) (-1997.722) * [-1982.406] (-2001.650) (-1999.746) (-1985.176) -- 0:02:37
      512700 -- [-1978.503] (-1994.584) (-2000.184) (-1999.571) * [-1982.487] (-1992.331) (-2001.351) (-1993.003) -- 0:02:37
      512800 -- [-1982.459] (-1993.011) (-2002.112) (-1998.205) * [-1981.508] (-1994.491) (-2004.682) (-1989.387) -- 0:02:37
      512900 -- (-1989.498) (-2003.370) (-1992.281) [-1993.132] * [-1983.926] (-1999.894) (-2020.035) (-1988.768) -- 0:02:37
      513000 -- [-1983.567] (-1999.169) (-2003.725) (-1996.826) * [-1986.852] (-1997.950) (-2007.360) (-2004.674) -- 0:02:37

      Average standard deviation of split frequencies: 0.003438

      513100 -- [-1980.109] (-1994.837) (-2012.733) (-2003.201) * [-1988.147] (-1992.874) (-2001.889) (-1996.467) -- 0:02:37
      513200 -- [-1981.692] (-1997.408) (-2004.252) (-2002.626) * (-1988.064) [-1991.971] (-1998.738) (-1994.171) -- 0:02:37
      513300 -- [-1988.106] (-1994.104) (-1996.437) (-2002.745) * [-1986.930] (-1989.828) (-1992.734) (-1982.397) -- 0:02:37
      513400 -- (-1983.860) [-1992.245] (-1985.737) (-2009.777) * (-1984.056) [-1989.172] (-1986.933) (-1986.695) -- 0:02:37
      513500 -- [-1981.909] (-1992.795) (-1991.793) (-2007.596) * (-1985.652) (-1993.736) [-1987.403] (-1986.726) -- 0:02:37
      513600 -- [-1981.802] (-1995.936) (-1987.409) (-2007.471) * (-1992.324) (-1995.044) (-1989.059) [-1988.955] -- 0:02:37
      513700 -- (-1986.680) (-1996.383) [-1986.557] (-2009.102) * [-1983.543] (-2013.024) (-1984.366) (-1994.160) -- 0:02:37
      513800 -- (-1987.730) (-1990.099) [-1987.718] (-1999.896) * [-1982.956] (-2002.245) (-1987.745) (-1991.692) -- 0:02:37
      513900 -- (-1982.879) [-1988.485] (-1994.792) (-2002.584) * [-1984.901] (-2004.539) (-1986.591) (-1987.203) -- 0:02:37
      514000 -- [-1987.497] (-1993.887) (-1996.253) (-1990.446) * (-1989.431) (-2002.501) [-1986.618] (-1990.171) -- 0:02:36

      Average standard deviation of split frequencies: 0.003432

      514100 -- (-1988.279) [-1990.378] (-1991.803) (-1995.695) * (-1994.150) (-1999.702) [-1988.397] (-1994.279) -- 0:02:36
      514200 -- [-1982.178] (-1985.022) (-1995.608) (-1999.154) * (-1998.750) (-1996.158) [-1988.117] (-1995.525) -- 0:02:36
      514300 -- [-1982.195] (-1984.936) (-1992.878) (-2010.575) * (-1993.934) (-1992.948) (-1989.371) [-1995.534] -- 0:02:36
      514400 -- [-1984.338] (-1986.327) (-1996.490) (-2001.021) * (-1985.644) (-1993.906) [-1984.574] (-1999.976) -- 0:02:36
      514500 -- [-1982.464] (-1986.828) (-1995.077) (-1993.929) * (-1987.204) [-1991.702] (-1985.463) (-1998.781) -- 0:02:36
      514600 -- [-1982.938] (-1985.515) (-1989.212) (-1997.225) * (-1984.704) (-1989.130) [-1992.721] (-1997.219) -- 0:02:36
      514700 -- [-1984.581] (-1992.690) (-1988.571) (-1996.385) * [-1990.486] (-1988.136) (-1996.925) (-1996.253) -- 0:02:36
      514800 -- (-1990.175) (-2003.379) [-1986.827] (-1992.340) * (-1999.377) (-1991.468) [-1996.829] (-1996.787) -- 0:02:36
      514900 -- (-1988.867) (-2006.415) (-1988.346) [-1993.411] * (-1990.561) [-1990.898] (-1992.409) (-1995.787) -- 0:02:36
      515000 -- [-1988.005] (-2000.161) (-1985.861) (-1999.755) * (-1997.907) (-1987.984) [-1991.276] (-1994.860) -- 0:02:36

      Average standard deviation of split frequencies: 0.003555

      515100 -- [-1980.454] (-1991.821) (-1995.550) (-2000.690) * (-1992.283) (-1987.131) (-1995.049) [-1991.446] -- 0:02:36
      515200 -- [-1980.810] (-1991.784) (-1991.741) (-2000.785) * [-1992.201] (-1991.272) (-2003.202) (-1994.603) -- 0:02:36
      515300 -- (-1983.485) [-1985.486] (-1990.197) (-1999.772) * (-1992.761) [-1986.004] (-1991.242) (-1991.678) -- 0:02:36
      515400 -- (-1986.588) (-1989.994) [-1986.090] (-2005.665) * (-1992.130) [-1991.931] (-1994.093) (-2000.796) -- 0:02:36
      515500 -- [-1984.717] (-1990.601) (-1989.789) (-1995.673) * (-2012.144) [-1989.226] (-1990.380) (-2014.823) -- 0:02:36
      515600 -- [-1990.862] (-1992.196) (-1993.207) (-1990.469) * (-1997.899) (-1989.090) [-1991.689] (-1992.217) -- 0:02:36
      515700 -- [-1982.939] (-1995.835) (-1993.368) (-1983.061) * (-2002.671) (-1987.250) [-1990.515] (-1986.631) -- 0:02:36
      515800 -- [-1982.268] (-1995.760) (-1984.422) (-1991.314) * [-1992.372] (-1985.889) (-1988.607) (-1985.546) -- 0:02:36
      515900 -- (-1983.694) (-1997.040) [-1990.248] (-1991.764) * (-1989.959) (-1996.123) (-1992.724) [-1985.221] -- 0:02:36
      516000 -- [-1985.946] (-1995.409) (-1990.355) (-1991.830) * [-1984.321] (-1990.053) (-1985.622) (-1990.718) -- 0:02:36

      Average standard deviation of split frequencies: 0.003392

      516100 -- [-1995.570] (-2001.299) (-1991.053) (-1989.721) * (-1988.917) (-1988.363) [-1986.569] (-1992.040) -- 0:02:36
      516200 -- [-1986.724] (-1999.228) (-1991.496) (-1993.417) * (-1992.371) [-1987.571] (-1988.944) (-2003.571) -- 0:02:36
      516300 -- (-1990.930) (-2007.863) [-1988.358] (-1998.729) * [-1988.364] (-1989.273) (-1989.726) (-1998.623) -- 0:02:36
      516400 -- [-1988.777] (-2009.793) (-1983.937) (-1997.579) * [-1993.773] (-2004.419) (-1988.385) (-1997.865) -- 0:02:36
      516500 -- [-1985.986] (-1995.692) (-1982.335) (-1992.215) * (-1999.206) (-1998.022) [-1989.493] (-1989.062) -- 0:02:36
      516600 -- [-1982.731] (-1990.154) (-1989.083) (-1993.956) * (-1997.886) (-1992.601) (-1991.662) [-1988.432] -- 0:02:36
      516700 -- (-1982.808) (-1988.935) [-1988.156] (-1986.638) * (-1991.955) (-1992.282) (-2001.087) [-1985.047] -- 0:02:36
      516800 -- [-1979.616] (-1993.326) (-1989.095) (-1989.355) * (-1996.877) (-1993.078) (-1995.761) [-1986.373] -- 0:02:36
      516900 -- [-1983.270] (-1997.358) (-1996.397) (-1991.018) * (-1996.414) (-1995.946) (-1999.849) [-1980.288] -- 0:02:36
      517000 -- [-1982.467] (-1992.203) (-1991.664) (-1993.244) * (-1989.233) (-2000.386) (-1997.141) [-1984.528] -- 0:02:36

      Average standard deviation of split frequencies: 0.003255

      517100 -- (-1980.653) (-1993.315) (-1996.702) [-1993.710] * (-1990.631) (-1996.870) (-1997.455) [-1982.700] -- 0:02:35
      517200 -- [-1987.068] (-2008.935) (-1994.601) (-2004.517) * [-1988.893] (-1994.554) (-2004.039) (-1989.870) -- 0:02:35
      517300 -- [-1984.445] (-2009.295) (-1995.082) (-1995.094) * (-1995.582) (-1988.950) (-1993.249) [-1983.025] -- 0:02:35
      517400 -- [-1982.622] (-1998.769) (-1995.564) (-1998.661) * (-1990.793) (-1992.034) (-1992.900) [-1981.879] -- 0:02:35
      517500 -- [-1981.564] (-1995.043) (-2002.767) (-2000.208) * (-1995.434) (-1997.172) (-1993.403) [-1985.618] -- 0:02:35
      517600 -- (-1984.309) (-1989.962) (-2015.488) [-1995.820] * (-1994.884) (-1992.071) (-1995.641) [-1983.880] -- 0:02:35
      517700 -- [-1988.337] (-2001.556) (-1997.507) (-1994.814) * (-1992.415) (-1994.228) (-1992.675) [-1987.204] -- 0:02:35
      517800 -- [-1981.679] (-1994.569) (-1999.129) (-2006.507) * (-1982.725) (-2000.309) (-1997.626) [-1987.464] -- 0:02:35
      517900 -- [-1981.872] (-1992.699) (-2006.083) (-1998.598) * [-1982.158] (-2000.872) (-1991.412) (-1983.072) -- 0:02:35
      518000 -- (-1991.920) [-1996.761] (-1998.877) (-1992.191) * (-1992.078) (-2003.489) (-1990.844) [-1980.835] -- 0:02:35

      Average standard deviation of split frequencies: 0.003327

      518100 -- (-1989.424) (-1994.594) (-2000.209) [-1992.291] * (-1988.649) (-2005.613) (-1986.815) [-1982.029] -- 0:02:35
      518200 -- [-1987.647] (-1990.831) (-1994.878) (-1995.822) * (-1987.306) (-2001.281) (-1994.582) [-1983.363] -- 0:02:35
      518300 -- [-1980.932] (-1990.551) (-1990.634) (-2003.281) * [-1987.520] (-2000.491) (-1999.611) (-1984.575) -- 0:02:35
      518400 -- [-1980.857] (-1991.691) (-1989.888) (-1998.523) * (-1992.329) (-1995.772) (-1997.973) [-1984.326] -- 0:02:35
      518500 -- (-1986.987) [-1992.019] (-1988.794) (-1990.748) * (-1989.514) (-2002.094) [-1989.631] (-1990.182) -- 0:02:35
      518600 -- [-1980.575] (-1993.170) (-1986.477) (-1987.669) * [-1991.083] (-1996.610) (-1986.877) (-1985.054) -- 0:02:35
      518700 -- (-1992.102) (-1995.580) (-1988.875) [-1987.290] * (-1986.534) (-2004.614) (-1990.689) [-1984.216] -- 0:02:35
      518800 -- (-1989.268) (-1990.824) [-1984.362] (-1988.883) * (-1992.115) (-1996.617) [-1985.987] (-1987.416) -- 0:02:35
      518900 -- [-1984.879] (-2013.590) (-1984.216) (-2001.094) * (-1984.737) (-1989.420) (-1985.870) [-1985.178] -- 0:02:35
      519000 -- [-1981.768] (-1994.886) (-1989.064) (-2004.170) * [-1980.081] (-1994.464) (-1997.979) (-1983.774) -- 0:02:35

      Average standard deviation of split frequencies: 0.003243

      519100 -- [-1981.459] (-1994.905) (-1997.848) (-1996.618) * (-1980.111) (-1992.945) (-1997.607) [-1982.842] -- 0:02:35
      519200 -- [-1983.323] (-1997.925) (-1995.029) (-2000.040) * (-1983.603) (-1988.520) (-1990.385) [-1980.378] -- 0:02:35
      519300 -- (-1985.010) (-1994.162) [-1995.304] (-1993.510) * [-1984.311] (-1990.194) (-1991.743) (-1983.508) -- 0:02:35
      519400 -- [-1988.172] (-2009.929) (-1991.515) (-1996.104) * (-1994.475) (-1994.966) (-1992.930) [-1987.085] -- 0:02:35
      519500 -- [-1983.168] (-2015.297) (-1989.038) (-1993.059) * [-1989.524] (-1996.569) (-1993.509) (-1985.102) -- 0:02:35
      519600 -- [-1987.643] (-2020.827) (-1993.937) (-1994.548) * [-1985.455] (-1999.496) (-1992.916) (-1986.260) -- 0:02:35
      519700 -- [-1988.638] (-2012.803) (-1993.546) (-1991.279) * (-1988.643) (-2019.694) (-1993.856) [-1984.769] -- 0:02:35
      519800 -- [-1982.302] (-2006.975) (-1988.835) (-1992.062) * (-1986.329) (-2003.575) [-1986.216] (-1988.535) -- 0:02:35
      519900 -- (-1986.780) (-1998.829) [-1989.397] (-1991.829) * (-1987.091) (-1997.280) (-1993.763) [-1990.212] -- 0:02:35
      520000 -- (-1990.215) (-2004.801) [-1991.775] (-1985.631) * [-1986.208] (-2005.225) (-1994.465) (-1986.979) -- 0:02:35

      Average standard deviation of split frequencies: 0.003289

      520100 -- (-1993.382) (-2014.443) (-1998.047) [-1983.848] * (-1985.149) (-2003.762) (-1992.929) [-1988.464] -- 0:02:35
      520200 -- (-1981.661) (-1996.493) (-1987.667) [-1980.619] * [-1988.986] (-1996.234) (-1997.111) (-1980.790) -- 0:02:34
      520300 -- [-1983.971] (-1994.573) (-1993.901) (-1994.448) * (-1986.357) (-1994.093) (-1999.043) [-1982.362] -- 0:02:34
      520400 -- (-1983.321) (-1995.462) [-1990.453] (-1994.489) * [-1983.465] (-1993.205) (-2003.960) (-1981.154) -- 0:02:34
      520500 -- [-1983.824] (-1992.302) (-1994.735) (-1991.465) * [-1983.624] (-1990.424) (-2008.346) (-1985.387) -- 0:02:34
      520600 -- [-1982.176] (-2000.448) (-1995.920) (-1990.653) * [-1986.735] (-1990.589) (-2012.442) (-1986.154) -- 0:02:34
      520700 -- [-1983.204] (-2006.064) (-1989.985) (-1993.322) * (-1989.493) [-1990.686] (-2011.614) (-1986.511) -- 0:02:34
      520800 -- [-1980.707] (-2005.007) (-1992.031) (-1993.146) * (-1995.881) (-1992.572) (-2006.453) [-1984.171] -- 0:02:34
      520900 -- [-1983.052] (-2005.346) (-1980.595) (-2000.633) * (-1997.971) (-1992.731) (-1999.776) [-1985.354] -- 0:02:34
      521000 -- [-1983.329] (-2005.120) (-1982.712) (-1997.325) * (-1994.439) (-1990.593) (-2000.771) [-1984.433] -- 0:02:34

      Average standard deviation of split frequencies: 0.003385

      521100 -- (-1983.479) (-2008.355) [-1976.379] (-1996.832) * (-1989.789) (-1987.469) (-1994.779) [-1980.419] -- 0:02:34
      521200 -- (-1981.867) (-2001.252) [-1978.685] (-2006.062) * (-1993.282) [-1987.789] (-1998.133) (-1982.506) -- 0:02:34
      521300 -- [-1978.709] (-2002.331) (-1987.685) (-1998.934) * (-1988.732) (-1988.304) (-1995.816) [-1982.034] -- 0:02:34
      521400 -- [-1987.392] (-1996.320) (-1989.835) (-2000.808) * (-1988.105) (-1987.157) (-1990.551) [-1978.956] -- 0:02:34
      521500 -- [-1985.013] (-1992.853) (-1983.181) (-1993.819) * (-1993.356) (-1987.108) (-1997.315) [-1979.120] -- 0:02:34
      521600 -- [-1983.029] (-1987.890) (-1981.813) (-1989.407) * (-1993.025) (-1994.516) (-1996.530) [-1978.721] -- 0:02:34
      521700 -- (-1979.330) [-1991.776] (-1979.643) (-1986.627) * (-1993.049) (-1997.142) (-2003.702) [-1980.204] -- 0:02:34
      521800 -- (-1977.889) (-1992.988) [-1981.467] (-1986.542) * [-1984.847] (-1992.727) (-1992.460) (-1984.344) -- 0:02:34
      521900 -- (-1981.747) (-1995.721) [-1981.495] (-1983.745) * [-1985.286] (-1998.209) (-1993.691) (-1994.079) -- 0:02:34
      522000 -- [-1981.246] (-1991.507) (-1982.351) (-1986.505) * (-1987.795) (-1989.774) (-1997.527) [-1983.446] -- 0:02:34

      Average standard deviation of split frequencies: 0.003457

      522100 -- (-1987.865) (-1992.287) (-1982.159) [-1988.116] * [-1982.343] (-1997.777) (-1993.642) (-1983.963) -- 0:02:34
      522200 -- [-1988.275] (-1996.517) (-1985.081) (-1985.911) * [-1985.146] (-1996.408) (-1995.323) (-1979.412) -- 0:02:34
      522300 -- [-1984.551] (-1995.356) (-1990.621) (-1990.639) * [-1979.248] (-1993.579) (-1989.749) (-1981.356) -- 0:02:34
      522400 -- (-1987.283) (-1997.338) [-1988.829] (-1994.574) * [-1977.911] (-1995.342) (-1989.421) (-1984.969) -- 0:02:34
      522500 -- [-1978.759] (-1994.534) (-1982.127) (-1997.171) * [-1978.631] (-2000.275) (-1992.970) (-1991.066) -- 0:02:34
      522600 -- [-1984.105] (-1993.599) (-1982.975) (-1997.877) * [-1980.246] (-1992.735) (-1994.462) (-1991.237) -- 0:02:34
      522700 -- [-1982.090] (-1994.608) (-1986.154) (-1996.344) * (-1983.752) (-1997.189) (-1996.357) [-1981.036] -- 0:02:34
      522800 -- [-1979.225] (-2000.838) (-1987.719) (-1998.656) * (-1989.785) (-1990.154) (-1996.084) [-1985.310] -- 0:02:34
      522900 -- (-1979.851) (-2010.002) (-1986.908) [-1988.243] * (-1988.968) (-1993.053) [-1994.724] (-1982.990) -- 0:02:34
      523000 -- [-1984.822] (-2013.412) (-1988.328) (-1987.680) * (-1992.570) [-1986.034] (-1999.114) (-1983.458) -- 0:02:34

      Average standard deviation of split frequencies: 0.003398

      523100 -- (-1987.662) (-2014.138) [-1984.432] (-1987.475) * (-1989.060) (-1989.555) (-2010.051) [-1983.215] -- 0:02:34
      523200 -- [-1988.092] (-2001.501) (-1985.289) (-1988.992) * (-1988.672) [-1988.485] (-1996.926) (-1984.857) -- 0:02:34
      523300 -- (-1991.639) (-2001.295) (-1987.907) [-1987.828] * [-1984.309] (-1992.856) (-1996.036) (-1983.903) -- 0:02:33
      523400 -- (-1985.544) (-1995.103) (-1987.391) [-1985.926] * [-1981.685] (-1990.028) (-1994.779) (-1987.822) -- 0:02:33
      523500 -- (-1986.802) (-1996.030) (-1987.450) [-1985.118] * (-1983.470) (-1993.079) [-1996.511] (-1989.329) -- 0:02:33
      523600 -- (-1988.048) (-1999.821) (-1991.596) [-1984.250] * (-1986.491) (-1996.522) (-1995.997) [-1984.807] -- 0:02:33
      523700 -- (-1984.935) (-2003.620) (-1992.485) [-1983.663] * (-1984.574) [-1993.177] (-1993.475) (-1991.543) -- 0:02:33
      523800 -- (-1987.271) (-1994.642) (-1994.715) [-1982.292] * [-1984.948] (-1991.800) (-1994.034) (-1989.245) -- 0:02:33
      523900 -- [-1991.080] (-2009.571) (-1995.458) (-1981.620) * [-1989.439] (-1990.727) (-2001.354) (-1990.506) -- 0:02:33
      524000 -- [-1984.846] (-2000.512) (-1996.211) (-1988.209) * (-1994.236) (-1992.159) (-2002.780) [-1985.027] -- 0:02:33

      Average standard deviation of split frequencies: 0.003366

      524100 -- [-1981.511] (-2006.981) (-1992.421) (-1985.334) * (-1987.144) (-1995.664) (-2005.095) [-1983.252] -- 0:02:33
      524200 -- (-1983.426) (-2014.829) (-2001.649) [-1978.582] * [-1980.081] (-1987.917) (-1993.510) (-1986.529) -- 0:02:33
      524300 -- (-1981.428) (-2004.724) (-1996.588) [-1979.307] * [-1980.588] (-1997.452) (-2003.451) (-1981.951) -- 0:02:33
      524400 -- (-1988.137) (-2001.070) (-2006.358) [-1982.910] * (-1980.357) (-1990.392) (-2000.662) [-1988.532] -- 0:02:33
      524500 -- (-1981.737) (-1998.624) (-1997.425) [-1978.909] * [-1978.306] (-1996.708) (-1994.435) (-1986.922) -- 0:02:33
      524600 -- (-1984.342) (-1992.327) (-1999.866) [-1979.022] * [-1979.467] (-1999.529) (-1994.164) (-1985.413) -- 0:02:33
      524700 -- [-1979.691] (-1989.935) (-2004.960) (-1988.062) * [-1982.509] (-2013.004) (-1987.104) (-1986.595) -- 0:02:33
      524800 -- (-1980.274) [-1983.779] (-2003.450) (-1991.499) * [-1982.902] (-2002.865) (-1989.912) (-1981.850) -- 0:02:33
      524900 -- [-1985.696] (-1987.680) (-2004.636) (-1989.447) * (-1981.794) (-2015.362) (-1991.238) [-1987.776] -- 0:02:33
      525000 -- [-1989.044] (-1990.251) (-1994.610) (-1993.460) * (-1982.214) (-2004.371) (-1990.635) [-1990.840] -- 0:02:33

      Average standard deviation of split frequencies: 0.003462

      525100 -- (-1991.807) (-1994.230) [-1989.839] (-1988.099) * (-1983.178) (-2022.217) [-1991.242] (-1986.069) -- 0:02:33
      525200 -- (-1987.761) (-1990.055) [-1986.969] (-1986.726) * (-1982.785) (-2017.031) (-1993.924) [-1988.151] -- 0:02:33
      525300 -- (-1984.871) (-1996.199) (-1990.274) [-1983.956] * [-1980.761] (-2007.839) (-1999.508) (-1991.165) -- 0:02:33
      525400 -- [-1982.547] (-1990.007) (-1994.427) (-1988.712) * [-1980.331] (-2008.285) (-1989.586) (-1987.482) -- 0:02:33
      525500 -- [-1987.418] (-1991.305) (-2001.839) (-1989.224) * (-1982.819) (-1999.392) [-1990.005] (-1995.740) -- 0:02:33
      525600 -- (-1991.788) (-1991.182) (-2002.885) [-1988.520] * [-1979.398] (-1997.193) (-1989.284) (-1990.900) -- 0:02:33
      525700 -- (-1992.369) [-1990.641] (-1998.710) (-1985.084) * [-1982.912] (-1987.434) (-1986.698) (-1992.367) -- 0:02:33
      525800 -- (-1992.042) (-1987.852) [-1989.983] (-1987.846) * [-1981.189] (-1993.160) (-1991.842) (-1989.415) -- 0:02:33
      525900 -- [-1983.750] (-1985.036) (-1995.645) (-1990.239) * [-1984.413] (-1992.567) (-1995.757) (-1996.638) -- 0:02:33
      526000 -- (-1996.667) (-1990.905) (-1993.951) [-1988.080] * [-1987.391] (-1991.023) (-1991.361) (-1998.388) -- 0:02:33

      Average standard deviation of split frequencies: 0.003226

      526100 -- (-1995.706) (-1994.993) (-1985.583) [-1990.708] * [-1980.431] (-1987.688) (-1990.563) (-1990.433) -- 0:02:33
      526200 -- (-1999.419) (-1997.287) [-1990.922] (-1996.785) * [-1983.042] (-1994.903) (-1992.964) (-1998.830) -- 0:02:33
      526300 -- (-1998.945) [-1995.116] (-1997.872) (-2000.651) * (-1986.842) [-1986.332] (-1992.848) (-2004.309) -- 0:02:33
      526400 -- (-1996.977) (-1999.813) [-1990.586] (-1997.089) * (-1995.762) (-1991.246) (-1991.209) [-1999.609] -- 0:02:32
      526500 -- (-1999.073) [-1991.830] (-1997.049) (-1992.365) * (-2007.956) (-1990.684) [-1990.690] (-1997.429) -- 0:02:32
      526600 -- (-1995.935) [-1986.954] (-2000.742) (-1990.382) * (-1989.829) [-1984.179] (-1989.632) (-1991.540) -- 0:02:32
      526700 -- (-1991.689) (-1987.179) (-1993.434) [-1984.956] * [-1986.897] (-1982.745) (-1989.369) (-2004.047) -- 0:02:32
      526800 -- (-1993.455) (-1992.162) (-1990.376) [-1986.698] * (-1989.463) [-1986.143] (-1987.182) (-1990.256) -- 0:02:32
      526900 -- (-1992.250) (-1995.090) (-1989.254) [-1980.288] * [-1982.826] (-1985.818) (-1995.962) (-1988.487) -- 0:02:32
      527000 -- (-1990.765) (-2004.051) (-1981.628) [-1982.867] * [-1981.788] (-1991.828) (-1993.262) (-1990.397) -- 0:02:32

      Average standard deviation of split frequencies: 0.003219

      527100 -- [-1989.838] (-2001.738) (-1991.569) (-1992.715) * [-1988.240] (-1996.439) (-1999.321) (-2000.405) -- 0:02:32
      527200 -- (-1993.707) (-2001.743) (-1993.390) [-1985.488] * [-1987.153] (-2001.454) (-1996.390) (-1993.468) -- 0:02:32
      527300 -- (-1987.715) (-2000.582) (-2001.821) [-1976.647] * [-1987.867] (-2002.193) (-1995.518) (-1988.892) -- 0:02:32
      527400 -- (-1994.834) (-1998.819) (-1996.972) [-1979.796] * [-1983.352] (-2006.351) (-1997.772) (-1991.864) -- 0:02:32
      527500 -- (-1995.583) (-2008.181) (-1995.114) [-1983.370] * [-1981.981] (-2000.192) (-2000.937) (-1992.177) -- 0:02:32
      527600 -- (-1988.073) (-2004.099) (-1992.323) [-1982.636] * (-1981.172) (-1991.645) [-1992.262] (-1996.527) -- 0:02:32
      527700 -- (-1985.099) (-2004.950) (-1987.061) [-1984.011] * (-1988.577) (-1996.480) [-1988.120] (-1993.796) -- 0:02:32
      527800 -- (-1987.446) (-1989.354) (-1989.080) [-1984.307] * [-1981.642] (-2001.487) (-1999.555) (-1991.478) -- 0:02:32
      527900 -- [-1978.716] (-1987.978) (-1985.814) (-1984.829) * [-1978.809] (-1994.804) (-1999.643) (-1998.631) -- 0:02:32
      528000 -- (-1983.592) (-1986.772) (-1982.190) [-1981.233] * [-1980.723] (-2000.196) (-2015.618) (-1997.171) -- 0:02:32

      Average standard deviation of split frequencies: 0.003213

      528100 -- (-1985.994) (-1987.592) [-1990.710] (-1985.562) * [-1979.498] (-1993.117) (-1993.334) (-1990.146) -- 0:02:32
      528200 -- (-1991.531) (-1987.663) (-1990.914) [-1980.931] * [-1981.090] (-1991.386) (-2000.656) (-1993.630) -- 0:02:32
      528300 -- (-1997.157) (-1991.946) (-1991.581) [-1982.644] * [-1982.580] (-1996.914) (-1992.622) (-1993.015) -- 0:02:32
      528400 -- (-1995.462) [-1985.341] (-1983.292) (-1980.649) * [-1983.523] (-1994.957) (-1996.118) (-1988.965) -- 0:02:32
      528500 -- (-1996.880) (-1986.106) (-1982.057) [-1980.470] * (-1992.034) (-1997.651) (-1999.555) [-1984.237] -- 0:02:32
      528600 -- (-1992.150) (-1991.509) (-1987.147) [-1979.846] * [-1991.763] (-1996.548) (-1988.852) (-1987.187) -- 0:02:32
      528700 -- (-1995.788) (-1986.535) (-1988.845) [-1979.601] * (-2001.965) (-1987.768) [-1987.437] (-1995.802) -- 0:02:32
      528800 -- (-1981.959) (-1995.306) [-1983.595] (-1984.638) * (-1996.138) (-1991.820) (-1984.948) [-1990.088] -- 0:02:32
      528900 -- (-1988.203) (-2000.578) (-1986.411) [-1980.009] * (-1989.809) (-1988.910) (-1989.016) [-1986.013] -- 0:02:32
      529000 -- (-1983.378) (-2005.803) (-1990.719) [-1980.626] * [-1990.679] (-1991.183) (-1997.695) (-1988.480) -- 0:02:32

      Average standard deviation of split frequencies: 0.003156

      529100 -- [-1986.863] (-1998.996) (-1990.885) (-1982.213) * (-1989.143) (-1990.341) (-1992.828) [-1984.123] -- 0:02:32
      529200 -- [-1981.100] (-1997.245) (-1992.404) (-1981.909) * (-1987.967) (-1991.855) (-1996.043) [-1984.702] -- 0:02:32
      529300 -- (-1981.651) (-1995.985) [-1983.090] (-1980.515) * [-1985.154] (-1993.118) (-1987.830) (-1992.564) -- 0:02:32
      529400 -- (-1983.646) (-1998.040) (-1982.755) [-1979.162] * (-1982.385) (-1997.293) [-1984.166] (-1987.038) -- 0:02:32
      529500 -- (-1986.029) (-1998.236) [-1979.959] (-1983.899) * [-1985.596] (-1994.645) (-1984.735) (-1993.933) -- 0:02:31
      529600 -- [-1985.655] (-1988.708) (-1982.640) (-1987.667) * (-1987.133) (-1988.828) (-1985.464) [-1988.898] -- 0:02:31
      529700 -- [-1988.988] (-1989.576) (-1984.866) (-1988.431) * (-1989.526) (-1990.670) [-1983.146] (-1985.659) -- 0:02:31
      529800 -- (-1990.644) (-1991.385) [-1991.520] (-1989.063) * (-1989.851) [-1987.238] (-1989.165) (-1988.229) -- 0:02:31
      529900 -- (-1986.488) (-1990.545) [-1980.104] (-1992.576) * (-1988.694) (-1986.519) [-1987.645] (-1991.038) -- 0:02:31
      530000 -- (-1986.176) (-1994.270) [-1985.185] (-1987.573) * (-1985.656) [-1988.479] (-1990.023) (-1991.156) -- 0:02:31

      Average standard deviation of split frequencies: 0.003303

      530100 -- (-1988.416) [-1989.997] (-1989.292) (-1992.180) * [-1985.403] (-1994.177) (-1990.022) (-1989.585) -- 0:02:31
      530200 -- (-1985.562) (-1987.966) [-1984.864] (-1983.677) * (-1990.376) (-1993.708) (-1995.096) [-1989.281] -- 0:02:31
      530300 -- (-1994.427) (-1992.972) (-1989.204) [-1984.562] * (-1990.673) [-1991.104] (-1996.157) (-1993.390) -- 0:02:31
      530400 -- (-1990.772) (-1991.957) (-2006.982) [-1987.250] * (-1991.574) (-1992.329) (-2005.249) [-1987.253] -- 0:02:31
      530500 -- (-1992.965) [-1988.370] (-1995.912) (-1991.964) * (-1991.754) (-1996.243) (-2002.226) [-1987.832] -- 0:02:31
      530600 -- [-1979.802] (-1984.936) (-2000.122) (-1989.447) * (-1989.415) (-1987.359) (-1994.961) [-1990.209] -- 0:02:31
      530700 -- (-1983.737) (-1988.674) (-1989.325) [-1980.087] * (-1997.802) [-1983.819] (-1989.910) (-1993.267) -- 0:02:31
      530800 -- (-1980.397) (-1989.798) (-1993.020) [-1978.794] * (-1988.659) [-1988.044] (-1988.679) (-1996.164) -- 0:02:31
      530900 -- (-1983.298) (-1991.969) [-1985.327] (-1984.423) * (-1986.339) (-1988.837) [-1985.479] (-1998.203) -- 0:02:31
      531000 -- (-1985.645) (-1995.522) (-1983.089) [-1982.259] * (-1987.424) (-1987.462) (-1989.879) [-1987.958] -- 0:02:31

      Average standard deviation of split frequencies: 0.003195

      531100 -- (-1991.805) (-1998.688) [-1985.153] (-1993.350) * (-1989.791) (-1992.488) (-1988.121) [-1985.070] -- 0:02:31
      531200 -- (-1992.077) (-1992.394) [-1985.039] (-1998.826) * [-1985.974] (-1984.694) (-1988.621) (-1986.643) -- 0:02:31
      531300 -- [-1988.202] (-1993.384) (-1986.656) (-1999.322) * (-1989.174) (-1996.215) (-1990.270) [-1988.586] -- 0:02:31
      531400 -- (-1988.638) (-1995.990) [-1985.956] (-2000.112) * (-1996.282) [-1988.691] (-1989.603) (-1991.418) -- 0:02:31
      531500 -- (-1995.029) (-1990.002) [-1987.413] (-1982.958) * (-1986.875) [-1984.268] (-1991.289) (-1989.883) -- 0:02:31
      531600 -- (-2000.725) [-1987.124] (-1991.154) (-1984.847) * (-1982.477) (-1989.010) (-1995.607) [-1988.792] -- 0:02:31
      531700 -- (-2004.406) (-1995.771) (-1987.486) [-1981.494] * (-1987.292) (-1981.677) (-2000.148) [-1988.241] -- 0:02:31
      531800 -- (-1994.193) [-1994.867] (-1993.716) (-1983.527) * (-1987.470) [-1983.279] (-1998.187) (-1996.086) -- 0:02:31
      531900 -- (-1990.940) (-1991.456) (-1996.119) [-1979.492] * (-1988.399) (-1996.262) (-1991.577) [-1991.656] -- 0:02:31
      532000 -- (-1983.258) (-1993.622) (-1987.167) [-1977.657] * [-1994.945] (-1996.657) (-1987.388) (-1997.309) -- 0:02:31

      Average standard deviation of split frequencies: 0.003214

      532100 -- (-1983.701) (-1993.874) (-1991.226) [-1983.353] * [-1985.984] (-1995.217) (-1985.145) (-2000.794) -- 0:02:31
      532200 -- (-1981.827) (-1997.263) (-1987.158) [-1979.175] * [-1983.653] (-2001.959) (-1987.984) (-1996.334) -- 0:02:31
      532300 -- [-1982.814] (-1994.276) (-1995.779) (-1981.448) * (-1985.893) (-2001.089) [-1988.043] (-1993.420) -- 0:02:31
      532400 -- (-1982.889) (-1990.665) (-1998.334) [-1986.475] * (-1987.807) [-1992.676] (-1985.104) (-2007.936) -- 0:02:31
      532500 -- [-1978.467] (-1993.002) (-1991.964) (-1987.387) * [-1985.332] (-1997.212) (-1997.342) (-2007.546) -- 0:02:31
      532600 -- [-1983.756] (-1993.028) (-1988.161) (-1990.452) * [-1984.369] (-1995.369) (-2004.228) (-2009.903) -- 0:02:30
      532700 -- (-1985.036) (-1987.974) (-1983.173) [-1982.296] * [-1986.763] (-1990.803) (-2002.612) (-2016.751) -- 0:02:30
      532800 -- (-1987.120) (-1990.328) (-1983.090) [-1981.738] * [-1990.241] (-1986.220) (-1999.619) (-2014.412) -- 0:02:30
      532900 -- [-1987.961] (-1994.248) (-2000.120) (-1983.046) * [-1986.975] (-1995.482) (-1990.888) (-2001.377) -- 0:02:30
      533000 -- (-1985.247) (-1995.913) [-1994.802] (-1990.911) * (-1992.302) (-1994.778) [-1985.944] (-2006.824) -- 0:02:30

      Average standard deviation of split frequencies: 0.003158

      533100 -- [-1985.627] (-1989.990) (-1990.173) (-1981.877) * (-1999.861) (-1991.181) [-1985.896] (-2000.465) -- 0:02:30
      533200 -- (-1986.920) (-1988.297) [-1983.932] (-1992.355) * (-1993.611) (-1993.394) [-1987.364] (-1993.716) -- 0:02:30
      533300 -- [-1981.409] (-1993.508) (-1983.835) (-1984.052) * (-1986.280) (-1993.551) [-1985.228] (-1995.726) -- 0:02:30
      533400 -- [-1982.417] (-1990.640) (-1981.189) (-1991.543) * (-1985.268) [-1989.866] (-1988.798) (-1999.994) -- 0:02:30
      533500 -- [-1984.232] (-1988.485) (-1980.587) (-1991.829) * [-1983.394] (-1989.797) (-1992.005) (-1995.721) -- 0:02:30
      533600 -- (-1982.649) (-1991.036) (-1985.372) [-1993.149] * (-1984.939) (-1990.035) [-1990.346] (-1996.700) -- 0:02:30
      533700 -- [-1981.323] (-1991.194) (-1987.892) (-1992.802) * (-1982.806) [-1989.485] (-1988.765) (-2001.413) -- 0:02:30
      533800 -- [-1982.949] (-1991.765) (-1990.279) (-1990.211) * [-1984.225] (-1989.071) (-1983.157) (-2005.655) -- 0:02:30
      533900 -- (-1985.042) (-1987.433) [-1987.291] (-1989.608) * (-1988.374) (-1994.227) [-1980.155] (-2004.582) -- 0:02:31
      534000 -- [-1985.511] (-1989.588) (-1991.174) (-1988.665) * (-1986.207) (-1998.172) [-1976.733] (-2002.121) -- 0:02:30

      Average standard deviation of split frequencies: 0.003127

      534100 -- (-1984.868) (-1998.149) (-1995.065) [-1981.594] * (-1989.258) (-1999.406) [-1980.605] (-2011.085) -- 0:02:30
      534200 -- (-1981.297) (-2000.360) (-2003.042) [-1981.194] * (-1992.664) (-2000.069) [-1987.846] (-2004.142) -- 0:02:30
      534300 -- [-1979.302] (-1997.353) (-1997.451) (-1982.875) * (-2000.468) (-1995.040) [-1984.743] (-2001.319) -- 0:02:30
      534400 -- [-1981.064] (-2001.215) (-1991.546) (-1987.628) * (-1990.838) (-1992.146) [-1980.800] (-1993.274) -- 0:02:30
      534500 -- [-1989.156] (-2009.077) (-1987.329) (-1990.515) * (-1997.567) (-1996.022) [-1981.217] (-1997.771) -- 0:02:30
      534600 -- (-1981.331) (-2000.703) (-1982.883) [-1984.131] * (-1993.009) (-1997.209) [-1982.697] (-1997.832) -- 0:02:30
      534700 -- (-1992.287) [-1986.690] (-1979.395) (-1988.833) * (-1993.570) [-1994.821] (-1985.418) (-2000.713) -- 0:02:30
      534800 -- (-1985.692) [-1983.331] (-1991.594) (-1985.214) * (-2000.876) (-1990.437) [-1990.566] (-1996.783) -- 0:02:30
      534900 -- (-1987.299) [-1983.727] (-1995.134) (-1984.546) * (-1988.008) (-1987.212) [-1987.630] (-1996.869) -- 0:02:30
      535000 -- (-1987.623) [-1990.132] (-2008.979) (-1989.934) * (-1988.485) [-1989.214] (-1991.126) (-1993.792) -- 0:02:30

      Average standard deviation of split frequencies: 0.003171

      535100 -- [-1982.531] (-1987.753) (-1998.429) (-1989.517) * (-1988.716) (-1991.554) [-1984.517] (-1996.309) -- 0:02:30
      535200 -- (-1980.984) [-1984.250] (-1992.297) (-1995.111) * [-1996.523] (-1994.721) (-1985.203) (-1992.584) -- 0:02:30
      535300 -- (-1984.602) (-1992.976) (-1991.741) [-1984.867] * (-1995.295) (-2000.741) [-1988.833] (-1994.403) -- 0:02:30
      535400 -- (-1987.151) (-1988.984) (-2007.201) [-1984.471] * (-1994.376) [-1996.003] (-1988.024) (-1997.111) -- 0:02:30
      535500 -- (-1985.741) (-1998.446) (-1994.422) [-1985.349] * [-1991.439] (-1995.890) (-1988.857) (-1992.288) -- 0:02:30
      535600 -- [-1978.031] (-1993.570) (-2003.984) (-1985.762) * (-1987.335) (-2003.279) [-1984.789] (-1994.859) -- 0:02:30
      535700 -- [-1980.027] (-2000.213) (-1997.673) (-1982.516) * [-1989.940] (-2002.575) (-1986.200) (-1993.222) -- 0:02:29
      535800 -- [-1980.072] (-1997.373) (-1989.238) (-1984.182) * [-1990.993] (-1991.449) (-1991.002) (-1986.736) -- 0:02:29
      535900 -- [-1977.538] (-1992.772) (-1986.188) (-1990.836) * (-1992.772) (-1993.661) (-1992.377) [-1986.834] -- 0:02:29
      536000 -- [-1980.930] (-1994.757) (-1983.326) (-1993.776) * (-1982.909) [-1987.157] (-1994.350) (-1999.233) -- 0:02:29

      Average standard deviation of split frequencies: 0.003266

      536100 -- (-1987.596) (-1992.799) [-1982.808] (-1994.659) * [-1986.347] (-1994.091) (-1988.181) (-2009.045) -- 0:02:29
      536200 -- [-1984.480] (-1989.857) (-1985.963) (-1990.277) * [-1986.412] (-1998.558) (-1984.509) (-2006.105) -- 0:02:29
      536300 -- (-1992.652) (-1984.824) [-1984.304] (-1991.356) * (-1986.408) (-1997.122) [-1982.150] (-2008.180) -- 0:02:29
      536400 -- [-1992.455] (-1985.103) (-1985.823) (-1990.530) * (-1989.151) (-1998.993) [-1987.167] (-2005.735) -- 0:02:29
      536500 -- (-1991.931) (-1987.259) [-1982.646] (-1998.222) * [-1983.427] (-1997.954) (-1994.608) (-2005.071) -- 0:02:29
      536600 -- (-1987.028) (-1993.272) [-1985.064] (-1996.988) * [-1986.164] (-2004.316) (-1986.050) (-1998.175) -- 0:02:29
      536700 -- [-1984.337] (-1993.700) (-1983.881) (-2003.732) * [-1988.654] (-2010.656) (-1985.411) (-1999.430) -- 0:02:29
      536800 -- (-1982.599) (-1992.876) [-1980.948] (-2008.070) * (-1983.194) (-2002.629) [-1984.901] (-2001.013) -- 0:02:29
      536900 -- (-1977.740) [-1986.343] (-1994.032) (-1998.371) * [-1988.369] (-1997.884) (-1991.798) (-1994.515) -- 0:02:29
      537000 -- [-1983.986] (-1987.805) (-1988.885) (-1997.226) * [-1985.742] (-2003.738) (-1990.074) (-2007.154) -- 0:02:30

      Average standard deviation of split frequencies: 0.003360

      537100 -- (-1982.671) [-1986.517] (-1991.101) (-1991.947) * [-1985.189] (-1994.469) (-1987.183) (-2009.240) -- 0:02:29
      537200 -- [-1981.262] (-1984.241) (-1989.796) (-1998.515) * [-1980.126] (-1997.937) (-1998.328) (-2001.702) -- 0:02:29
      537300 -- [-1984.285] (-1986.236) (-1987.283) (-1996.313) * (-1980.366) (-1992.374) (-2005.496) [-1989.359] -- 0:02:29
      537400 -- [-1988.445] (-1984.947) (-1988.405) (-2005.122) * [-1982.294] (-1996.752) (-1995.095) (-1997.930) -- 0:02:29
      537500 -- (-1987.555) [-1987.598] (-1990.533) (-1995.695) * [-1984.974] (-2001.398) (-1994.057) (-1997.414) -- 0:02:29
      537600 -- (-1983.252) [-1983.757] (-1993.718) (-1996.413) * (-1984.526) [-1984.532] (-1982.911) (-1995.880) -- 0:02:29
      537700 -- [-1981.132] (-1987.960) (-1998.953) (-1998.326) * (-1987.017) (-1988.322) [-1986.352] (-1997.692) -- 0:02:29
      537800 -- [-1980.973] (-1985.771) (-1997.049) (-1992.573) * [-1978.068] (-1991.245) (-1987.110) (-1995.097) -- 0:02:29
      537900 -- [-1985.703] (-1996.669) (-1996.404) (-1998.771) * (-1989.225) (-1996.899) [-1981.425] (-1995.965) -- 0:02:29
      538000 -- (-1984.840) (-1990.584) [-1995.378] (-1996.235) * [-1989.028] (-1993.428) (-1977.447) (-1994.089) -- 0:02:29

      Average standard deviation of split frequencies: 0.003479

      538100 -- (-1985.265) [-1991.920] (-2003.703) (-1994.818) * (-1988.125) (-1993.495) [-1980.067] (-1996.166) -- 0:02:29
      538200 -- (-1985.855) (-1991.158) (-2010.430) [-1984.924] * (-1980.426) (-1992.918) [-1983.432] (-1996.115) -- 0:02:29
      538300 -- (-1987.942) (-1991.986) (-1992.900) [-1987.730] * (-1988.085) (-1996.189) [-1983.112] (-2003.353) -- 0:02:29
      538400 -- [-1981.499] (-1999.915) (-1993.603) (-1989.838) * [-1981.127] (-1997.384) (-1985.120) (-1995.967) -- 0:02:29
      538500 -- [-1982.017] (-1997.067) (-1998.889) (-1989.444) * [-1979.032] (-1992.823) (-1992.042) (-1988.816) -- 0:02:29
      538600 -- (-1981.620) (-1999.981) (-1998.576) [-1985.500] * (-1982.229) (-1992.653) [-1986.724] (-1992.193) -- 0:02:29
      538700 -- [-1983.265] (-2005.131) (-1995.625) (-1992.070) * [-1989.152] (-1988.912) (-1988.969) (-1992.760) -- 0:02:28
      538800 -- (-1982.179) (-1998.931) (-2001.811) [-1996.103] * [-1983.996] (-1990.533) (-1995.372) (-1996.220) -- 0:02:28
      538900 -- [-1987.618] (-1988.400) (-1996.858) (-1990.384) * (-1985.776) [-1987.841] (-1990.888) (-1994.203) -- 0:02:28
      539000 -- (-1994.052) (-1993.475) (-1999.159) [-1986.146] * [-1985.151] (-1993.516) (-1996.811) (-1992.032) -- 0:02:28

      Average standard deviation of split frequencies: 0.003322

      539100 -- [-1986.091] (-1997.945) (-1999.639) (-1987.993) * (-1990.888) (-1985.100) (-1999.154) [-1988.068] -- 0:02:28
      539200 -- [-1987.063] (-2001.201) (-2003.136) (-1992.393) * (-1992.039) (-1991.595) [-1994.265] (-1987.562) -- 0:02:28
      539300 -- (-1988.303) (-1998.812) [-1996.174] (-1994.842) * [-1982.340] (-1995.691) (-1990.729) (-1996.694) -- 0:02:28
      539400 -- (-1987.917) (-1993.299) [-1988.387] (-1999.059) * [-1983.250] (-1994.199) (-1994.274) (-1991.188) -- 0:02:28
      539500 -- [-1987.230] (-1991.798) (-1990.985) (-1996.411) * [-1983.839] (-1994.819) (-1995.474) (-1991.202) -- 0:02:28
      539600 -- (-1990.481) [-1992.809] (-1989.537) (-2007.918) * [-1988.674] (-1995.759) (-1998.629) (-1986.828) -- 0:02:28
      539700 -- (-1993.838) (-1991.135) [-1987.316] (-2007.840) * [-1980.756] (-1996.721) (-1993.264) (-1991.253) -- 0:02:28
      539800 -- (-1990.506) (-1998.483) [-1991.646] (-2010.617) * [-1980.522] (-1990.250) (-2004.396) (-1990.891) -- 0:02:28
      539900 -- (-1991.198) (-2002.562) [-1984.984] (-1995.630) * [-1987.341] (-1990.269) (-1996.080) (-1989.607) -- 0:02:28
      540000 -- [-1985.260] (-1996.255) (-1988.507) (-1989.061) * [-1985.657] (-1994.266) (-2000.032) (-1990.459) -- 0:02:28

      Average standard deviation of split frequencies: 0.003341

      540100 -- (-1999.982) (-2001.763) [-1985.056] (-1990.267) * [-1987.917] (-1992.944) (-2002.309) (-1991.349) -- 0:02:29
      540200 -- (-1982.440) (-1998.872) [-1986.082] (-1989.294) * [-1980.218] (-1995.642) (-2004.844) (-1991.700) -- 0:02:28
      540300 -- [-1982.872] (-2003.482) (-1986.080) (-1988.243) * [-1980.135] (-2000.498) (-2015.045) (-1999.870) -- 0:02:28
      540400 -- [-1988.574] (-2004.858) (-1991.548) (-1994.502) * [-1982.259] (-1994.626) (-2003.699) (-1991.472) -- 0:02:28
      540500 -- (-1983.280) (-1997.441) (-2000.117) [-1985.468] * [-1976.515] (-1985.082) (-2001.319) (-1993.946) -- 0:02:28
      540600 -- [-1980.474] (-2001.062) (-1998.305) (-1987.651) * [-1978.921] (-1981.241) (-1993.916) (-1994.885) -- 0:02:28
      540700 -- [-1983.389] (-1989.584) (-1995.139) (-1991.119) * (-1981.090) [-1979.621] (-1987.554) (-1987.304) -- 0:02:28
      540800 -- (-1995.138) [-1992.345] (-1999.721) (-1993.356) * (-1985.692) [-1983.694] (-1991.641) (-1987.945) -- 0:02:28
      540900 -- (-1994.864) (-1996.385) (-2014.676) [-1986.878] * (-1981.544) [-1980.930] (-1992.844) (-1993.699) -- 0:02:28
      541000 -- (-1987.598) (-2007.156) [-1992.448] (-1985.938) * [-1982.781] (-1987.700) (-1985.060) (-1992.797) -- 0:02:28

      Average standard deviation of split frequencies: 0.003235

      541100 -- (-1984.679) (-2000.777) (-1992.042) [-1980.259] * (-1985.131) [-1984.561] (-1982.046) (-1997.040) -- 0:02:28
      541200 -- (-1980.211) (-2001.862) (-1992.975) [-1981.506] * (-1999.759) [-1982.099] (-1983.391) (-1995.064) -- 0:02:28
      541300 -- [-1981.686] (-1999.498) (-1988.036) (-1983.665) * [-1985.664] (-1984.274) (-1984.727) (-1991.329) -- 0:02:28
      541400 -- (-1983.164) (-2000.712) (-1995.223) [-1983.641] * (-1984.657) (-1984.361) [-1983.856] (-1993.439) -- 0:02:28
      541500 -- (-1982.270) (-1994.430) (-1998.542) [-1979.695] * (-1982.254) [-1982.506] (-1986.960) (-1991.431) -- 0:02:28
      541600 -- (-1982.242) (-1988.333) (-1997.800) [-1979.489] * (-1984.028) [-1980.622] (-1984.219) (-1989.873) -- 0:02:28
      541700 -- [-1978.752] (-1985.484) (-2004.830) (-1980.720) * (-1991.215) [-1980.214] (-1984.965) (-1986.440) -- 0:02:28
      541800 -- (-1986.373) (-1993.868) (-2001.556) [-1979.814] * (-1988.651) [-1985.086] (-1987.119) (-1988.690) -- 0:02:27
      541900 -- [-1990.595] (-1995.691) (-2006.591) (-1986.058) * [-1987.069] (-1982.723) (-1992.065) (-1996.393) -- 0:02:27
      542000 -- (-1987.354) (-1997.995) (-1998.281) [-1983.065] * (-1992.928) [-1979.562] (-1988.169) (-2001.836) -- 0:02:27

      Average standard deviation of split frequencies: 0.003180

      542100 -- (-1988.499) (-2000.944) (-1993.932) [-1978.044] * (-1980.125) (-1985.046) [-1985.592] (-1996.342) -- 0:02:27
      542200 -- (-1988.347) (-1998.355) (-1996.193) [-1984.978] * (-1983.539) (-1994.015) [-1993.948] (-1991.769) -- 0:02:27
      542300 -- [-1986.258] (-2000.585) (-2000.445) (-1988.264) * (-1993.297) [-1985.923] (-1981.001) (-1993.831) -- 0:02:27
      542400 -- (-1988.274) [-1991.690] (-2007.462) (-1992.598) * [-1984.884] (-1981.303) (-1982.418) (-1989.144) -- 0:02:27
      542500 -- [-1982.912] (-1986.291) (-2000.993) (-1982.766) * [-1983.900] (-1985.350) (-1983.282) (-2000.058) -- 0:02:27
      542600 -- (-1982.826) [-1989.002] (-1998.423) (-1987.249) * (-1984.924) (-1984.176) [-1983.293] (-1994.593) -- 0:02:27
      542700 -- (-1992.627) (-1989.204) (-1988.947) [-1983.668] * (-1984.219) [-1983.986] (-1989.160) (-2003.194) -- 0:02:27
      542800 -- [-1980.719] (-1992.303) (-1991.805) (-1986.884) * [-1984.885] (-1992.529) (-1987.930) (-2009.270) -- 0:02:27
      542900 -- (-1985.496) (-1989.345) (-1999.668) [-1985.684] * (-1990.045) (-1985.848) [-1981.850] (-2006.510) -- 0:02:27
      543000 -- (-1989.983) (-1993.813) (-1996.164) [-1981.782] * (-1993.604) (-1992.222) [-1982.444] (-2011.145) -- 0:02:27

      Average standard deviation of split frequencies: 0.003099

      543100 -- [-1991.573] (-1998.039) (-1990.990) (-1982.782) * (-1998.257) (-1986.076) (-1983.485) [-2001.899] -- 0:02:28
      543200 -- (-1988.325) (-1992.660) (-1997.336) [-1981.128] * (-1996.798) [-1983.259] (-1984.761) (-1995.448) -- 0:02:28
      543300 -- (-1988.555) (-1994.950) (-1998.023) [-1981.835] * (-1991.932) (-1985.661) [-1985.111] (-1994.120) -- 0:02:27
      543400 -- (-1985.782) (-1992.559) (-1994.512) [-1984.762] * (-1989.650) [-1983.140] (-1985.189) (-2000.273) -- 0:02:27
      543500 -- (-1984.748) (-1994.892) (-1986.616) [-1985.529] * (-1994.946) [-1982.114] (-1988.916) (-2001.129) -- 0:02:27
      543600 -- (-1989.450) (-1995.050) (-1990.223) [-1991.001] * (-1990.935) [-1983.228] (-1989.164) (-1997.513) -- 0:02:27
      543700 -- (-1988.978) (-2005.259) (-1996.427) [-1986.323] * (-1989.713) [-1983.034] (-1982.228) (-1995.442) -- 0:02:27
      543800 -- [-1985.039] (-1991.112) (-1998.503) (-1987.181) * (-1990.714) (-1988.946) [-1981.907] (-1995.105) -- 0:02:27
      543900 -- (-1983.901) (-1998.262) (-1996.097) [-1987.743] * (-1999.441) [-1987.173] (-1987.673) (-1996.788) -- 0:02:27
      544000 -- [-1989.120] (-2003.558) (-1992.105) (-1993.152) * (-2000.389) (-1983.220) (-1988.035) [-1989.072] -- 0:02:27

      Average standard deviation of split frequencies: 0.002896

      544100 -- [-1985.441] (-1994.760) (-1994.443) (-1987.176) * (-2003.457) (-1984.898) [-1985.897] (-1988.995) -- 0:02:27
      544200 -- (-1992.277) (-1991.089) (-1995.498) [-1984.194] * (-2008.264) [-1983.319] (-1982.272) (-1992.157) -- 0:02:27
      544300 -- (-1999.297) (-1988.432) (-2005.529) [-1983.575] * (-2003.111) [-1992.058] (-1987.133) (-1994.497) -- 0:02:27
      544400 -- (-2008.058) [-1986.563] (-1998.905) (-1988.108) * (-2003.180) [-1984.208] (-1987.860) (-1986.863) -- 0:02:27
      544500 -- (-2004.411) [-1988.030] (-2009.556) (-1996.197) * (-1995.501) (-1980.041) [-1981.492] (-1997.424) -- 0:02:27
      544600 -- (-1998.910) (-1985.507) (-2003.172) [-1980.770] * (-1995.441) [-1984.682] (-1988.855) (-1998.063) -- 0:02:27
      544700 -- (-1995.535) [-1985.598] (-1990.831) (-1985.475) * (-1998.589) [-1981.252] (-1990.736) (-1997.866) -- 0:02:27
      544800 -- (-1991.753) [-1988.989] (-1995.347) (-1982.851) * (-1995.546) [-1981.508] (-1987.499) (-1999.287) -- 0:02:27
      544900 -- (-2001.306) (-2000.466) (-1997.317) [-1983.291] * (-1994.954) (-1983.120) [-1986.549] (-2001.047) -- 0:02:26
      545000 -- (-1987.954) (-1998.887) (-1996.210) [-1984.262] * (-1990.503) [-1979.821] (-1993.301) (-2000.413) -- 0:02:26

      Average standard deviation of split frequencies: 0.002940

      545100 -- [-1987.940] (-1997.473) (-1991.317) (-1985.439) * (-1986.694) [-1980.486] (-2006.813) (-1992.546) -- 0:02:26
      545200 -- (-1986.108) (-1999.857) (-1996.438) [-1986.620] * (-1987.695) [-1981.271] (-2005.690) (-1991.129) -- 0:02:26
      545300 -- [-1985.809] (-1996.591) (-1993.481) (-1982.836) * (-1983.017) [-1980.741] (-2000.346) (-1997.987) -- 0:02:26
      545400 -- (-1987.280) [-1989.366] (-1996.349) (-1985.786) * (-1991.178) [-1980.845] (-2008.650) (-1992.961) -- 0:02:26
      545500 -- (-1983.746) [-1989.182] (-1999.205) (-1983.654) * (-1985.783) [-1982.748] (-1999.015) (-1997.930) -- 0:02:26
      545600 -- (-1988.296) (-1987.622) (-1998.319) [-1980.111] * [-1983.446] (-1995.291) (-1991.942) (-2001.168) -- 0:02:26
      545700 -- [-1983.409] (-1990.785) (-1993.655) (-1983.441) * [-1979.427] (-1994.453) (-1985.011) (-2002.969) -- 0:02:26
      545800 -- (-1992.951) (-1986.107) (-1999.037) [-1985.416] * (-1981.887) (-1994.582) [-1991.048] (-1995.185) -- 0:02:26
      545900 -- (-1991.005) [-1987.500] (-2002.896) (-1985.655) * [-1982.749] (-1993.406) (-1990.986) (-1996.379) -- 0:02:26
      546000 -- (-1995.725) (-1986.772) (-1993.973) [-1982.752] * [-1985.191] (-1993.777) (-1998.401) (-2001.649) -- 0:02:26

      Average standard deviation of split frequencies: 0.003009

      546100 -- (-1984.740) [-1986.540] (-1991.549) (-1985.991) * [-1984.186] (-1991.957) (-1992.718) (-1992.065) -- 0:02:27
      546200 -- (-1984.862) (-1995.440) (-1999.415) [-1984.243] * [-1983.763] (-1985.040) (-2001.270) (-1992.763) -- 0:02:27
      546300 -- (-1990.897) (-2002.813) (-1999.571) [-1983.309] * (-1983.781) [-1986.118] (-1999.652) (-1987.956) -- 0:02:26
      546400 -- (-1991.481) (-1996.445) (-1999.879) [-1982.071] * [-1982.175] (-1985.742) (-2001.346) (-1997.303) -- 0:02:26
      546500 -- (-2003.068) (-1994.342) [-1997.908] (-1977.831) * [-1981.676] (-1988.815) (-2001.350) (-1988.706) -- 0:02:26
      546600 -- (-2005.236) (-1998.687) (-1998.229) [-1982.696] * [-1985.316] (-1998.814) (-2003.868) (-1988.555) -- 0:02:26
      546700 -- [-1989.031] (-1992.730) (-1999.327) (-1983.542) * (-1990.088) (-1995.388) (-2001.665) [-1982.410] -- 0:02:26
      546800 -- (-1993.770) (-1995.505) (-2009.563) [-1980.733] * (-1980.098) (-1985.932) (-2006.021) [-1982.837] -- 0:02:26
      546900 -- (-2002.135) (-1991.830) (-1997.492) [-1976.860] * [-1982.805] (-1977.583) (-1998.972) (-1994.130) -- 0:02:26
      547000 -- (-1993.674) (-1996.469) (-1988.820) [-1976.214] * [-1980.248] (-1983.296) (-1994.163) (-1995.931) -- 0:02:26

      Average standard deviation of split frequencies: 0.003151

      547100 -- (-1988.518) (-1990.283) (-2000.355) [-1978.890] * (-1983.128) [-1981.772] (-1996.373) (-1995.385) -- 0:02:26
      547200 -- (-1991.050) (-1988.208) (-2005.005) [-1986.944] * (-1986.119) [-1984.004] (-1995.183) (-1997.786) -- 0:02:26
      547300 -- (-1988.503) (-1989.207) (-1996.417) [-1985.982] * (-1988.013) [-1979.248] (-1986.472) (-1998.994) -- 0:02:26
      547400 -- (-1987.651) (-1987.572) (-1994.825) [-1982.598] * (-1992.505) [-1980.271] (-1984.969) (-1997.628) -- 0:02:26
      547500 -- (-1992.526) (-1999.560) (-1994.331) [-1980.537] * (-1991.351) (-1987.717) [-1982.606] (-1999.101) -- 0:02:26
      547600 -- (-1989.800) (-1999.301) (-1992.895) [-1980.218] * (-1987.181) (-1988.776) (-1985.515) [-1985.199] -- 0:02:26
      547700 -- (-1989.361) (-1992.561) (-1995.671) [-1981.110] * (-1990.720) [-1988.946] (-1982.769) (-1986.633) -- 0:02:26
      547800 -- (-1989.144) (-2006.519) [-1985.178] (-1981.984) * (-1996.075) (-1993.599) [-1982.431] (-1990.116) -- 0:02:26
      547900 -- (-1991.992) (-2000.476) [-1987.474] (-1986.450) * (-1987.011) (-1993.498) [-1987.840] (-1988.553) -- 0:02:26
      548000 -- (-1985.226) (-1989.024) (-1993.737) [-1987.979] * (-1994.817) (-1992.105) [-1986.097] (-1994.244) -- 0:02:25

      Average standard deviation of split frequencies: 0.003170

      548100 -- (-1995.015) (-1990.337) (-1987.450) [-1986.620] * (-1997.874) [-1983.034] (-1988.782) (-1990.366) -- 0:02:25
      548200 -- (-1986.505) (-1994.929) (-1987.320) [-1983.777] * (-1992.339) [-1979.657] (-1986.341) (-1997.130) -- 0:02:25
      548300 -- (-1984.759) (-2006.071) [-1988.465] (-1986.532) * (-1993.930) [-1981.143] (-1989.592) (-1992.221) -- 0:02:25
      548400 -- (-1989.705) (-1993.078) [-1989.996] (-1989.450) * (-2004.210) (-1987.471) [-1986.428] (-1986.496) -- 0:02:25
      548500 -- [-1989.930] (-1995.890) (-1990.160) (-1985.900) * (-1995.354) (-1984.957) [-1985.271] (-1999.629) -- 0:02:25
      548600 -- (-1986.007) (-2000.542) (-1991.148) [-1984.142] * (-1997.638) [-1983.414] (-1990.911) (-1993.314) -- 0:02:25
      548700 -- [-1986.622] (-2001.444) (-1995.620) (-1984.290) * (-1991.664) [-1986.131] (-1988.074) (-2001.765) -- 0:02:25
      548800 -- (-1987.766) (-2005.868) [-1988.952] (-1983.293) * (-1996.234) (-1990.281) [-1987.405] (-2006.067) -- 0:02:25
      548900 -- (-1992.750) (-2003.678) [-1987.467] (-1993.744) * [-1987.711] (-1986.628) (-1992.487) (-1996.685) -- 0:02:25
      549000 -- (-1996.300) [-1999.311] (-1997.669) (-1994.661) * [-1990.100] (-1983.207) (-1998.662) (-1994.735) -- 0:02:25

      Average standard deviation of split frequencies: 0.003213

      549100 -- [-1982.259] (-1989.241) (-2000.227) (-1986.280) * (-1991.172) [-1982.458] (-1995.511) (-1998.076) -- 0:02:26
      549200 -- [-1977.646] (-1997.890) (-1995.479) (-1985.277) * (-1991.593) [-1981.680] (-1991.077) (-1992.450) -- 0:02:26
      549300 -- [-1982.932] (-1988.159) (-1995.382) (-1988.593) * (-1993.523) [-1987.169] (-1989.733) (-1993.252) -- 0:02:26
      549400 -- [-1982.447] (-1994.374) (-1990.323) (-1989.090) * (-1988.176) [-1981.152] (-1993.366) (-1997.420) -- 0:02:25
      549500 -- (-1980.739) (-1998.476) [-1989.701] (-1985.849) * (-1986.037) [-1981.792] (-1989.288) (-1993.844) -- 0:02:25
      549600 -- (-1982.223) (-2010.146) [-1987.813] (-1987.912) * (-1987.467) [-1980.957] (-1988.027) (-1993.490) -- 0:02:25
      549700 -- (-1980.783) (-2002.155) (-1988.807) [-1987.878] * (-1995.648) [-1982.523] (-1996.374) (-1987.397) -- 0:02:25
      549800 -- [-1981.692] (-2000.799) (-1988.345) (-1991.757) * (-1989.902) (-1983.006) (-1987.265) [-1984.996] -- 0:02:25
      549900 -- [-1979.539] (-2002.359) (-1986.221) (-1988.283) * (-1989.873) (-1989.325) (-1986.692) [-1985.904] -- 0:02:25
      550000 -- (-1989.811) (-2013.273) [-1991.007] (-1991.636) * (-1986.270) [-1987.949] (-1989.178) (-1989.666) -- 0:02:25

      Average standard deviation of split frequencies: 0.003207

      550100 -- (-1989.282) (-2004.999) [-1987.018] (-1988.355) * [-1982.149] (-1982.135) (-1995.250) (-1987.642) -- 0:02:25
      550200 -- (-1993.529) (-1998.962) (-1990.477) [-1985.828] * (-1982.890) [-1984.014] (-1988.225) (-1991.137) -- 0:02:25
      550300 -- (-1992.062) (-1990.986) [-1986.572] (-1987.270) * (-1993.125) [-1981.707] (-2002.035) (-1992.703) -- 0:02:25
      550400 -- [-1989.626] (-1989.907) (-1985.854) (-1999.843) * (-1985.596) [-1986.340] (-1997.680) (-1994.611) -- 0:02:25
      550500 -- (-1992.904) [-1991.805] (-1995.316) (-1995.813) * [-1983.985] (-1987.101) (-1992.371) (-1991.858) -- 0:02:25
      550600 -- (-1992.156) [-1987.198] (-1984.402) (-1997.805) * (-1984.727) [-1981.045] (-2000.723) (-1997.900) -- 0:02:25
      550700 -- (-1988.437) (-1993.685) (-1988.364) [-1991.146] * (-1986.487) [-1987.210] (-1999.064) (-1997.034) -- 0:02:25
      550800 -- (-1986.942) (-1996.992) (-1996.421) [-1985.718] * [-1984.576] (-1988.619) (-1991.535) (-1991.454) -- 0:02:25
      550900 -- [-1985.168] (-2006.931) (-1999.842) (-1995.569) * [-1978.422] (-1989.356) (-1997.946) (-1984.584) -- 0:02:25
      551000 -- (-1985.023) (-1996.125) (-1992.308) [-1992.929] * [-1977.247] (-1986.508) (-2000.080) (-1986.531) -- 0:02:25

      Average standard deviation of split frequencies: 0.003103

      551100 -- [-1985.551] (-1996.409) (-1991.047) (-1991.635) * (-1981.474) [-1982.910] (-2002.336) (-1985.518) -- 0:02:24
      551200 -- [-1983.824] (-1993.743) (-1991.899) (-1989.518) * (-1985.293) (-1979.345) (-2001.650) [-1989.268] -- 0:02:24
      551300 -- (-1988.995) (-1985.913) (-1992.604) [-1988.102] * (-1986.445) [-1982.953] (-2007.935) (-1994.761) -- 0:02:24
      551400 -- (-1990.201) (-1989.949) (-2002.527) [-1983.806] * [-1989.508] (-1983.385) (-1998.050) (-2001.456) -- 0:02:24
      551500 -- [-1985.210] (-1993.476) (-1997.306) (-1985.633) * (-1989.541) [-1980.165] (-2005.109) (-1999.277) -- 0:02:24
      551600 -- [-1982.525] (-1991.812) (-1992.308) (-1988.903) * [-1983.718] (-1982.756) (-1995.719) (-1995.390) -- 0:02:24
      551700 -- [-1988.055] (-1992.289) (-1999.471) (-1987.495) * [-1986.235] (-1980.356) (-1995.370) (-2003.779) -- 0:02:24
      551800 -- [-1983.823] (-1992.332) (-1993.691) (-1992.333) * [-1980.832] (-1981.988) (-1999.892) (-2003.254) -- 0:02:24
      551900 -- (-1983.019) [-1988.048] (-1992.810) (-1988.839) * (-1982.002) [-1980.287] (-2000.549) (-2003.232) -- 0:02:24
      552000 -- [-1985.295] (-1986.531) (-2000.844) (-1982.423) * [-1982.859] (-1983.259) (-1990.213) (-1996.034) -- 0:02:24

      Average standard deviation of split frequencies: 0.002927

      552100 -- (-1985.952) (-1987.810) (-2000.875) [-1986.303] * (-1981.827) [-1984.979] (-1996.372) (-1991.974) -- 0:02:24
      552200 -- (-1992.867) [-1989.202] (-1996.606) (-1994.817) * (-1984.380) [-1983.092] (-1997.714) (-1990.676) -- 0:02:25
      552300 -- (-1997.554) (-1998.059) [-1992.490] (-1991.354) * [-1979.681] (-1988.598) (-1999.347) (-1997.906) -- 0:02:25
      552400 -- [-1996.671] (-1994.026) (-1990.968) (-1988.351) * [-1982.041] (-1988.828) (-1999.098) (-2005.094) -- 0:02:25
      552500 -- (-1994.870) (-1999.123) [-1989.506] (-1990.868) * (-1981.459) [-1982.480] (-1995.495) (-1997.378) -- 0:02:24
      552600 -- (-1997.039) (-1994.536) (-1992.524) [-1979.919] * [-1983.103] (-1981.879) (-1987.661) (-1997.106) -- 0:02:24
      552700 -- (-2000.553) (-1992.585) (-1992.814) [-1983.478] * (-1984.608) (-1983.036) [-1990.818] (-2004.357) -- 0:02:24
      552800 -- (-2000.310) (-1996.735) (-1993.277) [-1981.035] * (-1980.423) [-1985.925] (-1988.809) (-2006.870) -- 0:02:24
      552900 -- (-1996.224) [-1989.811] (-1990.802) (-1983.697) * (-1984.844) [-1979.789] (-1987.686) (-1997.531) -- 0:02:24
      553000 -- (-2001.179) (-1990.262) [-1989.948] (-1983.289) * [-1984.382] (-1984.907) (-1990.213) (-1996.424) -- 0:02:24

      Average standard deviation of split frequencies: 0.003092

      553100 -- [-1993.588] (-1992.288) (-1989.354) (-1984.929) * [-1981.606] (-1985.428) (-1992.946) (-1991.777) -- 0:02:24
      553200 -- (-1999.141) (-1992.357) (-1990.403) [-1979.509] * (-1978.481) [-1986.324] (-1993.723) (-1992.115) -- 0:02:24
      553300 -- (-1994.328) (-1992.808) (-1994.036) [-1980.100] * [-1981.331] (-1998.188) (-1991.275) (-1992.793) -- 0:02:24
      553400 -- (-1993.368) (-1992.720) (-1996.025) [-1979.085] * (-1983.227) (-1993.331) [-1992.670] (-1993.266) -- 0:02:24
      553500 -- (-1994.723) (-1988.090) (-2001.186) [-1982.600] * [-1984.415] (-1984.797) (-1986.528) (-1996.866) -- 0:02:24
      553600 -- (-1996.580) (-1990.246) (-1999.950) [-1979.599] * [-1982.513] (-1990.340) (-1992.637) (-1996.770) -- 0:02:24
      553700 -- (-1993.886) (-2002.234) (-2004.060) [-1980.192] * [-1977.847] (-1988.311) (-1987.352) (-1999.509) -- 0:02:24
      553800 -- (-1989.398) [-1992.883] (-1992.928) (-1983.138) * (-1982.087) [-1985.574] (-1990.183) (-1991.829) -- 0:02:24
      553900 -- (-1997.843) (-2001.148) (-1991.356) [-1986.103] * (-1980.980) [-1982.565] (-1989.923) (-1996.650) -- 0:02:24
      554000 -- (-1996.580) (-1999.258) [-1996.697] (-1989.493) * [-1978.830] (-1982.747) (-1992.826) (-2000.694) -- 0:02:24

      Average standard deviation of split frequencies: 0.003135

      554100 -- (-2000.491) [-1989.482] (-1995.544) (-1988.794) * (-1981.051) [-1981.431] (-1991.513) (-1996.270) -- 0:02:24
      554200 -- (-2005.630) (-1991.048) (-1995.298) [-1986.323] * [-1983.610] (-1982.238) (-1991.204) (-1998.296) -- 0:02:23
      554300 -- (-2003.673) (-1985.074) (-1995.299) [-1980.198] * (-1985.227) [-1982.941] (-1994.993) (-1999.765) -- 0:02:23
      554400 -- (-1997.276) (-1989.832) (-1997.609) [-1983.984] * [-1983.695] (-1981.449) (-1996.003) (-1998.101) -- 0:02:23
      554500 -- (-1989.553) (-1990.368) (-2004.747) [-1981.765] * (-1985.740) [-1981.584] (-1990.699) (-2001.596) -- 0:02:23
      554600 -- (-1985.750) (-1993.496) (-2002.731) [-1981.024] * (-1991.631) [-1985.745] (-1988.003) (-1999.393) -- 0:02:23
      554700 -- [-1987.406] (-2000.603) (-1997.267) (-1981.456) * (-1995.353) [-1988.877] (-1988.788) (-2000.025) -- 0:02:23
      554800 -- [-1984.952] (-1996.763) (-1991.528) (-1984.828) * (-1989.952) (-1991.883) [-1990.696] (-2005.804) -- 0:02:23
      554900 -- (-1987.462) (-1996.765) (-1988.635) [-1982.471] * (-1995.166) (-1993.841) [-1990.382] (-2015.270) -- 0:02:23
      555000 -- (-1985.352) (-2006.411) (-1985.599) [-1980.426] * (-1988.279) [-1989.772] (-1994.258) (-2012.142) -- 0:02:23

      Average standard deviation of split frequencies: 0.003202

      555100 -- [-1983.648] (-1987.970) (-1988.129) (-1984.374) * [-1982.367] (-1991.586) (-1990.733) (-2006.903) -- 0:02:23
      555200 -- (-1986.993) (-1989.670) (-1985.946) [-1980.191] * (-1985.127) [-1981.332] (-1994.144) (-1992.825) -- 0:02:23
      555300 -- [-1985.708] (-1986.431) (-1994.157) (-1982.843) * (-1988.647) [-1983.403] (-1993.288) (-1999.799) -- 0:02:24
      555400 -- (-1987.350) (-1989.662) (-1997.469) [-1980.480] * [-1983.087] (-1977.605) (-1989.213) (-2005.147) -- 0:02:24
      555500 -- (-1990.960) (-1993.360) (-2001.516) [-1982.543] * [-1981.510] (-1977.648) (-1991.845) (-1997.834) -- 0:02:24
      555600 -- (-1990.846) (-1993.254) (-1999.529) [-1979.185] * (-1982.935) [-1979.375] (-1991.113) (-1997.251) -- 0:02:23
      555700 -- (-1995.378) (-1989.641) (-2002.585) [-1978.516] * (-1984.311) [-1984.336] (-1985.749) (-2003.085) -- 0:02:23
      555800 -- (-1995.883) [-1989.695] (-1995.196) (-1983.034) * [-1982.466] (-1985.029) (-1987.804) (-2005.084) -- 0:02:23
      555900 -- (-1994.905) (-1994.541) (-1993.203) [-1989.387] * [-1983.500] (-1992.124) (-1985.791) (-2006.131) -- 0:02:23
      556000 -- (-1998.423) (-1998.388) (-1987.368) [-1982.320] * [-1987.332] (-1985.645) (-1990.423) (-2011.555) -- 0:02:23

      Average standard deviation of split frequencies: 0.002955

      556100 -- (-1993.992) (-2008.258) [-1986.875] (-1983.234) * (-1991.091) [-1985.177] (-1992.036) (-2002.077) -- 0:02:23
      556200 -- (-1995.363) (-2001.594) (-1995.352) [-1984.439] * (-1999.903) [-1984.372] (-1986.697) (-2005.607) -- 0:02:23
      556300 -- [-1988.226] (-2003.894) (-1997.917) (-1991.626) * (-1994.939) (-1981.338) (-1996.092) [-1992.423] -- 0:02:23
      556400 -- (-1991.144) (-1995.931) (-1998.127) [-1991.109] * (-1994.381) [-1977.594] (-1998.083) (-1991.682) -- 0:02:23
      556500 -- [-1983.766] (-1993.423) (-2002.669) (-1984.612) * (-2000.907) [-1981.842] (-2006.587) (-1987.639) -- 0:02:23
      556600 -- (-1987.885) (-1993.488) (-1992.545) [-1980.214] * (-2002.011) [-1980.655] (-1989.184) (-1994.862) -- 0:02:23
      556700 -- (-1980.871) (-1991.769) (-1999.519) [-1981.685] * (-1990.465) [-1980.723] (-1992.296) (-1993.408) -- 0:02:23
      556800 -- (-1982.862) (-1999.815) (-1992.215) [-1982.496] * (-1993.493) [-1978.643] (-1996.753) (-1995.526) -- 0:02:23
      556900 -- (-1982.053) (-2001.102) (-1998.211) [-1984.824] * (-1991.153) (-1981.610) [-1996.024] (-1994.189) -- 0:02:23
      557000 -- [-1984.641] (-1994.421) (-1998.720) (-1988.637) * [-1990.716] (-1987.607) (-1997.523) (-1989.384) -- 0:02:23

      Average standard deviation of split frequencies: 0.002925

      557100 -- [-1986.832] (-1989.532) (-1989.418) (-1983.932) * [-1984.748] (-1997.088) (-1997.429) (-1997.537) -- 0:02:23
      557200 -- [-1984.612] (-1991.012) (-1995.129) (-1980.093) * (-1989.196) (-1998.766) [-1986.472] (-1998.600) -- 0:02:23
      557300 -- (-1992.179) (-2000.108) (-1995.152) [-1980.984] * [-1983.636] (-1997.946) (-1989.904) (-1998.786) -- 0:02:22
      557400 -- [-1982.831] (-1993.403) (-2001.176) (-1983.127) * [-1982.194] (-1992.773) (-1994.782) (-1991.340) -- 0:02:22
      557500 -- (-1993.378) (-1995.271) (-1999.863) [-1982.877] * (-1981.011) (-1990.983) (-1993.684) [-1986.472] -- 0:02:22
      557600 -- (-2003.549) (-1989.196) (-1996.514) [-1978.353] * [-1982.066] (-2000.265) (-1991.261) (-1988.742) -- 0:02:22
      557700 -- (-1990.042) (-1990.890) (-2001.441) [-1979.586] * [-1981.954] (-1996.978) (-1989.595) (-1991.720) -- 0:02:22
      557800 -- [-1984.674] (-1987.280) (-1998.813) (-1980.481) * [-1982.983] (-1993.273) (-1992.040) (-2001.839) -- 0:02:22
      557900 -- (-1984.856) (-1992.343) [-1989.854] (-1985.319) * [-1981.077] (-1986.564) (-1992.835) (-2009.183) -- 0:02:22
      558000 -- (-1992.328) (-1993.131) (-1990.185) [-1985.676] * (-1984.990) [-1985.418] (-1995.553) (-1996.774) -- 0:02:22

      Average standard deviation of split frequencies: 0.003016

      558100 -- (-1993.736) (-2007.097) (-1990.014) [-1985.800] * (-1985.609) [-1987.233] (-1997.903) (-1997.264) -- 0:02:22
      558200 -- (-1992.037) (-1996.449) (-1992.716) [-1983.802] * (-1986.657) [-1985.117] (-1994.117) (-1988.211) -- 0:02:22
      558300 -- (-1994.559) (-1995.949) (-1994.289) [-1980.385] * [-1988.184] (-1991.699) (-1993.353) (-1983.149) -- 0:02:23
      558400 -- (-2007.980) (-1999.546) (-1986.699) [-1980.168] * (-1989.498) (-2001.519) (-1993.533) [-1983.135] -- 0:02:23
      558500 -- (-2005.319) (-1991.469) [-1988.978] (-1980.483) * (-1989.513) (-2010.539) (-1995.109) [-1988.760] -- 0:02:23
      558600 -- (-2007.453) (-2001.814) [-1990.194] (-1982.019) * (-1994.083) [-2005.461] (-1991.354) (-1989.489) -- 0:02:23
      558700 -- (-1999.956) (-2001.367) (-1994.414) [-1979.946] * (-1989.268) (-1998.591) (-1997.563) [-1991.342] -- 0:02:22
      558800 -- (-2007.370) (-1993.765) [-1994.565] (-1981.890) * (-1987.219) (-2003.010) (-2002.135) [-1987.876] -- 0:02:22
      558900 -- (-2005.728) (-1998.760) (-1992.381) [-1983.066] * [-1991.835] (-1992.954) (-2007.135) (-1992.925) -- 0:02:22
      559000 -- (-2002.354) (-1996.655) (-1994.913) [-1977.402] * (-1987.490) (-1988.499) (-1994.017) [-1988.290] -- 0:02:22

      Average standard deviation of split frequencies: 0.003035

      559100 -- (-1997.296) (-1999.881) (-1995.594) [-1977.823] * (-1987.937) [-1989.580] (-1994.049) (-1999.806) -- 0:02:22
      559200 -- (-1997.257) (-2002.487) (-1997.199) [-1979.386] * (-1991.700) (-1993.623) [-1995.829] (-1994.389) -- 0:02:22
      559300 -- (-1990.529) [-1994.943] (-1992.261) (-1984.056) * (-1996.306) (-1995.571) [-1988.868] (-1994.410) -- 0:02:22
      559400 -- (-1990.124) (-1997.109) (-1989.878) [-1987.393] * (-1988.456) [-1991.612] (-1992.850) (-1996.806) -- 0:02:22
      559500 -- (-1993.907) (-1994.320) (-1997.886) [-1990.228] * [-1988.412] (-1995.884) (-1996.816) (-1994.186) -- 0:02:22
      559600 -- (-1993.184) [-1988.757] (-1995.853) (-1988.985) * (-1985.739) (-1993.558) [-1992.845] (-1989.830) -- 0:02:22
      559700 -- (-1998.228) (-1984.624) (-1996.350) [-1985.672] * [-1986.604] (-1984.363) (-1998.242) (-1995.542) -- 0:02:22
      559800 -- (-1992.447) (-1986.265) (-1993.890) [-1992.743] * (-1994.067) [-1986.153] (-2002.921) (-1996.035) -- 0:02:22
      559900 -- (-2000.778) [-1988.628] (-1995.182) (-1984.068) * (-2003.319) [-1980.363] (-1999.692) (-1995.130) -- 0:02:22
      560000 -- (-2007.412) [-1984.440] (-1998.406) (-1980.775) * (-1992.973) [-1981.492] (-1998.210) (-1996.216) -- 0:02:22

      Average standard deviation of split frequencies: 0.002789

      560100 -- (-1998.910) (-1988.846) (-2006.368) [-1981.842] * (-1992.098) [-1980.038] (-1993.968) (-1996.882) -- 0:02:22
      560200 -- (-1990.524) (-1988.260) (-2008.287) [-1984.534] * (-1997.020) [-1983.897] (-1990.490) (-1994.659) -- 0:02:22
      560300 -- (-1992.264) (-1992.197) (-2005.585) [-1981.274] * (-2001.407) (-1990.959) (-2000.523) [-1990.553] -- 0:02:22
      560400 -- [-1985.130] (-1989.755) (-1997.580) (-1979.004) * (-2001.518) [-1987.102] (-1997.260) (-1991.001) -- 0:02:21
      560500 -- [-1986.656] (-1996.005) (-2004.115) (-1980.462) * (-2010.828) (-1983.383) (-1997.242) [-1989.426] -- 0:02:21
      560600 -- [-1986.456] (-1999.331) (-2005.798) (-1983.270) * (-1997.264) [-1978.161] (-1987.694) (-1990.978) -- 0:02:21
      560700 -- (-1990.577) (-2001.477) [-2000.589] (-1982.953) * (-1993.782) [-1978.784] (-1991.512) (-1988.724) -- 0:02:21
      560800 -- (-1987.501) (-1994.185) (-2007.530) [-1977.212] * (-1993.362) [-1984.685] (-1993.205) (-1985.093) -- 0:02:21
      560900 -- (-1989.582) (-1995.757) (-1996.196) [-1982.157] * (-1991.752) [-1983.359] (-1990.212) (-1985.630) -- 0:02:21
      561000 -- (-1991.742) (-2007.342) (-1994.285) [-1982.509] * (-1985.133) [-1983.826] (-1992.108) (-1993.768) -- 0:02:21

      Average standard deviation of split frequencies: 0.002880

      561100 -- [-1989.616] (-1992.582) (-1995.870) (-1984.422) * (-1985.269) (-1984.587) [-1989.114] (-1994.453) -- 0:02:21
      561200 -- (-1996.208) (-1993.851) (-1999.269) [-1982.523] * [-1982.803] (-1985.943) (-1992.167) (-1990.463) -- 0:02:21
      561300 -- (-1990.899) (-1996.900) (-1993.790) [-1982.381] * [-1988.279] (-1982.288) (-1994.888) (-1990.325) -- 0:02:22
      561400 -- (-1997.882) (-1991.531) [-1983.800] (-1986.347) * (-1990.784) (-1989.487) (-1994.441) [-1991.399] -- 0:02:22
      561500 -- (-1993.367) [-1988.193] (-1992.969) (-1986.146) * (-1995.614) [-1985.657] (-1993.918) (-1999.475) -- 0:02:22
      561600 -- (-2004.332) (-1993.802) (-1987.320) [-1984.814] * [-1985.452] (-1990.634) (-1991.442) (-1991.742) -- 0:02:22
      561700 -- (-1998.423) (-1990.735) (-1991.155) [-1987.645] * (-1990.166) [-1987.787] (-1993.487) (-1995.981) -- 0:02:22
      561800 -- (-1992.895) (-1990.599) (-1992.635) [-1987.971] * (-1984.472) [-1990.576] (-1995.049) (-1993.522) -- 0:02:21
      561900 -- [-1986.089] (-1990.102) (-1990.448) (-1995.546) * (-1987.643) (-1989.916) [-1987.501] (-2001.954) -- 0:02:21
      562000 -- [-1991.619] (-1994.116) (-1987.774) (-1998.276) * (-1986.584) [-1984.516] (-1993.381) (-1997.528) -- 0:02:21

      Average standard deviation of split frequencies: 0.002827

      562100 -- (-1988.995) (-1994.830) [-1985.816] (-1992.269) * (-1987.205) [-1985.940] (-1989.134) (-1999.051) -- 0:02:21
      562200 -- (-1987.355) (-1995.208) [-1984.536] (-1994.542) * (-1989.549) (-1984.155) [-1990.448] (-1997.201) -- 0:02:21
      562300 -- [-1985.497] (-2005.957) (-1986.031) (-1997.846) * (-1987.494) [-1981.706] (-1990.302) (-1996.748) -- 0:02:21
      562400 -- [-1984.303] (-1999.659) (-1983.976) (-1999.348) * (-1990.494) [-1984.130] (-1993.002) (-1994.718) -- 0:02:21
      562500 -- [-1988.942] (-1997.355) (-1987.325) (-2000.789) * [-1986.496] (-1987.583) (-1995.729) (-1988.469) -- 0:02:21
      562600 -- [-1990.148] (-1996.088) (-1986.720) (-1994.089) * (-1986.357) (-1992.878) (-1994.655) [-1991.889] -- 0:02:21
      562700 -- (-1990.512) [-1991.539] (-1991.195) (-1991.831) * (-1988.815) (-1998.101) [-1993.554] (-1999.644) -- 0:02:21
      562800 -- [-1980.316] (-1995.693) (-1989.746) (-1994.376) * [-1988.310] (-1999.368) (-1992.938) (-2000.979) -- 0:02:21
      562900 -- [-1979.554] (-1998.311) (-1991.141) (-1994.416) * [-1988.585] (-1993.587) (-1995.643) (-1991.622) -- 0:02:21
      563000 -- (-1986.458) (-1999.065) [-1990.317] (-1999.265) * [-1989.507] (-1988.235) (-2004.317) (-2006.543) -- 0:02:21

      Average standard deviation of split frequencies: 0.002822

      563100 -- (-1987.675) [-1992.713] (-1994.444) (-1994.910) * (-1984.342) [-1983.302] (-2002.654) (-1999.939) -- 0:02:21
      563200 -- (-1985.200) (-1989.571) (-1996.506) [-1987.060] * (-1986.795) [-1985.135] (-1995.838) (-1998.604) -- 0:02:21
      563300 -- (-1993.848) (-1988.672) (-1992.679) [-1989.900] * (-1982.731) [-1988.293] (-1993.741) (-2012.733) -- 0:02:21
      563400 -- (-1993.742) [-1982.388] (-1991.958) (-1986.875) * (-1985.574) [-1987.174] (-1996.107) (-1997.380) -- 0:02:21
      563500 -- (-1994.900) (-1987.984) [-1986.105] (-1987.649) * (-1991.624) (-1986.502) [-1994.106] (-2002.282) -- 0:02:20
      563600 -- (-1992.463) (-1988.214) (-1986.359) [-1984.337] * (-1987.074) [-1984.516] (-1994.448) (-1992.948) -- 0:02:20
      563700 -- (-1988.895) (-1982.729) (-1987.980) [-1986.360] * [-1997.411] (-1980.624) (-1997.898) (-1989.041) -- 0:02:20
      563800 -- (-1986.099) (-1992.123) (-1986.352) [-1984.616] * (-1992.970) [-1982.010] (-1993.473) (-1992.735) -- 0:02:20
      563900 -- [-1985.888] (-1991.889) (-1993.832) (-1988.134) * (-1987.944) [-1983.529] (-1990.959) (-1989.941) -- 0:02:20
      564000 -- (-1985.137) (-1994.361) (-1990.231) [-1985.512] * (-1993.281) [-1981.199] (-1989.193) (-1992.593) -- 0:02:20

      Average standard deviation of split frequencies: 0.002865

      564100 -- (-1983.373) (-1987.773) (-1991.426) [-1984.832] * (-1990.546) [-1982.728] (-1989.403) (-1992.044) -- 0:02:20
      564200 -- [-1981.801] (-1995.732) (-1990.723) (-1982.977) * (-1997.118) [-1984.418] (-1986.355) (-1993.451) -- 0:02:20
      564300 -- (-1979.422) (-1995.512) (-1987.607) [-1984.827] * (-1997.936) [-1985.304] (-1987.763) (-1997.387) -- 0:02:20
      564400 -- (-1980.990) (-1988.562) (-1993.892) [-1985.366] * [-1997.876] (-1990.548) (-1995.542) (-1997.903) -- 0:02:21
      564500 -- (-1989.125) [-1990.908] (-1988.301) (-1985.433) * (-1997.480) (-1988.811) (-1990.023) [-1990.011] -- 0:02:21
      564600 -- (-1991.279) (-1988.310) [-1984.395] (-1987.820) * (-1992.467) [-1985.803] (-1987.298) (-1988.764) -- 0:02:21
      564700 -- (-1989.879) [-1985.253] (-1989.900) (-1989.676) * (-1998.625) [-1985.861] (-1996.907) (-1995.924) -- 0:02:21
      564800 -- (-1992.115) [-1985.395] (-1990.549) (-1988.085) * (-1999.257) [-1986.098] (-1996.858) (-1995.567) -- 0:02:21
      564900 -- (-1987.657) [-1985.310] (-1990.175) (-1995.339) * (-1996.424) [-1988.550] (-2002.441) (-1999.473) -- 0:02:20
      565000 -- (-1992.642) (-1985.244) [-1992.203] (-1994.223) * (-2000.171) [-1984.401] (-1991.406) (-1993.687) -- 0:02:20

      Average standard deviation of split frequencies: 0.002717

      565100 -- (-1998.302) [-1986.544] (-1986.442) (-1995.596) * (-1995.410) [-1988.132] (-1994.208) (-1996.840) -- 0:02:20
      565200 -- (-1996.386) (-1988.249) [-1990.097] (-1995.620) * (-1984.279) (-1992.873) (-1998.034) [-1995.362] -- 0:02:20
      565300 -- (-1994.342) [-1990.775] (-1993.595) (-2004.883) * (-1988.022) (-1988.255) [-1993.561] (-2013.914) -- 0:02:20
      565400 -- (-1993.487) (-1991.540) [-1988.875] (-2001.746) * [-1990.364] (-1993.763) (-1994.945) (-1992.391) -- 0:02:20
      565500 -- (-1988.876) (-1996.705) [-1987.703] (-1996.978) * [-1986.596] (-1987.784) (-2007.631) (-1990.217) -- 0:02:20
      565600 -- (-1987.727) (-2000.679) [-1986.617] (-1991.999) * [-1992.443] (-1989.586) (-1998.187) (-1990.471) -- 0:02:20
      565700 -- (-1984.029) [-1988.546] (-2003.776) (-1993.239) * (-2000.719) [-1990.448] (-1997.217) (-1989.727) -- 0:02:20
      565800 -- [-1979.535] (-1989.608) (-1995.009) (-1993.631) * (-1996.370) [-1985.967] (-1991.520) (-1986.667) -- 0:02:20
      565900 -- [-1980.205] (-1986.209) (-1991.244) (-1996.292) * (-1995.476) [-1984.832] (-1995.550) (-1993.587) -- 0:02:20
      566000 -- [-1980.532] (-1989.043) (-1990.129) (-1993.641) * (-2002.537) [-1984.355] (-2006.327) (-1990.971) -- 0:02:20

      Average standard deviation of split frequencies: 0.002855

      566100 -- [-1983.899] (-1993.184) (-1990.352) (-1994.570) * (-2004.462) [-1982.213] (-1992.152) (-1993.054) -- 0:02:20
      566200 -- (-1982.090) [-1990.530] (-1991.741) (-1995.559) * (-2000.766) [-1982.973] (-1986.583) (-1989.786) -- 0:02:20
      566300 -- [-1983.632] (-1990.505) (-1988.448) (-2000.410) * (-1994.234) [-1986.099] (-1990.796) (-1996.958) -- 0:02:20
      566400 -- [-1984.333] (-1988.681) (-1987.206) (-2006.580) * (-2004.101) (-1990.660) [-1989.954] (-1999.754) -- 0:02:20
      566500 -- (-1987.725) (-1992.134) [-1986.227] (-2005.886) * (-2004.283) [-1988.418] (-1992.094) (-2009.317) -- 0:02:20
      566600 -- (-1992.502) (-1987.689) [-1993.908] (-1994.826) * (-1997.724) [-1985.058] (-1999.873) (-1992.930) -- 0:02:19
      566700 -- [-1991.760] (-1989.519) (-1993.165) (-1997.939) * (-1995.563) [-1990.777] (-1996.305) (-1988.187) -- 0:02:19
      566800 -- (-1988.509) (-1991.549) [-1997.298] (-2000.726) * (-2001.030) (-1991.957) (-2002.417) [-1987.259] -- 0:02:19
      566900 -- [-1986.478] (-1992.534) (-2000.479) (-1991.868) * [-1993.362] (-1991.592) (-1998.390) (-1984.412) -- 0:02:19
      567000 -- (-1990.258) (-1996.146) (-2000.515) [-1987.580] * (-1997.050) (-1989.623) (-1997.211) [-1986.788] -- 0:02:19

      Average standard deviation of split frequencies: 0.002802

      567100 -- [-1987.168] (-1997.247) (-2003.029) (-1991.476) * [-1989.175] (-1989.685) (-1992.248) (-1984.627) -- 0:02:19
      567200 -- [-1989.750] (-1993.230) (-2001.026) (-1987.141) * (-1993.237) (-1997.520) [-1988.919] (-1986.670) -- 0:02:19
      567300 -- (-1989.846) (-1996.022) (-2002.345) [-1986.005] * (-1997.971) (-1997.306) (-1991.321) [-1990.532] -- 0:02:19
      567400 -- (-1989.992) (-1997.300) (-2000.870) [-1982.322] * [-1989.708] (-1998.068) (-1992.837) (-1990.803) -- 0:02:20
      567500 -- (-1986.070) (-1993.308) (-2002.128) [-1985.512] * [-1983.989] (-1993.991) (-1996.170) (-1990.733) -- 0:02:20
      567600 -- (-1990.911) (-1991.858) (-1995.494) [-1979.498] * (-1983.146) [-1987.463] (-1991.410) (-1993.852) -- 0:02:20
      567700 -- (-1993.270) (-1992.079) (-1996.004) [-1979.647] * (-1984.683) [-1985.176] (-1992.806) (-1998.831) -- 0:02:20
      567800 -- (-1998.866) (-1994.266) (-2000.045) [-1980.325] * (-1990.734) [-1984.115] (-2000.990) (-1997.523) -- 0:02:20
      567900 -- (-2000.792) (-1996.135) (-1993.538) [-1989.368] * (-1990.137) [-1988.953] (-2001.160) (-2003.200) -- 0:02:20
      568000 -- (-2003.045) (-2002.511) [-1989.333] (-1994.542) * (-1988.563) [-1986.209] (-2004.723) (-1993.903) -- 0:02:19

      Average standard deviation of split frequencies: 0.002489

      568100 -- (-2004.297) (-1995.486) (-1992.314) [-1992.404] * (-1989.977) [-1985.008] (-2001.479) (-1993.854) -- 0:02:19
      568200 -- (-2011.672) [-1997.942] (-1991.028) (-1994.896) * [-1988.920] (-1982.528) (-1999.915) (-2004.875) -- 0:02:19
      568300 -- (-1997.773) [-1990.832] (-1986.587) (-1993.726) * (-1992.557) [-1983.447] (-1991.283) (-2004.115) -- 0:02:19
      568400 -- (-1993.762) (-1989.445) [-1986.399] (-1990.299) * (-1985.935) (-1981.089) [-1989.577] (-2002.907) -- 0:02:19
      568500 -- (-1996.183) (-1993.121) [-1984.621] (-1991.840) * [-1981.747] (-1986.584) (-1992.624) (-2002.589) -- 0:02:19
      568600 -- [-1993.427] (-1998.713) (-1986.006) (-1986.597) * [-1979.331] (-1990.984) (-1991.661) (-2000.361) -- 0:02:19
      568700 -- [-1993.537] (-1992.732) (-1986.521) (-1983.596) * [-1980.477] (-1986.698) (-1997.963) (-2000.302) -- 0:02:19
      568800 -- (-1995.654) (-1993.806) (-1991.924) [-1983.192] * [-1976.826] (-1989.349) (-1993.123) (-2010.431) -- 0:02:19
      568900 -- (-1998.228) (-1998.554) (-1988.759) [-1981.632] * [-1985.815] (-1989.830) (-1993.350) (-2000.209) -- 0:02:19
      569000 -- (-1994.889) (-1990.599) (-1985.529) [-1980.445] * [-1984.516] (-1992.744) (-2000.832) (-1992.084) -- 0:02:19

      Average standard deviation of split frequencies: 0.002414

      569100 -- (-1998.098) (-1998.300) [-1985.937] (-1986.374) * [-1984.308] (-1981.966) (-1995.996) (-1993.017) -- 0:02:19
      569200 -- [-1995.490] (-1999.483) (-1986.229) (-1989.455) * (-1982.997) [-1983.558] (-2000.701) (-1995.100) -- 0:02:19
      569300 -- (-1991.956) (-2003.374) (-1989.985) [-1985.092] * (-1991.655) [-1982.886] (-2003.460) (-2002.446) -- 0:02:19
      569400 -- (-1989.419) (-1995.111) (-1984.924) [-1984.000] * (-1985.867) (-1985.763) [-1995.944] (-2000.466) -- 0:02:19
      569500 -- (-2003.146) (-1995.009) (-1987.674) [-1983.462] * (-1985.695) [-1981.181] (-1993.033) (-1991.887) -- 0:02:19
      569600 -- (-1993.989) (-1993.320) (-1997.901) [-1982.833] * (-1989.805) [-1979.984] (-2001.057) (-1989.370) -- 0:02:19
      569700 -- (-1991.616) (-1999.890) (-1994.648) [-1981.155] * (-1993.848) [-1981.299] (-1998.428) (-1995.662) -- 0:02:18
      569800 -- (-1998.341) (-1994.346) (-1992.785) [-1982.337] * (-1984.305) [-1984.720] (-1997.953) (-1993.292) -- 0:02:18
      569900 -- (-1994.572) (-1992.362) [-1989.791] (-1984.859) * (-1987.128) [-1991.124] (-1989.002) (-1989.764) -- 0:02:18
      570000 -- [-1992.899] (-2000.690) (-1988.131) (-1980.124) * (-1982.905) [-1983.005] (-1994.072) (-1992.542) -- 0:02:18

      Average standard deviation of split frequencies: 0.002528

      570100 -- (-2000.740) (-1991.016) [-1992.070] (-1986.996) * (-1982.453) [-1983.541] (-1999.718) (-1989.762) -- 0:02:18
      570200 -- (-1994.352) (-1995.400) (-1991.113) [-1991.151] * [-1981.974] (-1986.245) (-2004.141) (-1996.556) -- 0:02:18
      570300 -- (-1992.402) (-1997.574) (-1991.160) [-1985.633] * (-1978.954) [-1988.193] (-2002.316) (-1995.712) -- 0:02:18
      570400 -- [-1991.207] (-1996.515) (-1989.519) (-1987.371) * [-1982.946] (-1991.247) (-1999.122) (-1994.380) -- 0:02:18
      570500 -- (-1989.390) [-1988.298] (-1990.274) (-1987.289) * (-1988.542) [-1995.218] (-1997.656) (-1993.316) -- 0:02:19
      570600 -- [-1986.410] (-1992.483) (-1993.766) (-1990.857) * [-1984.934] (-1996.511) (-1993.920) (-1997.308) -- 0:02:19
      570700 -- [-1988.003] (-1991.132) (-1987.799) (-1987.511) * [-1983.867] (-1994.497) (-1993.703) (-1990.781) -- 0:02:19
      570800 -- (-1987.579) (-1996.644) [-1988.096] (-1986.387) * (-1993.607) (-1994.898) (-1996.158) [-1988.144] -- 0:02:19
      570900 -- (-1988.465) [-1987.601] (-1988.459) (-1987.556) * (-1988.614) (-1992.205) [-1993.359] (-1987.003) -- 0:02:19
      571000 -- (-1991.480) [-1985.898] (-1989.518) (-1994.010) * (-1989.608) (-2003.807) [-1991.291] (-1992.519) -- 0:02:18

      Average standard deviation of split frequencies: 0.002452

      571100 -- (-1987.281) [-1987.043] (-1997.030) (-1993.463) * [-1987.042] (-1996.651) (-1993.559) (-2003.649) -- 0:02:18
      571200 -- (-1992.117) [-1988.064] (-1997.191) (-1991.880) * (-1985.890) (-1984.821) [-1992.479] (-2003.133) -- 0:02:18
      571300 -- (-1995.221) (-1988.526) (-1988.962) [-1984.394] * (-1982.623) (-1991.621) [-1985.954] (-2004.313) -- 0:02:18
      571400 -- (-1997.522) (-1993.864) (-1989.386) [-1982.669] * (-1983.818) (-1989.626) [-1985.826] (-2007.922) -- 0:02:18
      571500 -- (-1995.161) (-1998.791) (-1988.354) [-1986.075] * [-1985.101] (-1989.561) (-1987.537) (-2005.415) -- 0:02:18
      571600 -- (-1994.531) (-2003.586) (-1991.435) [-1985.729] * (-1991.677) [-1982.112] (-2001.282) (-1998.345) -- 0:02:18
      571700 -- (-1994.096) (-2008.532) (-1985.601) [-1985.425] * (-1990.371) [-1979.538] (-2003.566) (-2001.089) -- 0:02:18
      571800 -- (-1988.504) (-1992.519) [-1988.968] (-1988.554) * [-1992.304] (-1982.278) (-2001.700) (-2002.616) -- 0:02:18
      571900 -- (-1992.189) (-1991.067) [-1981.766] (-1984.946) * (-2002.044) (-1995.231) (-2000.729) [-2005.200] -- 0:02:18
      572000 -- (-1990.473) (-1991.634) (-1982.660) [-1984.935] * (-1989.104) [-1984.923] (-1998.084) (-2006.113) -- 0:02:18

      Average standard deviation of split frequencies: 0.002401

      572100 -- (-1993.864) (-1991.580) (-1990.760) [-1984.077] * (-1985.808) (-1991.036) [-1994.805] (-2014.213) -- 0:02:18
      572200 -- [-1992.268] (-1991.735) (-1989.785) (-1989.308) * [-1980.920] (-1987.042) (-1994.304) (-2014.768) -- 0:02:18
      572300 -- (-1994.413) (-1996.748) [-1982.950] (-1984.574) * [-1979.809] (-1988.414) (-1998.812) (-2006.762) -- 0:02:18
      572400 -- (-2007.940) [-1995.107] (-1987.379) (-1981.130) * (-1982.522) [-1980.555] (-2002.691) (-2004.101) -- 0:02:18
      572500 -- (-2003.075) (-1988.127) (-1984.693) [-1984.438] * (-1979.719) [-1983.319] (-2005.704) (-2003.854) -- 0:02:18
      572600 -- (-2000.525) (-1992.413) (-1989.742) [-1981.758] * (-1980.552) [-1985.031] (-1997.794) (-2012.530) -- 0:02:18
      572700 -- (-1996.443) (-1999.868) (-1997.488) [-1985.328] * (-1979.940) [-1978.235] (-2004.378) (-2008.674) -- 0:02:18
      572800 -- [-1989.695] (-2002.909) (-1995.044) (-1987.981) * [-1986.063] (-1982.995) (-2002.791) (-2008.478) -- 0:02:17
      572900 -- [-1987.812] (-1996.099) (-1997.186) (-1986.534) * [-1988.366] (-1984.876) (-2004.064) (-2011.761) -- 0:02:17
      573000 -- (-1992.354) (-1987.554) (-1992.863) [-1989.384] * (-1986.425) [-1984.846] (-1998.845) (-2002.628) -- 0:02:17

      Average standard deviation of split frequencies: 0.002491

      573100 -- (-1998.051) (-1985.345) (-1995.164) [-1983.313] * (-1983.691) [-1986.544] (-1995.012) (-2005.287) -- 0:02:17
      573200 -- (-1993.298) (-1987.345) [-1991.228] (-1987.334) * [-1987.476] (-1992.675) (-1996.072) (-2001.404) -- 0:02:17
      573300 -- (-1993.732) (-1986.207) (-1995.963) [-1982.106] * [-1982.563] (-1987.838) (-1994.201) (-2007.284) -- 0:02:17
      573400 -- (-2000.450) (-1990.981) (-1995.144) [-1984.902] * [-1984.805] (-1991.796) (-1997.800) (-2004.738) -- 0:02:17
      573500 -- (-1996.232) [-1985.557] (-2007.557) (-1987.271) * [-1992.416] (-1990.034) (-1997.588) (-2002.178) -- 0:02:18
      573600 -- (-1997.745) (-1984.823) (-2010.345) [-1983.375] * (-1990.735) (-1987.276) [-1989.760] (-1993.702) -- 0:02:18
      573700 -- (-1993.758) [-1987.578] (-1997.095) (-1987.571) * (-1989.453) (-1985.946) [-1983.069] (-2004.359) -- 0:02:18
      573800 -- (-1991.259) [-1991.742] (-2006.013) (-1990.074) * (-1992.340) (-1989.375) [-1987.276] (-1992.708) -- 0:02:18
      573900 -- [-1990.020] (-1994.721) (-2006.822) (-1983.687) * (-1983.979) (-1993.984) [-1990.420] (-1995.942) -- 0:02:18
      574000 -- (-1992.316) (-1991.022) (-1997.819) [-1986.174] * [-1986.510] (-2002.838) (-1989.754) (-1997.004) -- 0:02:18

      Average standard deviation of split frequencies: 0.002581

      574100 -- [-1992.339] (-1987.815) (-1994.072) (-1988.228) * (-1985.619) [-1991.260] (-1989.808) (-1995.663) -- 0:02:17
      574200 -- (-1995.760) [-1982.089] (-1994.733) (-1983.056) * [-1984.333] (-1993.998) (-1991.664) (-2007.815) -- 0:02:17
      574300 -- (-1991.255) (-1984.637) (-1994.844) [-1985.120] * [-1981.392] (-1991.615) (-1989.991) (-2001.266) -- 0:02:17
      574400 -- (-1984.800) (-1998.245) (-1991.719) [-1987.226] * (-1984.662) (-2009.102) (-1990.766) [-1998.704] -- 0:02:17
      574500 -- (-1993.316) (-1995.254) (-1991.525) [-1984.887] * (-1985.250) (-2006.176) [-1984.627] (-2004.079) -- 0:02:17
      574600 -- [-1988.388] (-1989.991) (-1991.811) (-1987.888) * (-1983.231) (-2008.632) [-1978.813] (-1999.964) -- 0:02:17
      574700 -- (-1987.752) (-1996.480) (-1995.380) [-1988.163] * [-1981.619] (-1998.267) (-1978.156) (-2000.440) -- 0:02:17
      574800 -- [-1983.728] (-1996.692) (-1993.789) (-1994.469) * [-1980.139] (-1999.385) (-1982.649) (-2001.806) -- 0:02:17
      574900 -- [-1989.549] (-1992.469) (-1997.444) (-1992.974) * (-1985.989) (-1995.113) [-1980.933] (-1998.129) -- 0:02:17
      575000 -- (-1992.522) (-1985.323) [-1992.802] (-1998.114) * (-1987.896) (-1993.304) [-1983.832] (-2016.981) -- 0:02:17

      Average standard deviation of split frequencies: 0.002576

      575100 -- (-2001.956) [-1990.550] (-1986.809) (-1993.062) * (-1990.394) (-1996.116) [-1984.734] (-1999.423) -- 0:02:17
      575200 -- (-2003.698) [-1988.572] (-1988.347) (-1990.780) * (-1989.531) (-1992.020) [-1981.545] (-1998.576) -- 0:02:17
      575300 -- (-2000.309) [-1989.481] (-1992.030) (-1990.599) * [-1986.449] (-1997.690) (-1985.744) (-1989.011) -- 0:02:17
      575400 -- (-2003.088) [-1986.982] (-1990.350) (-1984.263) * [-1985.349] (-1993.294) (-1992.026) (-1996.279) -- 0:02:17
      575500 -- (-2008.566) [-1986.737] (-1994.889) (-1985.741) * [-1984.516] (-1988.359) (-1994.120) (-1997.144) -- 0:02:17
      575600 -- (-2006.862) (-1989.593) (-1991.952) [-1984.065] * [-1990.245] (-1997.536) (-1993.918) (-1995.638) -- 0:02:17
      575700 -- (-1999.571) [-1988.098] (-2000.423) (-1981.294) * (-1990.889) [-1997.803] (-1990.269) (-1995.876) -- 0:02:17
      575800 -- (-1990.829) (-1992.965) (-1995.925) [-1980.009] * [-1982.146] (-1997.935) (-1986.759) (-2006.007) -- 0:02:17
      575900 -- (-1995.827) (-1990.116) (-1993.212) [-1980.837] * (-1990.020) (-1996.526) [-1984.590] (-2013.971) -- 0:02:16
      576000 -- (-1993.519) (-1987.710) (-1995.799) [-1988.812] * (-1991.707) (-1991.751) [-1984.419] (-1999.306) -- 0:02:16

      Average standard deviation of split frequencies: 0.002618

      576100 -- [-1992.493] (-1992.903) (-1988.581) (-1987.718) * (-1986.463) (-1999.772) [-1982.457] (-1997.888) -- 0:02:16
      576200 -- (-1989.444) (-1990.813) [-1985.839] (-1990.292) * [-1983.370] (-2003.944) (-1984.942) (-1997.053) -- 0:02:16
      576300 -- (-1996.143) (-1987.844) (-1989.609) [-1984.792] * [-1982.556] (-1999.590) (-1992.218) (-1997.763) -- 0:02:16
      576400 -- [-1990.774] (-1995.435) (-1994.167) (-1990.328) * (-1986.218) (-2001.532) (-1990.917) [-1993.289] -- 0:02:16
      576500 -- [-1988.379] (-1988.663) (-1994.136) (-1989.296) * [-1984.276] (-1997.179) (-2002.998) (-1993.759) -- 0:02:16
      576600 -- (-1992.712) (-1989.435) (-1997.683) [-1986.090] * (-1993.458) [-1993.213] (-1995.826) (-1993.428) -- 0:02:17
      576700 -- (-1995.406) (-1985.369) (-1992.475) [-1993.104] * (-1989.191) [-1990.993] (-1996.193) (-1990.819) -- 0:02:17
      576800 -- (-1993.228) (-1986.553) (-1992.454) [-1985.082] * (-1986.649) [-1992.136] (-1992.901) (-1996.816) -- 0:02:17
      576900 -- (-1987.825) [-1989.550] (-1996.753) (-1988.461) * [-1986.515] (-1997.559) (-1991.779) (-1994.744) -- 0:02:17
      577000 -- (-1996.504) (-1997.226) (-1992.566) [-1991.256] * [-1978.183] (-2001.450) (-2002.931) (-1991.417) -- 0:02:17

      Average standard deviation of split frequencies: 0.002613

      577100 -- (-1992.334) (-2004.485) (-1996.161) [-1988.285] * [-1984.208] (-1988.674) (-1995.605) (-1984.666) -- 0:02:17
      577200 -- (-1999.296) (-2010.248) (-1991.275) [-1983.119] * [-1986.697] (-1994.699) (-1992.160) (-1989.233) -- 0:02:16
      577300 -- (-1996.597) (-2001.137) (-1990.116) [-1987.067] * [-1986.078] (-1989.854) (-1993.013) (-1989.902) -- 0:02:16
      577400 -- (-1996.370) (-1995.725) (-1986.472) [-1990.004] * [-1983.475] (-1988.052) (-1993.807) (-1997.589) -- 0:02:16
      577500 -- (-2007.942) (-1993.127) [-1986.802] (-1984.990) * [-1984.189] (-1991.887) (-1990.894) (-1998.858) -- 0:02:16
      577600 -- [-1995.619] (-1996.185) (-1989.111) (-1985.024) * (-1988.696) (-1993.592) [-1990.438] (-1996.960) -- 0:02:16
      577700 -- (-2004.471) (-2001.819) [-1986.408] (-1990.449) * (-1991.802) [-1989.538] (-1997.129) (-1992.051) -- 0:02:16
      577800 -- (-1994.553) (-1996.150) (-1989.315) [-1989.636] * (-1992.179) [-1983.642] (-2000.574) (-1992.558) -- 0:02:16
      577900 -- (-1995.597) (-1991.438) (-1995.666) [-1983.342] * (-1991.846) (-1990.841) (-1997.360) [-1987.406] -- 0:02:16
      578000 -- (-1996.431) (-1990.800) [-1993.027] (-1988.982) * [-1986.335] (-1988.127) (-1992.201) (-1993.231) -- 0:02:16

      Average standard deviation of split frequencies: 0.002889

      578100 -- (-2010.563) (-1990.060) [-1990.984] (-1994.227) * [-1994.720] (-1985.833) (-1995.134) (-1992.060) -- 0:02:16
      578200 -- (-2010.235) (-1993.318) [-1986.684] (-1992.302) * (-1991.667) (-1986.370) (-1992.538) [-1987.544] -- 0:02:16
      578300 -- (-2002.724) (-2004.388) [-1988.994] (-1988.574) * (-1988.963) (-1984.200) (-1988.782) [-1988.845] -- 0:02:16
      578400 -- (-2000.459) (-1990.539) (-1994.376) [-1984.059] * (-1995.361) (-2000.067) (-1988.610) [-1985.012] -- 0:02:16
      578500 -- (-1996.402) (-1984.954) (-1994.375) [-1990.416] * (-1987.527) (-1998.956) (-1985.852) [-1984.899] -- 0:02:16
      578600 -- (-1999.421) (-1987.160) (-1997.642) [-1992.528] * (-1986.592) (-2000.067) [-1986.906] (-1986.475) -- 0:02:16
      578700 -- (-2002.701) [-1987.813] (-1997.805) (-1985.745) * [-1981.067] (-2006.631) (-1984.926) (-1992.529) -- 0:02:16
      578800 -- (-2001.674) [-1988.489] (-2002.779) (-1992.908) * [-1979.735] (-1999.329) (-1983.093) (-1990.706) -- 0:02:16
      578900 -- (-1997.052) (-1987.505) (-2007.898) [-1992.139] * (-1983.210) (-1998.475) [-1984.738] (-2006.874) -- 0:02:16
      579000 -- (-1999.087) [-1989.196] (-2005.213) (-1992.682) * (-1980.084) (-1992.098) [-1981.429] (-2008.273) -- 0:02:15

      Average standard deviation of split frequencies: 0.002744

      579100 -- (-1995.032) [-1988.363] (-2010.653) (-1988.248) * (-1981.817) (-1998.588) [-1985.140] (-1995.294) -- 0:02:15
      579200 -- (-2005.483) [-1981.267] (-2013.677) (-1988.421) * (-1983.170) (-1992.414) [-1984.933] (-1986.229) -- 0:02:15
      579300 -- (-2009.880) [-1983.217] (-2003.101) (-1987.238) * (-1990.159) (-1997.819) [-1988.364] (-1993.621) -- 0:02:15
      579400 -- (-2001.407) [-1984.443] (-2004.402) (-1994.609) * (-1987.263) (-2002.874) (-1987.236) [-1988.062] -- 0:02:15
      579500 -- (-1998.919) [-1984.732] (-1991.000) (-2000.828) * (-1989.259) [-1985.597] (-1986.840) (-1989.116) -- 0:02:15
      579600 -- (-1999.720) [-1980.942] (-1996.710) (-1997.766) * (-1984.660) (-1991.726) [-1984.604] (-1990.466) -- 0:02:16
      579700 -- (-2003.485) [-1977.256] (-1994.071) (-1997.790) * [-1977.671] (-1999.581) (-1991.018) (-1991.954) -- 0:02:16
      579800 -- (-1996.226) (-1982.258) (-1992.055) [-1999.640] * [-1980.188] (-1985.577) (-1998.832) (-1994.659) -- 0:02:16
      579900 -- (-2000.697) [-1979.906] (-1994.020) (-1992.346) * (-1982.722) [-1982.454] (-1985.925) (-1988.113) -- 0:02:16
      580000 -- (-2015.687) [-1979.159] (-1991.757) (-1992.375) * (-1988.322) (-1986.317) [-1986.517] (-1994.375) -- 0:02:16

      Average standard deviation of split frequencies: 0.002670

      580100 -- (-2005.048) [-1981.724] (-1989.627) (-1992.251) * [-1988.100] (-1990.670) (-1996.855) (-1989.958) -- 0:02:16
      580200 -- (-2003.201) [-1981.819] (-1989.279) (-1989.167) * (-1988.076) [-1986.765] (-1995.011) (-1983.879) -- 0:02:16
      580300 -- [-1992.370] (-1985.084) (-1989.072) (-1988.301) * (-1991.401) (-1990.350) (-1986.253) [-1985.609] -- 0:02:15
      580400 -- (-1991.057) (-1989.247) (-1990.261) [-1986.026] * [-1991.470] (-1995.481) (-1990.549) (-1987.224) -- 0:02:15
      580500 -- (-1991.796) [-1981.737] (-1991.845) (-1986.118) * [-1992.248] (-1993.354) (-1985.654) (-1992.379) -- 0:02:15
      580600 -- (-1997.561) (-1986.927) (-1994.583) [-1988.555] * (-1988.648) (-1988.445) [-1981.188] (-1989.495) -- 0:02:15
      580700 -- (-1999.734) [-1983.320] (-1994.011) (-1993.466) * (-1983.978) (-1990.472) [-1981.964] (-1988.465) -- 0:02:15
      580800 -- [-1987.961] (-1984.615) (-1992.584) (-2000.782) * [-1983.143] (-1999.904) (-1985.388) (-1988.700) -- 0:02:15
      580900 -- (-1997.075) [-1983.106] (-1989.438) (-1999.173) * [-1982.187] (-1995.266) (-1991.809) (-1994.690) -- 0:02:15
      581000 -- (-1992.873) [-1983.605] (-1987.273) (-1999.575) * [-1982.530] (-1995.372) (-1987.736) (-1991.426) -- 0:02:15

      Average standard deviation of split frequencies: 0.002735

      581100 -- (-1993.423) (-1982.788) [-1986.228] (-2000.451) * [-1981.238] (-2004.476) (-1983.310) (-1991.762) -- 0:02:15
      581200 -- (-1994.145) (-1980.172) [-1989.565] (-1996.621) * (-1979.881) (-1999.397) [-1983.862] (-2001.170) -- 0:02:15
      581300 -- (-1996.319) (-1985.576) [-1989.987] (-1994.873) * (-1979.118) (-2008.956) [-1979.624] (-2007.716) -- 0:02:15
      581400 -- (-1995.485) (-1987.177) (-1988.592) [-1988.090] * (-1983.598) (-2001.000) [-1980.494] (-1993.183) -- 0:02:15
      581500 -- (-1997.053) [-1986.107] (-2008.429) (-1992.407) * (-1983.025) (-2002.904) [-1981.341] (-1991.779) -- 0:02:15
      581600 -- [-1993.353] (-1985.765) (-2015.236) (-2001.803) * (-1985.785) (-1996.141) [-1981.911] (-1993.115) -- 0:02:15
      581700 -- (-1997.523) [-1984.311] (-1987.337) (-2003.764) * [-1978.959] (-1995.173) (-1986.908) (-1988.583) -- 0:02:15
      581800 -- (-1994.817) [-1983.170] (-1989.259) (-2002.640) * [-1980.610] (-1999.546) (-1987.273) (-1992.109) -- 0:02:15
      581900 -- (-1991.191) [-1978.044] (-1993.398) (-2000.436) * (-1978.815) (-1998.063) [-1986.585] (-1987.302) -- 0:02:15
      582000 -- (-1997.978) [-1981.731] (-1993.835) (-1994.609) * (-1983.663) (-1995.610) [-1987.631] (-1990.811) -- 0:02:15

      Average standard deviation of split frequencies: 0.002684

      582100 -- (-1996.314) (-1983.307) [-1995.529] (-1995.879) * (-1982.772) (-1996.683) [-1985.713] (-1997.395) -- 0:02:14
      582200 -- (-1998.182) [-1983.614] (-1996.107) (-1992.162) * [-1979.762] (-1999.206) (-1989.715) (-2000.596) -- 0:02:14
      582300 -- (-2000.352) [-1982.842] (-1992.219) (-1996.189) * (-1978.076) (-1991.554) [-1985.620] (-1996.904) -- 0:02:14
      582400 -- (-2004.069) [-1983.310] (-1990.626) (-1999.652) * (-1985.828) (-1993.860) [-1983.374] (-2004.343) -- 0:02:14
      582500 -- (-1998.348) [-1978.701] (-1992.412) (-1995.686) * [-1981.867] (-2000.059) (-1989.891) (-1993.874) -- 0:02:14
      582600 -- (-1992.258) [-1975.892] (-1993.196) (-1997.707) * [-1978.292] (-1999.264) (-1987.310) (-1991.121) -- 0:02:15
      582700 -- (-1991.414) [-1976.824] (-1990.014) (-2003.187) * (-1978.655) (-1998.636) [-1987.757] (-1994.734) -- 0:02:15
      582800 -- (-1992.197) [-1979.393] (-1991.777) (-1996.056) * [-1984.390] (-1985.430) (-1988.433) (-1995.915) -- 0:02:15
      582900 -- (-1988.000) [-1984.111] (-1994.413) (-1996.369) * [-1980.832] (-1990.009) (-1987.898) (-1994.979) -- 0:02:15
      583000 -- (-1994.981) [-1985.864] (-1991.259) (-1999.790) * [-1981.283] (-1990.108) (-1989.150) (-1996.177) -- 0:02:15

      Average standard deviation of split frequencies: 0.002679

      583100 -- (-1999.289) [-1983.407] (-1991.895) (-1997.869) * [-1982.900] (-1991.601) (-1989.377) (-1996.372) -- 0:02:15
      583200 -- (-1992.049) (-1983.032) [-1990.372] (-2000.039) * (-1987.022) (-2001.820) [-1987.028] (-1998.120) -- 0:02:15
      583300 -- (-1995.040) [-1988.894] (-1988.659) (-1988.369) * (-1986.533) (-2014.702) [-1987.754] (-2001.605) -- 0:02:15
      583400 -- (-1992.555) [-1986.254] (-1985.234) (-1990.990) * (-1987.816) (-1997.564) [-1978.100] (-1994.730) -- 0:02:14
      583500 -- (-1991.756) [-1983.565] (-1991.105) (-1996.184) * (-1993.514) (-2000.402) [-1982.873] (-1992.651) -- 0:02:14
      583600 -- (-1996.388) [-1980.194] (-1990.903) (-2000.241) * [-1989.671] (-1999.354) (-1988.158) (-1994.117) -- 0:02:14
      583700 -- (-1992.419) (-1975.876) [-1991.710] (-1992.670) * (-1987.398) (-2000.592) [-1988.106] (-1995.195) -- 0:02:14
      583800 -- (-1996.491) [-1979.357] (-1995.956) (-1993.501) * (-1990.671) (-1998.214) (-1989.977) [-1996.841] -- 0:02:14
      583900 -- (-1991.157) [-1981.855] (-1998.460) (-2006.737) * (-1994.093) (-1999.584) [-1987.602] (-1993.940) -- 0:02:14
      584000 -- (-1995.620) [-1981.550] (-1997.908) (-1999.892) * [-1985.790] (-1991.048) (-1990.194) (-1995.040) -- 0:02:14

      Average standard deviation of split frequencies: 0.002721

      584100 -- (-1994.478) [-1982.165] (-1998.015) (-1989.699) * (-1982.384) (-1992.235) [-1984.812] (-2008.089) -- 0:02:14
      584200 -- (-1995.995) [-1981.209] (-1995.256) (-1997.350) * [-1985.239] (-1989.360) (-1992.253) (-1992.598) -- 0:02:14
      584300 -- (-1992.458) [-1981.868] (-1996.487) (-1997.857) * (-1992.027) [-1993.388] (-1984.815) (-1989.915) -- 0:02:14
      584400 -- (-2000.081) [-1985.100] (-2008.151) (-1999.867) * (-1991.781) (-1987.873) [-1984.234] (-1995.925) -- 0:02:14
      584500 -- (-1996.140) (-1981.811) (-2005.978) [-1996.745] * (-1992.794) [-1983.928] (-1982.338) (-1994.411) -- 0:02:14
      584600 -- [-1992.594] (-1981.134) (-1994.624) (-2000.048) * (-1992.071) [-1986.168] (-1987.377) (-1992.403) -- 0:02:14
      584700 -- (-2004.112) [-1980.299] (-1996.445) (-1999.316) * (-1996.468) (-1988.203) [-1990.370] (-1993.589) -- 0:02:14
      584800 -- (-2005.238) [-1984.009] (-2002.138) (-1999.372) * (-1994.810) (-1988.213) [-1984.961] (-1989.402) -- 0:02:14
      584900 -- (-2004.795) (-1990.125) (-1999.854) [-2001.694] * (-2000.539) (-1990.331) [-1988.284] (-1998.816) -- 0:02:14
      585000 -- (-2004.708) [-1989.710] (-1988.128) (-1997.465) * (-1998.353) [-1987.841] (-1989.084) (-2002.849) -- 0:02:14

      Average standard deviation of split frequencies: 0.002624

      585100 -- (-2008.297) (-1998.287) (-1993.199) [-1988.506] * (-1994.581) [-1988.840] (-1982.779) (-2001.255) -- 0:02:14
      585200 -- (-2011.181) (-1989.392) (-1994.631) [-1990.486] * (-1992.122) (-1996.636) [-1981.575] (-2002.211) -- 0:02:13
      585300 -- (-2009.539) (-1987.681) (-2000.137) [-1991.651] * (-1986.852) (-1997.568) [-1985.084] (-2015.687) -- 0:02:13
      585400 -- (-2003.390) [-1985.703] (-2002.211) (-1988.404) * (-1983.957) [-1989.305] (-2000.077) (-2008.476) -- 0:02:13
      585500 -- (-1996.226) (-1988.970) [-1995.407] (-1993.190) * [-1982.618] (-1992.651) (-1995.855) (-2007.339) -- 0:02:13
      585600 -- (-1995.379) [-1986.047] (-1998.359) (-1991.349) * (-1986.164) (-1992.303) [-1985.995] (-2001.097) -- 0:02:13
      585700 -- (-1993.891) (-1988.024) [-1996.838] (-1988.834) * (-1986.638) [-1986.752] (-2000.276) (-1999.627) -- 0:02:14
      585800 -- (-1998.034) [-1989.943] (-1997.030) (-1987.367) * [-1988.558] (-1986.738) (-1998.835) (-2007.028) -- 0:02:14
      585900 -- (-1994.507) [-1986.750] (-2002.258) (-1995.424) * [-1982.588] (-1985.497) (-1990.250) (-2006.016) -- 0:02:14
      586000 -- (-1993.995) [-1984.290] (-2007.626) (-1998.188) * [-1984.613] (-1991.137) (-1992.316) (-2012.059) -- 0:02:14

      Average standard deviation of split frequencies: 0.002620

      586100 -- (-1990.385) [-1981.265] (-2009.802) (-1999.302) * [-1986.238] (-1993.144) (-1984.793) (-1999.225) -- 0:02:14
      586200 -- [-1992.271] (-1989.616) (-2007.230) (-2001.852) * (-1984.327) (-2004.393) [-1983.898] (-2004.011) -- 0:02:14
      586300 -- [-1993.284] (-1989.799) (-2007.734) (-1994.292) * [-1986.295] (-1992.537) (-1987.089) (-1999.719) -- 0:02:14
      586400 -- (-1992.660) [-1983.924] (-2006.506) (-1987.032) * [-1983.038] (-1993.065) (-1990.764) (-2004.280) -- 0:02:14
      586500 -- (-1994.506) [-1982.627] (-2013.988) (-1988.503) * [-1985.251] (-1989.362) (-1991.961) (-2010.672) -- 0:02:13
      586600 -- (-1991.941) (-1986.992) (-2003.170) [-1990.676] * [-1987.120] (-1993.763) (-1990.672) (-2006.637) -- 0:02:13
      586700 -- (-1993.762) [-1981.884] (-2000.687) (-1988.486) * (-1984.795) (-1995.677) [-1988.030] (-2008.152) -- 0:02:13
      586800 -- (-2003.793) [-1980.785] (-2004.566) (-1993.600) * [-1983.685] (-2001.491) (-1989.040) (-2005.237) -- 0:02:13
      586900 -- (-1994.222) [-1983.612] (-2018.649) (-1995.419) * (-1985.699) [-1994.251] (-1988.253) (-1995.108) -- 0:02:13
      587000 -- (-1990.639) (-1980.290) (-2006.113) [-1985.414] * [-1983.239] (-1999.086) (-1991.893) (-1993.314) -- 0:02:13

      Average standard deviation of split frequencies: 0.002661

      587100 -- (-1988.131) [-1980.573] (-2006.358) (-1986.223) * (-1989.679) (-1996.724) [-1985.488] (-1995.101) -- 0:02:13
      587200 -- (-1989.510) [-1985.019] (-2001.677) (-1997.149) * (-1992.621) (-1994.676) [-1983.043] (-2001.063) -- 0:02:13
      587300 -- (-1991.314) [-1986.228] (-2005.377) (-1992.527) * (-1987.075) (-1995.072) [-1984.984] (-2006.055) -- 0:02:13
      587400 -- (-1998.458) (-1992.118) (-1996.989) [-1992.582] * (-1991.232) (-1995.863) [-1983.910] (-2016.010) -- 0:02:13
      587500 -- (-2013.245) [-1984.561] (-2001.982) (-1989.668) * [-1987.309] (-2003.247) (-1986.604) (-2002.209) -- 0:02:13
      587600 -- (-2008.413) (-1985.068) (-2001.819) [-1999.182] * (-1988.561) (-2015.362) [-1985.522] (-1997.061) -- 0:02:13
      587700 -- (-2003.873) [-1988.535] (-1997.932) (-1994.646) * (-1991.158) (-2007.809) [-1982.034] (-2000.659) -- 0:02:13
      587800 -- (-1992.975) [-1983.874] (-1995.967) (-1996.455) * (-1992.914) (-2007.301) [-1985.108] (-1995.539) -- 0:02:13
      587900 -- (-1999.278) [-1986.340] (-1994.336) (-1998.433) * (-1993.105) (-1999.003) (-1987.442) [-1992.513] -- 0:02:13
      588000 -- (-2000.318) (-1983.972) [-1992.484] (-1999.079) * (-1994.396) [-1998.371] (-2003.126) (-1998.612) -- 0:02:13

      Average standard deviation of split frequencies: 0.002656

      588100 -- (-1995.623) [-1983.190] (-1991.153) (-2004.717) * [-1995.889] (-1991.682) (-1994.297) (-2001.936) -- 0:02:13
      588200 -- (-1991.920) [-1986.212] (-1993.029) (-2002.366) * [-1999.222] (-1993.139) (-1999.416) (-2005.681) -- 0:02:13
      588300 -- (-1990.781) [-1983.062] (-1997.914) (-1999.858) * (-1998.844) (-1992.411) [-1992.698] (-1996.740) -- 0:02:12
      588400 -- [-1988.779] (-1986.048) (-2006.669) (-1995.611) * [-1995.950] (-1994.663) (-1998.234) (-2005.117) -- 0:02:12
      588500 -- [-1988.436] (-1992.377) (-2006.199) (-1990.408) * [-1989.749] (-1995.406) (-1990.921) (-2000.211) -- 0:02:12
      588600 -- (-1990.582) [-1991.664] (-2008.359) (-1993.144) * (-1990.446) (-1992.174) [-1987.161] (-1997.866) -- 0:02:12
      588700 -- (-1989.653) (-1993.467) (-2005.110) [-1992.530] * (-1993.437) (-1995.811) [-1986.307] (-2000.317) -- 0:02:13
      588800 -- [-1988.667] (-1990.290) (-2009.474) (-1988.045) * (-1991.602) (-1992.572) [-1985.578] (-1996.554) -- 0:02:13
      588900 -- [-1987.701] (-1995.490) (-1999.630) (-1986.190) * (-1990.173) (-2001.002) [-1984.290] (-1994.902) -- 0:02:13
      589000 -- [-1988.022] (-1990.560) (-2000.358) (-1993.319) * (-1992.058) (-1995.496) (-1981.634) [-1984.414] -- 0:02:13

      Average standard deviation of split frequencies: 0.002515

      589100 -- (-1991.307) [-1983.913] (-2002.389) (-1996.284) * (-2003.049) (-1995.143) [-1982.457] (-1991.797) -- 0:02:13
      589200 -- [-1988.261] (-1987.015) (-2005.451) (-1994.176) * (-2001.938) (-1989.237) (-1986.243) [-1989.951] -- 0:02:13
      589300 -- (-1987.050) [-1988.575] (-2012.881) (-1996.229) * (-2005.300) (-1998.934) [-1983.858] (-1986.313) -- 0:02:13
      589400 -- [-1989.631] (-2000.864) (-2013.928) (-2003.346) * (-2001.856) (-1997.984) (-1996.458) [-1985.591] -- 0:02:13
      589500 -- [-1987.473] (-1996.338) (-2009.326) (-2000.075) * (-1987.651) (-1998.478) (-1988.328) [-1985.367] -- 0:02:13
      589600 -- (-1999.868) (-1992.403) (-2011.719) [-1993.451] * (-1990.541) (-2000.450) (-1997.729) [-1987.736] -- 0:02:12
      589700 -- (-1998.238) (-1982.326) (-2010.796) [-1994.312] * (-1993.428) (-1993.671) (-1990.438) [-1991.114] -- 0:02:12
      589800 -- (-1994.328) [-1983.815] (-2011.699) (-1999.783) * (-2001.289) [-1996.771] (-1990.942) (-1989.951) -- 0:02:12
      589900 -- (-1992.406) [-1982.908] (-2013.845) (-2001.554) * (-1993.836) (-2000.426) (-1996.655) [-1988.009] -- 0:02:12
      590000 -- [-1993.048] (-1980.206) (-2001.178) (-1998.052) * (-1994.185) (-2001.501) (-2000.010) [-1985.074] -- 0:02:12

      Average standard deviation of split frequencies: 0.002511

      590100 -- (-1990.220) [-1980.080] (-2007.634) (-1994.038) * (-1998.832) (-1995.497) (-1998.380) [-1986.338] -- 0:02:12
      590200 -- [-1987.272] (-1978.725) (-1998.324) (-1998.179) * (-1994.129) [-1987.866] (-1993.823) (-1986.545) -- 0:02:12
      590300 -- (-1996.598) [-1977.272] (-2004.327) (-1997.001) * (-2002.559) (-1998.051) (-1989.346) [-1988.902] -- 0:02:12
      590400 -- (-2009.130) [-1986.659] (-1997.874) (-1991.804) * (-1995.857) (-1990.899) (-1984.137) [-1986.783] -- 0:02:12
      590500 -- (-2007.455) [-1986.431] (-2000.970) (-1985.167) * (-1998.359) (-1990.327) (-1987.115) [-1987.535] -- 0:02:12
      590600 -- (-2009.355) (-1979.764) [-1990.295] (-1985.997) * (-2000.497) (-1986.246) [-1987.833] (-1991.304) -- 0:02:12
      590700 -- (-2007.973) [-1981.739] (-1990.865) (-1993.251) * (-2000.630) (-1983.925) (-2000.836) [-1989.846] -- 0:02:12
      590800 -- (-2010.022) [-1991.225] (-1991.466) (-1993.370) * (-1996.605) [-1984.346] (-1992.249) (-1989.500) -- 0:02:12
      590900 -- (-2011.850) [-1978.938] (-2000.922) (-1997.459) * (-1992.612) [-1986.660] (-1995.043) (-1990.381) -- 0:02:12
      591000 -- (-2004.372) [-1984.229] (-1996.028) (-1998.982) * (-1991.705) [-1985.599] (-1999.528) (-2001.871) -- 0:02:12

      Average standard deviation of split frequencies: 0.002506

      591100 -- (-2000.909) [-1981.798] (-1998.192) (-1992.574) * [-1988.901] (-1989.961) (-1987.671) (-2001.182) -- 0:02:12
      591200 -- (-2010.459) (-1990.814) [-1991.317] (-1991.158) * [-1985.420] (-1993.513) (-1985.981) (-2008.660) -- 0:02:12
      591300 -- (-1997.448) [-1984.776] (-1996.250) (-1998.160) * (-1992.354) [-1989.845] (-1988.736) (-1999.945) -- 0:02:12
      591400 -- (-2004.431) [-1985.786] (-1996.622) (-1998.927) * (-1983.714) (-1991.310) [-1983.244] (-2004.435) -- 0:02:11
      591500 -- (-1994.721) [-1986.978] (-1991.887) (-1990.119) * (-1987.915) (-1996.876) [-1986.513] (-1999.931) -- 0:02:11
      591600 -- (-1990.673) [-1983.138] (-1995.634) (-1996.304) * (-1989.277) (-1996.591) [-1984.767] (-2007.801) -- 0:02:11
      591700 -- (-1995.057) [-1986.050] (-1993.775) (-1994.105) * (-1991.062) (-1990.374) [-1980.667] (-2007.738) -- 0:02:11
      591800 -- (-1996.748) [-1988.923] (-1993.658) (-2005.771) * (-1989.520) (-1990.036) [-1982.017] (-2017.603) -- 0:02:12
      591900 -- (-1992.672) [-1981.490] (-1987.088) (-2003.474) * (-1989.834) (-1989.534) [-1979.900] (-2005.838) -- 0:02:12
      592000 -- (-1989.858) [-1979.551] (-1988.294) (-2010.841) * [-1982.769] (-1988.704) (-1978.317) (-1998.725) -- 0:02:12

      Average standard deviation of split frequencies: 0.002525

      592100 -- [-1986.186] (-1982.325) (-1991.032) (-2007.438) * (-1983.291) (-1990.879) [-1976.634] (-1999.616) -- 0:02:12
      592200 -- (-1994.425) (-1984.804) [-1991.715] (-2002.143) * [-1984.789] (-1992.064) (-1980.304) (-2004.345) -- 0:02:12
      592300 -- (-1992.374) [-1981.383] (-1995.846) (-2000.831) * (-1989.864) (-1998.001) [-1980.959] (-1996.880) -- 0:02:12
      592400 -- (-1992.630) [-1978.877] (-1995.397) (-2002.642) * (-1989.546) (-1995.234) [-1980.783] (-1999.603) -- 0:02:12
      592500 -- (-2000.818) [-1977.074] (-1996.519) (-1993.177) * (-1990.505) (-1997.284) [-1984.621] (-1996.501) -- 0:02:12
      592600 -- (-2000.078) [-1982.180] (-1989.578) (-1994.293) * (-1988.309) (-1993.623) (-1987.565) [-1989.393] -- 0:02:11
      592700 -- (-1991.708) [-1984.081] (-1988.766) (-1993.204) * (-1989.250) (-1991.534) [-1984.595] (-1997.239) -- 0:02:11
      592800 -- [-1987.654] (-1984.094) (-1991.564) (-1994.896) * [-1985.977] (-1991.400) (-1988.819) (-1990.915) -- 0:02:11
      592900 -- (-1991.275) [-1982.057] (-1994.540) (-1998.302) * (-1998.931) (-1993.350) (-1994.023) [-1988.801] -- 0:02:11
      593000 -- (-1992.887) [-1981.345] (-2003.496) (-1995.546) * (-2003.999) (-2000.196) (-1991.746) [-1993.561] -- 0:02:11

      Average standard deviation of split frequencies: 0.002475

      593100 -- (-1993.706) [-1979.633] (-2000.295) (-1999.195) * (-1999.135) (-2002.306) [-1990.317] (-1990.925) -- 0:02:11
      593200 -- (-1988.176) [-1977.808] (-2003.023) (-2006.445) * (-1995.921) (-2000.940) [-1986.013] (-1991.252) -- 0:02:11
      593300 -- (-1990.962) [-1977.479] (-1990.886) (-1998.739) * (-1995.754) (-1992.824) (-1988.210) [-1984.939] -- 0:02:11
      593400 -- (-1993.740) [-1980.124] (-1994.645) (-1995.240) * (-1991.098) (-2003.783) (-1986.604) [-1982.988] -- 0:02:11
      593500 -- (-1999.906) [-1980.218] (-1997.583) (-1992.674) * (-1991.100) (-2001.803) [-1984.427] (-1983.254) -- 0:02:11
      593600 -- (-2003.617) (-1980.042) (-1996.574) [-1988.227] * (-1997.015) (-2001.701) [-1979.771] (-1985.576) -- 0:02:11
      593700 -- (-1996.091) [-1983.222] (-2002.540) (-1986.267) * (-1996.965) (-2005.187) [-1980.379] (-1999.071) -- 0:02:11
      593800 -- (-1992.145) (-1982.608) (-2002.470) [-1990.365] * [-1995.594] (-1996.652) (-1984.178) (-1995.090) -- 0:02:11
      593900 -- (-1994.329) [-1984.887] (-2002.421) (-1989.219) * (-1993.201) (-2008.864) (-1985.939) [-1997.242] -- 0:02:11
      594000 -- (-1994.416) [-1986.543] (-2005.707) (-1991.048) * [-1995.005] (-2001.276) (-1983.613) (-2000.506) -- 0:02:11

      Average standard deviation of split frequencies: 0.002471

      594100 -- (-1987.790) (-1991.096) (-1999.524) [-1988.814] * (-2006.382) (-2001.305) (-1983.466) [-1987.335] -- 0:02:11
      594200 -- [-1993.204] (-1992.548) (-1989.368) (-1992.389) * (-2008.998) (-2003.221) (-1988.729) [-1989.033] -- 0:02:11
      594300 -- (-1987.200) [-1993.102] (-1991.562) (-1995.791) * (-1998.030) (-1999.206) (-1985.753) [-1985.145] -- 0:02:11
      594400 -- [-1986.276] (-1989.259) (-1990.276) (-1992.691) * (-1998.370) (-1993.355) (-1991.542) [-1991.706] -- 0:02:11
      594500 -- [-1985.239] (-1994.788) (-1991.989) (-1993.017) * (-2000.025) (-1992.280) [-1993.310] (-1991.621) -- 0:02:10
      594600 -- (-1989.960) (-1989.857) (-1993.486) [-1993.724] * (-1995.760) [-1990.505] (-1988.728) (-1998.835) -- 0:02:10
      594700 -- (-1991.909) (-1992.962) [-1991.009] (-1995.634) * (-1999.481) [-1987.258] (-1989.593) (-2005.989) -- 0:02:10
      594800 -- (-1985.820) [-1985.117] (-1990.559) (-1994.203) * (-2001.150) [-1982.394] (-1987.573) (-2004.659) -- 0:02:11
      594900 -- (-2002.635) [-1982.526] (-1997.785) (-1991.408) * (-2012.958) [-1987.999] (-1986.612) (-2005.942) -- 0:02:11
      595000 -- (-1998.603) [-1982.494] (-1995.843) (-1990.598) * (-2006.910) (-1991.152) [-1983.041] (-2004.522) -- 0:02:11

      Average standard deviation of split frequencies: 0.002602

      595100 -- [-1985.052] (-1987.355) (-1990.503) (-1985.424) * (-2001.879) (-1995.071) [-1981.245] (-1998.870) -- 0:02:11
      595200 -- [-1985.330] (-1987.116) (-1994.929) (-1989.550) * (-1998.617) (-2000.424) [-1979.764] (-1995.900) -- 0:02:11
      595300 -- [-1983.657] (-1985.740) (-1992.166) (-1989.578) * (-2000.530) (-2004.443) [-1982.991] (-1994.083) -- 0:02:11
      595400 -- (-1993.384) [-1985.784] (-1997.522) (-1987.417) * (-1999.426) (-1988.667) [-1981.213] (-1993.465) -- 0:02:11
      595500 -- (-1998.996) [-1983.516] (-1993.458) (-1989.313) * (-1993.316) (-1985.997) [-1977.489] (-1995.006) -- 0:02:11
      595600 -- (-1992.251) [-1984.861] (-1991.290) (-1987.944) * (-1998.517) (-1986.749) [-1980.633] (-2004.941) -- 0:02:11
      595700 -- (-1998.624) [-1991.184] (-1996.586) (-1999.604) * (-1999.957) (-1990.808) [-1980.206] (-1992.054) -- 0:02:10
      595800 -- (-1996.077) [-1986.372] (-1988.151) (-1998.454) * (-1994.228) (-1987.402) [-1987.032] (-1994.982) -- 0:02:10
      595900 -- [-1988.720] (-1997.275) (-1992.884) (-1994.426) * (-1996.520) (-1988.677) (-1991.063) [-1985.808] -- 0:02:10
      596000 -- [-1985.642] (-1997.427) (-1986.096) (-1990.863) * (-2002.564) [-1987.265] (-2002.948) (-1986.653) -- 0:02:10

      Average standard deviation of split frequencies: 0.002711

      596100 -- (-1987.762) (-1989.789) (-1991.101) [-1990.481] * (-2003.884) (-1990.279) (-2006.678) [-1988.270] -- 0:02:10
      596200 -- [-1990.200] (-1994.645) (-1997.862) (-1987.055) * (-2008.141) (-1987.003) [-1992.967] (-1990.149) -- 0:02:10
      596300 -- [-1989.557] (-1999.856) (-2005.666) (-1989.238) * [-1996.864] (-1990.260) (-1992.061) (-1990.836) -- 0:02:10
      596400 -- [-1994.300] (-1999.517) (-1988.779) (-1993.031) * (-1997.640) [-1996.500] (-1984.997) (-1991.371) -- 0:02:10
      596500 -- [-1989.940] (-1987.298) (-1989.698) (-1995.279) * (-1996.529) (-1992.693) [-1980.810] (-1994.991) -- 0:02:10
      596600 -- (-1989.704) (-1988.371) (-1992.397) [-1987.308] * (-1990.743) (-1994.359) [-1981.043] (-1991.620) -- 0:02:10
      596700 -- (-1991.014) (-1987.118) [-1991.617] (-1994.712) * (-1991.035) (-1998.695) [-1979.964] (-1992.855) -- 0:02:10
      596800 -- (-1991.330) [-1985.267] (-1991.618) (-1999.912) * (-1993.906) (-2001.765) [-1979.863] (-1992.042) -- 0:02:10
      596900 -- (-1999.751) [-1981.291] (-1987.634) (-2006.560) * (-1998.196) (-2001.650) [-1978.440] (-1997.175) -- 0:02:10
      597000 -- (-2003.312) [-1983.991] (-1984.416) (-1997.159) * (-1994.120) (-2008.434) [-1982.955] (-1994.717) -- 0:02:10

      Average standard deviation of split frequencies: 0.002661

      597100 -- (-2014.239) (-1986.014) [-1982.670] (-1997.293) * [-1993.470] (-1995.435) (-1987.320) (-1993.441) -- 0:02:10
      597200 -- (-2006.123) (-1984.763) [-1982.364] (-1997.583) * (-1992.155) (-1990.756) (-1991.309) [-1990.266] -- 0:02:10
      597300 -- (-1999.119) [-1983.205] (-1993.595) (-1994.600) * (-1993.077) (-1988.542) [-1989.266] (-1989.580) -- 0:02:10
      597400 -- (-2005.772) (-1989.520) (-1983.466) [-1991.719] * (-1997.540) [-1986.916] (-1993.694) (-1991.649) -- 0:02:10
      597500 -- (-1994.473) [-1985.545] (-1988.729) (-1993.648) * (-2000.562) [-1984.584] (-1987.732) (-1985.402) -- 0:02:10
      597600 -- (-1998.525) (-1983.935) [-1983.334] (-1992.289) * (-1999.469) [-1985.305] (-1991.066) (-1993.383) -- 0:02:09
      597700 -- (-1995.467) [-1988.792] (-1981.107) (-1994.021) * (-1997.983) [-1987.703] (-1994.819) (-1989.741) -- 0:02:09
      597800 -- (-1998.095) (-1991.701) [-1984.365] (-2011.001) * (-2002.075) [-1989.045] (-1992.628) (-1996.345) -- 0:02:09
      597900 -- (-2000.749) (-1985.298) [-1981.293] (-2007.730) * (-1997.774) [-1984.417] (-1991.488) (-1993.042) -- 0:02:10
      598000 -- (-2008.969) [-1981.248] (-1979.872) (-2000.572) * (-1997.243) (-1996.251) (-2002.678) [-1985.155] -- 0:02:10

      Average standard deviation of split frequencies: 0.002725

      598100 -- (-1998.593) (-1985.589) [-1981.811] (-1986.589) * [-1991.304] (-1996.321) (-1996.223) (-1991.709) -- 0:02:10
      598200 -- (-1996.055) (-1984.534) [-1984.280] (-1987.922) * (-1989.831) (-1992.696) (-1994.196) [-1992.228] -- 0:02:10
      598300 -- (-1999.661) (-1983.308) [-1982.060] (-1990.670) * (-1987.016) [-1985.409] (-1997.445) (-1993.072) -- 0:02:10
      598400 -- (-1996.706) (-1987.257) (-1982.264) [-1987.841] * (-1990.081) [-1984.121] (-2001.471) (-2001.402) -- 0:02:10
      598500 -- (-1998.731) (-1979.839) [-1982.836] (-1987.103) * (-1994.893) (-1981.717) (-1991.096) [-1992.389] -- 0:02:10
      598600 -- (-1994.423) [-1982.582] (-1988.196) (-1990.418) * (-1994.001) (-1990.595) [-1989.385] (-1989.521) -- 0:02:10
      598700 -- (-1987.458) (-1987.434) [-1981.761] (-1989.525) * (-1994.398) (-1997.829) [-1986.534] (-1991.745) -- 0:02:10
      598800 -- (-1993.326) (-1996.991) [-1976.322] (-1986.489) * (-1993.841) (-1990.658) [-1983.018] (-1992.649) -- 0:02:09
      598900 -- (-1997.348) (-1986.022) (-1985.005) [-1988.728] * [-1987.233] (-1998.817) (-1985.022) (-1987.303) -- 0:02:09
      599000 -- (-1989.270) (-1989.127) (-1987.609) [-1989.589] * (-1990.484) (-2004.321) (-1990.150) [-1988.443] -- 0:02:09

      Average standard deviation of split frequencies: 0.002855

      599100 -- (-1998.544) (-1988.313) (-1991.857) [-1991.662] * (-1990.899) (-2000.608) (-1991.900) [-1985.211] -- 0:02:09
      599200 -- (-1994.523) (-1989.780) [-1991.692] (-1995.234) * (-1990.450) (-1994.410) (-1985.449) [-1986.765] -- 0:02:09
      599300 -- (-1991.560) (-1992.010) [-1988.722] (-1989.640) * (-1989.529) (-1999.123) (-1982.326) [-1988.440] -- 0:02:09
      599400 -- (-1985.925) (-1988.688) (-1980.560) [-1988.554] * (-1991.783) (-1997.304) [-1980.157] (-1989.985) -- 0:02:09
      599500 -- (-1984.004) (-1982.504) [-1982.691] (-1988.245) * (-1991.330) (-1997.968) [-1987.538] (-1996.963) -- 0:02:09
      599600 -- (-2004.337) (-1985.361) [-1981.289] (-1987.229) * (-1991.764) (-1997.600) [-1983.939] (-1993.805) -- 0:02:09
      599700 -- (-2002.459) (-1996.329) [-1977.439] (-1989.604) * (-1989.072) (-2000.531) [-1981.789] (-1998.665) -- 0:02:09
      599800 -- (-1993.999) [-1981.118] (-1981.089) (-1992.815) * (-1993.316) (-2002.094) [-1981.053] (-1999.304) -- 0:02:09
      599900 -- (-2002.065) (-1982.084) [-1980.961] (-1991.267) * (-1986.968) (-2000.300) [-1981.358] (-1995.847) -- 0:02:09
      600000 -- (-1994.816) (-1984.744) [-1982.969] (-1992.250) * [-1983.633] (-2001.505) (-1984.714) (-1993.930) -- 0:02:09

      Average standard deviation of split frequencies: 0.002738

      600100 -- (-1995.676) (-1986.019) [-1982.514] (-1996.195) * (-1981.195) (-1998.557) [-1981.240] (-1995.159) -- 0:02:09
      600200 -- (-1994.730) (-1984.895) [-1980.653] (-1997.679) * [-1986.912] (-2004.117) (-1985.355) (-2000.575) -- 0:02:09
      600300 -- (-1999.497) (-1987.793) [-1983.222] (-1994.170) * (-1989.520) (-2003.532) [-1984.856] (-1997.757) -- 0:02:09
      600400 -- (-1995.189) (-1981.527) [-1979.099] (-1987.130) * [-1983.193] (-1995.291) (-1999.536) (-1996.277) -- 0:02:09
      600500 -- (-1997.179) (-1983.388) [-1982.910] (-1988.023) * [-1987.615] (-1994.532) (-1996.741) (-2003.836) -- 0:02:09
      600600 -- (-1995.694) (-1985.533) [-1982.749] (-1983.867) * [-1982.744] (-1994.545) (-1996.654) (-1996.649) -- 0:02:09
      600700 -- (-2000.149) (-1986.216) [-1978.426] (-1983.710) * [-1988.393] (-1997.441) (-1992.137) (-1994.080) -- 0:02:08
      600800 -- (-1996.463) [-1993.496] (-1979.496) (-1994.563) * (-1989.157) (-1994.817) [-1986.943] (-2000.383) -- 0:02:08
      600900 -- (-2003.335) (-1994.054) [-1980.164] (-1998.183) * (-1992.063) (-1999.709) [-1986.666] (-2002.185) -- 0:02:09
      601000 -- (-2001.735) (-1994.345) [-1982.426] (-1994.336) * (-1993.230) (-2011.126) [-1982.265] (-2005.921) -- 0:02:09

      Average standard deviation of split frequencies: 0.002778

      601100 -- (-1997.392) (-1996.342) [-1982.300] (-1993.821) * (-2001.274) (-2008.609) [-1983.691] (-1999.513) -- 0:02:09
      601200 -- (-1998.739) (-1992.870) [-1979.231] (-1990.639) * (-2000.944) (-2002.636) [-1979.828] (-1998.831) -- 0:02:09
      601300 -- (-1997.686) (-1994.385) (-1978.739) [-1985.588] * (-2000.991) (-1991.913) [-1987.605] (-1992.073) -- 0:02:09
      601400 -- (-1996.555) (-1986.484) [-1983.007] (-1990.637) * (-2005.979) (-1990.749) (-1988.408) [-1982.814] -- 0:02:09
      601500 -- (-1988.886) (-1996.535) [-1983.474] (-1999.447) * (-2002.935) (-1993.502) (-1984.485) [-1984.021] -- 0:02:09
      601600 -- (-1995.279) (-1986.987) [-1977.710] (-1993.723) * (-1988.211) [-1987.564] (-1989.299) (-1986.360) -- 0:02:09
      601700 -- (-1990.004) [-1985.034] (-1978.192) (-2003.890) * (-1999.578) [-1985.025] (-1986.401) (-1986.210) -- 0:02:09
      601800 -- (-1991.569) [-1981.586] (-1985.476) (-2007.374) * (-1992.573) (-1990.245) [-1988.618] (-1998.055) -- 0:02:09
      601900 -- (-1988.121) [-1980.892] (-1983.369) (-2007.029) * (-1983.862) (-1990.577) [-1986.831] (-1998.232) -- 0:02:08
      602000 -- (-1993.174) [-1979.493] (-1987.278) (-1997.689) * (-1986.734) (-1990.777) [-1989.079] (-1992.203) -- 0:02:08

      Average standard deviation of split frequencies: 0.002953

      602100 -- (-1993.931) (-1983.846) [-1982.757] (-1999.900) * (-1982.280) (-1993.583) (-1999.291) [-1987.576] -- 0:02:08
      602200 -- (-1990.007) [-1979.943] (-1982.935) (-2000.877) * [-1986.285] (-1993.981) (-1987.285) (-1985.706) -- 0:02:08
      602300 -- (-1992.528) [-1980.494] (-1983.928) (-1999.361) * (-1986.245) (-1995.498) (-1994.902) [-1992.185] -- 0:02:08
      602400 -- (-1990.325) (-1982.333) [-1977.801] (-2001.327) * [-1985.346] (-1991.881) (-1991.200) (-1997.778) -- 0:02:08
      602500 -- (-1989.942) (-1982.283) [-1984.455] (-2004.394) * [-1980.662] (-1992.950) (-1990.935) (-1995.900) -- 0:02:08
      602600 -- (-1990.646) [-1979.352] (-1984.468) (-2004.142) * (-1989.412) [-1988.304] (-2002.764) (-1999.341) -- 0:02:08
      602700 -- (-1990.268) (-1982.545) [-1979.952] (-1997.279) * [-1985.951] (-1988.852) (-1984.748) (-2006.417) -- 0:02:08
      602800 -- (-1996.096) (-1988.170) [-1980.909] (-1998.043) * (-1983.751) (-1994.166) [-1981.152] (-2007.653) -- 0:02:08
      602900 -- (-1999.407) [-1979.428] (-1983.614) (-1995.722) * (-1992.049) (-2000.669) [-1977.506] (-2010.402) -- 0:02:08
      603000 -- (-1993.875) (-1986.740) [-1979.475] (-1993.752) * (-1996.516) (-1994.950) [-1977.180] (-2002.002) -- 0:02:08

      Average standard deviation of split frequencies: 0.002970

      603100 -- (-1995.015) (-2000.213) [-1978.841] (-1993.355) * (-1996.508) (-1994.314) [-1978.440] (-1996.746) -- 0:02:08
      603200 -- (-1994.044) (-1987.846) [-1981.870] (-1993.124) * (-1996.035) (-1997.977) [-1981.111] (-1999.844) -- 0:02:08
      603300 -- (-1991.929) (-1992.664) [-1981.154] (-2007.268) * (-1988.699) [-2000.586] (-1982.871) (-1995.013) -- 0:02:08
      603400 -- (-1990.395) (-1987.270) [-1986.955] (-2000.981) * (-1981.781) (-1997.277) [-1981.031] (-1997.997) -- 0:02:08
      603500 -- (-1994.207) [-1988.340] (-1986.888) (-2004.658) * (-1982.122) (-1999.137) (-1981.303) [-1993.253] -- 0:02:08
      603600 -- (-1992.770) [-1985.184] (-1988.287) (-2001.617) * [-1985.607] (-1999.776) (-1983.311) (-1999.778) -- 0:02:08
      603700 -- (-1995.848) [-1988.076] (-1988.291) (-2006.606) * [-1988.305] (-2009.472) (-1990.829) (-1994.914) -- 0:02:08
      603800 -- (-1995.160) [-1987.315] (-1985.922) (-1996.325) * [-1990.129] (-2000.065) (-1989.602) (-2000.133) -- 0:02:07
      603900 -- (-1993.975) (-1990.501) [-1985.223] (-1989.049) * [-1984.171] (-1995.664) (-1992.210) (-1985.407) -- 0:02:08
      604000 -- (-1993.764) (-1986.367) (-1985.219) [-1989.528] * (-1982.656) (-1996.318) [-1978.680] (-1989.813) -- 0:02:08

      Average standard deviation of split frequencies: 0.003077

      604100 -- (-1997.127) (-1985.946) (-1981.166) [-1987.780] * (-1988.124) (-1993.645) [-1980.753] (-1992.868) -- 0:02:08
      604200 -- (-1996.469) (-1982.805) [-1981.248] (-1988.228) * (-1991.748) (-1992.003) (-1983.592) [-1986.853] -- 0:02:08
      604300 -- (-1995.627) (-1983.674) [-1979.619] (-1990.358) * (-1993.135) (-2001.474) [-1989.903] (-1988.028) -- 0:02:08
      604400 -- (-1995.358) (-1989.457) [-1978.349] (-1996.415) * (-1992.556) (-2002.117) [-1983.232] (-1988.046) -- 0:02:08
      604500 -- (-1994.045) (-1992.819) [-1984.422] (-1996.631) * (-1989.761) (-1996.327) [-1984.740] (-1995.329) -- 0:02:08
      604600 -- (-1989.593) [-1985.901] (-1985.832) (-2004.737) * (-1997.168) (-2002.445) [-1984.362] (-1990.108) -- 0:02:08
      604700 -- (-1991.235) (-1989.477) [-1982.186] (-1998.914) * (-2004.609) (-2002.600) [-1980.242] (-1985.245) -- 0:02:08
      604800 -- (-1989.958) (-1992.325) [-1979.603] (-1989.781) * (-1996.448) (-2000.929) (-1978.527) [-1988.021] -- 0:02:08
      604900 -- (-1999.053) (-1988.978) [-1981.574] (-1992.602) * (-1992.261) (-1998.785) [-1985.718] (-1984.624) -- 0:02:08
      605000 -- (-2009.259) (-1990.191) [-1979.514] (-1989.026) * (-1992.791) (-2006.481) (-1980.400) [-1984.246] -- 0:02:07

      Average standard deviation of split frequencies: 0.003138

      605100 -- (-1997.697) (-1991.614) [-1979.708] (-1991.513) * (-1999.233) (-2000.324) (-1983.054) [-1983.124] -- 0:02:07
      605200 -- (-1994.634) (-1991.576) [-1979.226] (-2012.842) * (-2000.145) (-1992.161) [-1983.639] (-1985.845) -- 0:02:07
      605300 -- (-1992.160) (-1986.630) [-1980.830] (-2009.699) * (-1991.910) (-1991.030) [-1981.280] (-1984.291) -- 0:02:07
      605400 -- (-1992.079) (-1977.813) [-1979.587] (-1998.060) * (-1999.886) (-1994.583) [-1985.118] (-1989.447) -- 0:02:07
      605500 -- (-1989.143) (-1986.161) [-1986.984] (-1995.185) * (-1995.554) (-1995.209) [-1983.742] (-1990.942) -- 0:02:07
      605600 -- (-1993.596) (-1985.861) [-1989.521] (-2001.071) * (-1997.037) (-1993.963) [-1980.537] (-1985.596) -- 0:02:07
      605700 -- (-1995.466) [-1987.212] (-1987.387) (-1995.002) * (-1998.635) (-1993.079) [-1988.700] (-1986.714) -- 0:02:07
      605800 -- (-1989.564) (-1986.858) [-1984.276] (-1993.536) * (-1995.939) (-2000.633) (-1984.657) [-1986.733] -- 0:02:07
      605900 -- (-1989.608) (-1988.729) [-1985.612] (-1990.602) * (-1991.615) (-1993.058) [-1984.302] (-1984.676) -- 0:02:07
      606000 -- (-1988.936) (-1988.553) [-1984.487] (-1993.207) * (-1995.306) (-2001.613) [-1985.853] (-1985.770) -- 0:02:07

      Average standard deviation of split frequencies: 0.003089

      606100 -- (-1994.244) [-1982.513] (-1985.412) (-1991.118) * (-1994.116) (-1992.325) (-1982.056) [-1987.636] -- 0:02:07
      606200 -- (-1992.514) [-1980.133] (-2000.506) (-1991.911) * (-1998.711) (-1996.579) [-1982.312] (-1985.783) -- 0:02:07
      606300 -- (-2004.389) [-1985.131] (-1995.808) (-1993.226) * [-1992.956] (-1995.860) (-1996.145) (-1986.707) -- 0:02:07
      606400 -- (-1994.788) (-1990.952) [-1988.272] (-1994.974) * (-1991.380) (-1990.818) [-1987.418] (-1988.128) -- 0:02:07
      606500 -- (-1991.288) [-1983.603] (-1985.979) (-1993.688) * (-1991.259) [-1986.306] (-1991.854) (-1990.961) -- 0:02:07
      606600 -- (-1998.524) (-1984.642) [-1980.266] (-2003.392) * (-1993.489) [-1986.411] (-1991.511) (-1994.077) -- 0:02:07
      606700 -- (-1992.437) [-1985.468] (-1982.453) (-2002.064) * (-1990.897) (-1983.506) [-1997.952] (-1993.399) -- 0:02:07
      606800 -- (-1993.915) (-1984.446) [-1980.790] (-1997.266) * (-1991.528) [-1985.709] (-1997.423) (-1993.968) -- 0:02:07
      606900 -- [-1996.016] (-1990.434) (-1981.166) (-1995.958) * (-1989.115) [-1986.550] (-1990.599) (-1993.520) -- 0:02:06
      607000 -- (-1993.556) [-1982.291] (-1987.474) (-1995.821) * (-1991.912) [-1984.826] (-1988.930) (-1988.747) -- 0:02:07

      Average standard deviation of split frequencies: 0.003105

      607100 -- (-1994.216) (-1985.148) [-1984.223] (-1995.892) * (-1991.327) (-1992.725) [-1986.109] (-1993.911) -- 0:02:07
      607200 -- (-1988.352) (-1990.057) [-1987.313] (-1996.797) * (-1988.082) (-1997.173) (-1992.663) [-1994.243] -- 0:02:07
      607300 -- (-1993.438) [-1986.133] (-1986.329) (-1999.043) * [-1983.524] (-1988.715) (-1989.994) (-1990.076) -- 0:02:07
      607400 -- (-2003.004) (-1983.976) [-1982.027] (-1992.419) * (-1990.531) (-1980.219) (-1990.946) [-1987.860] -- 0:02:07
      607500 -- (-1994.807) (-1990.450) (-1985.772) [-1994.875] * (-1990.482) [-1984.136] (-1992.304) (-1986.195) -- 0:02:07
      607600 -- (-2005.309) (-1988.616) [-1983.314] (-1995.107) * (-1994.941) (-1988.779) (-1991.944) [-1997.279] -- 0:02:07
      607700 -- (-1996.311) (-1984.656) [-1990.212] (-2000.817) * [-1987.990] (-1996.487) (-2002.657) (-1990.505) -- 0:02:07
      607800 -- (-1999.106) (-1986.490) (-1987.408) [-1995.081] * [-1985.288] (-1991.750) (-1993.143) (-1988.764) -- 0:02:07
      607900 -- (-1995.910) [-1982.957] (-1986.687) (-1993.415) * [-1985.631] (-1985.933) (-1991.227) (-1999.500) -- 0:02:07
      608000 -- (-1996.407) [-1980.236] (-1993.876) (-2001.387) * [-1986.973] (-1989.625) (-1989.419) (-2001.487) -- 0:02:07

      Average standard deviation of split frequencies: 0.003123

      608100 -- (-1996.829) (-1987.403) [-1982.271] (-1996.094) * (-1992.339) [-1988.767] (-1988.618) (-2001.046) -- 0:02:06
      608200 -- (-1997.811) [-2000.610] (-1981.760) (-1990.157) * (-1996.990) [-1990.031] (-1994.149) (-1992.219) -- 0:02:06
      608300 -- (-2000.709) (-1989.357) [-1985.359] (-1986.183) * (-1992.686) (-1982.500) (-1988.715) [-1990.119] -- 0:02:06
      608400 -- (-1999.167) (-1986.926) [-1982.247] (-1991.496) * (-1991.426) [-1978.864] (-1986.737) (-1994.584) -- 0:02:06
      608500 -- (-2000.174) (-1984.927) [-1981.675] (-1997.484) * (-1996.269) (-1985.093) [-1985.490] (-1999.993) -- 0:02:06
      608600 -- (-1998.533) [-1981.536] (-1983.844) (-1992.694) * (-1994.408) [-1979.469] (-1986.532) (-1993.900) -- 0:02:06
      608700 -- (-1993.427) [-1984.897] (-1985.901) (-2000.979) * (-2005.388) [-1981.391] (-1984.317) (-1989.894) -- 0:02:06
      608800 -- (-1993.868) [-1980.818] (-1991.729) (-2007.931) * (-2007.352) (-1982.678) (-1985.155) [-1987.890] -- 0:02:06
      608900 -- (-1987.619) [-1981.150] (-1995.578) (-1996.494) * (-2001.906) [-1977.301] (-1982.016) (-1985.726) -- 0:02:06
      609000 -- (-1989.049) [-1981.548] (-1983.920) (-2000.902) * (-2003.666) [-1978.641] (-1993.591) (-1988.522) -- 0:02:06

      Average standard deviation of split frequencies: 0.003095

      609100 -- [-1991.079] (-1985.159) (-1988.187) (-2000.900) * (-2007.275) [-1982.265] (-1993.289) (-1988.149) -- 0:02:06
      609200 -- (-1993.549) [-1989.017] (-1991.286) (-2000.838) * (-2001.673) (-1986.407) (-1997.294) [-1987.052] -- 0:02:06
      609300 -- (-1996.182) [-1983.275] (-1991.617) (-2001.310) * (-1998.024) [-1982.121] (-1999.430) (-1992.555) -- 0:02:06
      609400 -- (-1994.723) [-1983.788] (-1986.152) (-1995.580) * (-2001.465) [-1985.522] (-2003.847) (-1989.874) -- 0:02:06
      609500 -- (-1994.143) [-1981.877] (-1986.638) (-1998.455) * (-2001.377) [-1984.478] (-1995.611) (-1992.902) -- 0:02:06
      609600 -- (-1994.121) (-1992.747) [-1985.749] (-1992.350) * [-1997.184] (-1990.424) (-1988.373) (-1985.516) -- 0:02:06
      609700 -- (-1996.556) (-1989.973) [-1986.996] (-1986.170) * (-1992.021) (-1992.448) (-1992.371) [-1987.366] -- 0:02:06
      609800 -- (-2000.460) (-1984.957) (-1990.159) [-1985.909] * (-1994.945) (-1987.471) (-1984.049) [-1987.343] -- 0:02:06
      609900 -- (-1996.447) [-1985.905] (-1982.392) (-1986.805) * (-2004.914) (-1989.207) [-1989.713] (-1991.818) -- 0:02:06
      610000 -- (-1994.098) (-1983.007) (-1990.414) [-1988.487] * (-1999.100) (-1989.598) (-1986.155) [-1988.828] -- 0:02:06

      Average standard deviation of split frequencies: 0.003091

      610100 -- (-1991.823) (-1984.350) (-1991.046) [-1987.024] * (-2001.582) (-1981.718) [-1984.871] (-1995.378) -- 0:02:06
      610200 -- (-1986.186) [-1983.501] (-1995.953) (-1995.577) * (-2002.298) [-1982.562] (-1988.450) (-1991.559) -- 0:02:06
      610300 -- [-1987.783] (-1988.715) (-2004.969) (-1997.658) * (-2000.877) [-1981.527] (-1983.374) (-1995.368) -- 0:02:06
      610400 -- [-1986.041] (-1988.223) (-1995.524) (-1990.772) * (-1996.099) (-2000.035) [-1983.506] (-1993.847) -- 0:02:06
      610500 -- (-1989.141) [-1982.470] (-2000.226) (-1989.029) * (-1998.902) (-1992.962) [-1984.963] (-1999.493) -- 0:02:06
      610600 -- (-1992.416) [-1980.258] (-1996.486) (-2000.296) * (-1995.777) [-1984.093] (-1982.748) (-2001.063) -- 0:02:06
      610700 -- (-1993.552) [-1981.391] (-1997.819) (-1997.289) * (-1993.380) (-1986.692) (-1985.954) [-1995.053] -- 0:02:06
      610800 -- (-1994.600) [-1980.927] (-1995.382) (-1996.556) * (-1992.524) [-1980.452] (-1989.443) (-1997.021) -- 0:02:06
      610900 -- (-1986.872) [-1980.660] (-2001.624) (-1992.770) * (-1988.017) [-1978.755] (-1988.923) (-1996.379) -- 0:02:06
      611000 -- (-1989.943) [-1986.399] (-1999.232) (-1996.466) * (-1987.669) [-1980.287] (-1987.987) (-1991.461) -- 0:02:06

      Average standard deviation of split frequencies: 0.002997

      611100 -- (-1994.822) [-1991.384] (-2002.327) (-1993.717) * (-1986.514) [-1982.512] (-1983.145) (-2002.429) -- 0:02:06
      611200 -- (-1986.020) [-1985.098] (-1998.798) (-1992.602) * (-1999.254) [-1979.748] (-1986.001) (-1996.398) -- 0:02:05
      611300 -- [-1991.923] (-1985.094) (-1984.941) (-1997.344) * (-1995.698) [-1979.568] (-1984.561) (-1996.935) -- 0:02:05
      611400 -- (-1991.104) (-1986.956) [-1986.247] (-1996.968) * (-1991.370) [-1981.796] (-1980.172) (-1995.925) -- 0:02:05
      611500 -- (-1992.683) (-1984.193) [-1984.126] (-1999.162) * (-1985.773) [-1987.565] (-1987.983) (-1995.628) -- 0:02:05
      611600 -- (-1990.659) [-1989.379] (-1981.667) (-1989.909) * [-1986.384] (-1987.922) (-1982.845) (-1992.569) -- 0:02:05
      611700 -- (-1998.572) [-1988.452] (-1983.094) (-1992.154) * (-1984.697) (-1989.250) [-1982.830] (-1993.163) -- 0:02:05
      611800 -- (-1994.678) (-1982.176) [-1984.904] (-1990.653) * (-1989.931) (-1996.181) [-1978.763] (-1989.808) -- 0:02:05
      611900 -- [-1988.719] (-1985.677) (-1984.461) (-1990.179) * (-1990.795) (-1992.498) [-1983.844] (-1990.232) -- 0:02:05
      612000 -- (-2004.078) (-1985.295) [-1980.583] (-1992.540) * (-1991.687) (-1994.869) [-1981.380] (-1992.860) -- 0:02:05

      Average standard deviation of split frequencies: 0.002882

      612100 -- (-2011.614) (-1986.025) [-1981.910] (-2003.667) * (-1991.117) (-1997.341) [-1982.651] (-1991.618) -- 0:02:05
      612200 -- (-1990.860) (-1987.607) [-1979.192] (-2011.453) * (-2002.719) (-2003.114) [-1990.131] (-1993.043) -- 0:02:05
      612300 -- (-1993.077) (-1983.480) [-1983.014] (-1999.135) * (-2006.580) (-1997.173) (-1995.537) [-1991.226] -- 0:02:05
      612400 -- (-1991.817) (-1989.002) [-1988.533] (-1999.346) * (-2004.287) (-1993.968) [-1990.972] (-1987.139) -- 0:02:05
      612500 -- (-1992.859) (-1996.367) [-1987.730] (-1997.915) * (-2007.883) (-1999.753) [-1985.609] (-2000.830) -- 0:02:05
      612600 -- (-1990.633) (-1987.970) [-1982.314] (-1997.849) * (-1993.200) (-2007.170) [-1985.272] (-1992.058) -- 0:02:05
      612700 -- (-1991.091) (-1989.522) [-1981.438] (-1994.453) * (-1994.559) (-2009.754) [-1982.733] (-1992.871) -- 0:02:05
      612800 -- (-1999.014) [-1983.756] (-1995.199) (-1999.999) * (-1994.953) (-2002.820) (-1985.757) [-1993.980] -- 0:02:05
      612900 -- (-2001.328) [-1986.953] (-1990.222) (-1998.224) * (-1992.033) (-1998.925) [-1987.942] (-1991.411) -- 0:02:05
      613000 -- (-1997.859) (-1994.566) [-1985.479] (-1990.782) * (-1996.345) (-1991.605) [-1981.292] (-1992.372) -- 0:02:05

      Average standard deviation of split frequencies: 0.003119

      613100 -- (-1987.316) (-1998.104) [-1984.935] (-1987.497) * (-1991.530) (-1993.782) [-1982.314] (-1996.128) -- 0:02:05
      613200 -- [-1987.788] (-1998.628) (-1987.617) (-1989.857) * (-1986.590) (-1997.850) [-1980.472] (-1998.585) -- 0:02:05
      613300 -- (-1988.109) (-1999.635) (-1986.298) [-1987.043] * (-1991.557) (-1990.556) [-1982.620] (-1998.339) -- 0:02:05
      613400 -- (-1993.743) (-1988.198) [-1987.408] (-1988.246) * (-2001.233) (-1995.180) [-1980.453] (-2001.114) -- 0:02:05
      613500 -- (-1993.314) (-1994.878) (-1991.565) [-1990.507] * (-1993.004) (-1990.128) [-1983.034] (-1987.839) -- 0:02:05
      613600 -- (-1989.336) [-1992.018] (-1988.609) (-1998.404) * (-1988.479) [-1988.762] (-1988.166) (-1988.210) -- 0:02:05
      613700 -- [-1993.364] (-1995.075) (-1980.249) (-1996.338) * (-1996.422) (-1993.110) (-1995.127) [-1987.008] -- 0:02:05
      613800 -- (-1995.887) (-1986.703) [-1979.377] (-2000.642) * [-1989.188] (-1999.073) (-1990.380) (-1987.736) -- 0:02:05
      613900 -- (-1998.829) (-1992.706) [-1980.945] (-1991.534) * (-1989.254) (-1992.817) [-1988.686] (-1990.862) -- 0:02:05
      614000 -- (-1988.902) (-1992.103) [-1980.235] (-1993.003) * (-1988.201) [-1990.430] (-1984.560) (-1985.476) -- 0:02:05

      Average standard deviation of split frequencies: 0.003334

      614100 -- (-1996.473) (-1987.112) [-1979.763] (-1998.854) * (-1994.218) (-1994.396) [-1983.698] (-1997.634) -- 0:02:05
      614200 -- (-2004.130) (-1989.042) (-1985.938) [-1993.073] * (-1995.249) (-1985.859) [-1981.243] (-1995.784) -- 0:02:04
      614300 -- (-1991.143) [-1992.225] (-1989.407) (-2000.113) * (-1998.120) [-1986.531] (-1987.681) (-1993.071) -- 0:02:04
      614400 -- (-1990.975) [-1986.004] (-1990.025) (-2000.440) * [-1992.506] (-1990.673) (-1992.710) (-1998.795) -- 0:02:04
      614500 -- [-1989.874] (-1986.111) (-1993.418) (-1990.005) * [-1998.203] (-1996.576) (-1998.792) (-1993.279) -- 0:02:04
      614600 -- (-1994.051) [-1985.486] (-1994.679) (-1988.034) * [-1992.221] (-1994.143) (-1996.729) (-1987.849) -- 0:02:04
      614700 -- (-1994.980) [-1981.789] (-2000.301) (-1988.383) * (-1986.554) (-1989.068) [-1991.631] (-1990.295) -- 0:02:04
      614800 -- [-1997.615] (-1983.756) (-2003.646) (-1988.756) * (-1989.276) [-1985.697] (-1994.493) (-1991.364) -- 0:02:04
      614900 -- (-1994.105) [-1982.564] (-2002.210) (-1992.735) * (-1985.120) (-1985.423) (-1991.188) [-1985.554] -- 0:02:04
      615000 -- (-1991.256) (-1987.954) (-2008.011) [-1988.363] * (-1989.477) (-1984.568) [-1985.381] (-1992.102) -- 0:02:04

      Average standard deviation of split frequencies: 0.003284

      615100 -- (-1999.140) [-1991.136] (-1997.411) (-1985.441) * (-1990.591) [-1984.122] (-1987.660) (-1997.320) -- 0:02:04
      615200 -- (-2004.836) [-1983.680] (-1994.077) (-1992.448) * (-1989.089) [-1990.855] (-1986.656) (-1994.295) -- 0:02:04
      615300 -- (-1991.844) [-1984.173] (-2002.063) (-2002.229) * [-1987.626] (-1986.789) (-1992.540) (-1988.083) -- 0:02:04
      615400 -- [-1986.734] (-1985.327) (-1996.782) (-1989.889) * (-1988.929) [-1983.284] (-2001.728) (-1995.776) -- 0:02:04
      615500 -- (-1985.626) [-1983.791] (-1998.232) (-1987.208) * (-1989.119) [-1982.893] (-1991.656) (-1997.807) -- 0:02:04
      615600 -- (-1988.916) [-1979.680] (-1990.598) (-1992.393) * (-1986.658) [-1986.091] (-1993.008) (-1989.598) -- 0:02:04
      615700 -- (-1990.403) [-1981.923] (-1990.877) (-1995.172) * (-1989.083) [-1982.203] (-1991.062) (-1993.493) -- 0:02:04
      615800 -- (-1990.570) [-1984.357] (-1990.270) (-1986.173) * (-2006.966) [-1983.403] (-1987.954) (-1996.409) -- 0:02:04
      615900 -- (-1991.125) [-1980.007] (-1984.867) (-1988.028) * (-2000.092) (-1993.509) (-1996.756) [-1999.067] -- 0:02:04
      616000 -- (-1991.125) (-1978.631) [-1991.838] (-1997.084) * [-1985.912] (-1991.363) (-1995.003) (-1995.149) -- 0:02:04

      Average standard deviation of split frequencies: 0.003301

      616100 -- (-1986.409) [-1987.069] (-1990.618) (-1996.548) * [-1986.756] (-1991.030) (-1993.486) (-1994.489) -- 0:02:04
      616200 -- (-1986.027) [-1986.382] (-1991.760) (-1985.509) * (-1995.563) (-1991.542) [-1987.071] (-2001.423) -- 0:02:04
      616300 -- (-1991.762) (-1984.323) (-1991.904) [-1988.811] * (-1990.865) (-1996.708) [-1986.288] (-1998.075) -- 0:02:04
      616400 -- (-1992.432) (-1987.704) [-1981.453] (-1989.156) * [-1989.625] (-1994.449) (-1992.730) (-1997.805) -- 0:02:04
      616500 -- (-1991.135) [-1984.755] (-1985.937) (-1996.463) * [-1988.677] (-1996.004) (-1990.931) (-1995.951) -- 0:02:04
      616600 -- (-1995.926) [-1985.107] (-1986.601) (-1993.586) * (-1993.809) (-1994.917) [-1982.106] (-1995.941) -- 0:02:04
      616700 -- (-1992.110) (-1989.166) [-1987.987] (-1996.033) * (-1993.635) (-1994.591) [-1984.815] (-1989.610) -- 0:02:04
      616800 -- (-1998.671) (-1985.594) [-1989.295] (-1991.400) * (-1990.245) (-1990.946) [-1980.859] (-1989.482) -- 0:02:04
      616900 -- (-1998.643) [-1980.599] (-1991.152) (-1989.235) * [-1991.469] (-1993.870) (-1992.934) (-1992.603) -- 0:02:04
      617000 -- (-2000.751) [-1983.659] (-1992.703) (-1996.123) * [-1987.349] (-1994.172) (-1986.812) (-1992.707) -- 0:02:04

      Average standard deviation of split frequencies: 0.003317

      617100 -- (-1992.163) [-1983.060] (-1987.820) (-2005.445) * [-1985.358] (-1995.871) (-1992.778) (-1994.971) -- 0:02:04
      617200 -- (-1995.676) (-1987.531) [-1990.349] (-2005.366) * [-1982.464] (-1993.756) (-1986.954) (-1997.290) -- 0:02:04
      617300 -- (-1994.345) [-1984.971] (-1992.521) (-1999.310) * [-1985.610] (-1995.201) (-1979.364) (-2006.778) -- 0:02:03
      617400 -- (-1986.924) [-1983.784] (-1997.174) (-2009.039) * (-1979.537) (-1989.200) [-1984.430] (-2007.467) -- 0:02:03
      617500 -- (-1988.720) (-1978.508) [-1992.727] (-1997.494) * (-1986.408) [-1983.136] (-1986.614) (-2008.710) -- 0:02:03
      617600 -- [-1982.767] (-1978.253) (-2000.217) (-1994.911) * [-1988.629] (-1983.007) (-1989.880) (-2007.202) -- 0:02:03
      617700 -- (-1985.256) [-1981.874] (-2007.325) (-1997.872) * (-1990.494) (-1994.494) (-1986.181) [-1994.479] -- 0:02:03
      617800 -- (-1989.609) (-1982.388) (-2017.243) [-1993.623] * (-1991.630) (-1997.661) [-1983.053] (-1992.231) -- 0:02:03
      617900 -- (-1992.677) [-1986.913] (-2004.065) (-2000.519) * (-1994.700) (-1995.026) [-1980.846] (-1992.590) -- 0:02:03
      618000 -- (-1990.176) [-1989.846] (-1998.820) (-1996.661) * (-1984.746) (-1992.469) [-1981.475] (-1993.593) -- 0:02:03

      Average standard deviation of split frequencies: 0.003312

      618100 -- (-1995.489) [-1980.899] (-2001.493) (-2002.282) * (-1984.209) [-1986.171] (-1982.168) (-1997.078) -- 0:02:03
      618200 -- (-1993.457) [-1987.833] (-1995.458) (-1995.838) * (-1989.353) [-1987.846] (-1986.725) (-1989.461) -- 0:02:03
      618300 -- (-1989.648) [-1980.058] (-1999.626) (-2003.400) * (-1994.524) [-1988.375] (-1990.922) (-1993.071) -- 0:02:03
      618400 -- (-1995.659) [-1986.239] (-1991.066) (-1999.742) * [-1991.166] (-1994.935) (-1997.916) (-2010.253) -- 0:02:03
      618500 -- (-1995.279) [-1981.439] (-1991.560) (-1998.338) * (-1987.910) [-1990.875] (-1991.839) (-2002.846) -- 0:02:03
      618600 -- (-1993.600) [-1984.185] (-1990.602) (-1993.057) * [-1990.952] (-1983.817) (-1989.415) (-1995.234) -- 0:02:03
      618700 -- [-1989.880] (-1988.900) (-2001.924) (-1988.178) * (-1989.825) [-1986.423] (-1992.161) (-1992.968) -- 0:02:03
      618800 -- (-1990.542) [-1985.804] (-2000.645) (-1991.934) * (-1992.167) [-1984.937] (-1988.243) (-2000.677) -- 0:02:03
      618900 -- [-1992.506] (-1991.445) (-2002.145) (-2010.731) * (-1994.203) [-1987.891] (-1991.782) (-1994.407) -- 0:02:03
      619000 -- [-1990.662] (-1990.672) (-1994.927) (-2004.727) * (-1989.887) (-2000.802) (-1991.301) [-1995.244] -- 0:02:03

      Average standard deviation of split frequencies: 0.003350

      619100 -- [-1986.970] (-1987.811) (-1991.788) (-2004.084) * (-1985.959) (-2003.144) [-1986.426] (-2006.068) -- 0:02:03
      619200 -- (-1997.535) (-1985.183) [-1986.258] (-2001.951) * [-1984.782] (-2002.877) (-1981.802) (-2008.245) -- 0:02:03
      619300 -- (-1996.679) [-1978.774] (-1986.270) (-2000.866) * (-1982.674) (-2000.606) [-1979.989] (-2001.515) -- 0:02:03
      619400 -- (-1989.000) [-1981.280] (-1990.355) (-2002.101) * (-1982.291) (-2004.362) [-1987.037] (-2007.405) -- 0:02:03
      619500 -- (-1986.292) [-1978.712] (-1990.646) (-1997.812) * (-1987.223) (-1996.687) [-1989.059] (-1999.216) -- 0:02:03
      619600 -- (-1990.869) [-1979.237] (-1991.618) (-1995.804) * [-1984.935] (-1994.757) (-1983.757) (-2003.623) -- 0:02:03
      619700 -- (-1988.999) [-1982.024] (-1986.148) (-2004.779) * [-1980.947] (-1995.444) (-1987.395) (-1994.287) -- 0:02:03
      619800 -- (-1997.917) (-1986.250) [-1979.040] (-2004.621) * [-1984.271] (-1996.434) (-1982.842) (-1994.451) -- 0:02:03
      619900 -- (-2002.658) (-1989.823) [-1981.935] (-2011.264) * [-1985.524] (-1999.312) (-1979.563) (-2001.138) -- 0:02:03
      620000 -- (-1997.441) (-1988.747) [-1987.851] (-2008.592) * (-1985.980) (-1998.786) [-1978.518] (-1999.860) -- 0:02:03

      Average standard deviation of split frequencies: 0.003214

      620100 -- (-1996.917) (-1989.445) [-1983.128] (-1999.541) * [-1985.850] (-1995.940) (-1987.119) (-1999.816) -- 0:02:03
      620200 -- (-1997.272) (-1988.552) [-1988.499] (-1991.204) * (-1991.470) (-1996.826) [-1980.857] (-2000.551) -- 0:02:03
      620300 -- (-2005.799) [-1990.308] (-1988.658) (-1995.563) * [-1992.893] (-1994.520) (-1980.128) (-2009.035) -- 0:02:03
      620400 -- (-2004.529) (-1989.633) (-1988.698) [-1993.358] * (-1990.668) (-1999.888) [-1981.680] (-2013.615) -- 0:02:02
      620500 -- (-1997.294) [-1985.286] (-1990.938) (-1988.622) * [-1989.265] (-1997.126) (-1987.423) (-2001.315) -- 0:02:02
      620600 -- [-1993.573] (-1987.965) (-1992.230) (-1992.756) * (-1989.996) (-1994.075) [-1982.492] (-2007.115) -- 0:02:02
      620700 -- (-1990.317) [-1983.806] (-1985.176) (-2000.552) * [-1987.961] (-1994.688) (-1994.279) (-2007.865) -- 0:02:02
      620800 -- [-1996.538] (-1988.805) (-1989.491) (-1994.327) * (-1985.656) (-1994.741) [-1987.089] (-2004.552) -- 0:02:02
      620900 -- (-1995.592) (-1987.774) (-2000.946) [-1992.642] * [-1984.044] (-1994.815) (-1985.324) (-2006.030) -- 0:02:02
      621000 -- (-1993.174) [-1981.780] (-1997.363) (-1990.738) * (-1983.823) [-1991.520] (-1989.958) (-2010.652) -- 0:02:02

      Average standard deviation of split frequencies: 0.003166

      621100 -- (-1993.084) (-1986.896) (-2002.900) [-1988.986] * (-1991.286) (-1996.731) [-1984.217] (-2011.096) -- 0:02:02
      621200 -- (-1993.615) (-1983.447) (-2010.171) [-1986.827] * [-1985.301] (-1988.357) (-1985.840) (-2003.235) -- 0:02:02
      621300 -- [-1994.747] (-1985.362) (-2004.997) (-1992.667) * (-1984.980) (-1997.729) (-1991.014) [-1995.685] -- 0:02:02
      621400 -- [-1988.683] (-1986.380) (-2004.350) (-1998.566) * [-1989.133] (-2002.029) (-1988.079) (-1994.708) -- 0:02:02
      621500 -- [-1989.360] (-1992.121) (-1999.322) (-1999.703) * [-1987.121] (-2015.776) (-1983.002) (-2000.443) -- 0:02:02
      621600 -- [-1996.140] (-1990.263) (-2003.078) (-2005.513) * (-1990.011) (-2014.872) [-1986.837] (-2007.607) -- 0:02:02
      621700 -- (-1989.014) [-1988.689] (-1998.545) (-2006.229) * (-1992.543) (-1999.586) [-1986.274] (-1997.783) -- 0:02:02
      621800 -- [-1987.500] (-1985.328) (-1992.125) (-2015.129) * (-1984.294) (-1988.760) [-1981.495] (-1998.280) -- 0:02:02
      621900 -- [-1988.640] (-1998.246) (-1991.930) (-2008.882) * (-1982.369) (-1995.177) [-1989.312] (-1994.601) -- 0:02:02
      622000 -- (-1990.858) [-1993.144] (-1999.851) (-2002.732) * (-1982.161) [-1987.508] (-1980.205) (-1998.896) -- 0:02:02

      Average standard deviation of split frequencies: 0.003161

      622100 -- [-1991.415] (-1995.246) (-2002.957) (-2001.787) * (-1980.736) (-1989.973) [-1980.426] (-1998.512) -- 0:02:02
      622200 -- [-1986.831] (-1991.940) (-1995.932) (-1998.856) * (-1991.936) (-1999.470) [-1980.989] (-1992.577) -- 0:02:02
      622300 -- [-1989.206] (-1983.617) (-1996.225) (-2003.808) * (-1986.589) (-1993.928) [-1982.482] (-1992.045) -- 0:02:02
      622400 -- (-1988.473) (-1983.798) [-1984.422] (-2008.648) * [-1983.082] (-1988.667) (-1983.528) (-1994.149) -- 0:02:02
      622500 -- (-1995.912) (-1983.478) [-1982.302] (-1997.317) * (-1985.459) [-1988.635] (-1992.598) (-1989.860) -- 0:02:02
      622600 -- (-1995.743) (-1985.358) [-1986.795] (-1998.911) * [-1983.605] (-1988.768) (-1989.277) (-1999.462) -- 0:02:02
      622700 -- (-1995.468) (-1985.252) [-1986.057] (-1997.186) * [-1979.581] (-1989.169) (-1990.819) (-1999.535) -- 0:02:02
      622800 -- (-2003.332) [-1979.474] (-1985.532) (-1997.185) * (-1984.443) (-1994.577) (-1992.997) [-1994.787] -- 0:02:02
      622900 -- (-1993.073) (-1977.303) [-1984.197] (-2002.288) * (-1986.462) (-1995.639) [-1993.767] (-2000.383) -- 0:02:02
      623000 -- (-2002.933) (-1980.210) [-1979.828] (-1999.054) * (-1992.056) (-1985.923) [-1991.815] (-1997.177) -- 0:02:02

      Average standard deviation of split frequencies: 0.003091

      623100 -- (-1994.046) [-1981.100] (-1980.294) (-1998.262) * (-1987.807) [-1985.493] (-1990.977) (-1996.333) -- 0:02:02
      623200 -- (-1987.146) [-1985.242] (-1983.447) (-1994.681) * (-1986.316) (-1983.507) [-1986.990] (-2005.275) -- 0:02:02
      623300 -- (-1993.553) [-1983.724] (-1981.733) (-1997.984) * (-1991.157) [-1990.727] (-1993.481) (-1992.337) -- 0:02:02
      623400 -- (-1994.118) [-1980.884] (-1983.343) (-1996.351) * [-1982.692] (-1985.715) (-1998.271) (-1995.316) -- 0:02:02
      623500 -- (-1994.925) (-1983.257) [-1983.362] (-1993.485) * [-1984.708] (-1997.039) (-1988.696) (-1997.654) -- 0:02:01
      623600 -- (-1999.240) (-1986.002) [-1984.370] (-1998.289) * [-1979.615] (-1992.955) (-1987.445) (-1998.859) -- 0:02:01
      623700 -- (-1999.084) [-1983.694] (-1981.743) (-1989.081) * (-1987.562) [-1991.512] (-1993.808) (-1992.882) -- 0:02:01
      623800 -- (-1993.934) (-1982.902) [-1981.764] (-1991.178) * [-1984.174] (-1989.408) (-1987.123) (-1997.834) -- 0:02:01
      623900 -- [-1993.283] (-1981.101) (-1980.604) (-1992.588) * (-1983.662) (-1993.006) [-1982.778] (-1995.339) -- 0:02:01
      624000 -- (-1991.619) (-1985.820) [-1983.954] (-1993.814) * [-1988.011] (-1996.065) (-1984.498) (-1991.815) -- 0:02:01

      Average standard deviation of split frequencies: 0.003172

      624100 -- (-1990.163) (-1999.438) [-1982.677] (-1998.029) * (-1988.969) (-1995.202) [-1992.951] (-1991.490) -- 0:02:01
      624200 -- (-1999.635) (-1991.386) [-1983.279] (-1989.689) * (-1994.794) (-1993.005) (-1998.965) [-1986.326] -- 0:02:01
      624300 -- (-2009.941) (-1982.045) [-1983.636] (-2001.020) * (-1997.140) (-1988.290) [-1986.611] (-1993.258) -- 0:02:01
      624400 -- (-1997.192) [-1983.333] (-1983.541) (-1991.941) * (-2000.850) [-1988.061] (-1997.758) (-1990.477) -- 0:02:01
      624500 -- (-2013.948) [-1993.357] (-1990.604) (-1991.051) * [-1982.397] (-1984.216) (-2003.076) (-1995.501) -- 0:02:01
      624600 -- (-2011.378) (-1998.924) (-1992.951) [-1997.788] * [-1981.910] (-1983.224) (-2012.516) (-1990.796) -- 0:02:01
      624700 -- (-2011.574) [-1994.121] (-1988.397) (-1992.359) * [-1981.170] (-1986.413) (-1995.900) (-1992.117) -- 0:02:01
      624800 -- (-2012.798) (-1983.376) [-1986.650] (-1988.581) * (-1982.519) [-1987.978] (-1999.317) (-1993.813) -- 0:02:01
      624900 -- (-2005.573) (-1982.420) [-1981.027] (-1996.161) * (-1984.129) [-1986.043] (-1996.233) (-1992.361) -- 0:02:01
      625000 -- (-1999.846) [-1981.636] (-1982.170) (-1992.063) * (-1981.878) [-1987.290] (-1994.616) (-1991.686) -- 0:02:01

      Average standard deviation of split frequencies: 0.003038

      625100 -- (-2006.915) (-1988.262) [-1979.591] (-1987.029) * [-1978.999] (-1987.891) (-1995.062) (-1992.494) -- 0:02:01
      625200 -- (-2019.638) (-1985.669) [-1982.607] (-1986.713) * [-1980.738] (-1988.793) (-1995.044) (-1996.397) -- 0:02:01
      625300 -- (-2016.088) [-1985.494] (-1991.555) (-1991.200) * (-1986.669) (-1996.442) [-1981.450] (-1989.501) -- 0:02:01
      625400 -- (-2008.366) (-1982.776) (-1994.755) [-1984.836] * (-1991.093) (-1996.039) [-1979.879] (-1988.266) -- 0:02:01
      625500 -- (-2008.712) (-1982.158) [-1994.475] (-1991.736) * (-1985.038) (-1989.134) [-1980.418] (-1991.430) -- 0:02:01
      625600 -- (-2005.659) [-1983.606] (-1991.281) (-1991.887) * (-1985.824) (-1999.077) [-1980.581] (-1992.962) -- 0:02:01
      625700 -- (-2005.912) (-1986.093) (-1992.420) [-1988.112] * [-1986.543] (-2001.810) (-1989.800) (-1998.508) -- 0:02:01
      625800 -- (-2009.280) [-1983.865] (-1991.183) (-1990.349) * [-1993.394] (-1993.212) (-1993.758) (-1998.378) -- 0:02:01
      625900 -- (-1994.539) [-1984.172] (-2001.798) (-1996.611) * (-1993.768) (-1992.671) [-1992.726] (-1994.320) -- 0:02:01
      626000 -- (-1992.132) [-1985.592] (-1997.065) (-1996.284) * [-1987.246] (-1991.588) (-1990.771) (-1994.921) -- 0:02:01

      Average standard deviation of split frequencies: 0.003012

      626100 -- [-1991.587] (-1990.856) (-2004.529) (-2000.459) * [-1983.650] (-1989.973) (-1991.004) (-1993.818) -- 0:02:01
      626200 -- (-1992.182) (-1982.169) (-1995.041) [-1996.375] * (-1990.162) [-1991.293] (-2009.849) (-1991.939) -- 0:02:01
      626300 -- (-1992.746) [-1981.811] (-2002.813) (-1991.299) * [-1990.167] (-1994.764) (-1996.015) (-1992.344) -- 0:02:01
      626400 -- (-1992.028) [-1981.325] (-2003.520) (-1989.596) * [-1987.339] (-1998.534) (-2000.843) (-1996.432) -- 0:02:01
      626500 -- (-1993.903) [-1978.054] (-2003.153) (-1993.675) * [-1987.333] (-1999.839) (-1991.265) (-1991.898) -- 0:02:01
      626600 -- (-1990.099) [-1981.910] (-1997.461) (-2006.569) * [-1988.245] (-1991.279) (-1995.305) (-1997.351) -- 0:02:00
      626700 -- [-1997.447] (-1984.670) (-2005.199) (-2009.945) * [-1988.565] (-1990.900) (-1996.216) (-1993.319) -- 0:02:00
      626800 -- (-1997.382) (-1983.191) [-1992.867] (-1992.678) * [-1986.995] (-1993.397) (-1992.857) (-1992.005) -- 0:02:00
      626900 -- [-1995.213] (-1980.591) (-1989.284) (-1991.169) * (-1992.994) (-1992.448) [-1986.298] (-1993.666) -- 0:02:00
      627000 -- (-1998.155) [-1981.779] (-1994.108) (-1994.679) * (-1994.153) (-1992.054) [-1984.449] (-1999.087) -- 0:02:00

      Average standard deviation of split frequencies: 0.002963

      627100 -- (-2002.444) [-1979.862] (-1995.178) (-1991.976) * (-2001.422) (-1996.153) [-1989.721] (-2000.401) -- 0:02:00
      627200 -- (-2004.172) [-1981.618] (-1999.009) (-1985.640) * (-1998.556) (-1993.716) [-1988.508] (-2002.651) -- 0:02:00
      627300 -- (-2003.496) [-1985.359] (-2000.279) (-1986.962) * (-2005.317) (-1995.517) [-1987.673] (-2004.059) -- 0:02:00
      627400 -- (-2012.767) (-1987.961) (-1999.797) [-1985.267] * (-2006.013) (-1995.026) [-1983.889] (-1999.093) -- 0:02:00
      627500 -- (-2014.213) [-1989.240] (-1992.538) (-1990.153) * (-2003.688) (-1993.344) [-1982.372] (-1989.018) -- 0:02:00
      627600 -- (-2011.294) (-1987.719) (-1999.019) [-1990.062] * (-2006.944) (-1989.288) [-1983.597] (-1986.711) -- 0:02:00
      627700 -- (-2007.370) (-1983.472) [-1990.678] (-1988.086) * (-2007.908) (-1986.243) [-1984.830] (-1986.284) -- 0:02:00
      627800 -- (-2002.361) (-1987.788) [-1985.323] (-1990.052) * (-2005.783) (-1989.248) (-1985.673) [-1985.242] -- 0:02:00
      627900 -- (-1999.058) (-1989.824) [-1985.930] (-1988.492) * (-2001.019) (-2004.204) [-1980.689] (-1986.843) -- 0:02:00
      628000 -- (-2000.335) (-1989.498) (-1986.419) [-1993.357] * (-1996.448) (-1999.503) [-1985.844] (-1992.599) -- 0:02:00

      Average standard deviation of split frequencies: 0.002938

      628100 -- (-1990.475) (-1989.655) [-1983.470] (-1994.493) * (-1998.231) [-1987.938] (-1991.984) (-2002.066) -- 0:02:00
      628200 -- [-1991.391] (-1987.302) (-1989.890) (-1991.039) * (-1992.328) (-1994.235) [-1982.391] (-1998.177) -- 0:02:00
      628300 -- (-1997.206) (-1986.321) [-1986.996] (-1991.517) * [-1988.978] (-1992.716) (-1981.756) (-1995.421) -- 0:02:00
      628400 -- (-1994.726) (-1987.446) (-2003.202) [-1985.251] * [-1993.847] (-1990.891) (-1984.023) (-1987.411) -- 0:02:00
      628500 -- [-1994.259] (-1991.046) (-1992.670) (-1985.062) * (-1990.965) (-2002.326) [-1985.753] (-1992.338) -- 0:02:00
      628600 -- (-2009.492) [-1986.178] (-1990.616) (-1986.000) * [-1981.979] (-1989.367) (-1983.016) (-2001.314) -- 0:02:00
      628700 -- (-1994.946) [-1980.644] (-1998.154) (-1990.025) * (-1982.293) (-1987.579) [-1984.671] (-2007.897) -- 0:02:00
      628800 -- (-1997.183) (-1981.634) (-1995.630) [-1990.898] * [-1982.474] (-1990.270) (-1983.814) (-1994.128) -- 0:02:00
      628900 -- (-1992.007) [-1981.656] (-1991.760) (-1988.555) * (-1983.525) (-1990.146) [-1984.793] (-1990.889) -- 0:02:00
      629000 -- (-1994.879) [-1983.471] (-2002.698) (-1992.173) * (-1990.960) (-1988.890) [-1981.128] (-1989.684) -- 0:02:00

      Average standard deviation of split frequencies: 0.002804

      629100 -- (-1986.889) (-1992.619) [-1997.074] (-1995.776) * [-1986.920] (-1995.085) (-1983.496) (-1990.132) -- 0:02:00
      629200 -- (-1994.567) [-1986.334] (-1997.056) (-1997.845) * (-1996.435) (-1995.187) (-1986.251) [-1991.483] -- 0:02:00
      629300 -- (-1989.225) [-1985.341] (-1996.944) (-1998.443) * (-2007.489) (-1990.762) [-1984.375] (-1995.058) -- 0:02:00
      629400 -- [-1987.321] (-1986.362) (-2000.422) (-2002.864) * (-2001.560) (-1992.610) [-1986.791] (-2000.893) -- 0:02:00
      629500 -- [-1990.346] (-1985.836) (-1996.692) (-2003.147) * (-2007.122) (-2000.549) [-1985.529] (-1994.241) -- 0:02:00
      629600 -- (-1997.186) [-1986.235] (-1993.962) (-1998.628) * (-2007.376) (-1998.164) (-1986.713) [-1995.817] -- 0:02:00
      629700 -- [-1993.208] (-1989.950) (-1994.855) (-2002.837) * (-2002.720) (-1997.971) [-1987.121] (-1989.917) -- 0:01:59
      629800 -- (-1992.294) [-1986.257] (-1997.099) (-1999.164) * (-2002.650) (-1996.091) (-1992.483) [-1991.673] -- 0:01:59
      629900 -- (-1985.128) [-1985.386] (-1989.417) (-1993.680) * (-2009.333) (-1997.991) [-1991.293] (-1990.875) -- 0:01:59
      630000 -- (-1995.934) [-1986.793] (-1995.920) (-2000.467) * (-2010.129) [-1988.360] (-1997.750) (-1987.854) -- 0:01:59

      Average standard deviation of split frequencies: 0.002821

      630100 -- [-1985.267] (-1988.863) (-1995.982) (-1998.256) * (-2004.627) (-1989.927) (-2009.338) [-1993.415] -- 0:01:59
      630200 -- (-1985.200) [-1987.852] (-1992.117) (-1995.979) * (-2001.056) [-1986.686] (-1997.699) (-1992.575) -- 0:01:59
      630300 -- (-1984.744) [-1991.079] (-1991.958) (-1998.873) * (-1997.220) (-1994.740) [-1988.987] (-1990.093) -- 0:01:59
      630400 -- (-1993.844) [-1980.111] (-1988.918) (-1991.904) * (-1991.477) [-1991.048] (-1983.704) (-1991.448) -- 0:01:59
      630500 -- (-1995.611) [-1978.706] (-1992.415) (-1994.386) * (-1989.636) (-2003.707) (-1984.444) [-1986.261] -- 0:01:59
      630600 -- (-1987.454) [-1980.453] (-1989.249) (-1995.806) * (-1986.953) (-1996.379) [-1981.796] (-1991.736) -- 0:01:59
      630700 -- (-1991.326) [-1986.749] (-1985.023) (-1999.999) * (-1986.796) [-1991.248] (-1986.205) (-1990.220) -- 0:01:59
      630800 -- (-1989.225) [-1991.110] (-1987.315) (-2004.770) * [-1983.636] (-1996.059) (-1992.350) (-1986.582) -- 0:01:59
      630900 -- (-1985.584) (-1995.933) [-1979.818] (-2000.040) * [-1985.873] (-2003.454) (-1990.051) (-1997.925) -- 0:01:59
      631000 -- (-1987.911) (-1993.148) [-1980.488] (-1997.749) * [-1984.413] (-2001.306) (-1992.279) (-1993.571) -- 0:01:59

      Average standard deviation of split frequencies: 0.002838

      631100 -- (-1989.151) (-1991.846) [-1984.911] (-2006.304) * (-1991.989) (-1996.789) (-1985.014) [-1986.253] -- 0:01:59
      631200 -- (-1989.869) [-1990.755] (-1990.023) (-1999.701) * (-1993.116) (-1998.600) (-1986.074) [-1985.087] -- 0:01:59
      631300 -- (-1989.801) (-1989.308) (-1990.460) [-1987.808] * (-1991.858) (-2003.295) (-1991.669) [-1990.494] -- 0:01:59
      631400 -- (-1991.302) [-1987.755] (-1987.009) (-1991.466) * [-1992.399] (-2004.009) (-1997.057) (-1990.628) -- 0:01:59
      631500 -- (-1989.526) (-1984.583) (-1983.978) [-1985.847] * (-1998.380) (-1997.790) (-1998.610) [-1998.648] -- 0:01:59
      631600 -- (-1993.805) [-1986.801] (-1983.680) (-1987.889) * [-1991.382] (-1997.406) (-1997.451) (-1987.023) -- 0:01:59
      631700 -- (-1994.479) [-1984.941] (-1982.879) (-1996.768) * (-1988.486) [-1992.102] (-2006.907) (-1993.626) -- 0:01:59
      631800 -- (-1988.919) [-1991.772] (-1985.579) (-1989.724) * (-1989.835) [-1987.519] (-1986.082) (-1996.835) -- 0:01:59
      631900 -- (-1998.480) [-1985.256] (-1983.504) (-1983.622) * (-1993.745) (-1986.862) [-1984.664] (-1995.730) -- 0:01:59
      632000 -- (-2001.102) [-1986.043] (-1982.371) (-1987.683) * (-1995.336) [-1986.490] (-1993.045) (-1995.941) -- 0:01:59

      Average standard deviation of split frequencies: 0.002919

      632100 -- (-2001.782) [-1981.580] (-1986.881) (-1992.499) * (-1987.606) (-1987.187) [-1989.095] (-1993.464) -- 0:01:59
      632200 -- (-1995.064) [-1989.846] (-1982.749) (-2002.989) * [-1984.656] (-1996.371) (-1990.284) (-1997.133) -- 0:01:59
      632300 -- (-1995.451) (-1984.360) [-1984.812] (-1999.240) * (-1990.906) (-1990.893) [-1981.594] (-1993.503) -- 0:01:59
      632400 -- (-1997.298) (-1986.927) [-1984.291] (-1998.166) * (-1990.764) [-1988.090] (-1987.838) (-1994.964) -- 0:01:59
      632500 -- (-1991.185) [-1982.069] (-1986.300) (-1996.049) * (-1998.061) (-1987.388) [-1986.819] (-1993.797) -- 0:01:59
      632600 -- (-1997.614) [-1984.347] (-1987.804) (-2007.939) * (-1997.889) (-1992.039) (-1989.847) [-1993.047] -- 0:01:59
      632700 -- (-1998.089) (-1982.599) [-1990.689] (-2005.072) * (-1992.274) [-1992.252] (-1990.783) (-2000.619) -- 0:01:59
      632800 -- (-1997.801) [-1986.766] (-1998.632) (-1993.942) * (-1986.468) [-1989.553] (-1996.252) (-1998.236) -- 0:01:58
      632900 -- (-2001.991) (-1989.313) [-1993.609] (-1992.842) * [-1983.541] (-1986.951) (-1994.258) (-1993.738) -- 0:01:58
      633000 -- (-2002.940) [-1984.029] (-1990.716) (-1996.434) * [-1983.916] (-1986.768) (-1989.911) (-1993.116) -- 0:01:58

      Average standard deviation of split frequencies: 0.002957

      633100 -- (-1994.879) [-1983.347] (-1990.207) (-1991.546) * [-1982.645] (-1987.634) (-1987.917) (-1990.959) -- 0:01:58
      633200 -- (-2000.289) [-1984.657] (-1987.462) (-1990.665) * [-1981.494] (-2000.751) (-1987.574) (-1996.766) -- 0:01:58
      633300 -- (-1991.872) [-1983.954] (-1992.683) (-1989.865) * [-1983.439] (-1985.673) (-1990.120) (-1997.362) -- 0:01:58
      633400 -- [-1990.104] (-1983.793) (-1989.192) (-1995.017) * [-1986.371] (-1983.295) (-1989.248) (-1986.708) -- 0:01:58
      633500 -- (-1993.200) [-1989.422] (-1989.488) (-1999.496) * (-1985.865) (-1984.988) (-1992.103) [-1991.263] -- 0:01:58
      633600 -- (-1989.608) (-1993.142) [-1978.806] (-1996.690) * [-1980.260] (-1986.079) (-1994.663) (-1991.987) -- 0:01:58
      633700 -- (-1995.233) (-1991.871) (-1979.088) [-1993.454] * [-1982.793] (-1992.865) (-1983.625) (-1998.942) -- 0:01:58
      633800 -- (-1998.738) (-1985.922) [-1980.911] (-2001.122) * [-1987.381] (-1999.503) (-1977.070) (-2002.116) -- 0:01:58
      633900 -- (-1997.908) (-1995.205) (-1991.600) [-1989.817] * (-1991.909) (-1999.953) [-1978.994] (-1992.945) -- 0:01:58
      634000 -- (-2002.322) (-1994.725) (-1996.482) [-1988.158] * (-1984.381) (-1997.366) [-1978.392] (-1997.000) -- 0:01:58

      Average standard deviation of split frequencies: 0.002995

      634100 -- (-1994.642) [-1994.226] (-2002.466) (-1995.542) * (-1982.935) [-1989.300] (-1981.727) (-2013.947) -- 0:01:58
      634200 -- [-1996.572] (-1997.502) (-2000.164) (-1996.213) * (-1982.277) (-1989.244) [-1986.336] (-1997.854) -- 0:01:58
      634300 -- (-1996.688) (-2002.436) [-1996.333] (-1992.182) * [-1983.036] (-1997.074) (-1985.229) (-2005.192) -- 0:01:58
      634400 -- [-1988.568] (-1995.449) (-1994.424) (-1999.927) * [-1977.994] (-1988.754) (-1987.020) (-1990.096) -- 0:01:58
      634500 -- [-1985.121] (-1997.048) (-2012.295) (-1994.716) * [-1980.714] (-1991.122) (-1988.236) (-1987.156) -- 0:01:58
      634600 -- [-1984.447] (-1992.503) (-2006.662) (-1999.312) * [-1979.942] (-1989.138) (-1986.065) (-1989.774) -- 0:01:58
      634700 -- (-1993.561) [-1990.088] (-1999.405) (-1992.747) * [-1980.825] (-1992.479) (-1990.440) (-1987.915) -- 0:01:58
      634800 -- (-1991.560) [-1990.516] (-2006.827) (-2005.296) * (-1981.220) (-1999.527) (-1998.082) [-1991.573] -- 0:01:58
      634900 -- (-1994.015) [-1989.189] (-2003.743) (-2006.687) * (-1978.849) (-1996.815) (-2009.971) [-1987.810] -- 0:01:58
      635000 -- (-2000.825) [-1991.422] (-2004.462) (-1999.184) * (-1987.853) (-1989.063) (-1988.764) [-1986.722] -- 0:01:58

      Average standard deviation of split frequencies: 0.002820

      635100 -- (-1995.014) [-1988.014] (-1998.792) (-1999.297) * (-1989.907) (-1993.470) [-1987.953] (-1985.419) -- 0:01:58
      635200 -- (-1999.617) [-1985.483] (-1998.070) (-1991.345) * (-1982.687) (-1999.006) (-1989.055) [-1984.272] -- 0:01:58
      635300 -- (-2000.696) (-1985.958) (-1995.921) [-1995.147] * (-1982.557) (-1997.644) [-1983.183] (-1992.680) -- 0:01:58
      635400 -- (-1994.772) [-1987.954] (-2002.874) (-2006.375) * (-1984.358) (-1995.344) [-1984.401] (-1997.256) -- 0:01:58
      635500 -- (-1995.258) [-1987.332] (-1999.758) (-2006.406) * [-1987.545] (-1992.888) (-1986.219) (-2006.033) -- 0:01:58
      635600 -- (-1991.034) [-1987.699] (-2003.858) (-2004.197) * (-1987.231) (-1994.960) [-1987.398] (-2001.918) -- 0:01:58
      635700 -- (-1989.370) [-1983.333] (-1990.300) (-2003.658) * (-1986.317) (-1991.728) [-1985.748] (-1998.530) -- 0:01:58
      635800 -- (-1991.595) [-1985.205] (-1994.286) (-1995.432) * [-1992.500] (-1991.256) (-1978.637) (-2007.165) -- 0:01:58
      635900 -- (-1989.547) [-1984.981] (-2000.816) (-2002.876) * [-1984.052] (-1993.538) (-1979.731) (-2005.989) -- 0:01:57
      636000 -- [-1986.480] (-1993.459) (-1996.834) (-2000.681) * (-1988.198) [-1992.621] (-1980.511) (-1995.605) -- 0:01:57

      Average standard deviation of split frequencies: 0.002795

      636100 -- (-1988.190) (-1991.048) [-1989.259] (-1992.050) * (-1998.302) (-1991.365) [-1983.103] (-2000.504) -- 0:01:57
      636200 -- [-1988.200] (-1993.558) (-1983.327) (-1996.592) * (-1992.886) (-1994.926) [-1983.543] (-1995.529) -- 0:01:57
      636300 -- [-1989.321] (-1999.061) (-1984.561) (-1997.341) * (-1988.866) (-1995.749) [-1986.808] (-1997.428) -- 0:01:57
      636400 -- (-1987.602) (-1999.951) [-1987.688] (-1993.820) * [-1984.771] (-1997.159) (-1992.253) (-1990.406) -- 0:01:57
      636500 -- (-1993.383) (-2005.575) [-1988.242] (-1987.078) * [-1977.451] (-1995.298) (-1996.435) (-1989.069) -- 0:01:57
      636600 -- (-1988.817) (-1992.605) [-1991.791] (-1985.342) * (-1978.232) (-1988.097) [-1984.440] (-1988.424) -- 0:01:57
      636700 -- (-1994.594) (-1987.965) (-1986.018) [-1987.932] * [-1978.564] (-1993.742) (-1992.759) (-1984.838) -- 0:01:57
      636800 -- (-1993.423) (-1994.952) (-1989.722) [-1986.141] * [-1981.554] (-2000.741) (-1988.108) (-1988.384) -- 0:01:57
      636900 -- (-1995.604) (-1995.855) (-1991.641) [-1991.408] * [-1981.795] (-1998.819) (-1987.244) (-1988.898) -- 0:01:57
      637000 -- [-1990.587] (-1992.458) (-1986.838) (-1997.450) * [-1982.470] (-1990.646) (-1991.070) (-1991.533) -- 0:01:57

      Average standard deviation of split frequencies: 0.002790

      637100 -- [-1989.063] (-1994.894) (-1989.169) (-1999.622) * [-1985.342] (-1989.457) (-1993.062) (-1997.215) -- 0:01:57
      637200 -- (-1984.321) (-2001.118) [-1983.474] (-1997.751) * [-1982.642] (-1990.428) (-1992.165) (-1998.708) -- 0:01:57
      637300 -- [-1986.853] (-2004.275) (-1984.897) (-1989.339) * (-1988.921) [-1989.734] (-1991.668) (-1993.532) -- 0:01:57
      637400 -- [-1988.327] (-1993.085) (-1993.759) (-1993.670) * (-1991.437) [-1996.532] (-1999.079) (-1992.818) -- 0:01:57
      637500 -- (-2004.041) (-1994.175) [-1990.279] (-1989.653) * (-1984.565) (-2002.100) [-1990.737] (-1989.061) -- 0:01:57
      637600 -- (-2000.846) (-1998.123) (-1993.609) [-1988.989] * [-1983.573] (-1998.910) (-1997.081) (-1992.342) -- 0:01:57
      637700 -- (-1998.446) (-1990.570) (-1990.575) [-1987.901] * [-1979.691] (-2000.193) (-1985.366) (-1992.059) -- 0:01:57
      637800 -- (-1995.822) (-1995.172) (-1993.612) [-1989.824] * [-1981.904] (-2009.981) (-1985.438) (-1994.501) -- 0:01:57
      637900 -- (-1997.140) (-2000.539) (-1988.049) [-1986.869] * (-1990.899) (-1995.931) [-1983.475] (-1992.996) -- 0:01:57
      638000 -- (-2004.932) (-1995.064) [-1991.233] (-1992.767) * [-1990.290] (-1989.514) (-1989.892) (-1985.548) -- 0:01:57

      Average standard deviation of split frequencies: 0.002681

      638100 -- (-2003.189) (-1991.470) (-1987.212) [-1986.929] * [-1985.139] (-1992.625) (-1990.200) (-1991.982) -- 0:01:57
      638200 -- (-2007.700) (-1988.856) (-1992.049) [-1991.095] * [-1982.468] (-1991.238) (-1993.199) (-1993.849) -- 0:01:57
      638300 -- (-1998.777) (-1991.627) (-1992.087) [-1987.294] * [-1981.645] (-1997.426) (-1984.337) (-2000.528) -- 0:01:57
      638400 -- (-2000.624) [-1985.563] (-2002.941) (-1988.374) * [-1982.899] (-2007.683) (-1982.440) (-1997.240) -- 0:01:57
      638500 -- (-1998.680) [-1986.056] (-1991.408) (-1986.749) * (-1981.966) (-1999.911) [-1985.022] (-2003.275) -- 0:01:57
      638600 -- (-1990.560) [-1985.792] (-1993.425) (-1994.239) * (-1984.247) (-1996.607) [-1985.607] (-2005.722) -- 0:01:57
      638700 -- (-1992.409) (-1989.450) [-1991.386] (-1988.879) * (-1992.184) (-1992.645) [-1982.399] (-2010.894) -- 0:01:57
      638800 -- (-2000.339) (-1988.513) [-1986.421] (-1992.681) * (-1987.781) (-1990.898) [-1986.113] (-1990.734) -- 0:01:57
      638900 -- (-2000.194) (-1983.990) [-1981.081] (-1986.659) * [-1985.037] (-1989.547) (-1988.400) (-1991.289) -- 0:01:56
      639000 -- (-1998.647) [-1987.012] (-1981.558) (-1986.428) * (-1985.835) (-1989.147) [-1982.572] (-1998.256) -- 0:01:56

      Average standard deviation of split frequencies: 0.002550

      639100 -- (-1999.640) (-1994.043) [-1977.164] (-1987.560) * [-1982.700] (-1993.263) (-1985.634) (-1999.373) -- 0:01:56
      639200 -- (-1998.988) (-1993.322) [-1978.256] (-1986.143) * [-1983.324] (-1988.968) (-1987.748) (-1997.940) -- 0:01:56
      639300 -- (-1998.799) (-1994.452) [-1977.397] (-2003.041) * (-1990.109) (-1990.081) [-1979.196] (-1991.303) -- 0:01:56
      639400 -- (-1997.848) (-1994.414) [-1976.577] (-1994.871) * (-1994.882) (-1993.493) [-1980.852] (-1987.231) -- 0:01:56
      639500 -- (-1995.185) (-1999.286) [-1981.409] (-1993.155) * (-1988.621) (-1996.826) [-1984.182] (-1998.187) -- 0:01:56
      639600 -- (-1990.201) (-2002.805) [-1979.740] (-1999.593) * (-1995.079) (-1999.001) [-1984.015] (-1999.832) -- 0:01:56
      639700 -- (-1990.180) (-1999.410) [-1985.539] (-1990.854) * (-1992.338) (-1996.845) [-1981.133] (-1991.983) -- 0:01:56
      639800 -- (-1995.550) (-2004.227) (-1985.128) [-1984.274] * (-1989.242) (-2001.460) [-1981.786] (-1988.451) -- 0:01:56
      639900 -- (-1998.252) (-1996.401) [-1984.199] (-1991.514) * (-1987.005) (-2006.459) (-1982.449) [-1986.350] -- 0:01:56
      640000 -- (-1994.912) (-1999.512) [-1982.874] (-1989.876) * (-1982.486) (-2000.762) [-1984.476] (-1994.225) -- 0:01:56

      Average standard deviation of split frequencies: 0.002462

      640100 -- (-1999.608) (-2002.108) (-1983.973) [-1992.955] * [-1979.007] (-1999.449) (-1988.677) (-2000.413) -- 0:01:56
      640200 -- (-1993.434) (-2001.928) [-1983.936] (-1991.422) * [-1978.725] (-1991.675) (-1981.429) (-1995.054) -- 0:01:56
      640300 -- (-1995.749) (-1995.314) [-1980.099] (-1996.456) * [-1983.113] (-1988.128) (-1985.514) (-1995.414) -- 0:01:56
      640400 -- (-1989.711) (-2002.607) [-1980.626] (-1997.792) * (-1983.351) (-1991.931) [-1988.894] (-2001.033) -- 0:01:56
      640500 -- (-1992.736) (-1998.233) [-1985.505] (-2001.269) * (-1989.778) [-1992.915] (-1985.123) (-1993.229) -- 0:01:56
      640600 -- (-1990.978) (-1996.594) [-1981.910] (-1994.527) * (-1990.945) (-1993.335) (-1987.277) [-1989.305] -- 0:01:56
      640700 -- (-1993.938) (-2004.802) [-1978.966] (-1991.892) * [-1984.947] (-1989.966) (-1983.174) (-1985.014) -- 0:01:56
      640800 -- (-1993.461) (-1991.183) [-1982.629] (-1991.668) * [-1981.125] (-1994.631) (-1988.487) (-1983.649) -- 0:01:56
      640900 -- (-2000.093) (-1992.367) [-1986.965] (-1988.338) * (-1979.883) (-1996.208) (-1997.068) [-1986.411] -- 0:01:56
      641000 -- (-2001.677) [-1987.539] (-1991.444) (-1984.439) * [-1985.346] (-1991.956) (-2005.013) (-1986.399) -- 0:01:56

      Average standard deviation of split frequencies: 0.002521

      641100 -- (-1999.043) (-1990.156) (-1989.815) [-1983.421] * [-1983.553] (-2000.507) (-2001.428) (-1987.604) -- 0:01:56
      641200 -- (-2007.209) (-1983.595) [-1981.719] (-1980.077) * [-1985.367] (-1995.330) (-1992.461) (-1992.109) -- 0:01:56
      641300 -- (-2005.252) (-1985.499) (-1984.432) [-1982.724] * (-1985.852) (-1989.938) [-1982.738] (-1992.335) -- 0:01:56
      641400 -- (-1998.836) [-1986.066] (-1983.371) (-1991.824) * (-1991.730) (-1995.590) [-1983.346] (-1996.800) -- 0:01:56
      641500 -- (-1991.051) (-2002.808) (-1986.287) [-1989.109] * [-1989.100] (-1997.403) (-1988.193) (-2008.019) -- 0:01:56
      641600 -- (-1991.395) (-1998.091) (-1985.672) [-1982.182] * (-1990.913) [-2001.258] (-1986.103) (-1997.622) -- 0:01:56
      641700 -- (-1988.729) (-1988.814) [-1991.502] (-1989.805) * [-1988.353] (-1998.012) (-1986.102) (-1989.951) -- 0:01:56
      641800 -- (-1987.741) (-1992.498) [-1987.931] (-1991.243) * (-1987.500) (-1992.935) (-1988.223) [-1989.418] -- 0:01:56
      641900 -- (-1991.097) (-2003.029) [-1983.270] (-1991.042) * [-1982.568] (-1996.159) (-1994.709) (-1991.928) -- 0:01:56
      642000 -- (-1994.435) (-2002.878) (-1982.553) [-1987.563] * (-1988.753) (-1996.147) (-1994.206) [-1993.725] -- 0:01:55

      Average standard deviation of split frequencies: 0.002559

      642100 -- (-1994.300) (-2010.816) [-1983.260] (-1992.924) * (-1988.378) (-1994.505) [-1992.256] (-1990.010) -- 0:01:55
      642200 -- (-1993.193) (-2017.081) [-1985.163] (-1996.741) * (-1990.507) (-2002.110) (-1995.702) [-1985.764] -- 0:01:55
      642300 -- (-2000.148) (-1995.291) (-1995.848) [-1988.640] * (-1992.806) (-1999.686) (-1995.367) [-1983.018] -- 0:01:55
      642400 -- (-1997.913) (-1996.771) (-1992.712) [-1985.440] * [-1996.250] (-2002.979) (-2004.288) (-1983.292) -- 0:01:55
      642500 -- (-2000.314) (-1991.465) (-2002.675) [-1985.061] * [-1996.682] (-2013.855) (-1998.830) (-1982.447) -- 0:01:55
      642600 -- (-1995.892) [-1989.890] (-1999.262) (-1988.806) * [-1984.301] (-1992.226) (-1989.943) (-1996.917) -- 0:01:55
      642700 -- (-1997.439) (-1995.962) (-2000.416) [-1987.918] * (-1986.941) (-1991.331) (-1992.766) [-1996.615] -- 0:01:55
      642800 -- (-1995.187) (-1997.573) (-1995.803) [-1984.694] * [-1987.219] (-1989.006) (-1990.911) (-1989.903) -- 0:01:55
      642900 -- (-1996.949) (-1997.812) [-1994.105] (-1985.520) * [-1986.878] (-1988.950) (-1999.203) (-1988.288) -- 0:01:55
      643000 -- (-1995.808) [-1989.570] (-1989.042) (-1989.808) * (-1988.993) [-1988.523] (-1995.321) (-1989.631) -- 0:01:55

      Average standard deviation of split frequencies: 0.002492

      643100 -- (-1986.818) (-1997.920) (-1991.781) [-1988.599] * (-1992.993) (-1992.026) (-1993.739) [-1990.883] -- 0:01:55
      643200 -- (-1986.360) (-2001.774) [-1986.351] (-1991.029) * (-1987.399) (-1988.522) [-1990.771] (-1999.619) -- 0:01:55
      643300 -- (-1987.143) (-1998.935) [-1986.215] (-1997.256) * (-1982.467) (-1988.036) [-1989.298] (-2002.429) -- 0:01:55
      643400 -- (-1992.260) (-2004.233) [-1990.813] (-1997.018) * (-1983.554) (-1992.015) [-1988.290] (-2005.220) -- 0:01:55
      643500 -- (-1985.184) (-2012.641) [-1987.950] (-1999.475) * [-1985.804] (-1996.133) (-1988.763) (-1998.446) -- 0:01:55
      643600 -- (-1991.833) (-2006.734) [-1988.034] (-1994.188) * (-1988.298) [-1995.559] (-1998.758) (-1999.635) -- 0:01:55
      643700 -- [-1988.149] (-2004.792) (-1990.149) (-1994.932) * (-1986.620) (-1988.701) [-1996.221] (-1999.472) -- 0:01:55
      643800 -- (-1994.417) (-2013.344) (-1986.770) [-1984.335] * [-1986.154] (-1992.172) (-1992.009) (-1998.137) -- 0:01:55
      643900 -- (-1992.887) (-1995.450) (-1985.515) [-1979.760] * (-1978.875) (-1997.888) [-1989.223] (-1987.790) -- 0:01:55
      644000 -- (-1998.799) (-1992.106) (-1999.452) [-1979.818] * (-1982.852) (-1994.519) (-1990.872) [-1990.398] -- 0:01:55

      Average standard deviation of split frequencies: 0.002530

      644100 -- (-1995.185) [-1989.465] (-1989.950) (-1979.903) * (-1979.362) [-1991.810] (-1988.349) (-2000.126) -- 0:01:55
      644200 -- (-1998.127) [-1990.271] (-1983.738) (-1985.833) * [-1979.832] (-1987.833) (-1998.032) (-1992.560) -- 0:01:55
      644300 -- (-2003.006) (-1991.643) [-1986.177] (-1984.306) * [-1977.665] (-1988.767) (-2000.151) (-1997.416) -- 0:01:55
      644400 -- (-1998.058) (-1998.791) (-1995.622) [-1985.589] * (-1978.383) (-1995.707) (-1999.228) [-1990.542] -- 0:01:55
      644500 -- (-1996.463) (-1992.413) (-1992.233) [-1987.154] * [-1976.613] (-1999.153) (-1995.125) (-1990.777) -- 0:01:55
      644600 -- (-1998.034) (-1997.782) [-1993.615] (-1984.469) * [-1981.250] (-1992.379) (-2002.927) (-1994.959) -- 0:01:55
      644700 -- (-1994.812) [-1993.418] (-1990.552) (-1986.192) * [-1979.423] (-1993.441) (-2002.001) (-1994.165) -- 0:01:55
      644800 -- (-1994.160) (-1994.031) [-1983.910] (-1981.714) * [-1977.572] (-1993.783) (-1998.182) (-1996.653) -- 0:01:55
      644900 -- (-1988.481) (-2013.853) (-1986.715) [-1978.202] * [-1979.889] (-2008.696) (-1993.679) (-1989.586) -- 0:01:55
      645000 -- [-1988.740] (-2003.198) (-1979.631) (-1978.520) * (-1981.787) (-2000.655) [-1989.122] (-1996.190) -- 0:01:55

      Average standard deviation of split frequencies: 0.002568

      645100 -- (-1989.973) (-2012.451) [-1981.926] (-1980.087) * [-1980.322] (-1996.743) (-1990.865) (-1991.364) -- 0:01:54
      645200 -- (-1986.011) (-2002.089) (-1981.350) [-1983.916] * [-1983.074] (-1997.560) (-1996.085) (-1987.460) -- 0:01:54
      645300 -- (-1987.874) (-2004.982) (-1990.396) [-1979.409] * (-1984.387) (-1989.816) (-1998.203) [-1986.576] -- 0:01:54
      645400 -- (-1983.667) (-2003.302) (-1995.288) [-1982.947] * (-1980.491) (-1993.259) [-1995.300] (-1983.680) -- 0:01:54
      645500 -- (-1991.569) (-1998.985) (-1995.350) [-1980.278] * (-1983.322) [-1986.271] (-1987.261) (-1991.248) -- 0:01:54
      645600 -- (-1995.379) (-1998.784) (-1990.812) [-1978.789] * (-1981.569) (-1991.165) [-1985.002] (-1986.278) -- 0:01:54
      645700 -- (-1993.620) (-1996.249) (-1992.145) [-1983.010] * (-1987.195) (-1991.731) [-1986.920] (-1995.026) -- 0:01:54
      645800 -- [-1992.647] (-1995.920) (-1991.904) (-1985.731) * (-1992.860) (-1996.945) (-1990.448) [-1987.786] -- 0:01:54
      645900 -- [-1994.811] (-1996.829) (-1993.876) (-1980.140) * [-1987.817] (-2004.952) (-1993.789) (-1990.755) -- 0:01:54
      646000 -- (-1992.390) (-1997.113) (-1983.280) [-1984.140] * [-1987.136] (-2002.390) (-1991.918) (-1996.546) -- 0:01:55

      Average standard deviation of split frequencies: 0.002606

      646100 -- (-2007.115) (-2003.652) [-1979.089] (-1983.886) * [-1983.722] (-2005.124) (-1994.204) (-1999.019) -- 0:01:55
      646200 -- (-2000.876) (-2001.584) [-1981.661] (-1986.306) * [-1984.972] (-1998.320) (-1996.329) (-1994.181) -- 0:01:54
      646300 -- (-1993.270) (-1996.416) [-1980.799] (-1983.087) * [-1984.015] (-1997.774) (-1988.344) (-1994.250) -- 0:01:54
      646400 -- (-2004.769) (-1998.250) (-1986.619) [-1984.259] * [-1986.628] (-2013.779) (-1988.096) (-1990.442) -- 0:01:54
      646500 -- (-1997.271) (-1995.114) [-1980.678] (-1984.004) * [-1989.607] (-2008.796) (-1990.872) (-1986.061) -- 0:01:54
      646600 -- (-1990.027) (-2002.978) (-1983.955) [-1980.483] * (-1993.129) (-2000.755) (-1988.270) [-1981.241] -- 0:01:54
      646700 -- (-1991.133) (-2004.714) (-1992.884) [-1984.934] * [-1984.388] (-2003.137) (-1990.472) (-1992.603) -- 0:01:54
      646800 -- (-1986.283) (-2006.136) (-1994.362) [-1985.891] * (-1983.692) (-2001.653) [-1989.056] (-1992.093) -- 0:01:54
      646900 -- [-1985.787] (-2011.074) (-2000.607) (-1990.260) * (-1983.598) (-1999.282) [-1981.890] (-1986.283) -- 0:01:54
      647000 -- (-1992.279) (-2010.624) [-1995.685] (-1986.474) * [-1983.955] (-2001.495) (-1982.584) (-1984.297) -- 0:01:54

      Average standard deviation of split frequencies: 0.002560

      647100 -- (-1989.674) (-1999.592) [-1981.183] (-1985.573) * (-1987.604) (-1995.984) [-1985.725] (-1994.117) -- 0:01:54
      647200 -- (-1992.774) (-2001.245) [-1980.965] (-1987.923) * (-1992.084) (-2002.653) [-1984.291] (-1997.768) -- 0:01:54
      647300 -- (-1991.275) (-2002.558) (-1982.570) [-1983.254] * (-1987.730) (-2004.614) [-1977.109] (-1993.834) -- 0:01:54
      647400 -- (-1990.083) (-1992.759) (-1983.063) [-1981.563] * (-1990.193) (-2002.818) [-1980.606] (-1988.824) -- 0:01:54
      647500 -- (-1989.984) (-1989.902) (-1979.062) [-1978.763] * (-1984.288) (-2008.871) (-1987.932) [-1983.591] -- 0:01:54
      647600 -- (-2001.107) (-1994.834) (-1984.030) [-1984.190] * [-1985.651] (-2006.954) (-1981.820) (-1983.403) -- 0:01:54
      647700 -- [-1994.983] (-1996.407) (-1985.426) (-1977.738) * (-1991.946) (-2004.527) [-1982.172] (-1988.720) -- 0:01:54
      647800 -- (-1992.999) (-2002.684) (-1989.948) [-1982.168] * (-1993.952) (-2005.061) [-1979.721] (-1990.126) -- 0:01:54
      647900 -- (-2001.488) (-1999.278) (-1990.909) [-1978.972] * (-1996.204) (-2001.024) (-1981.283) [-1989.964] -- 0:01:54
      648000 -- (-2001.591) (-1994.924) (-1995.081) [-1980.423] * (-2003.067) (-2010.789) [-1978.975] (-1985.984) -- 0:01:54

      Average standard deviation of split frequencies: 0.002639

      648100 -- (-2007.991) (-2002.481) (-1985.250) [-1980.637] * (-1996.627) (-2002.036) (-1985.945) [-1985.695] -- 0:01:54
      648200 -- (-1999.438) (-1997.334) [-1982.758] (-1983.649) * (-1991.570) (-1998.146) (-1987.050) [-1984.655] -- 0:01:53
      648300 -- (-1998.138) (-1995.381) (-1991.017) [-1982.360] * (-1995.007) [-1993.818] (-1995.011) (-1988.944) -- 0:01:53
      648400 -- (-1989.010) (-1997.618) [-1985.405] (-1991.252) * (-1985.619) (-1991.735) (-1990.201) [-1985.219] -- 0:01:53
      648500 -- (-1996.215) (-1993.219) [-1985.442] (-1986.282) * [-1979.072] (-1997.782) (-1985.437) (-1983.889) -- 0:01:53
      648600 -- (-1988.923) [-1989.493] (-1988.681) (-1996.411) * [-1981.480] (-1996.024) (-1987.562) (-1984.065) -- 0:01:53
      648700 -- (-1994.022) (-1988.046) [-1985.527] (-1991.410) * [-1981.007] (-1995.567) (-1985.810) (-1990.253) -- 0:01:53
      648800 -- (-1999.197) (-1986.415) (-2001.965) [-1988.473] * (-1984.544) (-1995.452) [-1986.912] (-1993.040) -- 0:01:53
      648900 -- [-2002.271] (-1994.902) (-2005.334) (-1992.813) * [-1984.993] (-1994.946) (-1990.345) (-1985.174) -- 0:01:53
      649000 -- (-2005.400) (-1995.681) (-2002.251) [-1981.502] * (-1995.808) (-1988.383) [-1981.998] (-1985.297) -- 0:01:53

      Average standard deviation of split frequencies: 0.002697

      649100 -- (-1998.906) (-1995.732) (-1998.648) [-1980.198] * (-1997.089) (-1989.136) (-1988.142) [-1985.205] -- 0:01:54
      649200 -- (-1999.173) [-1993.702] (-2000.085) (-1988.869) * (-1995.219) (-1988.886) (-1988.875) [-1982.756] -- 0:01:54
      649300 -- (-1996.434) (-1988.123) (-1998.886) [-1986.378] * (-1995.087) [-1985.596] (-1990.784) (-1991.917) -- 0:01:53
      649400 -- (-1989.874) [-1990.486] (-2011.241) (-1990.867) * (-1997.981) [-1984.083] (-1999.920) (-2001.905) -- 0:01:53
      649500 -- (-1989.402) (-1994.469) (-2006.109) [-1987.190] * (-1990.349) (-1995.693) [-1989.283] (-1994.732) -- 0:01:53
      649600 -- [-1983.657] (-1993.599) (-1994.580) (-1990.564) * (-1988.164) (-2001.708) [-1982.116] (-1993.579) -- 0:01:53
      649700 -- (-1989.818) (-1991.653) (-2002.997) [-1987.013] * (-1988.377) (-2007.764) [-1977.113] (-1997.912) -- 0:01:53
      649800 -- [-1994.315] (-1991.939) (-1999.194) (-1990.602) * (-1990.749) (-1997.704) (-1984.856) [-1991.766] -- 0:01:53
      649900 -- (-1995.773) (-1995.545) (-1995.905) [-1986.753] * (-2000.488) (-1995.353) (-1980.279) [-1984.985] -- 0:01:53
      650000 -- (-2008.201) (-1989.414) (-1995.363) [-1984.182] * (-2003.000) (-2000.019) [-1981.294] (-1988.645) -- 0:01:53

      Average standard deviation of split frequencies: 0.002817

      650100 -- (-2010.543) (-1993.732) (-1994.254) [-1980.183] * (-1994.601) [-1995.878] (-1982.825) (-1993.886) -- 0:01:53
      650200 -- (-1999.849) (-1991.229) [-1985.765] (-1984.351) * (-1997.434) (-1992.433) [-1986.899] (-1990.163) -- 0:01:53
      650300 -- (-1994.355) (-1986.349) (-1984.605) [-1988.198] * (-2000.219) (-1990.662) [-1987.702] (-1987.991) -- 0:01:53
      650400 -- (-1993.413) (-1993.740) [-1985.344] (-1988.436) * (-1999.383) (-1988.328) (-1984.825) [-1982.499] -- 0:01:53
      650500 -- (-1992.898) (-1988.294) (-1990.019) [-1981.610] * (-1998.981) (-1984.648) [-1983.197] (-1990.249) -- 0:01:53
      650600 -- (-2002.267) (-1989.525) [-1988.321] (-1980.605) * (-1988.910) (-1997.404) [-1980.035] (-1996.752) -- 0:01:53
      650700 -- (-2002.204) (-1991.246) (-1986.686) [-1981.516] * [-1986.815] (-1994.867) (-1992.962) (-1989.186) -- 0:01:53
      650800 -- (-1997.303) (-1993.200) (-1986.746) [-1983.441] * [-1982.825] (-1992.780) (-1998.503) (-1995.536) -- 0:01:53
      650900 -- (-1991.332) (-1993.948) (-1986.555) [-1982.663] * (-1989.025) (-1994.504) [-1983.549] (-1990.372) -- 0:01:53
      651000 -- (-1994.984) (-2003.115) (-1983.014) [-1983.319] * [-1985.806] (-1997.635) (-1984.919) (-1991.965) -- 0:01:53

      Average standard deviation of split frequencies: 0.002792

      651100 -- (-1994.799) (-1993.760) (-1988.522) [-1978.681] * (-1985.869) (-1992.675) [-1982.904] (-1991.945) -- 0:01:53
      651200 -- (-1992.133) (-2002.873) (-1986.933) [-1978.342] * (-1982.873) (-1998.183) [-1979.732] (-1988.251) -- 0:01:53
      651300 -- [-1989.837] (-1994.829) (-1990.901) (-1982.279) * [-1985.910] (-2012.280) (-1987.050) (-1988.994) -- 0:01:52
      651400 -- [-1987.579] (-1991.257) (-1993.575) (-1987.458) * [-1994.105] (-2013.101) (-1987.017) (-1987.228) -- 0:01:52
      651500 -- (-1991.483) (-1991.779) (-1994.194) [-1986.534] * (-1993.394) (-2001.135) [-1980.923] (-1984.183) -- 0:01:52
      651600 -- (-1994.155) [-1985.431] (-1999.389) (-1982.191) * (-1992.574) (-2009.614) (-1983.489) [-1977.699] -- 0:01:52
      651700 -- (-1991.507) [-1987.724] (-1994.366) (-1989.110) * (-1993.948) (-2009.642) (-1984.317) [-1979.550] -- 0:01:52
      651800 -- (-1990.370) (-1985.253) (-1997.155) [-1985.879] * (-1990.687) (-2011.540) [-1985.833] (-1982.687) -- 0:01:52
      651900 -- (-1998.140) (-1994.353) (-1990.333) [-1983.824] * (-1985.162) (-2010.489) (-1988.615) [-1981.012] -- 0:01:52
      652000 -- (-1993.248) (-1988.656) [-1992.598] (-1982.979) * (-1979.725) (-2012.514) (-1987.515) [-1982.755] -- 0:01:52

      Average standard deviation of split frequencies: 0.002809

      652100 -- (-1989.282) (-1990.113) (-1993.566) [-1982.326] * [-1983.023] (-2006.374) (-1998.749) (-1981.998) -- 0:01:53
      652200 -- (-1992.025) (-1989.537) (-1987.773) [-1978.544] * (-1979.454) (-2002.626) (-1990.831) [-1982.287] -- 0:01:53
      652300 -- (-1992.264) (-1986.095) (-1990.566) [-1977.593] * [-1982.538] (-1989.567) (-1995.683) (-1981.088) -- 0:01:53
      652400 -- (-1992.909) [-1988.605] (-1999.437) (-1986.024) * (-1981.761) (-2002.544) (-1992.937) [-1980.592] -- 0:01:52
      652500 -- [-1991.690] (-1987.366) (-2003.440) (-1986.152) * (-1978.519) (-1996.736) [-1995.519] (-1981.886) -- 0:01:52
      652600 -- (-1989.372) [-1986.325] (-1995.335) (-1987.161) * [-1976.484] (-1996.426) (-1986.956) (-1984.213) -- 0:01:52
      652700 -- (-1990.584) [-1988.590] (-2001.204) (-1983.745) * (-1981.362) (-1987.198) (-1994.770) [-1983.611] -- 0:01:52
      652800 -- (-1991.910) (-1989.463) [-1993.524] (-1984.643) * (-1986.216) (-1994.299) (-1998.021) [-1984.488] -- 0:01:52
      652900 -- (-2001.917) [-1985.585] (-1991.824) (-1989.087) * (-1981.874) (-1991.366) (-2002.506) [-1986.033] -- 0:01:52
      653000 -- (-1997.232) (-1985.638) [-1995.203] (-1981.869) * [-1979.013] (-1988.194) (-1995.112) (-1989.980) -- 0:01:52

      Average standard deviation of split frequencies: 0.002825

      653100 -- (-1995.811) (-1987.670) (-2006.111) [-1991.100] * [-1979.985] (-1991.913) (-1991.273) (-1983.863) -- 0:01:52
      653200 -- (-1995.307) [-1988.198] (-1985.136) (-1995.136) * (-1984.455) (-1990.726) (-1990.521) [-1985.980] -- 0:01:52
      653300 -- (-1990.746) [-1985.368] (-1988.215) (-1997.122) * [-1983.782] (-1991.482) (-1992.114) (-1998.333) -- 0:01:52
      653400 -- [-1989.343] (-1988.002) (-1995.381) (-1995.631) * [-1984.981] (-1988.422) (-1991.543) (-2001.121) -- 0:01:52
      653500 -- [-1985.796] (-1987.360) (-2002.209) (-1989.885) * [-1986.871] (-1987.108) (-1990.043) (-1989.570) -- 0:01:52
      653600 -- (-1992.467) (-1992.166) (-2013.481) [-1989.366] * (-1984.646) (-1989.395) (-1993.144) [-1979.404] -- 0:01:52
      653700 -- [-1986.283] (-1996.550) (-2024.827) (-1987.557) * (-1983.589) (-1994.256) (-1993.866) [-1980.237] -- 0:01:52
      653800 -- (-1998.003) [-1994.355] (-1996.115) (-1991.698) * (-1985.256) (-1999.587) (-1985.505) [-1983.055] -- 0:01:52
      653900 -- [-1987.896] (-1993.153) (-1989.546) (-1994.458) * (-1986.745) (-1998.846) [-1991.278] (-1982.531) -- 0:01:52
      654000 -- [-1985.028] (-1994.154) (-1988.909) (-1995.421) * (-1984.523) (-1993.499) (-1992.485) [-1986.922] -- 0:01:52

      Average standard deviation of split frequencies: 0.002697

      654100 -- (-1987.236) (-1995.754) (-1989.440) [-1991.805] * (-1986.634) (-1995.798) [-1987.900] (-1989.991) -- 0:01:52
      654200 -- (-1993.259) (-1996.132) [-1982.462] (-1998.209) * (-1988.324) (-2005.337) [-1984.603] (-1981.980) -- 0:01:52
      654300 -- [-1988.800] (-2000.429) (-1986.922) (-1989.270) * [-1990.153] (-1998.935) (-1982.355) (-1983.805) -- 0:01:52
      654400 -- (-1992.059) (-1999.513) [-1983.101] (-1989.752) * (-1988.731) (-2001.520) (-1981.608) [-1983.456] -- 0:01:51
      654500 -- (-1995.205) (-1996.910) [-1980.975] (-2000.222) * (-2000.273) (-2003.396) (-1985.466) [-1992.800] -- 0:01:51
      654600 -- (-1990.791) (-2003.837) [-1988.088] (-2008.746) * (-1992.413) (-1998.578) [-1987.831] (-1994.153) -- 0:01:51
      654700 -- (-1990.981) (-2000.207) [-1994.150] (-2007.501) * (-1991.148) (-1992.304) [-1984.747] (-1994.837) -- 0:01:51
      654800 -- (-1987.585) (-1997.605) [-1990.652] (-1993.959) * (-1993.956) [-1985.789] (-1983.429) (-2000.882) -- 0:01:51
      654900 -- [-1989.189] (-1991.314) (-1985.153) (-1994.871) * (-1995.400) [-1989.097] (-1986.377) (-1999.857) -- 0:01:51
      655000 -- (-1989.149) (-1993.676) (-1989.807) [-1990.178] * (-1993.605) [-1991.024] (-1988.360) (-1991.093) -- 0:01:51

      Average standard deviation of split frequencies: 0.002775

      655100 -- (-1993.069) (-1997.149) [-1991.331] (-1990.686) * (-1987.807) (-1997.389) (-1989.899) [-1988.063] -- 0:01:52
      655200 -- (-1999.750) (-1998.074) [-1991.995] (-1992.009) * (-1985.723) [-1992.788] (-1994.129) (-1989.912) -- 0:01:52
      655300 -- (-2001.002) [-1992.287] (-1989.222) (-1992.867) * [-1987.114] (-1995.916) (-1986.110) (-1988.771) -- 0:01:52
      655400 -- (-2003.150) (-1996.646) (-1996.472) [-1992.782] * [-1991.187] (-2019.795) (-1994.809) (-1992.699) -- 0:01:51
      655500 -- (-1992.509) (-1994.852) [-1987.418] (-1991.702) * [-1985.502] (-2006.219) (-1989.160) (-1998.919) -- 0:01:51
      655600 -- (-1992.529) [-1990.942] (-1988.413) (-1988.469) * [-1983.887] (-2009.041) (-1989.100) (-2002.551) -- 0:01:51
      655700 -- (-1991.895) (-2002.354) (-1996.347) [-1986.807] * (-1982.760) (-2002.255) [-1987.376] (-2004.279) -- 0:01:51
      655800 -- [-1993.143] (-2002.021) (-2004.760) (-1986.761) * [-1978.936] (-2005.844) (-1984.225) (-1999.001) -- 0:01:51
      655900 -- (-1992.101) (-1992.943) (-2004.848) [-1990.353] * (-1987.898) (-2000.658) [-1988.292] (-1992.297) -- 0:01:51
      656000 -- (-1992.279) (-1996.429) [-1994.954] (-1994.058) * (-1986.985) (-2002.715) [-1987.174] (-1996.952) -- 0:01:51

      Average standard deviation of split frequencies: 0.002751

      656100 -- [-1995.610] (-1996.833) (-2002.302) (-1998.077) * [-1980.833] (-1993.772) (-1988.262) (-2000.888) -- 0:01:51
      656200 -- [-1995.993] (-1999.075) (-1991.830) (-1994.508) * (-1987.074) [-1993.581] (-1985.375) (-1997.651) -- 0:01:51
      656300 -- (-1996.236) (-1998.054) (-1988.343) [-1993.053] * (-1982.196) (-1994.282) [-1984.679] (-1997.880) -- 0:01:51
      656400 -- (-1994.680) [-1986.528] (-1994.908) (-1986.549) * (-1981.230) [-1990.225] (-1984.995) (-2003.916) -- 0:01:51
      656500 -- (-1994.288) (-1984.725) (-1990.426) [-1985.676] * [-1982.275] (-1989.146) (-1985.099) (-1994.924) -- 0:01:51
      656600 -- (-1997.029) (-1985.716) (-1990.389) [-1986.890] * (-1982.229) [-1989.101] (-1992.012) (-1999.927) -- 0:01:51
      656700 -- (-2003.770) (-1991.618) (-1989.727) [-1993.458] * (-1986.891) (-2000.264) [-1988.286] (-1989.177) -- 0:01:51
      656800 -- [-1992.528] (-1996.546) (-1990.195) (-1983.462) * [-1987.983] (-1993.242) (-1987.948) (-1996.241) -- 0:01:51
      656900 -- (-2002.963) (-2005.555) (-1984.716) [-1980.734] * (-1984.786) (-1990.479) [-1981.185] (-1998.178) -- 0:01:51
      657000 -- (-1998.328) (-2005.402) [-1987.408] (-1985.751) * (-1986.025) (-1991.219) [-1983.279] (-1996.169) -- 0:01:51

      Average standard deviation of split frequencies: 0.002603

      657100 -- (-1992.920) (-2006.316) (-1993.491) [-1990.004] * [-1991.279] (-1992.367) (-1981.811) (-1999.657) -- 0:01:51
      657200 -- (-1992.372) (-2007.584) [-1989.952] (-1991.262) * [-1990.178] (-1997.542) (-1979.217) (-1993.547) -- 0:01:51
      657300 -- (-1989.723) (-2001.580) [-1984.734] (-1988.158) * (-1991.879) (-1997.458) [-1979.611] (-1995.857) -- 0:01:51
      657400 -- (-1998.050) (-1999.324) [-1983.720] (-1991.745) * (-1984.945) (-1991.993) [-1980.369] (-1998.631) -- 0:01:51
      657500 -- [-1995.590] (-2009.436) (-1985.525) (-1992.464) * [-1981.530] (-2001.193) (-1986.630) (-1993.974) -- 0:01:50
      657600 -- (-1997.255) (-2007.465) (-1987.074) [-1988.982] * (-1990.280) (-1987.670) [-1982.863] (-1986.916) -- 0:01:50
      657700 -- (-1994.591) (-1998.540) (-1987.892) [-1991.453] * (-1990.256) (-1990.302) [-1984.189] (-1993.371) -- 0:01:50
      657800 -- (-1988.995) (-1993.760) [-1989.549] (-1994.887) * [-1985.422] (-1989.644) (-1982.267) (-1989.706) -- 0:01:50
      657900 -- (-1993.985) (-1992.831) (-1992.621) [-1988.057] * (-1986.517) (-1992.631) [-1978.061] (-1988.378) -- 0:01:50
      658000 -- (-1998.060) [-1990.579] (-1993.648) (-1990.529) * (-1985.561) (-1990.321) [-1980.422] (-1992.533) -- 0:01:50

      Average standard deviation of split frequencies: 0.002640

      658100 -- (-1999.387) (-1993.933) [-1989.677] (-1986.190) * (-1984.429) (-1996.761) [-1981.341] (-1987.735) -- 0:01:51
      658200 -- (-1993.749) (-1997.895) (-1998.152) [-1987.485] * [-1983.798] (-1987.982) (-1986.460) (-1984.908) -- 0:01:51
      658300 -- (-1994.672) (-1998.725) (-1994.841) [-1982.962] * (-1985.450) (-1989.347) [-1983.627] (-1987.167) -- 0:01:51
      658400 -- (-1993.203) (-2002.672) (-1992.955) [-1982.066] * (-1983.016) (-1992.438) [-1980.132] (-1983.682) -- 0:01:51
      658500 -- (-1989.248) (-2002.968) (-1995.952) [-1985.046] * (-1982.412) (-1988.285) (-1981.398) [-1984.478] -- 0:01:50
      658600 -- (-1990.482) (-2010.588) (-2004.421) [-1984.792] * (-1987.527) (-1988.858) (-1984.547) [-1988.672] -- 0:01:50
      658700 -- [-1994.216] (-1992.212) (-1996.353) (-1990.042) * (-1986.565) (-1990.057) (-1981.759) [-1987.313] -- 0:01:50
      658800 -- [-1989.932] (-1992.013) (-1996.546) (-1983.101) * [-1988.085] (-1994.924) (-1984.737) (-1988.202) -- 0:01:50
      658900 -- (-1989.040) (-1993.704) (-1999.299) [-1984.359] * [-1984.388] (-1995.253) (-1987.597) (-1984.096) -- 0:01:50
      659000 -- (-1990.501) (-1998.834) (-2003.330) [-1986.378] * (-1988.529) (-1992.977) [-1982.650] (-1985.226) -- 0:01:50

      Average standard deviation of split frequencies: 0.002656

      659100 -- (-1988.425) [-1991.857] (-1997.689) (-1993.382) * (-1993.166) (-1999.298) [-1979.278] (-1987.631) -- 0:01:50
      659200 -- (-1993.002) [-1985.657] (-1991.592) (-1998.932) * (-1996.921) (-1997.699) [-1979.681] (-1987.200) -- 0:01:50
      659300 -- (-1990.569) (-1990.276) (-1989.428) [-1990.943] * (-1988.086) (-1989.840) [-1979.243] (-1990.224) -- 0:01:50
      659400 -- (-1989.898) (-1993.271) [-1987.680] (-1997.869) * (-1989.051) (-1997.677) [-1980.543] (-1989.593) -- 0:01:50
      659500 -- (-1991.925) (-1993.948) [-1986.256] (-1994.190) * (-1994.754) (-1995.896) [-1982.482] (-1992.096) -- 0:01:50
      659600 -- (-1992.871) (-1999.383) [-1988.446] (-1991.081) * (-1989.419) (-1996.334) [-1979.710] (-1990.571) -- 0:01:50
      659700 -- (-1989.350) (-1992.457) (-1986.528) [-1987.503] * (-1994.502) (-1989.624) [-1979.642] (-1985.585) -- 0:01:50
      659800 -- (-1988.715) (-1993.949) (-1989.188) [-1992.812] * (-1987.839) (-1987.658) [-1978.822] (-1986.829) -- 0:01:50
      659900 -- (-1989.379) (-2005.685) [-1991.439] (-1991.492) * (-1987.179) (-1991.714) [-1980.676] (-1983.369) -- 0:01:50
      660000 -- (-1991.404) (-2004.941) (-1994.907) [-1986.829] * (-1985.217) (-1995.945) [-1977.937] (-1983.755) -- 0:01:50

      Average standard deviation of split frequencies: 0.002795

      660100 -- (-1996.377) (-1998.218) (-1998.230) [-1986.393] * (-1989.935) (-1997.251) (-1981.713) [-1982.229] -- 0:01:50
      660200 -- (-1996.130) (-1992.795) [-1988.490] (-1988.255) * (-2003.052) (-1998.059) (-1980.695) [-1976.205] -- 0:01:50
      660300 -- (-1992.030) (-1996.682) [-1991.083] (-1989.375) * (-2005.579) (-1994.582) (-1983.822) [-1980.847] -- 0:01:50
      660400 -- (-1991.757) (-1994.289) (-1989.740) [-1986.084] * (-1995.674) (-1998.558) (-1984.252) [-1982.202] -- 0:01:50
      660500 -- [-1991.760] (-2002.259) (-1994.758) (-1993.652) * [-1988.632] (-2002.383) (-1987.713) (-1985.636) -- 0:01:49
      660600 -- (-1991.638) (-1998.628) (-1994.959) [-1985.880] * [-1990.538] (-2002.244) (-1987.000) (-1987.276) -- 0:01:49
      660700 -- (-2000.089) (-2005.222) (-1999.997) [-1986.000] * (-1992.395) (-2001.251) (-1987.204) [-1982.170] -- 0:01:49
      660800 -- [-1992.071] (-1996.332) (-2003.179) (-1996.572) * (-1996.912) (-1997.906) [-1987.770] (-1995.064) -- 0:01:49
      660900 -- [-1985.328] (-1996.446) (-2001.304) (-1996.069) * (-1994.639) (-2003.080) (-1990.576) [-1983.460] -- 0:01:49
      661000 -- (-1990.880) (-1997.339) (-1994.349) [-1992.589] * (-1984.754) (-2003.026) [-1989.191] (-1988.519) -- 0:01:49

      Average standard deviation of split frequencies: 0.002893

      661100 -- (-1991.253) (-1996.636) [-1995.911] (-1988.170) * (-1987.971) (-2004.711) [-1984.685] (-1988.479) -- 0:01:50
      661200 -- (-1992.688) (-2000.956) [-1992.209] (-1988.377) * (-1987.940) (-2014.284) [-1983.070] (-1991.632) -- 0:01:50
      661300 -- [-1986.175] (-1993.193) (-1998.850) (-1987.531) * (-1992.429) (-2012.339) [-1985.406] (-1995.960) -- 0:01:50
      661400 -- [-1984.885] (-1996.791) (-2003.997) (-1990.665) * (-1988.860) (-2015.786) [-1985.938] (-1994.298) -- 0:01:50
      661500 -- [-1983.226] (-1998.631) (-1991.700) (-1987.707) * (-1991.513) (-2005.249) [-1984.286] (-1997.274) -- 0:01:50
      661600 -- [-1989.553] (-1994.877) (-1990.521) (-1993.613) * (-1998.869) (-1997.420) [-1986.634] (-1998.330) -- 0:01:49
      661700 -- (-1989.800) (-1991.308) (-1989.577) [-1987.038] * (-1994.936) [-1990.542] (-1987.454) (-1997.219) -- 0:01:49
      661800 -- [-1986.499] (-1986.805) (-1989.852) (-1989.903) * (-2004.716) (-1990.523) [-1986.296] (-1995.830) -- 0:01:49
      661900 -- (-1989.266) (-2000.615) [-1991.019] (-1989.560) * (-1993.228) (-1988.571) [-1985.405] (-1990.811) -- 0:01:49
      662000 -- [-1991.752] (-1999.362) (-1992.934) (-1997.738) * [-1990.624] (-1995.649) (-1985.136) (-1998.498) -- 0:01:49

      Average standard deviation of split frequencies: 0.002929

      662100 -- (-1991.539) (-1996.287) [-1985.918] (-1994.868) * (-1987.523) (-2000.226) [-1983.783] (-2006.504) -- 0:01:49
      662200 -- (-1996.745) (-2001.962) [-1984.833] (-1990.114) * (-1988.666) (-1999.802) [-1985.784] (-1995.753) -- 0:01:49
      662300 -- (-2002.706) (-2000.590) [-1989.900] (-2002.479) * (-1987.571) (-1997.175) [-1990.421] (-1992.470) -- 0:01:49
      662400 -- (-2010.864) (-1990.247) [-1985.985] (-1998.759) * (-1991.566) (-1990.842) [-1984.452] (-1995.580) -- 0:01:49
      662500 -- (-2003.735) (-1994.643) [-1989.707] (-1998.700) * [-1987.060] (-1995.084) (-1982.814) (-1991.911) -- 0:01:49
      662600 -- (-1999.948) (-1998.859) [-1987.898] (-2001.139) * (-1985.778) (-1992.948) [-1980.399] (-1992.631) -- 0:01:49
      662700 -- (-1989.590) [-1993.182] (-1989.175) (-2002.110) * [-1985.275] (-2000.813) (-1981.743) (-1988.632) -- 0:01:49
      662800 -- (-1997.564) (-1993.399) [-1987.757] (-2007.829) * (-1987.530) (-2011.298) [-1977.209] (-1986.702) -- 0:01:49
      662900 -- [-1990.426] (-1990.407) (-1983.252) (-2002.353) * (-1986.456) (-1999.039) [-1983.754] (-1987.265) -- 0:01:49
      663000 -- (-1993.420) (-1985.936) [-1989.072] (-2003.856) * (-1994.663) (-1991.584) (-1984.409) [-1989.262] -- 0:01:49

      Average standard deviation of split frequencies: 0.002823

      663100 -- (-1996.027) (-1990.130) [-1984.751] (-1996.158) * [-1987.783] (-1992.714) (-1990.613) (-1990.897) -- 0:01:49
      663200 -- [-1991.034] (-1996.634) (-1988.851) (-2002.236) * [-1991.321] (-2001.758) (-1985.481) (-1991.140) -- 0:01:49
      663300 -- (-1989.133) (-1999.382) [-1993.435] (-1995.703) * (-1990.692) (-1994.992) (-1981.293) [-1986.066] -- 0:01:49
      663400 -- (-1986.772) (-1998.633) [-1994.939] (-2000.292) * [-1985.106] (-1999.579) (-1984.231) (-1988.540) -- 0:01:49
      663500 -- [-1988.667] (-1994.391) (-1991.540) (-2004.729) * [-1984.482] (-1993.159) (-1992.183) (-1992.551) -- 0:01:49
      663600 -- (-1998.391) (-1993.164) (-1998.856) [-2000.024] * (-1982.563) [-1998.695] (-2009.774) (-1989.169) -- 0:01:48
      663700 -- (-1993.611) [-1990.163] (-1991.195) (-1994.096) * [-1984.827] (-1992.984) (-2005.014) (-1995.180) -- 0:01:48
      663800 -- (-1999.122) [-1995.745] (-1995.672) (-1990.209) * [-1984.579] (-1991.908) (-2001.348) (-1991.107) -- 0:01:48
      663900 -- (-1993.434) (-1992.972) [-1990.848] (-1993.349) * [-1976.929] (-2002.286) (-1994.106) (-1987.213) -- 0:01:48
      664000 -- (-1998.145) [-1991.291] (-1986.893) (-1989.496) * [-1977.387] (-2001.326) (-1999.833) (-1993.845) -- 0:01:48

      Average standard deviation of split frequencies: 0.002718

      664100 -- (-2003.048) (-2000.431) [-1989.559] (-1990.643) * [-1984.754] (-1995.525) (-1998.674) (-1994.391) -- 0:01:49
      664200 -- (-2003.654) (-1989.925) (-1983.565) [-1984.370] * [-1986.180] (-1993.800) (-1987.686) (-1995.017) -- 0:01:49
      664300 -- (-2005.435) (-2000.940) (-1993.611) [-1996.105] * [-1984.447] (-2001.852) (-1985.988) (-1990.101) -- 0:01:49
      664400 -- (-2003.585) [-1992.795] (-1991.331) (-1996.657) * [-1979.428] (-1994.215) (-1988.277) (-1982.392) -- 0:01:49
      664500 -- (-2002.687) [-1987.224] (-1994.922) (-1992.703) * [-1984.619] (-1994.805) (-1988.341) (-1987.219) -- 0:01:49
      664600 -- (-1990.940) (-1984.878) (-1994.735) [-1989.201] * (-1987.896) (-1988.347) [-1987.635] (-1990.067) -- 0:01:49
      664700 -- (-1995.363) (-1993.200) (-1997.496) [-1996.287] * (-1979.367) [-1986.471] (-1983.010) (-1987.813) -- 0:01:48
      664800 -- [-1991.538] (-1996.754) (-1999.010) (-1988.790) * (-1985.864) (-1986.496) (-1991.018) [-1984.856] -- 0:01:48
      664900 -- (-1993.541) (-1997.807) (-1995.711) [-1985.211] * [-1987.156] (-1989.840) (-1993.230) (-1986.477) -- 0:01:48
      665000 -- [-1991.836] (-2007.822) (-2007.890) (-1989.555) * [-1983.476] (-1992.352) (-1990.001) (-1983.494) -- 0:01:48

      Average standard deviation of split frequencies: 0.002754

      665100 -- [-1990.559] (-2004.841) (-2004.089) (-1989.942) * [-1982.193] (-1990.673) (-1990.490) (-1988.633) -- 0:01:48
      665200 -- (-1990.562) (-1996.640) (-2018.103) [-1986.126] * [-1981.426] (-1992.622) (-1990.669) (-1990.931) -- 0:01:48
      665300 -- (-1984.043) (-1989.173) (-2005.160) [-1982.944] * [-1983.321] (-1992.695) (-1993.285) (-1988.959) -- 0:01:48
      665400 -- [-1988.062] (-1988.143) (-2005.192) (-1984.930) * [-1984.829] (-1987.823) (-1988.361) (-1982.865) -- 0:01:48
      665500 -- [-1986.936] (-1991.966) (-2001.008) (-1988.243) * (-1984.442) [-1983.423] (-1991.724) (-1984.194) -- 0:01:48
      665600 -- [-1986.819] (-1986.307) (-2003.645) (-1989.547) * (-1984.228) (-1985.800) (-1986.890) [-1983.845] -- 0:01:48
      665700 -- (-1987.950) [-1991.046] (-2009.663) (-1987.351) * (-1985.114) [-1983.226] (-1989.958) (-1983.019) -- 0:01:48
      665800 -- [-1990.452] (-1995.105) (-2008.919) (-1988.800) * (-1986.585) [-1981.784] (-1995.354) (-1987.975) -- 0:01:48
      665900 -- (-1995.909) (-1999.523) [-2001.701] (-1984.037) * (-1988.371) [-1982.617] (-1989.192) (-1991.038) -- 0:01:48
      666000 -- (-1999.108) (-1994.877) (-1999.674) [-1981.020] * [-1981.080] (-2006.162) (-1993.152) (-1987.971) -- 0:01:48

      Average standard deviation of split frequencies: 0.002790

      666100 -- (-1987.017) [-1987.547] (-2000.588) (-1983.547) * [-1980.991] (-1996.358) (-1993.630) (-1999.326) -- 0:01:48
      666200 -- (-1992.618) (-1985.963) (-2007.308) [-1982.314] * [-1982.325] (-1994.999) (-1996.401) (-2007.425) -- 0:01:48
      666300 -- (-1990.208) [-1987.694] (-1994.671) (-1982.495) * [-1980.182] (-1994.843) (-1996.040) (-2001.103) -- 0:01:48
      666400 -- (-1992.300) (-1990.256) (-1997.930) [-1985.243] * [-1977.196] (-1996.330) (-1994.599) (-2003.466) -- 0:01:48
      666500 -- (-1998.144) [-1989.458] (-1995.576) (-1980.541) * [-1978.370] (-1992.844) (-1993.877) (-2000.278) -- 0:01:48
      666600 -- (-1993.506) (-1988.981) [-1996.220] (-1978.953) * [-1981.691] (-1996.896) (-1999.540) (-2000.383) -- 0:01:48
      666700 -- (-1997.049) [-1989.545] (-1994.099) (-1985.688) * (-1982.008) (-1992.498) [-1990.567] (-2010.604) -- 0:01:47
      666800 -- [-2001.291] (-1990.096) (-1993.854) (-1987.382) * [-1984.249] (-1997.609) (-1985.772) (-1999.851) -- 0:01:47
      666900 -- (-2005.516) [-1988.327] (-1995.569) (-1987.374) * (-1982.048) (-1998.266) [-1984.162] (-1999.481) -- 0:01:47
      667000 -- (-2002.700) (-1987.814) [-1990.872] (-1986.010) * [-1977.047] (-1995.968) (-1982.139) (-2003.943) -- 0:01:47

      Average standard deviation of split frequencies: 0.002826

      667100 -- (-1993.423) (-1993.883) (-1991.675) [-1982.816] * [-1977.745] (-1997.518) (-1980.747) (-2001.573) -- 0:01:48
      667200 -- (-1993.334) (-1996.877) (-1991.791) [-1982.052] * [-1979.221] (-1992.141) (-1983.996) (-2000.744) -- 0:01:48
      667300 -- (-1991.326) [-1988.637] (-1997.237) (-1989.292) * [-1984.971] (-1988.228) (-1989.515) (-1999.191) -- 0:01:48
      667400 -- (-1990.274) (-1987.603) (-2001.119) [-1988.741] * [-1980.013] (-1990.088) (-1992.240) (-1994.165) -- 0:01:48
      667500 -- (-1994.198) (-1990.920) [-1995.089] (-1986.814) * [-1981.618] (-1992.248) (-1984.902) (-1993.174) -- 0:01:48
      667600 -- (-1998.931) (-1989.485) (-1995.219) [-1984.115] * [-1983.561] (-1996.650) (-1986.283) (-1992.262) -- 0:01:48
      667700 -- (-2001.107) (-1991.561) (-2003.917) [-1984.516] * (-1982.523) (-1989.536) [-1985.294] (-1989.519) -- 0:01:47
      667800 -- (-2000.908) [-1986.134] (-1996.175) (-1985.565) * (-1991.337) [-1988.648] (-1987.752) (-1987.290) -- 0:01:47
      667900 -- (-2000.668) (-1988.511) (-1998.172) [-1987.890] * [-1985.491] (-1998.376) (-1987.568) (-1987.473) -- 0:01:47
      668000 -- (-2006.262) [-1990.630] (-1999.645) (-1986.797) * (-1984.668) (-2002.451) [-1983.963] (-1989.041) -- 0:01:47

      Average standard deviation of split frequencies: 0.002903

      668100 -- (-2005.869) (-1990.611) (-2004.522) [-1984.304] * (-1995.272) (-2005.965) [-1985.498] (-1988.925) -- 0:01:47
      668200 -- (-2001.007) [-1992.745] (-1989.887) (-1988.852) * (-1992.955) (-1993.181) [-1986.676] (-1983.801) -- 0:01:47
      668300 -- (-1996.145) (-2019.463) (-1992.404) [-1984.751] * (-1996.765) (-2005.898) (-1985.908) [-1983.020] -- 0:01:47
      668400 -- (-1989.539) (-2009.123) [-1989.659] (-1982.757) * (-1990.721) (-2002.667) (-1987.248) [-1981.273] -- 0:01:47
      668500 -- (-1988.836) (-1998.031) (-1991.774) [-1979.950] * (-2000.221) (-2002.822) (-1990.920) [-1984.268] -- 0:01:47
      668600 -- (-1998.098) (-2001.362) [-1985.211] (-1976.473) * (-1999.839) (-2002.429) (-1998.519) [-1984.467] -- 0:01:47
      668700 -- (-1998.479) (-2002.359) [-1987.124] (-1978.767) * [-1988.986] (-1993.375) (-1998.403) (-1987.115) -- 0:01:47
      668800 -- (-1993.322) (-2007.109) (-1994.371) [-1988.390] * [-1989.814] (-1983.757) (-1985.875) (-1993.942) -- 0:01:47
      668900 -- (-1988.786) (-1997.283) [-1986.602] (-1984.834) * (-1990.435) (-1992.216) (-1987.941) [-1983.569] -- 0:01:47
      669000 -- (-1991.453) (-1995.754) (-1985.644) [-1985.226] * (-1982.083) (-1987.010) (-2004.449) [-1983.487] -- 0:01:47

      Average standard deviation of split frequencies: 0.002818

      669100 -- (-1999.035) (-2005.344) (-1988.124) [-1987.261] * (-1990.711) [-1994.222] (-2001.176) (-1983.855) -- 0:01:47
      669200 -- (-1998.834) (-2007.002) [-1993.691] (-1986.044) * [-1978.954] (-1985.721) (-1998.665) (-1988.512) -- 0:01:47
      669300 -- (-2005.263) (-2007.645) [-1997.024] (-1987.069) * [-1980.656] (-1990.535) (-1994.366) (-1990.043) -- 0:01:47
      669400 -- (-2007.668) (-1994.961) (-1990.295) [-1983.574] * (-1986.574) (-1988.486) (-1993.985) [-1993.996] -- 0:01:47
      669500 -- (-2002.990) (-1992.457) [-1989.890] (-1980.434) * (-1988.112) (-1998.720) (-1987.794) [-1984.307] -- 0:01:47
      669600 -- (-1993.736) (-1995.686) (-1991.605) [-1983.784] * (-1988.225) (-1992.199) (-1987.219) [-1980.866] -- 0:01:47
      669700 -- (-1993.577) (-1999.201) (-1992.611) [-1983.661] * (-1997.737) (-1988.203) (-1986.176) [-1980.580] -- 0:01:47
      669800 -- (-1988.274) (-1996.504) (-1991.241) [-1985.455] * (-1991.742) (-1993.838) (-1985.402) [-1977.667] -- 0:01:46
      669900 -- [-1986.239] (-1994.981) (-1989.358) (-1990.866) * [-1985.683] (-1990.544) (-1992.357) (-1982.780) -- 0:01:46
      670000 -- (-1991.637) (-1992.235) (-1994.778) [-1992.578] * [-1983.615] (-1992.223) (-1993.597) (-1982.393) -- 0:01:46

      Average standard deviation of split frequencies: 0.002874

      670100 -- (-1986.664) [-1985.501] (-2002.373) (-1988.725) * [-1982.671] (-2005.369) (-1990.774) (-1988.285) -- 0:01:46
      670200 -- (-1998.279) (-1988.671) (-2005.627) [-1990.028] * [-1980.313] (-2013.348) (-1991.114) (-1984.745) -- 0:01:47
      670300 -- (-1998.707) (-1989.117) (-2005.035) [-1989.443] * [-1981.745] (-2000.809) (-2003.075) (-1985.695) -- 0:01:47
      670400 -- (-1997.127) [-1997.038] (-2004.232) (-1989.330) * [-1980.328] (-2006.829) (-1991.046) (-1988.495) -- 0:01:47
      670500 -- (-1991.573) (-1998.350) (-1997.231) [-1986.467] * [-1980.464] (-2004.477) (-1995.278) (-1995.184) -- 0:01:47
      670600 -- (-1993.158) (-1999.908) (-1997.096) [-1986.886] * [-1979.279] (-2002.354) (-1991.464) (-1986.875) -- 0:01:47
      670700 -- (-1995.190) (-2005.997) (-1994.295) [-1984.993] * (-1978.880) (-2007.220) (-1988.412) [-1985.064] -- 0:01:47
      670800 -- (-1998.478) (-2007.102) (-1990.067) [-1982.078] * [-1977.042] (-1994.291) (-1990.501) (-1983.490) -- 0:01:46
      670900 -- (-1995.306) (-1996.635) (-1988.631) [-1980.571] * (-1980.819) (-2000.919) [-1988.946] (-1983.846) -- 0:01:46
      671000 -- (-1987.434) (-1998.568) (-1994.712) [-1975.588] * [-1977.818] (-1994.436) (-1986.864) (-1984.208) -- 0:01:46

      Average standard deviation of split frequencies: 0.002829

      671100 -- (-1989.294) (-1995.931) (-2000.564) [-1975.997] * [-1985.416] (-1997.021) (-1989.316) (-1985.384) -- 0:01:46
      671200 -- (-1991.161) (-1995.925) (-1993.927) [-1977.854] * [-1980.264] (-1994.251) (-1987.356) (-1993.382) -- 0:01:46
      671300 -- (-1986.364) (-1998.113) (-2001.516) [-1975.452] * [-1982.212] (-1992.786) (-1991.653) (-1988.351) -- 0:01:46
      671400 -- (-1989.854) (-2004.574) (-1995.934) [-1977.467] * (-1979.066) [-1993.811] (-1997.775) (-1991.254) -- 0:01:46
      671500 -- (-1992.310) (-1994.643) (-1993.733) [-1982.190] * [-1982.149] (-1992.902) (-1998.646) (-1997.249) -- 0:01:46
      671600 -- (-1991.512) (-1996.203) (-1996.824) [-1983.855] * [-1982.638] (-1991.823) (-1998.982) (-1989.320) -- 0:01:46
      671700 -- [-1994.486] (-1997.667) (-1998.224) (-1983.202) * [-1979.302] (-1995.729) (-1989.733) (-1985.529) -- 0:01:46
      671800 -- (-1994.976) [-1985.925] (-1994.480) (-1984.894) * (-1980.642) (-1999.821) [-1985.536] (-1988.039) -- 0:01:46
      671900 -- (-1996.993) [-1988.638] (-2000.356) (-1987.909) * (-1985.842) (-2000.208) (-1994.445) [-1985.667] -- 0:01:46
      672000 -- [-1995.084] (-1991.635) (-1988.732) (-1989.570) * (-1994.431) (-1990.868) (-1991.370) [-1988.895] -- 0:01:46

      Average standard deviation of split frequencies: 0.002805

      672100 -- (-1996.625) [-1991.238] (-2002.933) (-1995.958) * (-1988.965) [-1994.940] (-1992.820) (-1987.732) -- 0:01:46
      672200 -- (-1994.032) [-1988.065] (-1997.429) (-1991.337) * [-1985.129] (-1992.208) (-1991.959) (-1995.233) -- 0:01:46
      672300 -- (-1998.241) [-1986.094] (-1994.167) (-1994.575) * (-1984.992) [-1986.587] (-1991.114) (-1984.987) -- 0:01:46
      672400 -- (-2002.225) [-1985.832] (-2000.207) (-1994.591) * (-1989.768) (-1993.584) (-1990.665) [-1988.556] -- 0:01:46
      672500 -- (-1996.607) [-1989.499] (-1999.019) (-1993.454) * [-1987.710] (-1996.222) (-1994.791) (-1984.828) -- 0:01:46
      672600 -- (-1992.029) (-1995.645) (-1993.929) [-1985.893] * (-1986.405) (-1992.724) [-1992.034] (-1984.479) -- 0:01:46
      672700 -- (-1997.343) (-2000.396) (-1993.240) [-1987.405] * (-2003.057) (-1994.363) (-1992.598) [-1980.951] -- 0:01:46
      672800 -- (-1996.419) (-1996.962) [-1992.318] (-1976.724) * (-2005.667) (-1994.273) (-1991.279) [-1979.868] -- 0:01:46
      672900 -- (-1991.959) (-1992.529) (-1993.758) [-1980.336] * (-2000.876) (-1991.269) (-1998.131) [-1987.054] -- 0:01:45
      673000 -- (-1992.052) (-1992.629) (-1990.152) [-1979.515] * (-1986.892) (-1996.624) (-1993.765) [-1991.487] -- 0:01:45

      Average standard deviation of split frequencies: 0.002741

      673100 -- (-1995.150) (-1992.590) (-1996.350) [-1978.197] * [-1985.609] (-1997.072) (-1996.479) (-1995.411) -- 0:01:45
      673200 -- (-1990.557) (-2001.599) (-1988.769) [-1978.043] * (-1984.677) (-1994.332) [-1991.718] (-1993.204) -- 0:01:46
      673300 -- (-1993.312) (-1999.929) (-1989.276) [-1979.289] * [-1988.907] (-1992.434) (-1990.268) (-1991.224) -- 0:01:46
      673400 -- (-1991.757) (-2002.979) (-1983.342) [-1982.032] * [-1988.308] (-1991.756) (-1989.208) (-2000.406) -- 0:01:46
      673500 -- (-1994.247) (-2002.281) (-1980.480) [-1984.688] * (-1992.024) [-1992.156] (-1995.925) (-1993.454) -- 0:01:46
      673600 -- (-1998.145) (-2002.546) [-1983.284] (-1986.557) * [-1983.813] (-1995.405) (-1990.776) (-2002.308) -- 0:01:46
      673700 -- (-1996.776) (-1999.801) (-1990.081) [-1989.254] * [-1983.059] (-1998.053) (-1992.656) (-1996.686) -- 0:01:46
      673800 -- (-1994.958) (-2002.068) [-1989.069] (-1995.338) * (-1988.419) (-1996.769) [-1989.740] (-1989.111) -- 0:01:46
      673900 -- (-1995.729) (-2003.425) [-1986.486] (-1996.415) * [-1987.212] (-2002.736) (-1998.131) (-1988.327) -- 0:01:45
      674000 -- (-1997.662) (-2015.456) (-1985.757) [-1992.481] * [-1986.163] (-1988.614) (-1994.593) (-1994.061) -- 0:01:45

      Average standard deviation of split frequencies: 0.002817

      674100 -- (-2000.991) (-1989.779) [-1987.488] (-1988.664) * (-1985.145) [-1988.110] (-1997.764) (-1992.274) -- 0:01:45
      674200 -- (-2004.977) (-1989.634) (-1992.789) [-1984.357] * (-1986.545) [-1987.040] (-1995.832) (-2000.967) -- 0:01:45
      674300 -- (-2008.764) (-1998.471) (-1990.065) [-1977.551] * (-1991.539) (-1985.547) (-1992.277) [-1996.350] -- 0:01:45
      674400 -- (-2009.953) (-1999.406) (-1993.178) [-1980.075] * (-1988.826) (-1993.971) (-1990.034) [-1987.152] -- 0:01:45
      674500 -- (-1999.068) (-1994.138) [-1989.808] (-1981.794) * [-1987.940] (-1989.018) (-1990.550) (-1986.035) -- 0:01:45
      674600 -- (-1992.723) (-1990.023) (-1992.396) [-1985.081] * (-1985.011) (-1992.924) [-1987.974] (-1998.014) -- 0:01:45
      674700 -- (-1990.602) (-1989.234) (-1990.366) [-1983.539] * (-1983.056) [-1989.710] (-1994.748) (-2001.191) -- 0:01:45
      674800 -- (-1990.521) (-1988.411) (-1996.171) [-1979.829] * [-1982.174] (-1989.281) (-2000.286) (-1992.831) -- 0:01:45
      674900 -- (-1992.361) (-1990.496) (-1992.203) [-1987.068] * [-1981.632] (-1991.300) (-1991.554) (-1986.134) -- 0:01:45
      675000 -- (-1986.999) (-1995.114) [-1985.900] (-1985.447) * [-1977.442] (-1998.872) (-1989.827) (-1990.464) -- 0:01:45

      Average standard deviation of split frequencies: 0.002693

      675100 -- (-1995.103) (-1990.787) [-1986.193] (-1988.917) * [-1980.271] (-2005.291) (-1987.041) (-1986.708) -- 0:01:45
      675200 -- (-1987.872) [-1994.998] (-1989.604) (-1992.413) * [-1980.279] (-1998.432) (-1991.139) (-1992.183) -- 0:01:45
      675300 -- (-1997.233) (-1995.372) (-1988.488) [-1981.574] * (-1983.451) (-1994.714) (-1996.468) [-1992.618] -- 0:01:45
      675400 -- (-1999.366) (-1999.910) [-1989.955] (-1988.460) * (-1981.688) (-1996.363) [-1990.992] (-1994.761) -- 0:01:45
      675500 -- (-2008.310) (-2002.949) (-1991.471) [-1983.275] * [-1987.865] (-1991.851) (-1993.713) (-1994.083) -- 0:01:45
      675600 -- (-1997.442) (-2001.506) (-1987.671) [-1985.801] * (-1989.179) (-1989.654) (-1992.916) [-1990.960] -- 0:01:45
      675700 -- [-1989.995] (-1994.038) (-1995.487) (-1984.365) * (-1987.784) (-1995.243) [-1986.601] (-1992.461) -- 0:01:45
      675800 -- [-1986.672] (-1989.060) (-1993.782) (-1986.204) * [-1986.806] (-1992.856) (-1984.798) (-1992.523) -- 0:01:45
      675900 -- (-1995.651) (-1997.767) (-1989.292) [-1985.596] * (-1988.197) (-1994.987) [-1983.000] (-1984.909) -- 0:01:45
      676000 -- [-1985.056] (-1997.285) (-1996.864) (-1986.195) * (-1986.369) (-1999.868) [-1985.690] (-1994.759) -- 0:01:44

      Average standard deviation of split frequencies: 0.002649

      676100 -- [-1984.141] (-1989.534) (-1998.251) (-1990.644) * [-1988.543] (-1996.390) (-1986.172) (-2013.613) -- 0:01:44
      676200 -- [-1989.858] (-1984.442) (-1996.094) (-1995.764) * [-1983.855] (-2000.763) (-1983.866) (-2011.565) -- 0:01:45
      676300 -- [-1995.504] (-1995.230) (-2000.051) (-2010.494) * [-1981.849] (-1999.689) (-1987.609) (-2005.713) -- 0:01:45
      676400 -- (-1993.407) [-1989.801] (-1996.266) (-2011.496) * [-1983.762] (-1997.410) (-1988.354) (-2004.098) -- 0:01:45
      676500 -- (-1994.123) (-1998.787) (-1998.544) [-1993.788] * [-1980.867] (-1995.984) (-1986.507) (-2002.169) -- 0:01:45
      676600 -- (-1987.928) (-1990.648) (-1992.124) [-1988.978] * [-1982.144] (-1988.456) (-1993.159) (-1997.919) -- 0:01:45
      676700 -- (-1988.088) (-1991.566) (-1996.575) [-1985.584] * (-1986.722) [-1988.704] (-1997.492) (-1998.289) -- 0:01:45
      676800 -- (-1989.699) [-1988.898] (-1996.432) (-1993.975) * [-1983.603] (-1997.193) (-1995.803) (-1993.174) -- 0:01:45
      676900 -- [-1985.957] (-1994.057) (-1994.535) (-1990.878) * [-1981.151] (-2000.579) (-1994.539) (-1991.371) -- 0:01:45
      677000 -- [-1986.346] (-1995.414) (-1992.633) (-1988.744) * [-1985.884] (-2004.771) (-2003.784) (-1991.737) -- 0:01:44

      Average standard deviation of split frequencies: 0.002705

      677100 -- [-1984.600] (-1999.726) (-1998.726) (-1988.640) * [-1985.588] (-1997.832) (-1996.126) (-1997.104) -- 0:01:44
      677200 -- [-1986.816] (-1988.277) (-1993.832) (-1989.948) * (-1990.110) [-1990.272] (-1997.312) (-1992.962) -- 0:01:44
      677300 -- (-2002.821) (-1990.326) (-1991.254) [-1989.786] * (-1985.366) (-1989.595) (-2010.772) [-1993.663] -- 0:01:44
      677400 -- (-1997.637) (-1988.686) (-1986.740) [-1989.651] * [-1984.451] (-1985.044) (-2001.693) (-1999.329) -- 0:01:44
      677500 -- (-2004.306) (-1988.696) (-1989.880) [-1985.216] * (-1990.103) [-1987.063] (-1994.944) (-1994.483) -- 0:01:44
      677600 -- (-2004.670) (-1988.116) [-1989.605] (-1985.801) * [-1990.796] (-1986.968) (-1994.159) (-2003.878) -- 0:01:44
      677700 -- (-2011.097) (-1989.383) [-1988.038] (-1986.566) * (-1987.049) [-1991.020] (-1994.803) (-2002.966) -- 0:01:44
      677800 -- (-2004.623) (-1993.456) (-1986.106) [-1988.366] * (-1984.102) (-1989.890) [-1989.008] (-2000.570) -- 0:01:44
      677900 -- (-1994.533) [-1987.486] (-1989.278) (-1993.548) * (-1985.578) [-1993.228] (-1996.721) (-1999.774) -- 0:01:44
      678000 -- (-1991.966) [-1986.162] (-1989.855) (-1991.480) * (-1992.797) (-1999.019) (-1992.239) [-1991.106] -- 0:01:44

      Average standard deviation of split frequencies: 0.002602

      678100 -- [-1990.212] (-1989.000) (-1999.481) (-1997.188) * [-1986.421] (-2000.224) (-1998.848) (-1993.058) -- 0:01:44
      678200 -- (-1993.142) (-1989.811) [-1992.665] (-2001.487) * (-1980.592) (-1997.669) [-1992.661] (-1993.882) -- 0:01:44
      678300 -- [-1986.335] (-1988.149) (-1988.835) (-1992.108) * [-1984.616] (-2001.258) (-1992.661) (-2000.049) -- 0:01:44
      678400 -- (-1992.386) [-1994.208] (-1993.898) (-1995.132) * (-1992.304) [-1994.628] (-1991.968) (-1991.645) -- 0:01:44
      678500 -- (-1988.644) (-1997.910) [-1988.872] (-1989.501) * [-1984.044] (-1996.948) (-1993.791) (-1997.037) -- 0:01:44
      678600 -- (-1986.996) (-1995.799) (-1983.547) [-1986.100] * [-1984.914] (-1992.620) (-1987.266) (-1999.845) -- 0:01:44
      678700 -- [-1985.357] (-2005.519) (-1991.173) (-1982.309) * (-1993.073) (-1988.813) [-1985.848] (-1992.844) -- 0:01:44
      678800 -- (-1986.145) [-1998.608] (-1992.784) (-1986.844) * (-1994.916) (-1989.510) [-1988.642] (-1988.573) -- 0:01:44
      678900 -- (-1993.948) (-2003.179) (-1988.155) [-1989.177] * (-2004.733) [-1990.845] (-1989.683) (-1994.999) -- 0:01:44
      679000 -- (-1991.078) (-2000.140) [-1991.586] (-1995.170) * (-1993.745) [-1987.368] (-1987.655) (-2004.065) -- 0:01:44

      Average standard deviation of split frequencies: 0.002737

      679100 -- (-1989.533) (-2004.526) [-1990.558] (-1995.332) * (-1990.612) (-1989.830) (-1995.617) [-1991.429] -- 0:01:43
      679200 -- [-1987.720] (-1997.549) (-1986.224) (-1990.961) * [-1984.831] (-1997.573) (-1991.355) (-1993.606) -- 0:01:44
      679300 -- [-1986.327] (-1997.128) (-1994.914) (-1993.900) * [-1982.473] (-1998.135) (-2001.605) (-1984.595) -- 0:01:44
      679400 -- (-1983.885) (-1994.625) [-1991.979] (-1998.879) * [-1985.723] (-1991.096) (-2002.104) (-1985.849) -- 0:01:44
      679500 -- [-1985.475] (-1993.547) (-2006.543) (-1986.784) * (-1989.796) [-1988.647] (-1999.880) (-1991.687) -- 0:01:44
      679600 -- [-1990.571] (-2007.016) (-1992.974) (-1984.487) * (-1997.096) (-1987.702) (-2000.798) [-1987.668] -- 0:01:44
      679700 -- (-1989.997) (-2005.093) (-1987.544) [-1986.304] * (-1994.220) (-1993.312) (-1994.304) [-1986.726] -- 0:01:44
      679800 -- (-1994.951) (-1999.942) (-1986.271) [-1984.709] * [-1987.721] (-1991.395) (-2000.307) (-1986.132) -- 0:01:44
      679900 -- (-1996.803) (-2002.991) [-1982.901] (-1985.130) * [-1983.471] (-1986.571) (-1999.696) (-1986.778) -- 0:01:44
      680000 -- (-2003.367) (-2006.182) (-1988.173) [-1993.497] * (-1985.598) (-1994.716) (-2000.218) [-1983.372] -- 0:01:44

      Average standard deviation of split frequencies: 0.002970

      680100 -- (-2004.988) (-1995.494) [-1983.255] (-1989.305) * (-1989.114) (-1999.567) (-2000.382) [-1987.739] -- 0:01:43
      680200 -- (-2003.651) (-2004.146) (-1986.361) [-1991.766] * (-1990.867) [-1994.358] (-1993.817) (-1985.362) -- 0:01:43
      680300 -- (-1992.467) (-2007.869) (-1995.261) [-1988.635] * [-1984.573] (-1990.824) (-1996.391) (-1985.111) -- 0:01:43
      680400 -- (-1995.614) (-1991.609) [-1995.103] (-1996.040) * [-1985.606] (-2002.450) (-1994.416) (-1993.159) -- 0:01:43
      680500 -- (-1998.286) (-1995.722) (-1998.439) [-1982.973] * [-1985.522] (-2002.583) (-1993.057) (-1997.065) -- 0:01:43
      680600 -- (-2005.476) (-1992.744) (-1998.516) [-1982.344] * [-1986.600] (-1999.118) (-1997.992) (-1992.240) -- 0:01:43
      680700 -- (-1988.060) (-2002.112) (-1997.761) [-1987.838] * [-1982.988] (-2001.931) (-1992.460) (-1987.883) -- 0:01:43
      680800 -- (-1987.261) (-2003.683) (-1995.648) [-1983.340] * [-1982.768] (-1999.924) (-1989.270) (-1991.790) -- 0:01:43
      680900 -- [-1986.658] (-1996.216) (-1990.113) (-1983.440) * [-1982.204] (-1999.709) (-1994.328) (-1993.417) -- 0:01:43
      681000 -- (-1995.132) [-1992.155] (-1990.228) (-1993.588) * (-1986.681) (-2005.708) (-1994.044) [-1991.199] -- 0:01:43

      Average standard deviation of split frequencies: 0.002926

      681100 -- (-2000.171) (-1995.716) (-1994.873) [-1988.897] * [-1983.533] (-2009.575) (-1988.850) (-1990.872) -- 0:01:43
      681200 -- (-2001.145) [-1989.082] (-1996.451) (-1983.691) * [-1983.501] (-2005.749) (-1999.774) (-1992.825) -- 0:01:43
      681300 -- (-1997.080) (-1988.607) [-1998.152] (-1985.536) * [-1978.032] (-2005.280) (-1997.640) (-1991.255) -- 0:01:43
      681400 -- (-1999.629) (-1993.176) (-1996.835) [-1982.143] * [-1981.747] (-2006.440) (-1993.844) (-1991.852) -- 0:01:43
      681500 -- (-1992.866) (-1993.726) (-1990.372) [-1984.936] * [-1989.633] (-2000.815) (-1992.999) (-1992.650) -- 0:01:43
      681600 -- (-1990.546) (-1999.997) (-1989.562) [-1985.569] * [-1989.709] (-1999.157) (-1997.242) (-1997.104) -- 0:01:43
      681700 -- (-1988.135) (-1995.953) [-1990.649] (-1990.688) * (-1986.146) (-2001.224) (-2002.543) [-1989.451] -- 0:01:43
      681800 -- [-1988.461] (-1997.091) (-1991.130) (-1985.629) * (-1984.655) (-2003.815) (-2006.371) [-1993.127] -- 0:01:43
      681900 -- [-1988.013] (-1988.778) (-1991.596) (-1991.557) * (-1989.012) (-1998.044) [-1994.427] (-2001.924) -- 0:01:43
      682000 -- (-1986.722) (-1991.610) [-1985.269] (-1988.653) * (-1988.119) (-1997.367) (-2000.294) [-2001.301] -- 0:01:43

      Average standard deviation of split frequencies: 0.002903

      682100 -- [-1980.686] (-1991.679) (-1996.413) (-1988.785) * (-1987.634) (-1998.825) [-1991.498] (-1993.813) -- 0:01:42
      682200 -- (-1985.459) (-1992.388) (-1993.483) [-1988.626] * (-1987.663) [-1991.797] (-1991.665) (-2003.526) -- 0:01:42
      682300 -- [-1985.546] (-1999.492) (-1986.307) (-1989.914) * (-1987.289) [-1996.004] (-1998.230) (-2005.142) -- 0:01:43
      682400 -- (-1989.441) (-2002.349) [-1992.053] (-1991.161) * [-1986.132] (-1995.311) (-1993.583) (-1999.545) -- 0:01:43
      682500 -- [-1988.516] (-2000.574) (-1991.934) (-1986.671) * [-1990.058] (-1996.169) (-1998.589) (-1996.093) -- 0:01:43
      682600 -- (-1987.459) (-2005.146) (-1997.027) [-1986.764] * [-1986.563] (-1994.697) (-1998.229) (-2003.402) -- 0:01:43
      682700 -- (-1988.310) (-1999.269) (-1998.630) [-1992.247] * [-1988.675] (-2000.041) (-1997.857) (-2002.110) -- 0:01:43
      682800 -- (-1992.514) (-1998.657) (-1992.000) [-1988.514] * [-1985.600] (-2006.309) (-1995.631) (-2011.873) -- 0:01:43
      682900 -- (-1992.392) (-1998.027) [-1992.455] (-1988.852) * (-1989.146) (-2006.273) [-1993.102] (-2013.330) -- 0:01:43
      683000 -- [-1987.932] (-2003.151) (-2001.474) (-1990.529) * [-1983.263] (-2003.726) (-1993.429) (-2003.821) -- 0:01:43

      Average standard deviation of split frequencies: 0.002859

      683100 -- (-1992.852) (-1999.039) (-2008.097) [-1990.541] * (-1987.368) (-2002.387) (-1993.228) [-1998.234] -- 0:01:42
      683200 -- (-1992.032) (-1996.541) (-1998.942) [-1991.824] * (-1988.245) [-1993.897] (-1997.199) (-2007.189) -- 0:01:42
      683300 -- (-1992.621) (-1995.226) (-1992.399) [-1991.796] * (-1987.219) [-1995.869] (-1993.688) (-1990.621) -- 0:01:42
      683400 -- (-1994.709) (-1993.420) (-1989.151) [-1982.093] * (-1997.534) (-1993.262) (-1996.424) [-1986.027] -- 0:01:42
      683500 -- [-1986.903] (-1995.456) (-1991.132) (-1983.528) * (-2003.796) [-1991.244] (-1990.398) (-1993.673) -- 0:01:42
      683600 -- (-1989.555) (-1989.261) (-1999.300) [-1989.319] * (-2001.037) (-1990.209) [-1987.914] (-1997.939) -- 0:01:42
      683700 -- [-1993.103] (-1988.109) (-1996.609) (-1984.545) * [-1997.154] (-1989.706) (-1993.414) (-1996.901) -- 0:01:42
      683800 -- (-1987.378) (-1988.467) (-1991.309) [-1982.806] * (-1993.412) [-1987.795] (-1999.288) (-1993.658) -- 0:01:42
      683900 -- (-1990.838) (-1989.160) [-1993.257] (-1981.327) * [-1988.033] (-1995.622) (-2007.385) (-1985.382) -- 0:01:42
      684000 -- (-1991.259) [-1990.489] (-1997.261) (-1983.512) * [-1981.061] (-1998.894) (-1994.939) (-1989.229) -- 0:01:42

      Average standard deviation of split frequencies: 0.002874

      684100 -- (-1988.444) [-1989.592] (-2008.837) (-1989.623) * [-1982.802] (-2000.601) (-1991.907) (-1989.197) -- 0:01:42
      684200 -- (-1985.937) (-1989.073) (-1992.740) [-1985.064] * [-1981.597] (-2000.528) (-1992.582) (-1994.160) -- 0:01:42
      684300 -- (-1986.748) [-1984.116] (-1997.544) (-1991.656) * [-1981.456] (-1996.374) (-1995.584) (-1997.807) -- 0:01:42
      684400 -- (-1989.490) (-1984.366) [-1996.294] (-2003.205) * (-1983.497) (-1999.217) (-1992.534) [-1995.924] -- 0:01:42
      684500 -- [-1991.497] (-1989.068) (-1995.922) (-1999.618) * (-1981.018) (-2001.014) (-1992.928) [-1994.080] -- 0:01:42
      684600 -- (-1997.053) [-1988.329] (-2005.095) (-1992.795) * [-1983.626] (-1992.831) (-1996.967) (-1995.213) -- 0:01:42
      684700 -- (-1992.773) [-1987.683] (-2002.589) (-1992.122) * [-1985.549] (-2000.509) (-1993.896) (-1995.382) -- 0:01:42
      684800 -- (-2001.310) [-1987.645] (-1995.955) (-1992.096) * (-1982.701) (-2000.381) (-1998.238) [-1988.924] -- 0:01:42
      684900 -- (-2000.259) (-1985.937) (-2000.724) [-1991.608] * [-1988.706] (-1998.113) (-1991.614) (-1986.419) -- 0:01:42
      685000 -- (-1997.686) [-1988.350] (-1997.130) (-1991.303) * (-1986.338) (-1997.812) [-1988.629] (-1998.884) -- 0:01:42

      Average standard deviation of split frequencies: 0.002870

      685100 -- (-1995.046) (-1986.388) [-1995.146] (-1996.018) * (-1986.795) (-1997.938) (-1990.715) [-1993.748] -- 0:01:42
      685200 -- (-1993.973) (-1990.078) (-2003.651) [-1988.448] * [-1989.452] (-1998.223) (-1987.305) (-1987.723) -- 0:01:41
      685300 -- (-1993.764) (-1987.722) (-1997.130) [-1984.687] * (-1987.049) (-2002.311) [-1988.922] (-1995.334) -- 0:01:42
      685400 -- (-1996.856) [-1986.590] (-1998.108) (-1986.788) * [-1987.110] (-1999.386) (-1992.260) (-1993.309) -- 0:01:42
      685500 -- (-1988.568) [-1984.166] (-1997.249) (-1988.455) * [-1984.042] (-1995.825) (-1987.758) (-1994.239) -- 0:01:42
      685600 -- [-1988.093] (-1988.329) (-1999.400) (-1990.071) * [-1987.497] (-1991.375) (-1991.643) (-1987.809) -- 0:01:42
      685700 -- (-1984.166) (-1991.422) (-2006.085) [-1985.734] * [-1986.638] (-1992.437) (-1990.557) (-1989.988) -- 0:01:42
      685800 -- (-1989.904) [-1987.456] (-2004.330) (-1990.770) * (-1992.961) [-1990.729] (-1991.743) (-2000.407) -- 0:01:42
      685900 -- [-1982.100] (-1989.871) (-2006.980) (-1995.040) * (-2004.109) [-1985.845] (-1988.558) (-1988.211) -- 0:01:42
      686000 -- [-1986.257] (-1989.405) (-1998.102) (-1995.063) * (-2007.406) (-1989.054) [-1985.723] (-1994.756) -- 0:01:42

      Average standard deviation of split frequencies: 0.002748

      686100 -- [-1988.904] (-1990.581) (-1991.552) (-1990.619) * [-2000.904] (-1996.032) (-1989.358) (-1997.497) -- 0:01:42
      686200 -- [-1988.210] (-1990.965) (-1993.733) (-1994.287) * (-1998.354) (-1997.090) (-1987.286) [-1986.904] -- 0:01:41
      686300 -- (-1987.062) [-1985.440] (-1999.138) (-1988.616) * (-1991.868) (-1997.882) (-1998.252) [-1984.330] -- 0:01:41
      686400 -- [-1986.030] (-1992.692) (-1995.019) (-1987.959) * (-1991.147) (-1993.160) [-1993.429] (-1988.173) -- 0:01:41
      686500 -- (-1991.701) (-1992.390) (-1993.769) [-1985.468] * [-1987.775] (-1990.509) (-2002.080) (-1988.910) -- 0:01:41
      686600 -- [-1987.856] (-1992.019) (-1996.682) (-1992.836) * (-1989.169) (-1990.771) (-2002.223) [-1990.006] -- 0:01:41
      686700 -- [-1987.192] (-2003.497) (-1988.119) (-1993.695) * (-1991.828) [-1985.838] (-1999.209) (-1994.867) -- 0:01:41
      686800 -- (-1984.928) (-1992.733) [-1987.670] (-1999.096) * (-2000.879) [-1986.635] (-1995.575) (-1992.876) -- 0:01:41
      686900 -- (-1982.274) (-1998.931) (-1989.538) [-1988.794] * (-1998.181) (-1990.238) (-1992.742) [-1988.784] -- 0:01:41
      687000 -- [-1984.884] (-1998.869) (-1988.711) (-2001.003) * (-1990.511) (-1993.262) [-1989.396] (-1995.035) -- 0:01:41

      Average standard deviation of split frequencies: 0.002724

      687100 -- [-1986.553] (-2002.179) (-1991.579) (-2005.764) * (-1996.457) (-1995.489) [-1986.515] (-1997.204) -- 0:01:41
      687200 -- [-1987.360] (-1991.603) (-1990.788) (-2020.327) * (-1992.796) (-1989.902) [-1986.923] (-1999.895) -- 0:01:41
      687300 -- [-1984.933] (-1988.409) (-1995.499) (-1999.101) * [-1990.348] (-1996.806) (-1989.425) (-1999.930) -- 0:01:41
      687400 -- [-1989.398] (-1987.616) (-2008.642) (-1996.150) * (-1987.622) (-2001.768) [-1990.216] (-1988.595) -- 0:01:41
      687500 -- (-1992.158) [-1985.242] (-2008.852) (-1987.420) * (-1985.923) (-2004.925) [-1987.731] (-1989.813) -- 0:01:41
      687600 -- (-1988.152) (-1984.337) (-1999.939) [-1988.382] * (-1992.026) (-2012.137) (-1989.147) [-1995.306] -- 0:01:41
      687700 -- (-1992.618) (-1989.715) (-1994.560) [-1985.071] * (-1993.846) (-1995.616) [-1990.601] (-1997.823) -- 0:01:41
      687800 -- (-1997.517) (-1992.941) (-2006.414) [-1984.904] * (-2003.451) (-1998.971) [-1985.605] (-1989.435) -- 0:01:41
      687900 -- (-1990.429) (-1986.574) (-2005.144) [-1983.980] * (-1997.035) (-1989.064) [-1982.222] (-1991.833) -- 0:01:41
      688000 -- (-2000.255) (-1987.670) (-2004.834) [-1987.488] * (-2002.792) [-1988.698] (-1986.893) (-1997.726) -- 0:01:41

      Average standard deviation of split frequencies: 0.002721

      688100 -- (-1998.468) [-1987.700] (-2002.907) (-1991.169) * (-1997.034) [-1983.837] (-1988.626) (-1988.796) -- 0:01:41
      688200 -- (-1993.241) [-1983.389] (-1997.469) (-1985.797) * (-1988.995) [-1989.451] (-1990.819) (-1988.959) -- 0:01:41
      688300 -- (-1987.828) [-1986.968] (-1993.553) (-1995.702) * (-1992.626) (-1986.256) (-1990.936) [-1989.340] -- 0:01:41
      688400 -- (-2001.379) [-1985.685] (-1990.099) (-1991.654) * (-1993.779) (-1989.766) (-1989.250) [-1988.289] -- 0:01:41
      688500 -- (-2000.026) (-1993.108) (-1989.024) [-1994.706] * (-1996.775) [-1987.510] (-1994.878) (-1996.659) -- 0:01:41
      688600 -- (-1999.960) (-1980.041) [-1989.996] (-2002.473) * (-1993.879) (-1986.991) [-1993.863] (-1999.260) -- 0:01:41
      688700 -- (-1995.628) (-1980.818) [-1987.851] (-1995.352) * (-1993.005) [-1989.676] (-1986.705) (-1995.697) -- 0:01:41
      688800 -- (-2013.030) [-1981.509] (-1989.116) (-1994.954) * (-1990.520) (-1985.419) [-1983.806] (-1992.241) -- 0:01:41
      688900 -- (-2002.067) (-1983.741) (-1991.669) [-1993.776] * (-1996.103) (-1983.363) [-1985.084] (-1996.217) -- 0:01:41
      689000 -- (-1992.790) [-1984.224] (-1997.081) (-1994.198) * (-2000.111) [-1982.270] (-1986.549) (-1996.067) -- 0:01:41

      Average standard deviation of split frequencies: 0.002716

      689100 -- (-1996.272) [-1985.811] (-1988.660) (-1998.094) * (-2006.353) [-1984.473] (-1985.158) (-1991.191) -- 0:01:41
      689200 -- (-1992.655) [-1978.528] (-1990.813) (-1988.199) * (-2015.314) (-1983.511) (-1986.264) [-1988.443] -- 0:01:41
      689300 -- (-2000.238) [-1977.107] (-1986.798) (-1985.640) * (-2001.319) (-1989.922) [-1995.139] (-1995.720) -- 0:01:40
      689400 -- (-1997.289) (-1982.589) (-1988.337) [-1987.397] * (-2000.948) (-1992.541) [-1982.695] (-2001.574) -- 0:01:40
      689500 -- (-1993.372) [-1983.779] (-1987.133) (-1985.669) * (-1999.796) (-2000.587) [-1983.639] (-2004.326) -- 0:01:40
      689600 -- (-1991.065) (-1984.307) (-1988.938) [-1985.140] * (-1997.620) [-1988.702] (-1984.675) (-2015.743) -- 0:01:40
      689700 -- (-1988.749) [-1985.104] (-1985.081) (-1996.350) * (-2006.658) [-1983.592] (-1991.112) (-2008.013) -- 0:01:40
      689800 -- (-1988.082) [-1984.212] (-1987.795) (-1989.922) * (-2000.021) (-1983.252) [-1992.572] (-2002.814) -- 0:01:40
      689900 -- (-1997.988) (-1986.719) [-1987.819] (-1984.940) * [-1988.076] (-1987.547) (-1986.739) (-1996.359) -- 0:01:40
      690000 -- (-1996.625) (-1984.058) (-1991.442) [-1984.272] * [-1989.808] (-1998.495) (-1986.878) (-1994.399) -- 0:01:40

      Average standard deviation of split frequencies: 0.002849

      690100 -- (-1995.900) (-1985.110) (-1994.894) [-1989.152] * (-1997.497) (-1993.875) [-1987.842] (-2003.511) -- 0:01:40
      690200 -- (-1989.568) [-1985.963] (-1999.659) (-1983.777) * (-2001.113) (-1989.868) [-1989.601] (-2002.715) -- 0:01:40
      690300 -- (-1993.372) (-1992.945) (-1996.928) [-1983.487] * [-1991.626] (-1988.406) (-1979.648) (-1996.193) -- 0:01:40
      690400 -- (-1989.081) (-1995.566) (-1996.372) [-1984.665] * (-1992.272) (-1987.387) [-1979.254] (-1989.824) -- 0:01:40
      690500 -- (-1990.137) (-1985.531) [-1983.708] (-1985.222) * (-1995.421) (-1985.569) [-1986.504] (-1986.849) -- 0:01:40
      690600 -- (-1988.592) [-1991.169] (-1989.320) (-1983.595) * (-1992.056) [-1985.632] (-1985.917) (-1985.924) -- 0:01:40
      690700 -- [-1989.413] (-1992.555) (-1992.393) (-1989.217) * (-2003.612) (-1992.147) [-1984.537] (-1986.612) -- 0:01:40
      690800 -- (-1994.428) (-1995.076) (-1987.522) [-1978.607] * (-1993.906) (-1991.189) [-1984.434] (-1993.104) -- 0:01:40
      690900 -- (-1993.129) (-1985.362) (-1983.941) [-1976.872] * [-1993.088] (-1991.069) (-1987.071) (-1994.755) -- 0:01:40
      691000 -- (-1987.438) [-1988.569] (-1984.626) (-1983.058) * (-1999.604) [-1989.300] (-1987.828) (-2000.161) -- 0:01:40

      Average standard deviation of split frequencies: 0.002825

      691100 -- (-1988.203) (-1982.896) [-1989.023] (-1986.456) * (-1993.671) [-1989.388] (-1990.974) (-2004.879) -- 0:01:40
      691200 -- (-1990.120) [-1981.456] (-1998.899) (-1986.992) * (-1992.357) (-1995.145) [-1986.793] (-2001.481) -- 0:01:40
      691300 -- (-1999.627) [-1986.308] (-1989.789) (-1992.929) * (-1994.172) (-1990.286) [-1987.974] (-2000.149) -- 0:01:40
      691400 -- (-1993.710) [-1986.162] (-1994.178) (-1994.327) * (-1992.396) [-1987.522] (-1981.345) (-1992.544) -- 0:01:40
      691500 -- [-1987.744] (-1998.006) (-1993.978) (-1994.724) * (-1999.410) (-1991.155) [-1981.659] (-1998.988) -- 0:01:40
      691600 -- [-1992.502] (-1997.624) (-1996.370) (-1983.454) * (-1997.258) (-1990.929) (-1983.128) [-1992.224] -- 0:01:40
      691700 -- (-1993.732) (-1992.911) (-1993.227) [-1984.846] * (-1995.904) [-1992.404] (-1980.836) (-2002.390) -- 0:01:40
      691800 -- [-1993.307] (-1998.075) (-1987.409) (-1997.606) * (-1993.600) [-1991.030] (-1989.456) (-1993.707) -- 0:01:40
      691900 -- (-1994.929) (-1994.732) [-1994.591] (-2001.767) * [-1990.856] (-1994.742) (-1984.900) (-2000.361) -- 0:01:40
      692000 -- (-1996.514) [-1989.479] (-1994.398) (-1996.857) * (-1991.452) (-1993.383) [-1985.187] (-2004.984) -- 0:01:40

      Average standard deviation of split frequencies: 0.002841

      692100 -- (-2001.285) [-1988.567] (-1994.656) (-1995.071) * (-1988.815) [-1984.025] (-1987.987) (-1993.549) -- 0:01:40
      692200 -- (-1996.454) [-1987.628] (-2000.471) (-1988.774) * (-1992.660) (-1985.876) (-1985.806) [-1991.158] -- 0:01:40
      692300 -- (-2000.569) (-1983.820) (-1998.181) [-1981.164] * (-1992.604) [-1984.222] (-1988.534) (-1994.931) -- 0:01:40
      692400 -- (-2002.833) (-1982.847) (-1986.843) [-1988.242] * (-1996.329) (-1982.671) [-1988.194] (-1997.994) -- 0:01:39
      692500 -- (-2006.302) [-1979.522] (-1989.150) (-1984.688) * (-1994.037) (-1985.634) [-1986.328] (-1999.069) -- 0:01:39
      692600 -- (-1999.491) [-1987.165] (-1991.386) (-1987.569) * (-1999.847) [-1985.795] (-1991.629) (-1999.825) -- 0:01:39
      692700 -- (-1991.676) [-1986.020] (-1991.208) (-1992.507) * (-2009.231) [-1984.539] (-1990.425) (-1987.548) -- 0:01:39
      692800 -- (-1994.176) [-1988.753] (-1985.990) (-1993.233) * (-1994.548) [-1986.101] (-1996.412) (-1986.165) -- 0:01:39
      692900 -- (-1995.410) [-1983.711] (-1990.278) (-1989.586) * [-1983.567] (-1985.293) (-1994.894) (-1990.848) -- 0:01:39
      693000 -- (-2004.168) [-1983.125] (-1996.303) (-1984.142) * [-1985.812] (-1990.953) (-1988.343) (-1991.373) -- 0:01:39

      Average standard deviation of split frequencies: 0.002798

      693100 -- (-1994.084) [-1985.716] (-1998.715) (-1988.309) * (-1989.640) (-1998.668) (-1990.128) [-1986.944] -- 0:01:39
      693200 -- (-1985.820) (-1999.251) [-1993.968] (-1988.226) * (-1992.663) (-2000.158) (-1992.265) [-1988.827] -- 0:01:39
      693300 -- (-1983.217) (-1995.149) (-2003.477) [-1983.447] * (-2000.502) (-2003.157) [-1987.276] (-1992.374) -- 0:01:39
      693400 -- [-1986.965] (-1990.231) (-1996.233) (-1983.196) * (-2003.142) (-2000.684) (-1987.703) [-1996.409] -- 0:01:39
      693500 -- (-1991.591) (-1986.344) (-2003.531) [-1986.663] * (-1987.800) (-2010.036) (-1991.071) [-1988.094] -- 0:01:39
      693600 -- (-1989.970) [-1986.393] (-2000.957) (-1981.197) * (-1985.582) (-2015.732) [-1982.579] (-1987.705) -- 0:01:39
      693700 -- (-1989.062) [-1984.752] (-2007.374) (-1983.759) * [-1983.780] (-2018.217) (-1979.629) (-1986.167) -- 0:01:39
      693800 -- (-1988.772) [-1987.948] (-1999.086) (-1990.624) * [-1982.245] (-2007.058) (-1976.953) (-1990.485) -- 0:01:39
      693900 -- [-1988.012] (-1987.683) (-2007.305) (-1992.462) * (-1984.616) (-2000.681) [-1977.585] (-1998.101) -- 0:01:39
      694000 -- (-1986.894) [-1981.810] (-2005.289) (-1992.224) * (-1988.430) (-1998.063) [-1978.459] (-1995.234) -- 0:01:39

      Average standard deviation of split frequencies: 0.002949

      694100 -- (-1985.660) [-1982.754] (-2005.423) (-1991.509) * (-1990.963) (-1996.173) [-1981.968] (-1993.753) -- 0:01:39
      694200 -- [-1987.957] (-1985.313) (-1993.349) (-1992.268) * (-1992.300) [-1990.268] (-1984.474) (-1999.887) -- 0:01:39
      694300 -- [-1989.901] (-1986.982) (-1997.779) (-1992.042) * [-1984.933] (-1990.488) (-1990.558) (-2009.454) -- 0:01:39
      694400 -- (-1989.685) [-1983.749] (-1992.652) (-1995.820) * (-1990.619) [-1985.915] (-1997.349) (-2018.710) -- 0:01:39
      694500 -- (-1998.717) [-1984.733] (-1994.174) (-1996.515) * (-1992.628) [-1984.289] (-1997.918) (-2004.261) -- 0:01:39
      694600 -- (-2000.058) (-1984.674) [-1988.345] (-1985.740) * (-1990.549) (-1991.585) (-1997.275) [-1996.266] -- 0:01:39
      694700 -- [-1991.362] (-1991.554) (-1988.639) (-1983.829) * (-1986.739) [-1984.886] (-2001.757) (-1989.118) -- 0:01:39
      694800 -- (-1992.283) (-1988.363) [-1991.284] (-1983.607) * (-1991.141) [-1985.045] (-1998.131) (-1991.423) -- 0:01:39
      694900 -- (-2002.457) [-1985.256] (-1996.398) (-1985.289) * (-1986.542) (-1986.610) (-1991.569) [-1991.434] -- 0:01:39
      695000 -- (-2004.662) [-1982.280] (-1997.414) (-1985.041) * [-1981.179] (-1982.676) (-1997.900) (-1993.097) -- 0:01:39

      Average standard deviation of split frequencies: 0.003003

      695100 -- (-2003.757) [-1987.035] (-1998.591) (-1989.029) * (-1995.385) (-1988.348) (-2002.469) [-1985.455] -- 0:01:39
      695200 -- [-1996.929] (-2003.045) (-2000.064) (-1987.030) * (-1995.308) [-1981.440] (-1996.990) (-1987.131) -- 0:01:39
      695300 -- (-2001.333) [-1985.983] (-2001.155) (-1998.421) * (-1995.978) [-1975.877] (-1994.678) (-1987.743) -- 0:01:39
      695400 -- (-1990.716) (-1986.296) (-2000.668) [-1991.485] * (-2000.833) [-1982.969] (-1991.952) (-1988.301) -- 0:01:38
      695500 -- (-1995.042) (-1997.772) [-1996.669] (-1994.996) * (-1994.959) [-1981.008] (-1991.024) (-1987.009) -- 0:01:38
      695600 -- (-1997.897) (-2007.993) (-1998.959) [-1986.905] * [-1986.122] (-1980.876) (-1992.437) (-1986.089) -- 0:01:38
      695700 -- (-2004.811) (-2004.631) (-2003.001) [-1986.349] * (-1992.681) [-1987.182] (-1981.997) (-1983.828) -- 0:01:38
      695800 -- (-2001.583) (-1996.024) (-2008.312) [-1987.374] * (-1993.168) (-1990.973) [-1982.719] (-1986.591) -- 0:01:38
      695900 -- (-2000.886) [-1987.212] (-2005.056) (-1997.985) * (-1991.958) (-1987.275) [-1983.894] (-1992.008) -- 0:01:38
      696000 -- (-1994.998) (-1990.959) (-1999.258) [-1992.637] * [-1990.271] (-1991.994) (-1983.124) (-1990.389) -- 0:01:38

      Average standard deviation of split frequencies: 0.002999

      696100 -- [-1994.134] (-1998.031) (-1993.763) (-1988.936) * (-1985.984) [-1983.071] (-1983.274) (-1993.270) -- 0:01:38
      696200 -- [-1991.951] (-1995.542) (-1991.324) (-1986.854) * (-1990.092) [-1985.797] (-1985.891) (-1995.930) -- 0:01:38
      696300 -- [-1987.022] (-1992.814) (-1995.595) (-1989.954) * (-1990.960) (-1987.504) [-1981.749] (-2002.676) -- 0:01:38
      696400 -- [-1987.231] (-1987.724) (-2000.201) (-1982.240) * [-1988.413] (-1987.195) (-1984.332) (-2000.894) -- 0:01:38
      696500 -- (-1989.732) [-1984.622] (-2001.303) (-1982.663) * [-1981.001] (-1984.839) (-1981.923) (-1998.176) -- 0:01:38
      696600 -- (-1983.581) (-1986.125) (-1992.349) [-1982.220] * (-1982.501) (-1985.017) [-1977.648] (-2002.463) -- 0:01:38
      696700 -- [-1986.093] (-1987.077) (-1993.211) (-1986.228) * (-1981.353) (-1982.178) [-1979.891] (-1992.895) -- 0:01:38
      696800 -- [-1987.431] (-1996.915) (-1995.929) (-1986.076) * [-1977.870] (-1978.310) (-1985.292) (-1988.433) -- 0:01:38
      696900 -- (-1990.633) (-1995.284) (-1996.677) [-1985.854] * [-1980.481] (-1982.699) (-1992.290) (-1993.514) -- 0:01:38
      697000 -- (-1982.485) (-1995.765) [-1989.505] (-1983.408) * (-1979.864) [-1978.358] (-2007.634) (-1990.044) -- 0:01:38

      Average standard deviation of split frequencies: 0.003091

      697100 -- [-1986.918] (-1990.648) (-1998.939) (-1984.951) * [-1984.129] (-1978.547) (-1994.904) (-1991.159) -- 0:01:38
      697200 -- [-1984.434] (-1994.547) (-2011.159) (-1986.206) * (-1982.937) [-1979.851] (-1989.254) (-1987.697) -- 0:01:38
      697300 -- [-1986.908] (-1994.019) (-2000.802) (-1988.026) * (-1986.220) (-1983.459) (-1985.797) [-1984.165] -- 0:01:38
      697400 -- (-1986.298) (-1994.551) (-2001.312) [-1985.726] * (-1986.944) [-1981.031] (-1991.107) (-1992.095) -- 0:01:38
      697500 -- (-1984.594) (-2002.267) (-1996.730) [-1986.964] * [-1982.918] (-1982.660) (-1998.272) (-1989.769) -- 0:01:38
      697600 -- (-1991.023) (-1999.411) [-1991.732] (-1989.689) * [-1979.301] (-1985.019) (-1997.844) (-1999.798) -- 0:01:38
      697700 -- (-1991.153) (-1994.648) (-1989.199) [-1989.249] * [-1980.817] (-1994.266) (-1996.484) (-1999.198) -- 0:01:38
      697800 -- (-1996.113) (-1996.335) [-1986.317] (-1987.501) * [-1981.351] (-1990.318) (-1989.662) (-1999.899) -- 0:01:38
      697900 -- (-1991.042) (-1997.475) [-1988.669] (-1992.982) * [-1980.328] (-1988.112) (-1995.361) (-1996.136) -- 0:01:38
      698000 -- [-1985.546] (-1999.140) (-1995.217) (-1990.109) * [-1981.995] (-1989.931) (-1992.986) (-1989.187) -- 0:01:38

      Average standard deviation of split frequencies: 0.003222

      698100 -- (-1986.666) (-1998.849) [-1988.974] (-1987.137) * (-1983.305) (-1991.285) (-1997.241) [-1988.508] -- 0:01:38
      698200 -- (-1990.739) (-1992.560) (-1986.517) [-1984.746] * (-1990.342) (-1995.340) (-1993.302) [-1989.213] -- 0:01:38
      698300 -- (-1994.444) (-1996.214) [-1986.723] (-1994.157) * [-1988.588] (-1997.985) (-1994.616) (-1983.937) -- 0:01:38
      698400 -- (-1988.529) (-1997.897) [-1984.677] (-2001.440) * (-1986.698) (-2000.292) [-1991.468] (-1987.844) -- 0:01:38
      698500 -- (-1994.315) (-1986.541) [-1985.414] (-1992.123) * [-1981.725] (-1997.630) (-1989.636) (-1982.590) -- 0:01:37
      698600 -- [-1997.058] (-1989.970) (-1987.708) (-1998.845) * [-1981.549] (-1994.679) (-1997.995) (-1989.199) -- 0:01:37
      698700 -- (-1997.282) [-1985.579] (-1987.566) (-2008.971) * [-1983.951] (-1995.147) (-1996.273) (-1988.768) -- 0:01:37
      698800 -- (-1994.566) (-1979.652) [-1987.743] (-2014.709) * [-1982.677] (-1998.914) (-1997.456) (-1989.019) -- 0:01:37
      698900 -- (-1995.748) [-1983.845] (-1991.423) (-2016.640) * (-1981.096) [-1996.560] (-1993.268) (-1995.863) -- 0:01:37
      699000 -- [-1992.783] (-1986.740) (-1991.295) (-2007.621) * [-1980.270] (-1982.645) (-1992.287) (-1993.555) -- 0:01:37

      Average standard deviation of split frequencies: 0.003217

      699100 -- (-1991.175) (-1983.673) [-1990.858] (-2009.819) * [-1978.467] (-1983.432) (-1986.774) (-1999.330) -- 0:01:37
      699200 -- (-1993.006) (-1992.615) [-1992.951] (-2007.379) * [-1983.297] (-1987.490) (-1988.768) (-1993.020) -- 0:01:37
      699300 -- (-1991.671) (-1991.330) [-1986.502] (-2007.726) * [-1984.447] (-1987.151) (-1992.809) (-1996.267) -- 0:01:37
      699400 -- (-1990.538) [-1990.678] (-1984.217) (-1999.913) * (-1984.898) (-1990.840) [-1986.760] (-1994.981) -- 0:01:37
      699500 -- (-1990.982) [-1984.567] (-1996.248) (-1994.368) * [-1979.474] (-1988.924) (-1993.654) (-1991.241) -- 0:01:37
      699600 -- [-1986.640] (-1984.504) (-1991.120) (-1992.760) * (-1986.558) (-1988.594) (-1992.842) [-1986.955] -- 0:01:37
      699700 -- (-1988.181) [-1983.238] (-1993.383) (-1993.278) * (-1987.693) (-1989.150) (-1987.147) [-1981.511] -- 0:01:37
      699800 -- (-1994.694) [-1984.316] (-1990.292) (-1987.940) * (-1989.568) (-1994.384) (-1988.805) [-1982.848] -- 0:01:37
      699900 -- (-1994.627) [-1983.280] (-1999.505) (-1995.667) * (-1986.717) (-1988.109) (-1994.318) [-1987.276] -- 0:01:37
      700000 -- [-1993.322] (-1981.958) (-1998.907) (-2001.628) * (-1988.287) (-1988.792) [-1991.574] (-1989.003) -- 0:01:37

      Average standard deviation of split frequencies: 0.003232

      700100 -- (-1988.807) [-1985.006] (-1998.489) (-2003.301) * (-1996.052) (-1995.183) (-1993.548) [-1985.873] -- 0:01:37
      700200 -- [-1987.227] (-1986.482) (-1995.748) (-1999.846) * (-1990.227) (-1996.778) (-1987.595) [-1985.055] -- 0:01:37
      700300 -- [-1987.379] (-1991.152) (-1987.788) (-2000.766) * (-1997.223) (-2005.913) [-1992.013] (-1984.017) -- 0:01:37
      700400 -- [-1990.550] (-1991.239) (-1991.713) (-1995.893) * (-1997.727) (-1996.219) (-1990.692) [-1984.062] -- 0:01:37
      700500 -- (-1993.001) (-1989.021) [-1989.288] (-1991.643) * [-1987.653] (-1994.314) (-1998.113) (-1982.283) -- 0:01:37
      700600 -- (-2000.910) [-1996.037] (-1989.463) (-1997.399) * (-1989.016) (-1997.979) (-1995.908) [-1982.981] -- 0:01:37
      700700 -- (-1996.750) [-1986.781] (-1985.726) (-2009.215) * [-1989.935] (-1999.210) (-1993.721) (-1984.946) -- 0:01:37
      700800 -- (-2005.182) [-1980.506] (-1990.375) (-2002.210) * (-1988.915) (-1994.124) [-1990.476] (-1991.583) -- 0:01:37
      700900 -- (-1999.296) [-1979.268] (-1987.016) (-1997.018) * (-1996.057) (-2000.256) (-1988.276) [-1985.900] -- 0:01:37
      701000 -- (-1988.383) [-1981.305] (-1988.099) (-1995.570) * [-1993.830] (-1992.709) (-1998.316) (-1986.259) -- 0:01:37

      Average standard deviation of split frequencies: 0.003246

      701100 -- (-1994.794) [-1981.592] (-1995.412) (-2000.747) * (-1991.301) (-1994.795) (-1996.112) [-1986.988] -- 0:01:37
      701200 -- (-1997.752) (-1978.698) (-1990.358) [-1990.530] * [-1987.363] (-1995.605) (-1991.847) (-1994.803) -- 0:01:37
      701300 -- (-1992.219) [-1980.547] (-1991.613) (-1984.919) * [-1988.486] (-1986.045) (-1990.902) (-1987.988) -- 0:01:37
      701400 -- (-1996.464) (-1980.581) (-1991.430) [-1984.104] * (-1989.756) (-1988.157) [-1993.399] (-1981.953) -- 0:01:37
      701500 -- (-2007.087) [-1981.065] (-1987.904) (-1984.779) * (-1991.105) (-1995.435) (-2000.317) [-1981.319] -- 0:01:37
      701600 -- (-2008.020) (-1983.829) [-1986.701] (-1987.745) * [-1994.392] (-1989.882) (-1995.397) (-1981.561) -- 0:01:36
      701700 -- (-1999.764) (-1988.984) [-1987.594] (-1987.809) * (-1988.980) (-1995.323) (-1990.143) [-1984.831] -- 0:01:36
      701800 -- (-2004.871) [-1986.318] (-1986.288) (-1985.785) * [-1993.840] (-2001.607) (-1995.100) (-1988.371) -- 0:01:36
      701900 -- (-1995.306) (-1982.472) [-1986.758] (-1988.697) * [-1982.484] (-1995.927) (-1991.753) (-1983.135) -- 0:01:36
      702000 -- (-1988.923) [-1980.912] (-1989.756) (-1988.957) * [-1986.134] (-1987.944) (-1995.641) (-1984.734) -- 0:01:36

      Average standard deviation of split frequencies: 0.003146

      702100 -- (-1990.668) [-1980.128] (-1984.226) (-1986.135) * (-1983.488) (-1986.665) (-1995.215) [-1983.217] -- 0:01:36
      702200 -- (-1998.201) [-1980.982] (-1984.923) (-1989.598) * (-1997.284) [-1984.940] (-1993.033) (-1988.694) -- 0:01:36
      702300 -- (-1997.939) [-1982.637] (-1991.433) (-2003.729) * (-1996.704) [-1989.575] (-1997.394) (-1997.407) -- 0:01:36
      702400 -- (-1995.235) [-1984.675] (-1989.815) (-1998.104) * (-1991.645) (-1996.564) [-1989.981] (-2003.559) -- 0:01:36
      702500 -- (-1997.876) [-1986.398] (-1988.232) (-1990.673) * [-1987.056] (-1991.762) (-1988.172) (-1998.570) -- 0:01:36
      702600 -- (-1994.778) (-1987.660) [-1986.755] (-1992.719) * [-1985.268] (-1987.103) (-1987.083) (-1991.477) -- 0:01:36
      702700 -- (-1990.983) [-1980.811] (-2002.725) (-1989.665) * [-1984.805] (-1986.924) (-2001.310) (-1984.692) -- 0:01:36
      702800 -- (-2002.295) [-1983.072] (-1994.968) (-1995.022) * (-1984.725) (-1996.413) (-1995.722) [-1980.962] -- 0:01:36
      702900 -- (-1999.033) [-1981.471] (-1996.522) (-1991.851) * [-1992.655] (-1993.298) (-1991.994) (-1982.176) -- 0:01:36
      703000 -- (-2000.491) [-1987.256] (-1990.599) (-1998.192) * (-1990.972) [-1989.435] (-1998.391) (-1984.229) -- 0:01:36

      Average standard deviation of split frequencies: 0.002988

      703100 -- (-2002.288) [-1982.569] (-1993.847) (-1995.149) * [-1986.216] (-1991.535) (-1990.403) (-1987.669) -- 0:01:36
      703200 -- (-1993.857) (-1989.840) (-1984.827) [-1988.500] * [-1985.385] (-1998.758) (-1992.758) (-1994.525) -- 0:01:36
      703300 -- (-1997.190) [-1982.993] (-1987.640) (-1985.267) * [-1984.110] (-2000.288) (-1993.287) (-1997.617) -- 0:01:36
      703400 -- (-2008.213) [-1983.045] (-1990.158) (-1991.107) * (-1984.693) (-2013.686) (-1993.153) [-1996.340] -- 0:01:36
      703500 -- [-1997.280] (-1989.530) (-1991.813) (-1994.832) * [-1985.592] (-2011.363) (-1990.434) (-1993.174) -- 0:01:36
      703600 -- [-1993.164] (-1987.398) (-1992.602) (-1997.265) * [-1981.337] (-2003.687) (-1992.020) (-1993.247) -- 0:01:36
      703700 -- (-1989.888) [-1982.196] (-1997.375) (-1993.997) * [-1978.871] (-2007.997) (-1994.255) (-1996.959) -- 0:01:36
      703800 -- (-1994.338) [-1980.963] (-1997.356) (-1986.890) * (-1983.125) (-1994.591) [-1985.307] (-1987.978) -- 0:01:36
      703900 -- (-1999.139) [-1979.338] (-1994.716) (-1988.633) * (-1980.102) (-2001.182) [-1978.198] (-2000.371) -- 0:01:36
      704000 -- (-1989.171) [-1984.686] (-2004.005) (-1994.328) * (-1979.612) (-2002.989) [-1979.251] (-1994.184) -- 0:01:36

      Average standard deviation of split frequencies: 0.003118

      704100 -- (-1986.276) [-1984.386] (-1994.521) (-1989.989) * (-1986.193) (-2009.787) [-1978.289] (-1994.896) -- 0:01:36
      704200 -- (-1985.433) [-1979.726] (-1998.086) (-1998.501) * (-1983.962) (-2011.530) [-1981.404] (-1989.769) -- 0:01:36
      704300 -- (-1985.696) [-1982.852] (-2005.508) (-1998.937) * (-1984.768) (-2007.041) [-1985.134] (-1995.037) -- 0:01:36
      704400 -- (-1987.095) [-1977.402] (-1993.094) (-1995.646) * [-1986.188] (-1993.383) (-1990.962) (-1992.911) -- 0:01:36
      704500 -- (-1989.919) [-1982.437] (-1996.116) (-2000.079) * (-1983.354) [-1989.814] (-1984.063) (-1996.769) -- 0:01:36
      704600 -- (-1990.872) [-1987.274] (-1997.008) (-1989.509) * [-1983.627] (-1996.132) (-1985.243) (-2002.672) -- 0:01:36
      704700 -- (-1995.194) (-1985.503) (-1998.047) [-1990.889] * (-1987.378) (-1994.233) [-1986.187] (-1998.228) -- 0:01:35
      704800 -- (-1992.910) [-1988.119] (-1996.934) (-1993.639) * (-1990.122) [-1992.350] (-1984.790) (-1996.878) -- 0:01:35
      704900 -- (-1990.320) (-1986.652) (-1990.930) [-1985.951] * (-1995.743) (-1999.104) [-1983.363] (-1997.573) -- 0:01:35
      705000 -- (-1995.962) (-1990.565) [-1993.169] (-1987.035) * (-1995.617) (-1991.691) [-1983.189] (-1995.356) -- 0:01:35

      Average standard deviation of split frequencies: 0.003190

      705100 -- (-1994.554) (-1992.970) [-1988.187] (-1998.878) * (-1991.315) [-1990.400] (-1981.781) (-1996.705) -- 0:01:35
      705200 -- (-1998.670) (-1993.496) [-1985.113] (-1993.950) * (-1987.868) (-1996.683) [-1984.262] (-1998.720) -- 0:01:35
      705300 -- (-2006.119) [-1988.196] (-1989.287) (-1990.477) * (-1983.418) (-1990.965) (-1988.109) [-1993.646] -- 0:01:35
      705400 -- (-2003.029) [-1987.648] (-1992.614) (-1993.007) * [-1983.514] (-1994.090) (-1985.508) (-1989.771) -- 0:01:35
      705500 -- (-2003.387) (-1980.822) [-1989.563] (-1994.355) * (-1984.874) (-2001.444) (-1991.657) [-1988.884] -- 0:01:35
      705600 -- (-1996.432) [-1982.349] (-2003.527) (-1993.720) * (-1984.767) [-1992.929] (-1992.560) (-1991.894) -- 0:01:35
      705700 -- (-1997.750) [-1982.920] (-1997.871) (-1988.731) * [-1986.104] (-2003.247) (-1990.817) (-1999.239) -- 0:01:35
      705800 -- (-1998.582) [-1986.766] (-1991.565) (-1991.583) * (-1983.373) (-1998.957) [-1983.875] (-2002.752) -- 0:01:35
      705900 -- (-1999.480) (-1985.272) (-1988.019) [-1986.640] * [-1985.185] (-1991.917) (-1983.491) (-2009.871) -- 0:01:35
      706000 -- (-2005.103) (-1987.240) [-1986.123] (-1982.825) * [-1983.772] (-1995.270) (-1996.559) (-2000.634) -- 0:01:35

      Average standard deviation of split frequencies: 0.003147

      706100 -- (-2004.486) [-1988.868] (-1985.429) (-1981.012) * [-1987.443] (-1995.472) (-1992.126) (-1996.480) -- 0:01:35
      706200 -- (-2004.114) (-1990.698) (-1987.136) [-1982.462] * (-1986.642) (-2005.538) (-1990.203) [-1999.910] -- 0:01:35
      706300 -- (-2003.867) (-1992.875) (-1985.667) [-1981.087] * [-1991.930] (-2006.472) (-1990.291) (-1995.274) -- 0:01:35
      706400 -- (-1995.547) [-1989.779] (-1989.504) (-1982.032) * (-1984.560) [-1998.635] (-1988.579) (-1994.567) -- 0:01:35
      706500 -- (-1994.050) (-1993.610) (-1987.260) [-1984.287] * [-1982.741] (-2003.273) (-1995.772) (-1998.898) -- 0:01:35
      706600 -- (-1999.997) (-1994.199) (-1987.415) [-1984.824] * (-1982.879) (-2011.493) (-1985.331) [-1990.011] -- 0:01:35
      706700 -- (-1993.395) (-2002.768) (-1992.562) [-1983.670] * [-1986.842] (-1998.127) (-1984.470) (-1987.678) -- 0:01:35
      706800 -- (-1993.276) (-1998.624) (-1987.566) [-1983.256] * [-1987.987] (-1996.924) (-1987.194) (-1991.512) -- 0:01:35
      706900 -- (-1990.946) (-1995.568) (-2000.884) [-1983.068] * [-1994.459] (-1989.638) (-1990.886) (-1993.960) -- 0:01:35
      707000 -- (-1989.884) (-1998.636) (-2002.985) [-1983.089] * (-1986.602) (-1991.803) [-1983.361] (-1992.745) -- 0:01:35

      Average standard deviation of split frequencies: 0.003238

      707100 -- (-1991.089) [-1997.181] (-1994.851) (-1986.457) * [-1991.620] (-1989.104) (-1982.166) (-1993.295) -- 0:01:35
      707200 -- [-1991.346] (-1993.801) (-1991.547) (-1989.342) * (-1990.629) [-1985.441] (-1980.992) (-1998.889) -- 0:01:35
      707300 -- (-1988.927) (-1989.723) (-1995.967) [-1984.957] * (-1993.032) (-1983.969) [-1982.243] (-2002.526) -- 0:01:35
      707400 -- [-1990.041] (-2001.564) (-2005.376) (-1992.965) * (-1987.974) [-1985.984] (-1986.861) (-2000.698) -- 0:01:35
      707500 -- (-1988.725) (-1991.996) (-2002.934) [-1992.185] * (-1995.851) (-1983.011) [-1980.277] (-2004.739) -- 0:01:35
      707600 -- [-1987.889] (-1992.675) (-1998.869) (-1990.984) * (-1990.360) [-1986.265] (-1979.002) (-2000.086) -- 0:01:35
      707700 -- (-1991.798) [-1985.890] (-1992.338) (-2002.504) * [-1988.439] (-1987.129) (-1981.851) (-1996.377) -- 0:01:34
      707800 -- (-1996.741) [-1983.950] (-2000.225) (-1996.498) * (-1994.730) [-1984.481] (-1981.435) (-2003.675) -- 0:01:34
      707900 -- (-2002.562) [-1982.663] (-1994.320) (-1992.383) * (-1991.212) (-1994.402) [-1978.454] (-1997.609) -- 0:01:34
      708000 -- (-1996.762) (-1983.701) (-1998.703) [-1991.406] * (-1988.861) (-1990.970) [-1979.297] (-2000.226) -- 0:01:34

      Average standard deviation of split frequencies: 0.003157

      708100 -- (-1995.505) (-1990.709) (-1994.423) [-1988.929] * (-1984.211) (-1991.486) [-1980.578] (-1990.393) -- 0:01:34
      708200 -- (-1994.980) (-1991.754) (-1996.750) [-1987.619] * (-1979.870) (-1997.808) [-1987.975] (-1999.790) -- 0:01:34
      708300 -- (-2001.985) [-1989.313] (-2003.856) (-1984.323) * [-1978.382] (-1995.509) (-1981.740) (-1994.343) -- 0:01:34
      708400 -- (-2004.583) [-1983.099] (-2000.896) (-1986.636) * (-1982.163) (-1991.933) [-1980.696] (-1991.086) -- 0:01:34
      708500 -- (-2008.123) (-1981.101) (-2001.662) [-1988.554] * (-1986.426) (-1995.125) [-1984.623] (-2003.476) -- 0:01:34
      708600 -- (-2005.704) [-1981.253] (-2003.806) (-1986.742) * (-1987.454) (-1994.508) [-1985.906] (-2007.640) -- 0:01:34
      708700 -- (-1992.388) [-1979.459] (-1999.398) (-1987.103) * (-1985.889) (-2000.884) [-1985.059] (-1997.773) -- 0:01:34
      708800 -- (-1993.353) [-1980.940] (-2003.605) (-1990.578) * [-1984.510] (-1996.593) (-1982.637) (-1992.385) -- 0:01:34
      708900 -- (-1990.989) [-1989.760] (-1997.756) (-1987.395) * [-1985.225] (-1995.381) (-1986.443) (-1990.834) -- 0:01:34
      709000 -- (-1991.933) (-1999.444) (-2010.377) [-1981.263] * (-1994.327) (-1992.445) [-1978.279] (-1983.912) -- 0:01:34

      Average standard deviation of split frequencies: 0.003191

      709100 -- [-1990.348] (-1994.267) (-1996.214) (-1986.276) * (-1990.336) (-1990.857) [-1983.297] (-1990.043) -- 0:01:34
      709200 -- (-1994.533) (-1990.635) (-1995.501) [-1983.572] * [-1986.980] (-1995.224) (-1990.251) (-1994.174) -- 0:01:34
      709300 -- (-1990.985) (-1995.676) (-1995.194) [-1986.488] * (-1987.914) [-1990.118] (-1995.530) (-1984.215) -- 0:01:34
      709400 -- (-1993.317) (-2002.247) (-1990.398) [-1988.898] * (-1986.906) (-1985.906) [-1985.148] (-1988.768) -- 0:01:34
      709500 -- (-1993.610) (-1992.706) (-2001.145) [-1984.879] * [-1985.052] (-1985.787) (-1988.487) (-1985.061) -- 0:01:34
      709600 -- (-1998.345) [-1988.963] (-1990.175) (-1987.188) * [-1980.877] (-1986.487) (-1991.412) (-1985.132) -- 0:01:34
      709700 -- (-1996.615) (-1994.462) (-1996.731) [-1983.575] * [-1984.001] (-1988.134) (-1986.697) (-1982.890) -- 0:01:34
      709800 -- (-1988.138) (-1988.509) (-1997.701) [-1988.565] * (-1987.277) (-1993.312) (-1995.437) [-1986.636] -- 0:01:34
      709900 -- (-1989.115) [-1986.078] (-1997.640) (-1999.273) * [-1984.118] (-1995.806) (-1987.250) (-1992.347) -- 0:01:34
      710000 -- (-1991.000) [-1985.077] (-1992.989) (-1992.853) * [-1985.764] (-2004.053) (-1989.837) (-1997.201) -- 0:01:34

      Average standard deviation of split frequencies: 0.003186

      710100 -- (-1993.143) (-1990.412) [-1990.181] (-1994.795) * (-1989.776) (-1996.912) (-1988.498) [-1995.498] -- 0:01:34
      710200 -- (-1991.527) [-1991.501] (-1991.073) (-1987.247) * (-1984.408) (-2003.847) [-1982.546] (-1993.591) -- 0:01:34
      710300 -- (-1993.525) (-1988.501) (-1994.083) [-1979.864] * (-1986.656) (-1997.294) [-1982.367] (-2010.272) -- 0:01:34
      710400 -- (-1989.741) (-1992.029) (-1995.480) [-1979.005] * [-1984.404] (-1994.775) (-1987.355) (-2002.622) -- 0:01:34
      710500 -- (-1993.596) (-1983.350) (-1997.441) [-1977.259] * (-1985.548) (-1992.956) [-1990.173] (-1996.789) -- 0:01:34
      710600 -- (-1996.186) (-1987.244) (-1996.333) [-1979.176] * [-1985.682] (-1992.257) (-1989.978) (-2001.419) -- 0:01:34
      710700 -- (-1989.001) (-1981.888) (-1997.921) [-1979.706] * [-1981.890] (-1992.957) (-1988.801) (-2002.089) -- 0:01:34
      710800 -- (-1990.582) (-1983.890) (-1989.879) [-1981.636] * (-1987.560) (-1994.194) [-1984.421] (-2000.337) -- 0:01:33
      710900 -- (-1989.723) (-1982.006) (-1988.444) [-1979.408] * (-1986.899) (-1995.253) [-1985.139] (-1997.960) -- 0:01:33
      711000 -- (-1993.523) (-1980.721) (-1993.172) [-1980.439] * (-1993.322) (-1995.974) [-1992.889] (-2000.296) -- 0:01:33

      Average standard deviation of split frequencies: 0.003068

      711100 -- (-1988.581) [-1979.190] (-1988.561) (-1982.973) * (-1988.187) (-1996.386) [-1986.638] (-2005.999) -- 0:01:33
      711200 -- (-1985.423) [-1979.951] (-1998.365) (-1985.425) * [-1983.509] (-1998.705) (-1985.904) (-1997.254) -- 0:01:33
      711300 -- (-1997.865) [-1982.280] (-1997.194) (-1983.694) * [-1981.170] (-1999.437) (-1985.001) (-2002.277) -- 0:01:33
      711400 -- (-1992.594) (-1981.982) (-2010.373) [-1982.319] * [-1985.493] (-1997.756) (-1989.040) (-2003.049) -- 0:01:33
      711500 -- (-1983.824) [-1981.515] (-1996.375) (-1989.279) * (-1984.514) (-1998.850) [-1979.632] (-2007.183) -- 0:01:33
      711600 -- (-1987.536) (-1989.577) (-2009.224) [-1992.610] * [-1981.352] (-1993.682) (-1980.608) (-2015.597) -- 0:01:33
      711700 -- [-1987.333] (-1988.569) (-1998.408) (-1992.205) * (-1985.432) (-1992.052) [-1979.815] (-2020.181) -- 0:01:33
      711800 -- (-1990.697) [-1998.719] (-1996.642) (-1986.591) * (-1985.260) (-1992.839) [-1981.925] (-2007.550) -- 0:01:33
      711900 -- (-2003.563) (-2007.327) [-1986.060] (-1989.618) * [-1982.840] (-1986.485) (-1981.637) (-2001.532) -- 0:01:33
      712000 -- (-1999.748) (-1992.875) (-1987.225) [-1991.468] * [-1981.412] (-1995.788) (-1983.588) (-2002.645) -- 0:01:33

      Average standard deviation of split frequencies: 0.003140

      712100 -- (-2003.970) [-1991.614] (-1982.728) (-1991.115) * (-1988.137) (-1991.681) [-1982.965] (-1992.351) -- 0:01:33
      712200 -- (-1999.215) (-1991.004) (-1988.271) [-1993.247] * (-1985.951) (-1993.197) [-1984.100] (-1993.298) -- 0:01:33
      712300 -- (-1999.494) (-1989.612) [-1989.432] (-1989.328) * (-1992.207) (-1997.076) [-1982.804] (-1997.232) -- 0:01:33
      712400 -- (-1995.087) [-1985.511] (-1994.081) (-1985.686) * [-1987.896] (-1992.868) (-1985.639) (-1997.062) -- 0:01:33
      712500 -- [-2000.523] (-1993.566) (-1991.581) (-1988.958) * (-1987.973) (-1994.216) [-1982.012] (-1995.975) -- 0:01:33
      712600 -- (-1992.687) [-1986.061] (-1990.717) (-1988.971) * (-1987.370) (-1989.590) [-1984.052] (-2003.470) -- 0:01:33
      712700 -- (-2000.412) (-1987.561) (-1992.261) [-1981.597] * (-1991.250) (-1984.629) [-1984.508] (-1993.231) -- 0:01:33
      712800 -- (-2000.485) (-1987.305) [-1987.354] (-1981.608) * (-1990.452) (-1983.546) [-1983.097] (-1994.466) -- 0:01:33
      712900 -- (-1996.942) (-1988.962) (-1990.719) [-1984.484] * [-1986.354] (-1984.928) (-1985.565) (-1987.808) -- 0:01:33
      713000 -- (-1995.619) (-1985.904) (-1998.166) [-1983.812] * [-1990.936] (-1986.628) (-1985.919) (-1998.970) -- 0:01:33

      Average standard deviation of split frequencies: 0.003248

      713100 -- (-1989.130) (-1989.508) (-2001.300) [-1985.490] * (-1988.883) (-1987.719) [-1982.672] (-1997.535) -- 0:01:33
      713200 -- [-1988.033] (-2002.019) (-1995.823) (-1994.826) * (-1982.490) [-1991.332] (-1979.942) (-1993.060) -- 0:01:33
      713300 -- [-1988.034] (-1990.076) (-1997.204) (-2003.490) * (-1985.576) (-1988.574) [-1985.369] (-1995.274) -- 0:01:33
      713400 -- (-1994.811) [-1987.637] (-1990.637) (-1992.536) * (-1987.524) (-1988.278) [-1979.871] (-2002.184) -- 0:01:33
      713500 -- (-1991.050) (-1985.559) [-1984.774] (-1997.946) * (-1988.909) (-1988.838) [-1981.499] (-2003.789) -- 0:01:33
      713600 -- (-1991.046) [-1990.498] (-1989.940) (-2012.731) * (-1992.892) (-1988.815) [-1983.297] (-1994.394) -- 0:01:33
      713700 -- (-1995.561) [-1981.493] (-1988.769) (-1997.960) * (-1994.985) [-1989.373] (-1982.596) (-1996.364) -- 0:01:33
      713800 -- [-1989.313] (-1984.858) (-1995.245) (-1999.632) * (-1991.068) (-2003.776) [-1981.818] (-2011.740) -- 0:01:33
      713900 -- (-1988.610) (-1984.870) [-1991.310] (-1986.383) * (-1983.727) (-1997.894) [-1984.654] (-2006.669) -- 0:01:32
      714000 -- (-1988.909) [-1987.081] (-1991.912) (-1984.378) * [-1986.678] (-1996.927) (-1985.421) (-1998.080) -- 0:01:32

      Average standard deviation of split frequencies: 0.003282

      714100 -- (-1991.937) (-1982.608) (-1991.243) [-1982.800] * (-1988.765) (-1998.867) [-1981.656] (-1993.035) -- 0:01:32
      714200 -- (-1987.426) [-1985.420] (-1999.132) (-1980.977) * (-1990.897) (-2001.178) [-1981.634] (-1997.940) -- 0:01:32
      714300 -- (-2005.652) [-1984.735] (-2003.961) (-1982.234) * (-1990.839) (-1997.368) [-1985.065] (-2000.265) -- 0:01:32
      714400 -- (-1996.148) [-1984.820] (-1993.789) (-1982.420) * (-1989.710) (-2004.007) [-1989.335] (-1997.209) -- 0:01:32
      714500 -- (-1990.140) [-1981.743] (-2003.564) (-1982.148) * [-1983.863] (-1999.446) (-1987.033) (-2006.351) -- 0:01:32
      714600 -- [-1990.758] (-1983.725) (-2001.030) (-1982.878) * (-1984.509) (-1994.493) [-1996.349] (-2001.335) -- 0:01:32
      714700 -- (-1994.685) (-1986.363) (-2004.594) [-1983.852] * [-1981.413] (-1991.951) (-1991.893) (-1991.975) -- 0:01:32
      714800 -- (-1996.842) [-1983.305] (-2006.771) (-1989.152) * (-1988.577) (-2000.976) [-1991.897] (-1994.392) -- 0:01:32
      714900 -- (-1995.683) [-1980.468] (-1991.113) (-1989.194) * (-1987.825) (-1993.799) [-1980.464] (-2002.038) -- 0:01:32
      715000 -- (-1991.817) (-1984.208) (-1995.535) [-1983.633] * (-1986.239) (-1997.187) [-1985.951] (-1998.987) -- 0:01:32

      Average standard deviation of split frequencies: 0.003126

      715100 -- (-1992.305) [-1986.389] (-1992.836) (-1997.865) * (-1984.732) (-1993.641) [-1989.215] (-2003.862) -- 0:01:32
      715200 -- (-1986.140) [-1980.327] (-1991.007) (-2000.640) * (-1987.576) (-1984.607) [-1982.491] (-2006.521) -- 0:01:32
      715300 -- (-1988.802) (-1982.361) [-1987.408] (-2002.076) * [-1981.386] (-1994.495) (-1988.442) (-1994.108) -- 0:01:32
      715400 -- (-1993.360) [-1981.712] (-1988.825) (-1991.894) * [-1986.814] (-1993.309) (-1988.026) (-1990.381) -- 0:01:32
      715500 -- (-1993.450) (-1991.983) [-1990.560] (-1993.460) * [-1989.595] (-1995.085) (-2009.256) (-1990.481) -- 0:01:32
      715600 -- (-1989.348) (-1991.925) [-1989.535] (-1992.005) * [-1995.772] (-1998.400) (-1999.117) (-2010.547) -- 0:01:32
      715700 -- (-1991.667) [-1987.891] (-1989.380) (-1996.906) * (-1996.061) (-1993.814) [-1995.631] (-1998.045) -- 0:01:32
      715800 -- (-1992.634) (-1988.647) [-1988.815] (-1992.428) * (-1990.666) (-1995.572) (-1996.651) [-1991.082] -- 0:01:32
      715900 -- (-1993.853) (-1991.896) (-1989.867) [-1985.841] * [-1989.925] (-2001.175) (-1991.707) (-1991.215) -- 0:01:32
      716000 -- (-1995.546) [-1984.314] (-2005.209) (-1990.693) * [-1990.372] (-1992.754) (-1992.330) (-1993.605) -- 0:01:32

      Average standard deviation of split frequencies: 0.003122

      716100 -- (-1989.503) [-1985.389] (-1994.451) (-1987.869) * (-1982.659) (-1992.900) (-1985.492) [-1992.236] -- 0:01:32
      716200 -- (-1997.617) [-1988.759] (-1991.619) (-1986.167) * [-1983.767] (-1994.399) (-2003.310) (-1997.946) -- 0:01:32
      716300 -- (-1995.724) (-1988.038) [-1989.456] (-1989.572) * [-1985.907] (-2000.164) (-2000.499) (-1996.714) -- 0:01:32
      716400 -- (-1991.011) [-1985.079] (-1994.964) (-1991.096) * [-1983.250] (-2002.448) (-1994.019) (-1992.257) -- 0:01:32
      716500 -- (-1993.606) [-1986.333] (-2006.849) (-1996.244) * [-1981.622] (-2003.726) (-2002.625) (-1989.272) -- 0:01:32
      716600 -- (-1999.110) [-1979.495] (-2004.669) (-1990.561) * (-1981.645) (-2003.804) [-1994.796] (-1990.065) -- 0:01:32
      716700 -- (-1998.124) (-1986.488) (-1996.494) [-1995.592] * [-1981.763] (-1996.261) (-2006.037) (-1994.443) -- 0:01:32
      716800 -- (-2000.058) [-1988.573] (-1994.275) (-1988.365) * (-1990.778) (-1994.858) (-1999.189) [-1986.675] -- 0:01:32
      716900 -- (-1993.197) [-1992.224] (-1999.792) (-1984.406) * (-1985.783) (-1990.774) (-1995.138) [-1984.741] -- 0:01:32
      717000 -- (-2002.680) (-1998.614) (-1988.698) [-1981.923] * [-1984.121] (-1992.515) (-1992.201) (-1987.251) -- 0:01:31

      Average standard deviation of split frequencies: 0.003080

      717100 -- (-2014.327) (-2003.456) (-1989.432) [-1981.691] * (-1987.682) (-1992.589) (-1991.174) [-1986.065] -- 0:01:31
      717200 -- (-2003.178) (-1991.806) [-1986.813] (-1997.289) * (-1988.244) [-1994.466] (-1986.814) (-1999.535) -- 0:01:31
      717300 -- (-1995.409) [-1996.606] (-1992.389) (-2001.215) * [-1988.206] (-1991.752) (-1998.465) (-1999.959) -- 0:01:31
      717400 -- (-1994.127) (-1992.552) [-1993.457] (-1998.902) * [-1976.837] (-1991.902) (-1992.511) (-1993.436) -- 0:01:31
      717500 -- (-1992.435) [-1991.606] (-2006.168) (-1988.188) * [-1975.046] (-1996.067) (-1992.462) (-1986.792) -- 0:01:31
      717600 -- (-1991.795) (-1996.038) (-2000.865) [-1985.036] * [-1979.798] (-1991.733) (-2000.056) (-1986.968) -- 0:01:31
      717700 -- (-1989.406) [-1998.037] (-2000.122) (-1987.421) * (-1983.998) (-1982.116) (-1999.452) [-1991.680] -- 0:01:31
      717800 -- (-1986.738) (-1994.219) (-2002.367) [-1986.057] * [-1990.063] (-1985.481) (-1992.681) (-1996.119) -- 0:01:31
      717900 -- (-1987.063) (-1999.562) (-2002.706) [-1982.108] * (-1990.709) [-1986.199] (-2000.806) (-1988.770) -- 0:01:31
      718000 -- (-1988.900) (-1994.917) (-1997.437) [-1986.618] * (-1987.178) [-1987.248] (-1999.365) (-1987.421) -- 0:01:31

      Average standard deviation of split frequencies: 0.003226

      718100 -- (-1991.790) (-1993.029) (-2001.280) [-1985.001] * (-1987.155) (-1987.970) (-2005.457) [-1985.479] -- 0:01:31
      718200 -- (-1993.239) (-1993.163) (-1996.129) [-1984.249] * [-1982.931] (-1988.409) (-2005.731) (-1985.555) -- 0:01:31
      718300 -- (-2003.362) (-1994.770) (-1990.035) [-1989.967] * (-1988.250) (-1990.554) [-1996.679] (-1990.697) -- 0:01:31
      718400 -- (-2003.938) (-1997.024) (-1986.446) [-1992.170] * (-1992.047) (-1989.316) [-1995.638] (-1994.478) -- 0:01:31
      718500 -- (-1998.324) (-1995.344) [-1983.633] (-1991.177) * (-1992.316) [-1990.179] (-1994.310) (-1999.060) -- 0:01:31
      718600 -- (-1998.497) (-2000.085) (-1987.745) [-1989.473] * (-2001.969) [-1987.970] (-2000.292) (-1998.017) -- 0:01:31
      718700 -- (-2004.140) (-1992.712) (-1988.390) [-1983.709] * (-1995.702) [-1988.879] (-1995.468) (-1987.193) -- 0:01:31
      718800 -- (-1991.716) (-1994.106) (-1991.246) [-1979.815] * (-1997.116) [-1981.607] (-1992.866) (-1985.038) -- 0:01:31
      718900 -- [-1993.777] (-2002.493) (-2000.912) (-1986.516) * (-1992.064) (-1989.055) (-1995.723) [-1987.909] -- 0:01:31
      719000 -- (-1995.508) (-1998.526) (-1998.879) [-1987.258] * [-1987.670] (-1987.940) (-2006.076) (-1987.016) -- 0:01:31

      Average standard deviation of split frequencies: 0.003296

      719100 -- [-1991.237] (-1995.962) (-1990.201) (-1988.226) * (-1989.473) [-1984.170] (-1991.725) (-1992.904) -- 0:01:31
      719200 -- (-1986.382) (-1994.505) [-1985.612] (-1996.411) * (-1994.946) [-1987.815] (-1991.704) (-1993.519) -- 0:01:31
      719300 -- [-1984.220] (-1992.108) (-1990.441) (-1992.585) * (-1982.973) (-1993.174) [-1990.477] (-1985.416) -- 0:01:31
      719400 -- [-1986.005] (-2005.179) (-1992.401) (-1990.897) * (-1985.017) (-1998.734) [-1982.879] (-1980.048) -- 0:01:31
      719500 -- [-1988.463] (-1997.293) (-1990.156) (-1991.982) * (-1985.469) (-2000.722) [-1989.832] (-1985.779) -- 0:01:31
      719600 -- (-1990.348) (-1982.911) [-1987.047] (-1992.093) * (-1979.446) (-1995.836) (-1987.632) [-1984.305] -- 0:01:31
      719700 -- (-1991.861) [-1990.120] (-1993.986) (-1991.304) * (-1990.752) (-2001.654) (-1988.794) [-1980.089] -- 0:01:31
      719800 -- (-1992.882) [-1984.780] (-1996.457) (-1995.371) * (-1983.539) (-2010.588) (-1996.754) [-1978.985] -- 0:01:31
      719900 -- (-1993.643) [-1982.645] (-1995.818) (-1993.277) * [-1987.876] (-1995.701) (-1988.618) (-1978.499) -- 0:01:31
      720000 -- (-1998.296) [-1981.366] (-1990.079) (-1989.529) * (-1986.228) (-1990.370) (-1987.618) [-1981.369] -- 0:01:31

      Average standard deviation of split frequencies: 0.003292

      720100 -- (-1997.743) [-1983.558] (-1993.035) (-1989.740) * (-1987.259) (-1997.662) (-1989.782) [-1983.619] -- 0:01:30
      720200 -- (-1996.101) [-1980.309] (-1993.002) (-1991.309) * (-1986.780) (-1995.994) [-1982.187] (-1980.585) -- 0:01:30
      720300 -- (-2000.370) [-1983.565] (-1992.256) (-2000.090) * (-1987.735) (-1995.725) [-1987.085] (-1983.714) -- 0:01:30
      720400 -- (-2015.395) [-1985.608] (-1996.369) (-1996.631) * (-1989.170) (-1995.901) (-1981.026) [-1989.699] -- 0:01:30
      720500 -- (-2006.934) [-1986.396] (-2005.770) (-1990.661) * (-2002.869) [-1991.340] (-1983.751) (-1986.304) -- 0:01:30
      720600 -- (-2017.408) [-1984.104] (-2005.760) (-1994.663) * (-1997.984) (-1992.844) (-1986.357) [-1984.106] -- 0:01:30
      720700 -- (-1991.787) [-1988.860] (-2010.910) (-1990.092) * (-2006.380) (-1990.044) (-1986.086) [-1986.254] -- 0:01:30
      720800 -- (-1993.338) [-1988.395] (-2003.889) (-1989.528) * (-2012.322) (-1987.364) (-1987.679) [-1984.496] -- 0:01:30
      720900 -- (-1993.593) (-1998.390) (-2007.080) [-1989.027] * (-1995.823) (-1986.265) (-1989.852) [-1989.052] -- 0:01:30
      721000 -- [-1989.650] (-1992.392) (-1996.549) (-1989.710) * (-1992.182) (-1990.402) (-1985.724) [-1985.983] -- 0:01:30

      Average standard deviation of split frequencies: 0.003250

      721100 -- (-1985.560) (-1993.769) (-1990.177) [-1981.551] * (-1989.050) (-1988.484) (-1989.940) [-1986.953] -- 0:01:30
      721200 -- (-1989.332) (-1990.101) (-1989.788) [-1985.278] * (-1983.300) (-1999.331) [-1989.166] (-1984.447) -- 0:01:30
      721300 -- (-1991.905) (-1990.157) [-1985.498] (-1986.673) * (-1985.363) (-1999.546) (-1989.982) [-1985.964] -- 0:01:30
      721400 -- (-1991.375) (-1990.450) [-1981.294] (-1992.107) * [-1979.271] (-2002.878) (-1998.529) (-1982.046) -- 0:01:30
      721500 -- (-1999.850) (-1988.164) [-1983.418] (-1990.437) * (-1981.974) [-1990.464] (-2002.340) (-1983.742) -- 0:01:30
      721600 -- (-2002.128) (-1987.321) [-1985.814] (-1988.450) * [-1982.191] (-1991.826) (-1990.864) (-1991.361) -- 0:01:30
      721700 -- (-2002.828) (-1987.330) [-1984.713] (-1995.189) * [-1983.230] (-1989.745) (-1986.507) (-1992.858) -- 0:01:30
      721800 -- [-1995.619] (-1997.793) (-1987.037) (-2004.067) * [-1980.290] (-1993.637) (-1990.033) (-1997.299) -- 0:01:30
      721900 -- (-1993.176) (-1990.466) [-1985.991] (-1998.303) * [-1977.781] (-1990.558) (-1986.782) (-1997.916) -- 0:01:30
      722000 -- (-1990.776) (-1991.674) [-1985.655] (-1996.639) * [-1986.117] (-1989.652) (-1988.705) (-2000.903) -- 0:01:30

      Average standard deviation of split frequencies: 0.003208

      722100 -- (-1997.136) (-1997.353) (-1989.742) [-1983.798] * [-1985.081] (-1982.695) (-1984.952) (-2007.598) -- 0:01:30
      722200 -- (-1998.079) (-1994.199) (-1989.023) [-1983.942] * (-1989.225) [-1984.161] (-1988.395) (-2003.012) -- 0:01:30
      722300 -- (-2020.708) (-1996.269) (-1990.034) [-1981.507] * [-1984.881] (-1988.213) (-1989.636) (-1994.848) -- 0:01:30
      722400 -- (-1993.218) (-1998.169) (-1996.593) [-1984.245] * (-1984.818) (-1987.663) [-1989.623] (-2007.625) -- 0:01:30
      722500 -- (-1992.507) (-1999.580) (-2001.419) [-1985.703] * (-1988.351) [-1987.848] (-1991.043) (-1999.755) -- 0:01:30
      722600 -- (-1994.808) (-2000.814) (-1995.273) [-1989.296] * (-1995.440) (-1998.615) (-1991.773) [-1989.594] -- 0:01:30
      722700 -- [-1998.919] (-2004.901) (-1999.110) (-1995.534) * (-1987.846) (-2000.476) (-1988.961) [-1985.871] -- 0:01:30
      722800 -- [-1990.223] (-2000.116) (-1995.402) (-2002.200) * [-1985.166] (-2002.736) (-1992.448) (-1984.388) -- 0:01:30
      722900 -- (-1996.730) (-1996.307) (-1995.450) [-1993.157] * [-1985.881] (-1993.599) (-1994.491) (-1984.003) -- 0:01:30
      723000 -- (-1985.605) (-1994.797) (-2000.120) [-1987.641] * [-1989.073] (-1989.218) (-1992.681) (-1985.235) -- 0:01:30

      Average standard deviation of split frequencies: 0.003185

      723100 -- (-1991.191) [-1990.054] (-1998.154) (-1985.118) * [-1984.218] (-1992.620) (-1994.707) (-1987.044) -- 0:01:29
      723200 -- (-1994.734) (-1991.790) (-1994.289) [-1982.889] * [-1985.843] (-1989.519) (-1997.380) (-1986.853) -- 0:01:29
      723300 -- (-2009.247) (-1984.626) [-1987.976] (-1990.608) * [-1988.929] (-1992.989) (-1997.071) (-1986.896) -- 0:01:29
      723400 -- (-2001.440) [-1984.385] (-1986.445) (-1990.168) * [-1980.408] (-1991.627) (-2006.001) (-1986.144) -- 0:01:29
      723500 -- (-2003.587) [-1982.516] (-1988.968) (-1994.644) * [-1983.532] (-1994.793) (-2006.825) (-1987.046) -- 0:01:29
      723600 -- (-1993.075) [-1984.368] (-1993.104) (-1991.789) * [-1983.734] (-1992.439) (-1997.722) (-1985.197) -- 0:01:29
      723700 -- (-1995.870) (-1981.340) (-1997.366) [-1985.547] * [-1985.008] (-1995.939) (-2003.017) (-1990.963) -- 0:01:29
      723800 -- [-1995.223] (-1983.347) (-1994.503) (-1986.720) * (-1981.940) [-1987.492] (-1997.770) (-1993.938) -- 0:01:29
      723900 -- (-2001.726) (-1986.061) [-1982.259] (-1986.551) * (-1985.513) [-1990.740] (-2002.547) (-1990.838) -- 0:01:29
      724000 -- (-2002.705) [-1982.777] (-1990.518) (-1989.387) * (-1991.106) [-1986.028] (-2009.172) (-1987.094) -- 0:01:29

      Average standard deviation of split frequencies: 0.003162

      724100 -- (-2001.209) [-1981.042] (-1998.072) (-1999.610) * (-1988.859) [-1987.606] (-2004.677) (-1991.376) -- 0:01:29
      724200 -- (-1997.256) (-1988.813) (-2002.846) [-1999.347] * (-1997.716) [-1983.208] (-2011.959) (-1985.090) -- 0:01:29
      724300 -- (-1993.126) [-1985.328] (-1992.713) (-2004.149) * (-1995.568) (-1985.613) (-2011.420) [-1982.705] -- 0:01:29
      724400 -- (-1991.592) [-1983.811] (-1989.019) (-1995.622) * (-1997.141) (-1991.988) (-2013.394) [-1985.485] -- 0:01:29
      724500 -- [-1996.016] (-1981.318) (-1990.242) (-1993.547) * (-1996.387) (-1999.512) (-2001.477) [-1988.407] -- 0:01:29
      724600 -- (-1989.356) (-1980.162) [-1986.427] (-2002.572) * (-1986.429) (-1989.423) (-2008.277) [-1985.686] -- 0:01:29
      724700 -- [-1987.121] (-1986.789) (-1982.878) (-1993.231) * [-1983.168] (-1991.956) (-2007.680) (-1994.013) -- 0:01:29
      724800 -- (-1990.490) [-1983.749] (-1984.272) (-1989.456) * [-1983.969] (-1998.042) (-2005.770) (-1994.988) -- 0:01:29
      724900 -- (-1994.038) [-1983.379] (-1990.074) (-1994.621) * [-1982.829] (-1992.194) (-1998.473) (-1997.459) -- 0:01:29
      725000 -- (-1996.085) (-1985.728) (-1987.384) [-1989.139] * (-1987.253) [-1991.168] (-1998.462) (-1998.818) -- 0:01:29

      Average standard deviation of split frequencies: 0.003213

      725100 -- (-1992.603) (-1984.290) (-1988.263) [-1984.756] * [-1985.029] (-1991.583) (-1998.432) (-1994.464) -- 0:01:29
      725200 -- (-1999.026) [-1984.411] (-1987.309) (-1992.004) * [-1980.712] (-1992.139) (-2000.781) (-2001.169) -- 0:01:29
      725300 -- (-2003.874) [-1983.693] (-1984.492) (-1985.510) * [-1982.141] (-1991.259) (-1999.331) (-1991.694) -- 0:01:29
      725400 -- (-2000.804) (-1981.021) (-2000.056) [-1987.360] * (-1983.440) [-1989.957] (-2001.819) (-1993.437) -- 0:01:29
      725500 -- (-1991.549) [-1980.414] (-1988.959) (-1989.990) * (-1990.099) [-1987.084] (-2006.619) (-1997.895) -- 0:01:29
      725600 -- (-1995.415) [-1984.669] (-1983.742) (-1987.189) * (-1988.452) [-1986.537] (-2002.823) (-2003.966) -- 0:01:29
      725700 -- (-1988.060) (-1987.768) [-1985.709] (-1989.463) * (-1987.072) (-1993.760) [-1996.209] (-1993.869) -- 0:01:29
      725800 -- (-1991.040) (-1994.150) (-1987.582) [-1986.363] * [-1987.342] (-1983.418) (-1997.774) (-2000.403) -- 0:01:29
      725900 -- (-1989.783) [-1983.779] (-1992.205) (-1982.788) * [-1982.872] (-1990.076) (-1995.020) (-1986.955) -- 0:01:29
      726000 -- (-1990.799) [-1980.242] (-1995.406) (-1985.865) * (-1983.697) (-1990.691) (-1995.373) [-1987.708] -- 0:01:29

      Average standard deviation of split frequencies: 0.003246

      726100 -- [-1990.087] (-1990.026) (-1994.779) (-1983.202) * (-1986.291) (-1990.116) (-1996.301) [-1989.069] -- 0:01:29
      726200 -- (-1992.640) [-1982.995] (-1987.307) (-1986.033) * (-1989.124) [-1983.113] (-1991.458) (-1992.272) -- 0:01:28
      726300 -- (-1989.877) (-1988.212) (-1994.065) [-1984.196] * (-1992.114) [-1991.236] (-1996.694) (-2001.887) -- 0:01:28
      726400 -- (-1986.024) [-1986.414] (-1988.065) (-1982.840) * (-1986.008) (-1998.545) (-1996.594) [-2000.518] -- 0:01:28
      726500 -- (-1997.087) (-1988.904) (-1991.498) [-1980.951] * [-1987.220] (-1994.039) (-2002.263) (-1996.163) -- 0:01:28
      726600 -- (-1994.938) (-1986.575) (-1989.510) [-1980.457] * [-1983.135] (-1994.893) (-1993.458) (-1989.727) -- 0:01:28
      726700 -- (-1997.468) (-1986.604) (-1986.362) [-1983.301] * [-1987.886] (-2004.896) (-1999.487) (-1995.419) -- 0:01:28
      726800 -- (-1996.540) (-1983.107) [-1981.868] (-1983.302) * [-1991.491] (-2009.996) (-1998.723) (-1994.386) -- 0:01:28
      726900 -- (-1989.586) [-1979.098] (-1985.618) (-1984.742) * [-1988.506] (-2005.828) (-1993.816) (-1990.538) -- 0:01:28
      727000 -- [-1988.697] (-1981.166) (-1985.487) (-1981.552) * [-1987.336] (-2002.845) (-1992.230) (-1989.005) -- 0:01:28

      Average standard deviation of split frequencies: 0.003075

      727100 -- (-1987.835) (-1983.188) [-1981.718] (-1988.188) * [-1982.928] (-1999.625) (-1993.064) (-1991.109) -- 0:01:28
      727200 -- (-1990.993) (-1983.990) [-1981.451] (-1993.020) * [-1983.461] (-2000.736) (-1995.970) (-1995.428) -- 0:01:28
      727300 -- (-1995.779) [-1983.941] (-1982.099) (-1993.459) * [-1983.787] (-1998.315) (-1994.906) (-1995.487) -- 0:01:28
      727400 -- (-1996.505) (-1983.249) [-1982.570] (-1989.215) * [-1985.115] (-1995.758) (-1992.271) (-1995.409) -- 0:01:28
      727500 -- (-2001.859) (-1978.816) [-1982.396] (-1983.629) * (-1981.123) (-1993.026) (-1989.385) [-1993.622] -- 0:01:28
      727600 -- (-1995.588) [-1982.354] (-1982.308) (-1985.868) * [-1978.464] (-1997.771) (-1995.532) (-1994.723) -- 0:01:28
      727700 -- [-1987.703] (-1988.719) (-1988.738) (-1989.294) * [-1978.767] (-1991.069) (-1999.069) (-1995.351) -- 0:01:28
      727800 -- (-1991.347) [-1990.369] (-1984.645) (-1997.576) * [-1980.275] (-1986.675) (-1986.486) (-1993.990) -- 0:01:28
      727900 -- (-1993.478) [-1989.480] (-1989.234) (-2002.764) * [-1981.910] (-1985.898) (-1983.879) (-1994.701) -- 0:01:28
      728000 -- (-1998.480) [-1984.237] (-1982.235) (-1985.398) * (-1988.860) (-1992.293) [-1985.725] (-1983.651) -- 0:01:28

      Average standard deviation of split frequencies: 0.003089

      728100 -- (-2000.838) [-1982.455] (-1987.368) (-1983.837) * (-1988.025) (-1991.927) (-1984.272) [-1983.627] -- 0:01:28
      728200 -- (-2002.393) [-1986.979] (-1987.510) (-1986.085) * (-1991.647) (-1994.501) (-1995.903) [-1983.936] -- 0:01:28
      728300 -- (-1992.579) (-1979.894) (-1983.451) [-1981.196] * (-1992.766) (-1985.957) (-1989.945) [-1981.214] -- 0:01:28
      728400 -- (-1998.136) [-1978.950] (-1988.578) (-1984.105) * (-1994.876) (-1993.968) (-1986.072) [-1983.486] -- 0:01:28
      728500 -- (-2001.373) (-1980.843) [-1984.258] (-1987.474) * (-1989.129) (-1995.501) (-1982.244) [-1982.949] -- 0:01:28
      728600 -- (-1991.043) (-1984.836) [-1988.419] (-1988.436) * (-1985.176) (-1998.431) [-1985.883] (-1985.314) -- 0:01:28
      728700 -- (-1987.557) [-1985.133] (-1991.272) (-1991.232) * [-1978.880] (-1998.240) (-1984.476) (-1987.836) -- 0:01:28
      728800 -- (-1991.909) [-1984.638] (-1986.724) (-1988.995) * [-1983.970] (-1997.975) (-1986.458) (-1987.938) -- 0:01:28
      728900 -- (-2001.749) (-1987.989) [-1987.222] (-1988.787) * (-1984.492) (-2000.700) [-1986.212] (-1988.557) -- 0:01:28
      729000 -- (-1999.186) (-1985.700) (-1990.590) [-1983.179] * (-1983.807) (-2001.468) (-1991.956) [-1985.322] -- 0:01:28

      Average standard deviation of split frequencies: 0.003066

      729100 -- (-1998.979) [-1994.272] (-1989.416) (-1981.485) * (-1981.371) (-1997.607) (-1991.220) [-1985.543] -- 0:01:28
      729200 -- (-2000.234) [-1986.321] (-1997.137) (-1989.328) * (-1982.080) (-1997.110) (-1989.037) [-1982.860] -- 0:01:28
      729300 -- (-1999.335) [-1983.926] (-2006.342) (-1988.674) * (-1988.939) (-1994.926) [-1990.102] (-1982.613) -- 0:01:27
      729400 -- (-1988.972) [-1984.761] (-2007.220) (-1992.023) * (-1991.144) (-1993.888) (-1992.547) [-1986.538] -- 0:01:27
      729500 -- (-1991.015) [-1984.052] (-2001.866) (-1984.007) * (-1981.548) (-1992.760) [-1985.211] (-2000.889) -- 0:01:27
      729600 -- (-1989.649) (-1981.780) (-2003.494) [-1982.771] * [-1980.057] (-1992.859) (-1988.475) (-1998.924) -- 0:01:27
      729700 -- (-1990.706) [-1983.615] (-1994.921) (-1985.959) * [-1982.807] (-1993.025) (-1990.101) (-1997.029) -- 0:01:27
      729800 -- (-1993.399) [-1985.041] (-1997.506) (-1988.946) * [-1981.352] (-1992.284) (-1991.190) (-1995.630) -- 0:01:27
      729900 -- (-1989.463) (-1985.228) (-1997.751) [-1985.551] * [-1980.287] (-1992.911) (-1993.379) (-1995.316) -- 0:01:27
      730000 -- (-1992.472) (-1981.050) (-2001.927) [-1982.766] * (-1988.058) (-2005.680) (-1994.495) [-1990.697] -- 0:01:27

      Average standard deviation of split frequencies: 0.003118

      730100 -- (-1987.041) (-1980.662) (-1996.209) [-1983.510] * [-1987.384] (-1994.783) (-1993.372) (-1995.652) -- 0:01:27
      730200 -- (-1992.507) (-1985.025) (-2000.037) [-1979.049] * [-1984.188] (-2000.663) (-1989.955) (-1993.494) -- 0:01:27
      730300 -- (-1997.338) (-1983.085) (-1993.098) [-1980.416] * [-1985.648] (-2012.865) (-1986.180) (-2003.200) -- 0:01:27
      730400 -- (-1998.090) (-1983.904) (-1993.112) [-1982.444] * (-1984.886) (-2001.141) [-1984.026] (-1985.438) -- 0:01:27
      730500 -- (-1998.499) (-1985.677) (-1992.428) [-1983.238] * (-1981.908) (-1996.729) [-1984.393] (-1983.259) -- 0:01:27
      730600 -- (-2001.320) (-1985.845) (-2003.115) [-1990.747] * (-1989.857) (-2005.756) (-1987.531) [-1982.254] -- 0:01:27
      730700 -- (-1987.221) [-1985.057] (-1993.243) (-1990.478) * (-1994.235) (-1994.895) (-1988.186) [-1981.169] -- 0:01:27
      730800 -- (-1999.351) [-1981.709] (-1990.989) (-1994.060) * [-1986.141] (-1998.510) (-1988.179) (-1983.311) -- 0:01:27
      730900 -- (-1993.796) [-1984.745] (-1988.901) (-1994.543) * (-1990.448) [-1996.408] (-1990.716) (-1984.570) -- 0:01:27
      731000 -- [-1988.241] (-1989.245) (-1990.740) (-2004.909) * (-1986.293) (-2001.703) (-1993.701) [-1978.489] -- 0:01:27

      Average standard deviation of split frequencies: 0.003095

      731100 -- (-1986.974) [-1991.328] (-1982.213) (-2007.285) * (-1988.277) (-1997.487) (-1994.513) [-1979.279] -- 0:01:27
      731200 -- [-1986.161] (-1998.277) (-1987.447) (-2001.881) * [-1985.256] (-1991.344) (-1992.441) (-1980.060) -- 0:01:27
      731300 -- (-1991.417) (-1991.103) [-1983.383] (-1990.492) * (-1983.655) (-1993.178) (-1991.329) [-1984.086] -- 0:01:27
      731400 -- (-1998.389) (-1987.380) [-1981.286] (-1987.799) * [-1984.615] (-1998.732) (-1996.470) (-1984.405) -- 0:01:27
      731500 -- (-1989.676) (-1984.956) (-1986.152) [-1984.731] * (-1984.348) (-1994.790) (-1996.939) [-1988.365] -- 0:01:27
      731600 -- (-1986.002) [-1979.970] (-1986.425) (-1990.624) * [-1984.312] (-1996.484) (-2000.709) (-1989.369) -- 0:01:27
      731700 -- (-1987.589) (-1985.109) [-1983.195] (-1998.417) * [-1985.093] (-2003.069) (-2002.327) (-1993.795) -- 0:01:27
      731800 -- (-1990.647) (-1982.545) [-1980.014] (-1987.475) * (-1985.307) (-1997.496) [-1997.814] (-1985.862) -- 0:01:27
      731900 -- (-2000.628) [-1983.383] (-1978.605) (-1988.106) * [-1986.398] (-2001.830) (-1999.093) (-1988.681) -- 0:01:27
      732000 -- (-2012.661) (-1982.362) (-1981.535) [-1983.979] * (-1994.150) (-1996.359) [-1997.797] (-1988.567) -- 0:01:27

      Average standard deviation of split frequencies: 0.003091

      732100 -- (-1999.783) (-1979.003) [-1987.548] (-1983.751) * (-1986.976) (-1994.159) (-2000.347) [-1986.068] -- 0:01:27
      732200 -- (-1999.878) (-1987.180) (-1984.739) [-1983.105] * (-1995.297) (-1995.976) (-2002.138) [-1984.494] -- 0:01:27
      732300 -- [-1991.251] (-1985.688) (-1988.406) (-1983.781) * (-1997.376) (-1993.887) (-1998.603) [-1987.379] -- 0:01:27
      732400 -- (-1987.191) (-1982.341) (-1983.955) [-1984.228] * (-1997.812) (-1993.925) (-1993.343) [-1987.031] -- 0:01:26
      732500 -- (-1991.250) [-1987.509] (-1985.737) (-1988.349) * (-1999.506) [-1988.586] (-1985.990) (-1989.287) -- 0:01:26
      732600 -- (-1989.925) [-1986.120] (-1988.659) (-1987.662) * (-1995.972) [-1992.094] (-1992.761) (-1991.805) -- 0:01:26
      732700 -- (-1990.525) (-2000.956) [-1980.610] (-1990.692) * [-1991.547] (-1993.376) (-1994.703) (-1986.398) -- 0:01:26
      732800 -- (-1988.814) (-1995.352) [-1982.029] (-1996.293) * (-1994.054) (-1992.614) [-1988.486] (-1989.588) -- 0:01:26
      732900 -- (-1990.475) (-1997.566) [-1978.540] (-1991.144) * [-1989.197] (-1992.084) (-1986.927) (-1992.810) -- 0:01:26
      733000 -- (-1989.856) (-2001.137) [-1977.437] (-1995.742) * [-1985.581] (-1985.803) (-1985.563) (-1991.410) -- 0:01:26

      Average standard deviation of split frequencies: 0.003013

      733100 -- (-1992.421) (-1987.321) [-1975.815] (-1998.533) * (-1993.524) [-1984.836] (-1986.382) (-1988.748) -- 0:01:26
      733200 -- (-1988.977) (-1993.125) [-1981.986] (-1990.548) * (-1999.363) (-1986.226) [-1987.879] (-1991.062) -- 0:01:26
      733300 -- (-1990.972) (-1995.840) [-1979.220] (-1983.653) * (-2006.246) (-1984.938) (-1989.991) [-1991.735] -- 0:01:26
      733400 -- (-1998.137) (-1993.319) (-1989.017) [-1984.118] * (-2001.817) (-1988.473) (-1990.534) [-1989.650] -- 0:01:26
      733500 -- (-2002.368) (-1988.841) [-1983.705] (-1979.795) * (-2001.648) (-1993.192) [-1986.903] (-1996.251) -- 0:01:26
      733600 -- (-2000.363) (-1984.273) (-1985.665) [-1983.412] * (-1998.822) [-1988.216] (-1992.448) (-2002.858) -- 0:01:26
      733700 -- (-2001.271) (-1984.846) [-1982.844] (-1989.016) * (-1992.341) (-1990.713) (-1989.459) [-1995.315] -- 0:01:26
      733800 -- (-2007.347) (-1983.306) [-1979.148] (-1992.242) * [-1991.983] (-1988.733) (-1998.105) (-1999.251) -- 0:01:26
      733900 -- (-1989.053) (-1976.868) [-1984.437] (-1986.602) * [-1989.550] (-1999.291) (-1989.340) (-1992.140) -- 0:01:26
      734000 -- (-1992.297) (-1977.423) [-1986.766] (-1985.342) * (-1986.204) (-2000.701) (-1993.709) [-1987.369] -- 0:01:26

      Average standard deviation of split frequencies: 0.002935

      734100 -- (-1989.506) (-1978.758) (-1996.159) [-1983.896] * [-1988.981] (-1992.246) (-1991.791) (-1991.116) -- 0:01:26
      734200 -- (-1989.503) [-1978.911] (-1993.142) (-1979.928) * [-1987.335] (-1993.929) (-1994.655) (-1989.728) -- 0:01:26
      734300 -- (-1988.987) (-1980.563) (-1999.100) [-1985.370] * (-1987.282) (-1996.549) (-1992.581) [-1988.755] -- 0:01:26
      734400 -- (-1993.535) (-1981.546) (-1988.612) [-1984.342] * (-1994.729) (-1996.289) (-1997.273) [-1988.500] -- 0:01:26
      734500 -- (-1991.188) [-1984.362] (-1993.576) (-1987.657) * (-1991.218) (-1999.045) (-1992.754) [-1987.620] -- 0:01:26
      734600 -- (-1998.082) (-1991.751) (-1995.251) [-1988.802] * (-1991.287) (-1993.276) (-1995.462) [-1983.888] -- 0:01:26
      734700 -- (-2007.997) (-1988.053) [-1981.195] (-1990.849) * (-1985.940) (-1991.582) (-1994.172) [-1983.473] -- 0:01:26
      734800 -- (-2002.655) (-1985.383) [-1978.770] (-1982.520) * [-1983.867] (-1999.010) (-1995.905) (-1984.260) -- 0:01:26
      734900 -- (-2005.439) (-1988.576) [-1983.834] (-1983.486) * (-1996.830) (-1996.870) (-1995.777) [-1985.779] -- 0:01:26
      735000 -- (-1995.977) (-1989.641) (-1986.707) [-1980.387] * (-2001.276) (-1998.092) [-1994.539] (-1993.788) -- 0:01:26

      Average standard deviation of split frequencies: 0.002803

      735100 -- (-1999.143) (-1988.682) (-1986.904) [-1982.535] * (-1996.458) [-1997.351] (-1997.521) (-1991.958) -- 0:01:26
      735200 -- (-1998.440) (-1988.739) [-1984.024] (-1983.168) * [-1990.869] (-1998.241) (-2002.805) (-1994.136) -- 0:01:26
      735300 -- (-1995.819) (-1985.474) [-1983.639] (-1984.912) * [-1990.453] (-1995.569) (-1996.378) (-1996.822) -- 0:01:26
      735400 -- (-1993.931) (-1991.538) [-1987.272] (-1989.253) * [-1987.391] (-1986.454) (-2005.275) (-1995.023) -- 0:01:25
      735500 -- (-1993.257) (-1986.954) (-1983.479) [-1987.377] * (-1992.058) [-1985.992] (-1996.606) (-1998.860) -- 0:01:25
      735600 -- (-1992.214) [-1984.975] (-1985.077) (-1986.188) * (-1996.739) [-1987.326] (-1988.689) (-1992.773) -- 0:01:25
      735700 -- (-1992.191) (-1984.322) (-1982.764) [-1986.677] * (-1993.117) [-1991.628] (-1988.352) (-1991.651) -- 0:01:25
      735800 -- (-2006.246) [-1980.342] (-1996.578) (-1985.819) * (-1995.450) (-1991.931) [-1987.916] (-1992.931) -- 0:01:25
      735900 -- (-2002.848) [-1984.410] (-1992.317) (-1985.480) * (-1984.078) (-1993.458) (-1985.603) [-1994.805] -- 0:01:25
      736000 -- (-2000.647) [-1993.212] (-1993.229) (-1987.358) * (-1985.881) (-1993.593) [-1989.866] (-1994.901) -- 0:01:25

      Average standard deviation of split frequencies: 0.002763

      736100 -- (-1999.050) (-1991.738) (-1994.152) [-1984.137] * [-1987.706] (-1989.068) (-1989.296) (-1991.045) -- 0:01:25
      736200 -- (-2008.123) (-2004.809) (-1986.160) [-1984.432] * [-1988.326] (-1995.109) (-1991.548) (-1991.528) -- 0:01:25
      736300 -- (-1992.066) (-1995.054) (-1986.560) [-1986.095] * [-1990.505] (-1991.459) (-1992.685) (-1990.562) -- 0:01:25
      736400 -- (-1990.364) (-2006.234) [-1983.043] (-1993.437) * (-1986.748) [-1988.563] (-1989.313) (-1985.886) -- 0:01:25
      736500 -- (-1991.711) (-1993.622) [-1982.611] (-1991.632) * (-1990.310) (-1988.844) [-1987.186] (-1991.337) -- 0:01:25
      736600 -- (-1993.366) (-1987.714) [-1981.262] (-1989.345) * [-1990.511] (-1991.984) (-1996.660) (-1995.144) -- 0:01:25
      736700 -- (-1993.682) [-1986.813] (-1983.704) (-1990.971) * (-1986.968) (-1988.025) (-1994.486) [-1991.269] -- 0:01:25
      736800 -- (-1998.641) [-1990.023] (-1982.245) (-1993.380) * [-1986.503] (-1990.387) (-1996.163) (-1989.618) -- 0:01:25
      736900 -- (-1994.450) (-1987.635) [-1987.156] (-2001.634) * [-1986.710] (-1993.253) (-1986.244) (-1989.919) -- 0:01:25
      737000 -- (-1989.832) [-1990.648] (-1985.220) (-2005.811) * (-1996.513) [-1997.481] (-1992.220) (-1990.422) -- 0:01:25

      Average standard deviation of split frequencies: 0.002704

      737100 -- (-1991.502) (-1985.753) [-1990.271] (-1994.481) * (-1999.174) (-1999.222) [-1986.385] (-1987.414) -- 0:01:25
      737200 -- (-1990.808) [-1983.586] (-2003.603) (-2001.936) * (-1991.238) (-2000.853) (-1993.469) [-1987.175] -- 0:01:25
      737300 -- (-1991.067) [-1983.672] (-1998.594) (-1995.737) * (-1992.092) (-1989.820) (-1986.749) [-1987.487] -- 0:01:25
      737400 -- (-1996.664) [-1982.146] (-1986.095) (-1994.731) * (-1993.355) (-1995.563) [-1985.122] (-1988.201) -- 0:01:25
      737500 -- [-1994.159] (-1982.827) (-1999.411) (-1991.220) * (-1986.576) (-1994.863) [-1989.375] (-1993.404) -- 0:01:25
      737600 -- (-1997.146) [-1979.945] (-1993.191) (-1991.278) * (-1986.832) [-1989.426] (-1988.812) (-1993.859) -- 0:01:25
      737700 -- (-1993.572) [-1986.386] (-1995.363) (-1999.355) * [-1988.119] (-1991.376) (-1997.953) (-1992.193) -- 0:01:25
      737800 -- (-1989.335) [-1983.584] (-1990.220) (-1992.467) * (-1986.491) (-1991.606) (-1991.025) [-1986.562] -- 0:01:25
      737900 -- (-1998.481) [-1982.097] (-1982.484) (-1988.399) * (-2001.375) (-1993.569) [-1990.194] (-1997.219) -- 0:01:25
      738000 -- (-1986.864) [-1982.412] (-1980.801) (-1987.184) * (-2003.871) (-1995.776) [-1984.927] (-1992.006) -- 0:01:25

      Average standard deviation of split frequencies: 0.002701

      738100 -- (-1993.611) [-1979.268] (-1990.436) (-1992.735) * (-2009.176) (-1985.491) [-1984.463] (-1993.556) -- 0:01:25
      738200 -- (-1988.575) [-1976.879] (-1990.571) (-1995.096) * (-2003.396) (-1984.325) [-1985.003] (-1991.437) -- 0:01:25
      738300 -- (-1994.592) (-1988.211) [-1985.670] (-1991.002) * (-1996.183) [-1989.882] (-1988.135) (-1998.576) -- 0:01:25
      738400 -- (-1987.516) (-1998.786) [-1981.943] (-1991.016) * (-2005.359) [-1985.243] (-1988.166) (-1993.553) -- 0:01:25
      738500 -- (-1988.747) (-1998.305) [-1988.270] (-1999.145) * (-1999.069) [-1988.221] (-1986.428) (-1995.854) -- 0:01:24
      738600 -- [-1986.340] (-1994.820) (-1988.445) (-1993.613) * (-1990.966) [-1987.462] (-1992.975) (-1996.615) -- 0:01:24
      738700 -- [-1981.235] (-1998.348) (-1989.029) (-2001.514) * (-1993.237) [-1994.203] (-1996.911) (-1991.026) -- 0:01:24
      738800 -- [-1980.597] (-1996.925) (-1986.001) (-2001.475) * (-1996.515) (-1993.819) (-1997.486) [-1991.973] -- 0:01:24
      738900 -- (-1986.284) (-1986.189) [-1980.683] (-1991.521) * (-1995.613) (-2001.865) (-1999.215) [-1990.517] -- 0:01:24
      739000 -- [-1984.630] (-1990.599) (-1980.067) (-1994.988) * (-1990.723) (-2000.522) (-2000.364) [-1988.876] -- 0:01:24

      Average standard deviation of split frequencies: 0.002660

      739100 -- (-1987.683) (-1985.848) [-1979.082] (-1985.751) * (-2002.137) (-1996.978) (-1998.040) [-1986.142] -- 0:01:24
      739200 -- (-1988.951) (-1989.950) (-1983.222) [-1981.362] * (-1992.066) (-1993.498) (-1994.974) [-1986.475] -- 0:01:25
      739300 -- (-1992.582) (-1994.944) (-1986.818) [-1980.176] * [-1987.937] (-1996.547) (-1995.899) (-1989.918) -- 0:01:24
      739400 -- (-1991.692) (-1991.909) [-1980.477] (-1980.562) * [-1989.712] (-1990.809) (-1994.583) (-1990.934) -- 0:01:24
      739500 -- (-1988.260) (-1989.800) [-1978.813] (-1995.962) * (-1994.112) (-1983.432) (-1991.984) [-1983.833] -- 0:01:24
      739600 -- (-1996.340) [-1981.092] (-1977.626) (-1992.554) * (-1989.996) (-1992.058) (-1997.470) [-1986.988] -- 0:01:24
      739700 -- (-1996.190) (-1986.762) [-1981.199] (-1988.576) * (-1992.338) [-1987.943] (-1987.568) (-1990.766) -- 0:01:24
      739800 -- (-2000.094) [-1987.960] (-1981.466) (-1993.797) * [-1984.451] (-1995.246) (-1986.740) (-2000.404) -- 0:01:24
      739900 -- (-1998.780) (-1986.991) (-1987.293) [-1984.239] * [-1987.706] (-1998.028) (-1998.850) (-1993.402) -- 0:01:24
      740000 -- (-1995.037) [-1984.422] (-1990.997) (-1979.563) * (-1982.025) (-1994.772) (-1997.868) [-1985.902] -- 0:01:24

      Average standard deviation of split frequencies: 0.002639

      740100 -- (-1987.417) [-1981.192] (-1985.037) (-1985.594) * [-1977.483] (-1992.110) (-2009.412) (-1993.247) -- 0:01:24
      740200 -- (-1989.912) (-1978.595) [-1991.614] (-1995.881) * [-1979.610] (-1985.720) (-1995.853) (-1992.042) -- 0:01:24
      740300 -- (-1988.115) (-1985.429) (-1977.925) [-1982.571] * (-1986.464) (-1985.072) (-2014.755) [-1989.482] -- 0:01:24
      740400 -- (-1994.191) (-1985.010) [-1978.206] (-1984.258) * (-1982.990) [-1986.934] (-2001.079) (-1993.046) -- 0:01:24
      740500 -- (-1984.670) (-1990.614) [-1981.711] (-1986.295) * (-1985.957) [-1991.760] (-1998.035) (-1990.705) -- 0:01:24
      740600 -- (-1989.113) (-1990.856) (-1982.769) [-1980.709] * [-1982.687] (-1987.731) (-1999.421) (-1994.586) -- 0:01:24
      740700 -- [-1984.095] (-2001.550) (-1986.945) (-1981.315) * [-1988.802] (-1990.445) (-2001.388) (-1991.865) -- 0:01:24
      740800 -- (-1985.542) (-1989.735) (-1990.406) [-1982.900] * (-1987.435) (-1992.362) (-2007.816) [-1988.715] -- 0:01:24
      740900 -- (-1985.874) (-1995.384) (-1993.671) [-1979.824] * [-1983.808] (-1985.592) (-1997.155) (-2004.494) -- 0:01:24
      741000 -- (-1984.404) (-1993.907) (-1986.238) [-1984.812] * [-1980.158] (-1985.002) (-1996.685) (-2006.861) -- 0:01:24

      Average standard deviation of split frequencies: 0.002599

      741100 -- (-1984.650) (-2006.984) (-1995.778) [-1981.500] * [-1979.286] (-1990.123) (-1999.671) (-2003.339) -- 0:01:24
      741200 -- (-1990.264) (-2000.904) [-1989.253] (-1984.012) * (-1985.498) (-1997.363) [-1996.115] (-2004.481) -- 0:01:24
      741300 -- (-1990.322) (-1988.691) (-1990.409) [-1982.722] * [-1989.853] (-1995.293) (-2002.899) (-2000.945) -- 0:01:24
      741400 -- [-1989.069] (-1989.161) (-1987.019) (-1986.858) * [-1987.214] (-1997.882) (-1997.230) (-2004.972) -- 0:01:24
      741500 -- (-1985.082) (-1985.895) (-1991.476) [-1979.258] * [-1983.275] (-1995.285) (-1991.390) (-1993.861) -- 0:01:24
      741600 -- (-1985.148) (-1988.184) (-1992.466) [-1976.255] * [-1978.400] (-1997.366) (-1994.736) (-1991.597) -- 0:01:23
      741700 -- (-1991.890) (-1991.024) (-1994.340) [-1985.716] * (-1984.580) (-1992.542) (-1999.942) [-1988.916] -- 0:01:23
      741800 -- [-1983.832] (-1989.906) (-1997.997) (-1989.899) * [-1986.171] (-1990.838) (-1996.006) (-1989.973) -- 0:01:23
      741900 -- (-1985.787) (-1995.682) [-1983.395] (-1986.556) * [-1984.982] (-1991.149) (-1988.232) (-1988.160) -- 0:01:23
      742000 -- [-1979.120] (-2001.819) (-1979.057) (-1984.146) * [-1989.352] (-1991.024) (-2001.343) (-1987.034) -- 0:01:23

      Average standard deviation of split frequencies: 0.002577

      742100 -- (-1980.784) (-1996.552) [-1978.784] (-1984.943) * [-1988.276] (-1992.816) (-2006.898) (-1987.923) -- 0:01:23
      742200 -- (-1986.405) (-1989.072) [-1977.977] (-1988.721) * (-1993.366) (-1995.378) (-2002.541) [-1989.300] -- 0:01:24
      742300 -- (-1993.354) (-1986.674) [-1978.315] (-1992.342) * [-1987.844] (-1993.386) (-1999.845) (-1988.186) -- 0:01:24
      742400 -- (-1996.014) [-1983.526] (-1983.683) (-1992.947) * (-1988.733) (-2003.399) (-2002.989) [-1991.510] -- 0:01:23
      742500 -- (-1987.781) [-1983.338] (-1989.951) (-1990.057) * [-1988.881] (-1988.566) (-1995.239) (-1989.830) -- 0:01:23
      742600 -- (-1997.130) (-1993.998) [-1988.000] (-1986.943) * [-1983.552] (-1987.856) (-1994.634) (-1996.473) -- 0:01:23
      742700 -- (-1996.881) (-1995.163) [-1989.099] (-1986.954) * [-1986.283] (-1990.526) (-2000.829) (-1996.090) -- 0:01:23
      742800 -- (-2001.091) (-1998.613) [-1991.116] (-1994.786) * [-1981.087] (-2000.306) (-2008.369) (-1992.517) -- 0:01:23
      742900 -- (-2002.237) (-1991.354) [-1985.629] (-1988.777) * [-1985.023] (-1998.991) (-1999.917) (-1995.077) -- 0:01:23
      743000 -- (-2017.222) (-1996.944) [-1984.292] (-1987.761) * (-1985.930) (-2000.431) [-1989.583] (-1993.046) -- 0:01:23

      Average standard deviation of split frequencies: 0.002537

      743100 -- (-2004.651) (-1995.306) [-1987.570] (-1985.446) * (-1988.699) (-1998.778) [-1987.896] (-2003.478) -- 0:01:23
      743200 -- (-2003.549) (-1994.940) (-1992.722) [-1982.929] * [-1990.483] (-1999.190) (-1985.132) (-2000.641) -- 0:01:23
      743300 -- (-1996.880) (-1999.688) (-1987.792) [-1981.975] * (-1988.656) [-1992.087] (-1988.038) (-1997.731) -- 0:01:23
      743400 -- (-1989.273) (-1995.554) (-1985.569) [-1982.041] * (-1986.944) (-1994.850) [-1989.576] (-1991.832) -- 0:01:23
      743500 -- (-1997.266) (-1994.140) [-1983.373] (-1988.544) * (-1985.652) (-1994.149) [-1982.259] (-1989.672) -- 0:01:23
      743600 -- (-2000.429) (-1993.081) (-1984.912) [-1982.877] * (-1989.690) (-1989.451) [-1982.434] (-1986.490) -- 0:01:23
      743700 -- (-1996.603) (-1993.710) (-1987.831) [-1978.435] * (-1989.685) [-1986.807] (-1986.784) (-1993.692) -- 0:01:23
      743800 -- (-1993.751) (-1991.694) [-1991.245] (-1990.492) * (-1994.543) (-2004.969) (-1992.935) [-1989.473] -- 0:01:23
      743900 -- (-1995.755) (-1988.766) (-1991.387) [-1982.411] * (-1988.375) (-1991.261) (-1992.956) [-1985.460] -- 0:01:23
      744000 -- (-1995.151) (-1988.498) (-1994.424) [-1988.329] * (-1989.270) (-1985.247) [-1988.999] (-1997.845) -- 0:01:23

      Average standard deviation of split frequencies: 0.002516

      744100 -- (-1995.208) (-1987.791) (-1991.201) [-1990.813] * [-1982.967] (-1992.628) (-1987.687) (-1997.056) -- 0:01:23
      744200 -- (-1994.692) (-1985.562) [-1987.608] (-1983.407) * (-1983.290) [-1988.363] (-1987.196) (-1990.455) -- 0:01:23
      744300 -- (-1993.957) (-1986.067) [-1983.637] (-1982.784) * (-1992.027) [-1987.744] (-1989.369) (-1992.421) -- 0:01:23
      744400 -- (-1992.179) (-1990.024) [-1983.833] (-1987.550) * (-1990.108) [-1988.704] (-1989.120) (-2003.246) -- 0:01:23
      744500 -- (-1990.003) (-1988.276) [-1984.348] (-1985.025) * [-1986.043] (-1990.689) (-1990.456) (-2009.787) -- 0:01:23
      744600 -- (-1986.241) (-1990.023) (-1987.446) [-1983.971] * (-1987.574) (-1992.515) [-1986.218] (-2003.616) -- 0:01:23
      744700 -- (-1989.027) (-1990.832) (-1987.675) [-1981.024] * (-1989.406) (-1991.529) (-1988.692) [-1987.843] -- 0:01:22
      744800 -- (-1989.676) (-1994.531) (-1990.631) [-1982.397] * [-1991.640] (-1993.388) (-2003.676) (-1985.251) -- 0:01:22
      744900 -- (-1989.651) (-1992.002) (-1991.613) [-1984.945] * [-1981.310] (-1994.838) (-2002.824) (-1985.619) -- 0:01:22
      745000 -- [-1985.301] (-1994.340) (-1994.994) (-1986.362) * [-1982.559] (-1988.164) (-2014.266) (-1986.298) -- 0:01:22

      Average standard deviation of split frequencies: 0.002440

      745100 -- [-1987.930] (-1989.183) (-1993.514) (-1987.731) * (-1985.251) (-1987.693) (-1998.517) [-1985.689] -- 0:01:22
      745200 -- [-1985.117] (-1992.597) (-1998.101) (-1995.978) * [-1981.539] (-1992.364) (-1993.615) (-1987.733) -- 0:01:23
      745300 -- (-1988.911) [-1995.497] (-1990.817) (-1991.542) * [-1984.324] (-1989.405) (-1993.637) (-1990.430) -- 0:01:23
      745400 -- (-1990.321) (-1993.718) [-1988.533] (-1983.627) * [-1978.808] (-1988.929) (-1994.836) (-1988.434) -- 0:01:22
      745500 -- (-1993.935) (-2002.806) (-1983.792) [-1977.830] * [-1979.737] (-1989.672) (-1994.097) (-1991.639) -- 0:01:22
      745600 -- (-1990.764) (-2014.375) (-1983.348) [-1978.660] * [-1979.539] (-1988.320) (-2002.534) (-1986.147) -- 0:01:22
      745700 -- (-1992.610) (-1993.116) [-1985.493] (-1980.023) * [-1985.383] (-1991.679) (-1998.072) (-1991.381) -- 0:01:22
      745800 -- (-1993.531) (-1993.421) (-1984.599) [-1979.605] * [-1985.070] (-1992.301) (-2004.954) (-1993.768) -- 0:01:22
      745900 -- (-1993.717) (-1995.119) [-1983.667] (-1979.251) * (-1986.880) [-1990.574] (-2001.606) (-1998.914) -- 0:01:22
      746000 -- (-2005.628) (-1994.586) (-1984.769) [-1983.070] * [-1984.715] (-1999.587) (-1994.474) (-1992.981) -- 0:01:22

      Average standard deviation of split frequencies: 0.002365

      746100 -- (-1995.210) (-1991.744) (-1989.998) [-1979.486] * [-1986.198] (-1994.470) (-1997.124) (-1994.335) -- 0:01:22
      746200 -- [-1987.552] (-1994.076) (-1995.006) (-1984.183) * (-1993.389) (-1994.765) (-2001.157) [-1992.911] -- 0:01:22
      746300 -- [-1989.805] (-1993.936) (-1994.037) (-1984.426) * [-1989.681] (-1994.224) (-2005.212) (-1992.522) -- 0:01:22
      746400 -- (-1986.426) (-2005.493) (-1993.319) [-1982.697] * (-1991.078) (-1994.445) (-1986.179) [-1988.604] -- 0:01:22
      746500 -- (-1994.445) (-1995.528) (-1994.910) [-1985.947] * (-1984.124) [-1991.666] (-1987.495) (-1993.724) -- 0:01:22
      746600 -- (-1995.683) (-1994.693) (-1991.440) [-1986.199] * [-1979.381] (-1994.199) (-1987.377) (-1999.230) -- 0:01:22
      746700 -- (-1998.490) (-1995.420) [-1984.478] (-1989.745) * [-1982.887] (-1999.822) (-1991.527) (-1999.029) -- 0:01:22
      746800 -- (-1996.964) (-1995.759) [-1983.613] (-1995.952) * [-1982.467] (-2005.697) (-1998.970) (-2008.382) -- 0:01:22
      746900 -- (-1989.856) (-1993.226) [-1986.231] (-1993.358) * [-1980.903] (-2011.561) (-2001.453) (-2001.731) -- 0:01:22
      747000 -- [-1984.986] (-1993.837) (-1992.488) (-1992.885) * [-1981.209] (-1996.072) (-2002.665) (-1992.488) -- 0:01:22

      Average standard deviation of split frequencies: 0.002271

      747100 -- (-1986.360) (-2001.895) (-1987.907) [-2004.019] * [-1979.638] (-1996.809) (-1999.032) (-2001.641) -- 0:01:22
      747200 -- [-1987.827] (-1991.177) (-1985.081) (-1994.845) * [-1981.831] (-1994.769) (-1995.455) (-2002.864) -- 0:01:22
      747300 -- [-1989.420] (-1993.168) (-1987.892) (-1997.387) * [-1981.389] (-1996.417) (-2000.166) (-1997.490) -- 0:01:22
      747400 -- [-1989.443] (-1999.169) (-1988.306) (-1995.466) * (-1990.875) (-1994.346) [-1985.658] (-1992.007) -- 0:01:22
      747500 -- (-1992.950) (-2000.341) [-1989.910] (-1992.229) * (-1988.503) (-1989.868) [-1987.502] (-1992.601) -- 0:01:22
      747600 -- (-1996.946) (-2009.075) [-1991.350] (-1990.693) * (-1992.319) (-1988.596) [-1985.348] (-1993.758) -- 0:01:22
      747700 -- (-1998.369) (-1998.066) (-1981.158) [-1990.507] * (-1988.290) (-1996.394) (-1999.410) [-1993.173] -- 0:01:21
      747800 -- (-1993.986) (-1999.729) (-1985.192) [-1984.505] * [-1984.775] (-1989.243) (-2002.780) (-1991.755) -- 0:01:21
      747900 -- (-1997.391) (-1997.045) (-1982.556) [-1987.147] * [-1982.026] (-1990.511) (-1999.194) (-1998.505) -- 0:01:21
      748000 -- (-1999.877) (-1991.841) (-1980.004) [-1987.713] * [-1982.228] (-1992.371) (-1992.330) (-1994.332) -- 0:01:21

      Average standard deviation of split frequencies: 0.002232

      748100 -- (-1991.002) (-2000.823) [-1986.211] (-1993.685) * [-1982.644] (-1998.747) (-1992.844) (-1998.552) -- 0:01:21
      748200 -- [-1986.886] (-1993.437) (-1982.559) (-1986.557) * [-1979.904] (-1992.593) (-1992.127) (-2000.797) -- 0:01:22
      748300 -- (-1990.271) (-1995.683) [-1978.646] (-1985.717) * [-1984.621] (-1987.760) (-1994.051) (-1995.840) -- 0:01:22
      748400 -- (-1995.058) (-1997.199) [-1978.755] (-1992.127) * [-1986.487] (-1986.357) (-1999.535) (-1996.113) -- 0:01:22
      748500 -- (-2000.326) (-1994.406) [-1975.523] (-1990.626) * (-1988.341) [-1983.533] (-1991.547) (-1988.226) -- 0:01:21
      748600 -- (-1998.215) (-1989.191) [-1978.390] (-1985.446) * [-1988.228] (-1982.712) (-1991.491) (-1997.645) -- 0:01:21
      748700 -- (-1994.226) (-1987.893) [-1980.238] (-1989.142) * [-1985.435] (-1981.404) (-1997.407) (-2001.814) -- 0:01:21
      748800 -- (-1991.665) (-1989.943) (-1982.452) [-1989.168] * [-1983.300] (-1987.900) (-1991.377) (-1995.954) -- 0:01:21
      748900 -- (-1995.381) (-1987.055) [-1985.081] (-1993.860) * [-1981.716] (-1992.876) (-1987.752) (-1994.436) -- 0:01:21
      749000 -- (-1990.521) (-1989.822) (-1990.557) [-1988.849] * [-1979.209] (-1992.517) (-1993.058) (-1998.153) -- 0:01:21

      Average standard deviation of split frequencies: 0.002157

      749100 -- (-1989.431) [-1988.399] (-1989.176) (-1996.316) * [-1988.542] (-1985.893) (-1999.051) (-2000.502) -- 0:01:21
      749200 -- (-1990.017) (-1989.600) (-1997.481) [-1987.967] * [-1980.664] (-1990.724) (-2001.104) (-1988.371) -- 0:01:21
      749300 -- [-1988.511] (-1989.208) (-1995.936) (-1998.880) * (-1984.647) [-1986.626] (-1991.521) (-1984.461) -- 0:01:21
      749400 -- (-2001.883) [-1977.595] (-1992.305) (-1989.210) * (-1991.982) [-1979.126] (-1995.197) (-1986.203) -- 0:01:21
      749500 -- (-1992.911) (-1981.314) [-1981.208] (-1992.905) * (-1993.205) (-1982.951) (-1998.385) [-1988.414] -- 0:01:21
      749600 -- (-1997.177) [-1983.915] (-1981.546) (-1985.815) * (-1992.777) [-1988.893] (-1991.443) (-1988.999) -- 0:01:21
      749700 -- (-2003.799) (-1978.711) [-1986.030] (-1982.760) * (-1984.115) [-1983.005] (-2000.978) (-1990.854) -- 0:01:21
      749800 -- (-2003.226) [-1985.804] (-1982.975) (-1986.169) * (-1991.204) (-1987.699) (-1994.778) [-1989.446] -- 0:01:21
      749900 -- (-2005.922) (-1992.420) [-1981.498] (-1991.383) * (-1991.608) [-1987.987] (-1993.147) (-1993.080) -- 0:01:21
      750000 -- (-2001.751) [-1984.962] (-1979.459) (-1985.819) * (-1987.515) [-1982.522] (-1990.770) (-1996.226) -- 0:01:21

      Average standard deviation of split frequencies: 0.002137

      750100 -- (-1996.881) (-1985.736) [-1979.736] (-1996.589) * (-1985.433) [-1985.507] (-1987.202) (-1987.661) -- 0:01:21
      750200 -- (-2001.503) [-1985.714] (-1984.581) (-1992.647) * [-1986.601] (-1989.943) (-1994.207) (-1992.922) -- 0:01:21
      750300 -- (-2002.592) [-1988.563] (-1986.283) (-1991.861) * [-1987.940] (-1987.159) (-1989.858) (-2000.061) -- 0:01:21
      750400 -- (-2006.834) (-1990.321) (-1986.557) [-1987.087] * (-1987.591) [-1984.643] (-1995.734) (-2011.505) -- 0:01:21
      750500 -- (-2010.796) [-1983.687] (-1984.972) (-1984.576) * (-1987.692) [-1981.650] (-1999.258) (-2010.496) -- 0:01:21
      750600 -- (-2012.099) (-1981.510) (-1987.637) [-1985.576] * (-1986.723) [-1982.249] (-2000.092) (-2005.933) -- 0:01:21
      750700 -- (-2012.114) [-1982.433] (-1986.651) (-1982.409) * [-1986.771] (-1982.339) (-2000.879) (-2003.952) -- 0:01:21
      750800 -- (-2011.379) (-1988.054) [-1986.522] (-1986.874) * (-1983.958) (-1989.017) (-1992.564) [-1990.728] -- 0:01:20
      750900 -- (-2004.492) [-1980.986] (-1986.792) (-1989.177) * [-1984.434] (-1984.263) (-1991.370) (-1990.430) -- 0:01:20
      751000 -- (-1998.017) (-1984.515) [-1988.261] (-1982.482) * (-1995.175) [-1982.181] (-1986.478) (-1994.037) -- 0:01:20

      Average standard deviation of split frequencies: 0.002098

      751100 -- (-2006.002) (-1987.718) (-2000.814) [-1980.744] * (-1987.627) (-1988.178) [-1987.359] (-1999.493) -- 0:01:20
      751200 -- (-1995.665) (-1988.783) (-1991.344) [-1979.616] * [-1985.241] (-1984.175) (-1988.457) (-1994.174) -- 0:01:21
      751300 -- (-1994.442) [-1976.573] (-1987.312) (-1983.547) * (-1985.956) [-1981.921] (-1986.793) (-1991.675) -- 0:01:21
      751400 -- (-2007.538) [-1977.122] (-1987.709) (-1986.071) * (-1994.295) [-1977.198] (-1995.176) (-2003.774) -- 0:01:21
      751500 -- (-2007.596) [-1974.952] (-2007.831) (-1989.843) * (-1989.463) [-1981.715] (-1997.735) (-2013.244) -- 0:01:21
      751600 -- (-1999.415) [-1979.899] (-1999.228) (-1988.429) * (-1990.855) [-1980.439] (-1996.158) (-2011.583) -- 0:01:20
      751700 -- (-2000.864) [-1979.787] (-1991.210) (-1986.521) * [-1988.314] (-1985.745) (-1995.079) (-2016.147) -- 0:01:20
      751800 -- (-1995.952) [-1983.126] (-1989.869) (-1987.381) * (-1987.218) (-1987.570) [-1985.986] (-2010.935) -- 0:01:20
      751900 -- (-1993.026) [-1980.455] (-1994.289) (-1994.329) * (-1991.769) (-1989.020) [-1983.565] (-2011.531) -- 0:01:20
      752000 -- [-1995.202] (-1985.566) (-2000.650) (-1994.214) * (-1987.058) (-1982.662) [-1978.114] (-2006.302) -- 0:01:20

      Average standard deviation of split frequencies: 0.002113

      752100 -- (-1996.110) [-1982.827] (-1998.076) (-1988.070) * (-1988.048) (-1994.645) [-1985.083] (-2004.512) -- 0:01:20
      752200 -- (-1999.700) [-1980.502] (-1996.835) (-1995.909) * (-1999.862) (-1994.952) [-1983.191] (-1999.631) -- 0:01:20
      752300 -- (-1992.448) (-1983.598) (-1993.786) [-1989.013] * (-2007.608) (-1994.000) [-1984.205] (-2001.761) -- 0:01:20
      752400 -- (-1991.132) [-1987.088] (-1994.834) (-1993.871) * (-1998.674) (-2005.694) [-1981.898] (-2004.356) -- 0:01:20
      752500 -- (-1994.442) [-1978.636] (-1997.398) (-1987.088) * (-2004.568) (-1997.337) [-1979.916] (-2000.829) -- 0:01:20
      752600 -- (-1997.673) [-1980.308] (-1995.383) (-1988.435) * (-2000.657) [-1990.286] (-2002.240) (-1991.718) -- 0:01:20
      752700 -- (-1995.389) [-1979.034] (-1998.427) (-1987.878) * (-1990.972) [-1985.241] (-1987.106) (-1992.342) -- 0:01:20
      752800 -- (-2005.269) [-1979.597] (-2006.058) (-1993.446) * (-1989.579) (-1985.693) [-1986.458] (-1993.330) -- 0:01:20
      752900 -- (-1998.992) (-1983.340) (-2001.666) [-1994.362] * (-1987.533) [-1985.824] (-1992.216) (-2007.309) -- 0:01:20
      753000 -- (-1992.250) (-1989.524) (-1994.534) [-1988.349] * [-1985.579] (-1985.316) (-1986.182) (-1998.965) -- 0:01:20

      Average standard deviation of split frequencies: 0.002110

      753100 -- (-1992.594) (-1993.651) [-1991.610] (-1988.195) * (-1987.656) (-1980.566) [-1979.756] (-1984.203) -- 0:01:20
      753200 -- (-1998.339) (-1988.803) (-1992.625) [-1990.534] * (-1998.025) (-1983.597) (-1980.780) [-1982.855] -- 0:01:20
      753300 -- [-1999.053] (-1993.729) (-1990.042) (-1987.633) * (-1993.049) (-1978.676) [-1986.376] (-1992.025) -- 0:01:20
      753400 -- (-1997.399) (-1996.807) (-1991.751) [-1985.395] * (-1987.792) (-1989.858) (-1983.395) [-1990.583] -- 0:01:20
      753500 -- (-1996.712) (-2002.938) (-1995.867) [-1986.159] * (-1989.968) (-1985.399) [-1978.848] (-1998.547) -- 0:01:20
      753600 -- (-1997.513) (-2005.453) [-1990.494] (-1986.496) * (-1986.060) [-1984.551] (-1991.052) (-1992.759) -- 0:01:20
      753700 -- (-1997.932) (-1998.744) [-1985.375] (-1992.855) * (-1988.860) [-1987.230] (-1980.890) (-1998.916) -- 0:01:20
      753800 -- (-2008.010) (-1993.884) (-1983.302) [-1989.907] * (-1994.363) [-1983.748] (-1987.198) (-1999.148) -- 0:01:20
      753900 -- (-1995.641) (-1988.587) [-1985.556] (-1993.226) * (-1994.853) [-1982.694] (-1986.802) (-2003.859) -- 0:01:19
      754000 -- (-1997.797) (-2002.028) [-1985.302] (-1990.339) * (-1983.899) [-1983.531] (-1987.746) (-1998.758) -- 0:01:19

      Average standard deviation of split frequencies: 0.002143

      754100 -- (-2000.610) (-1992.338) [-1987.286] (-1999.171) * (-1989.697) (-1989.563) [-1994.984] (-1997.170) -- 0:01:19
      754200 -- (-1996.441) [-1991.935] (-1988.114) (-1991.280) * [-1992.855] (-1988.311) (-1987.567) (-1996.694) -- 0:01:20
      754300 -- (-1996.032) [-1993.094] (-1994.018) (-1989.852) * (-1992.728) (-1993.182) [-1984.377] (-1995.040) -- 0:01:20
      754400 -- [-1986.842] (-1995.124) (-1987.454) (-1988.798) * (-2009.246) [-1981.071] (-1991.068) (-1991.063) -- 0:01:20
      754500 -- [-1984.902] (-1992.438) (-1992.428) (-1994.150) * (-2011.438) (-1985.371) [-1982.702] (-1991.923) -- 0:01:20
      754600 -- (-1987.075) (-1992.493) (-1993.887) [-1986.628] * (-2003.571) (-1988.330) [-1981.559] (-1994.161) -- 0:01:20
      754700 -- [-1985.682] (-2001.118) (-1994.886) (-1988.714) * (-1996.642) (-1981.764) (-1978.716) [-1997.209] -- 0:01:19
      754800 -- (-1990.550) (-1996.288) (-1997.639) [-1986.808] * (-1996.505) [-1979.917] (-1985.029) (-2002.046) -- 0:01:19
      754900 -- [-1987.041] (-1992.967) (-1994.741) (-1991.939) * (-1986.847) [-1983.134] (-1986.230) (-1993.904) -- 0:01:19
      755000 -- (-1996.497) (-1990.768) (-1997.791) [-1985.412] * (-1997.242) [-1982.392] (-1979.765) (-1991.560) -- 0:01:19

      Average standard deviation of split frequencies: 0.002087

      755100 -- [-1995.265] (-2005.506) (-1992.050) (-1985.684) * (-2000.489) [-1978.475] (-1983.428) (-1992.867) -- 0:01:19
      755200 -- (-2000.197) (-2000.595) (-1989.428) [-1983.846] * (-1996.884) [-1981.981] (-1986.378) (-1989.008) -- 0:01:19
      755300 -- (-1995.397) (-1996.983) (-1990.010) [-1982.316] * (-2001.177) [-1983.453] (-1987.230) (-1988.470) -- 0:01:19
      755400 -- (-1993.785) (-1991.233) [-1989.078] (-1978.574) * (-2003.695) [-1981.747] (-1993.263) (-1993.779) -- 0:01:19
      755500 -- (-1991.866) (-1990.780) (-1995.548) [-1981.702] * (-1993.430) [-1978.617] (-1981.905) (-1995.652) -- 0:01:19
      755600 -- (-1998.502) (-1991.656) (-1996.853) [-1989.579] * (-1992.183) (-1983.129) [-1981.688] (-1992.063) -- 0:01:19
      755700 -- (-1995.673) (-1991.983) [-1994.359] (-1990.969) * (-1992.750) (-1987.746) [-1979.927] (-1992.737) -- 0:01:19
      755800 -- (-1996.469) (-1992.668) (-1995.167) [-1988.070] * (-1996.262) (-1984.877) [-1977.199] (-1989.384) -- 0:01:19
      755900 -- (-1997.606) (-1997.203) (-1995.960) [-1984.866] * (-1991.404) (-1990.851) [-1978.075] (-1994.928) -- 0:01:19
      756000 -- (-1995.680) (-1998.561) (-1997.211) [-1991.374] * (-1990.908) [-1981.698] (-1982.652) (-2004.335) -- 0:01:19

      Average standard deviation of split frequencies: 0.002031

      756100 -- (-2003.913) (-2001.220) [-1994.562] (-1989.489) * (-1992.038) [-1983.970] (-1984.688) (-2001.226) -- 0:01:19
      756200 -- (-1997.036) (-2016.225) [-1985.734] (-1983.229) * (-2001.235) [-1986.410] (-1984.057) (-2001.376) -- 0:01:19
      756300 -- (-1999.595) (-2002.988) (-1992.267) [-1980.050] * (-1995.618) [-1992.637] (-1985.221) (-1996.891) -- 0:01:19
      756400 -- (-1996.796) (-1996.269) (-1990.944) [-1978.998] * (-1995.028) [-1990.040] (-1988.003) (-1998.827) -- 0:01:19
      756500 -- (-1998.713) (-2004.347) (-1992.591) [-1979.942] * (-1997.755) [-1991.046] (-1994.173) (-1999.767) -- 0:01:19
      756600 -- (-1998.717) (-2005.702) (-1999.873) [-1981.914] * (-1996.566) (-1986.249) [-1982.012] (-1998.286) -- 0:01:19
      756700 -- (-1993.699) (-2002.353) (-1992.332) [-1981.774] * (-1995.308) (-1989.840) [-1986.870] (-2002.891) -- 0:01:19
      756800 -- (-2000.646) [-1999.960] (-1996.554) (-1982.955) * (-1992.372) (-1989.608) [-1984.142] (-2001.409) -- 0:01:19
      756900 -- (-2001.609) (-2008.042) (-2001.729) [-1980.011] * (-1990.889) [-1989.470] (-1984.826) (-2008.372) -- 0:01:19
      757000 -- (-1998.066) (-2013.692) (-1993.909) [-1981.006] * (-1997.248) [-1987.092] (-1986.754) (-2004.114) -- 0:01:18

      Average standard deviation of split frequencies: 0.002028

      757100 -- (-1996.173) (-2014.591) (-1993.685) [-1988.037] * (-1994.220) (-1988.811) [-1989.111] (-1994.421) -- 0:01:19
      757200 -- (-1996.801) (-1993.347) (-1994.901) [-1985.918] * (-1999.038) [-1990.496] (-1986.761) (-1993.842) -- 0:01:19
      757300 -- (-1997.472) [-1990.003] (-1996.915) (-1989.031) * (-1992.016) (-1992.272) (-1991.492) [-1991.056] -- 0:01:19
      757400 -- (-2000.739) (-1987.720) [-1991.309] (-1989.155) * (-1995.577) [-1996.394] (-1990.606) (-1992.409) -- 0:01:19
      757500 -- (-1990.191) (-1991.272) (-1991.154) [-1987.554] * (-1992.495) (-2007.319) [-1986.652] (-1994.336) -- 0:01:19
      757600 -- (-1992.277) [-1989.453] (-1996.006) (-1989.284) * (-1990.438) (-1990.179) [-1985.751] (-1992.827) -- 0:01:19
      757700 -- (-1993.471) (-1992.214) (-2000.260) [-1985.914] * (-2001.710) (-1986.615) [-1981.040] (-1996.010) -- 0:01:18
      757800 -- (-2002.842) (-1996.254) (-1995.935) [-1985.587] * (-2003.555) (-1990.611) [-1982.091] (-1995.355) -- 0:01:18
      757900 -- (-2001.135) [-1994.940] (-1995.411) (-1988.475) * (-2001.236) (-1990.802) [-1980.754] (-2005.602) -- 0:01:18
      758000 -- (-2004.788) (-2000.327) (-2001.913) [-1981.429] * (-2003.114) (-1989.444) [-1982.877] (-1998.081) -- 0:01:18

      Average standard deviation of split frequencies: 0.001972

      758100 -- (-1998.607) (-1993.159) (-1994.879) [-1980.835] * (-1998.621) (-1990.725) [-1981.203] (-2007.308) -- 0:01:18
      758200 -- (-1995.211) (-1993.228) (-1996.004) [-1983.050] * (-2004.614) (-1997.507) [-1981.334] (-1996.777) -- 0:01:18
      758300 -- (-1994.027) (-1987.426) (-2000.188) [-1980.446] * (-2001.730) (-1992.882) [-1982.300] (-2004.808) -- 0:01:18
      758400 -- (-1995.934) (-1989.892) (-1991.879) [-1983.495] * (-1993.789) (-1997.131) [-1979.699] (-1996.891) -- 0:01:18
      758500 -- (-1995.720) (-1995.640) (-2007.456) [-1983.991] * (-1992.742) (-1992.713) [-1981.710] (-1997.733) -- 0:01:18
      758600 -- (-1994.586) (-1995.647) (-1994.191) [-1980.947] * (-1993.802) (-1987.477) [-1982.329] (-1988.029) -- 0:01:18
      758700 -- (-1998.869) (-1994.771) (-1998.107) [-1979.022] * [-1990.513] (-1988.349) (-1988.431) (-1993.905) -- 0:01:18
      758800 -- (-2009.631) (-1987.813) (-2001.862) [-1980.403] * (-1986.536) (-1988.654) [-1983.959] (-1993.431) -- 0:01:18
      758900 -- (-2000.526) (-1989.356) (-2014.999) [-1985.782] * (-1986.284) (-1983.782) [-1982.735] (-1995.973) -- 0:01:18
      759000 -- [-1996.969] (-1988.043) (-2013.744) (-1986.841) * (-1993.100) (-1981.917) [-1978.856] (-1995.924) -- 0:01:18

      Average standard deviation of split frequencies: 0.001863

      759100 -- (-1992.622) [-1984.783] (-2000.590) (-1982.033) * (-1992.724) [-1977.712] (-1980.970) (-1987.891) -- 0:01:18
      759200 -- [-1989.474] (-1989.974) (-1999.402) (-1978.744) * (-2000.943) (-1983.478) [-1985.529] (-1988.585) -- 0:01:18
      759300 -- (-1985.796) (-1986.896) (-1995.026) [-1982.445] * (-2004.616) (-1983.727) [-1983.401] (-1985.256) -- 0:01:18
      759400 -- (-1988.881) (-1989.648) (-2003.767) [-1981.997] * (-2006.505) (-1985.009) [-1984.210] (-1984.280) -- 0:01:18
      759500 -- (-1985.793) (-1995.102) (-2005.814) [-1981.736] * (-1999.983) (-1981.515) (-1994.718) [-1985.500] -- 0:01:18
      759600 -- (-1990.897) (-1993.255) (-2001.559) [-1980.573] * (-2002.882) [-1979.730] (-1997.349) (-1985.539) -- 0:01:18
      759700 -- (-1993.040) (-1993.347) (-2000.774) [-1981.806] * (-1998.456) (-1983.435) (-1994.806) [-1994.271] -- 0:01:18
      759800 -- (-1983.842) (-1995.579) (-2005.713) [-1983.492] * (-1998.881) [-1987.899] (-1996.541) (-1997.206) -- 0:01:18
      759900 -- [-1986.307] (-1994.926) (-2001.767) (-1984.836) * (-2000.339) [-1987.883] (-1993.771) (-1990.508) -- 0:01:18
      760000 -- (-1987.172) (-1989.658) (-2005.240) [-1984.836] * (-1998.761) [-1984.246] (-2009.448) (-1995.923) -- 0:01:18

      Average standard deviation of split frequencies: 0.001843

      760100 -- [-1986.858] (-1994.114) (-2000.882) (-1989.675) * [-1994.835] (-1981.414) (-2000.475) (-1995.776) -- 0:01:18
      760200 -- (-1992.001) (-1992.027) (-1995.765) [-1986.103] * (-1998.578) [-1985.215] (-1998.577) (-1991.066) -- 0:01:18
      760300 -- (-1992.942) (-1991.711) (-1998.624) [-1983.972] * (-2001.562) (-1988.209) (-1994.008) [-1986.923] -- 0:01:18
      760400 -- (-1995.604) (-1987.581) (-1995.353) [-1985.831] * (-2003.334) (-1987.525) [-1991.907] (-1984.358) -- 0:01:18
      760500 -- (-1991.145) [-1989.446] (-1994.199) (-1987.937) * (-1999.315) (-1981.341) (-1992.384) [-1985.639] -- 0:01:18
      760600 -- (-1995.400) (-1988.252) (-1993.802) [-1984.188] * (-1993.170) [-1993.299] (-1982.656) (-1986.840) -- 0:01:18
      760700 -- (-1993.230) (-1990.293) (-1999.382) [-1981.677] * (-1993.528) (-1986.522) [-1984.126] (-1984.075) -- 0:01:18
      760800 -- (-1993.437) (-1993.818) (-1994.331) [-1981.467] * (-1991.594) [-1986.549] (-1987.884) (-1986.325) -- 0:01:17
      760900 -- (-1991.813) (-1989.861) (-2002.444) [-1982.699] * (-1993.011) (-1996.877) (-1986.393) [-1988.282] -- 0:01:17
      761000 -- (-2002.187) (-1991.404) (-1998.924) [-1983.095] * (-1992.555) (-1993.299) [-1981.046] (-1991.407) -- 0:01:17

      Average standard deviation of split frequencies: 0.001858

      761100 -- (-1988.480) [-1989.179] (-1997.603) (-1991.303) * (-1987.735) (-2004.290) [-1980.909] (-1989.035) -- 0:01:17
      761200 -- (-1991.138) [-1989.457] (-1997.076) (-1997.799) * (-1991.553) (-1996.198) [-1979.936] (-1984.409) -- 0:01:17
      761300 -- (-1996.320) [-1982.442] (-1994.041) (-1994.122) * (-1993.976) (-1995.377) [-1983.677] (-1990.654) -- 0:01:17
      761400 -- (-1993.295) [-1981.756] (-1993.261) (-1990.321) * (-1991.757) (-2003.586) [-1978.700] (-1992.988) -- 0:01:17
      761500 -- (-1989.535) [-1981.792] (-1992.677) (-1986.901) * (-1990.826) (-2005.963) [-1980.161] (-1992.509) -- 0:01:17
      761600 -- (-1994.321) [-1985.559] (-1995.837) (-2001.218) * (-1993.376) (-1995.787) [-1981.006] (-1992.277) -- 0:01:17
      761700 -- (-1989.552) [-1986.303] (-1999.464) (-1998.025) * (-1999.255) (-1994.677) [-1981.656] (-1995.780) -- 0:01:17
      761800 -- [-1991.671] (-1986.523) (-2003.742) (-1988.804) * (-1999.229) (-1993.207) [-1975.805] (-1995.770) -- 0:01:17
      761900 -- (-1998.452) (-1982.621) (-1999.204) [-1989.652] * (-2005.517) (-1994.013) [-1981.150] (-1992.579) -- 0:01:17
      762000 -- (-2004.024) [-1978.833] (-2004.780) (-1986.513) * (-1997.825) (-1996.707) [-1980.401] (-1990.754) -- 0:01:17

      Average standard deviation of split frequencies: 0.001926

      762100 -- (-1996.338) [-1981.993] (-1996.054) (-1989.942) * (-1998.273) [-1984.624] (-1981.311) (-1996.122) -- 0:01:17
      762200 -- (-1998.838) (-1981.799) (-1999.845) [-1986.490] * (-2007.515) [-1979.822] (-1982.434) (-1996.647) -- 0:01:17
      762300 -- (-2004.487) [-1978.518] (-1994.190) (-1990.621) * (-1999.478) (-1983.411) [-1985.732] (-1999.033) -- 0:01:17
      762400 -- (-1996.505) (-1978.392) [-1986.793] (-1995.726) * (-1994.133) [-1985.542] (-1988.693) (-1996.772) -- 0:01:17
      762500 -- (-1992.682) [-1979.050] (-1985.201) (-2007.453) * (-1996.272) [-1984.210] (-1988.248) (-1995.074) -- 0:01:17
      762600 -- (-1993.113) [-1984.159] (-1986.323) (-2014.781) * (-1990.311) (-1993.626) [-1982.570] (-1998.791) -- 0:01:17
      762700 -- [-1988.207] (-1985.868) (-1987.085) (-1996.112) * (-1998.396) (-1986.892) [-1983.010] (-1997.325) -- 0:01:17
      762800 -- (-1989.297) [-1978.877] (-1994.970) (-2000.168) * (-1992.110) (-1991.804) [-1986.202] (-1999.391) -- 0:01:17
      762900 -- [-1991.630] (-1983.676) (-1989.715) (-1994.416) * (-1994.307) (-1996.874) [-1979.964] (-2004.875) -- 0:01:17
      763000 -- [-1989.179] (-1976.627) (-1989.884) (-1996.701) * [-1987.744] (-1990.408) (-1984.807) (-1999.418) -- 0:01:17

      Average standard deviation of split frequencies: 0.002047

      763100 -- (-1983.876) [-1977.248] (-1986.234) (-2000.016) * [-1987.906] (-1989.374) (-1983.792) (-2005.759) -- 0:01:17
      763200 -- (-1989.018) [-1977.084] (-1985.644) (-1989.466) * (-1984.931) (-1985.628) [-1985.045] (-2005.406) -- 0:01:17
      763300 -- (-1989.325) (-1982.126) [-1984.842] (-1997.695) * (-1995.382) (-1984.352) [-1982.434] (-1998.005) -- 0:01:17
      763400 -- [-1990.643] (-1979.293) (-1986.923) (-1996.652) * (-1992.684) (-1992.014) [-1978.574] (-1996.963) -- 0:01:17
      763500 -- (-2004.665) (-1982.718) (-1986.637) [-1994.396] * (-1998.209) (-1984.230) [-1979.751] (-2005.754) -- 0:01:17
      763600 -- (-2000.362) [-1978.493] (-1991.560) (-1993.200) * (-2006.394) (-1984.920) [-1985.308] (-1992.256) -- 0:01:17
      763700 -- (-1996.868) [-1976.094] (-1986.053) (-2000.787) * (-1999.049) [-1982.069] (-1992.632) (-1994.096) -- 0:01:17
      763800 -- (-1998.826) (-1977.546) [-1989.223] (-1993.644) * (-1991.489) [-1988.144] (-1988.835) (-1998.263) -- 0:01:17
      763900 -- (-1998.088) [-1979.181] (-1988.470) (-2005.444) * (-1995.349) [-1992.391] (-1991.680) (-2000.149) -- 0:01:16
      764000 -- (-2007.390) [-1976.815] (-1986.641) (-1993.874) * (-1996.105) (-1991.077) [-1991.647] (-1999.912) -- 0:01:16

      Average standard deviation of split frequencies: 0.001974

      764100 -- (-2007.847) (-1981.084) [-1984.876] (-1996.573) * (-1996.877) [-1988.909] (-1985.810) (-1991.153) -- 0:01:16
      764200 -- (-2000.933) (-1978.132) [-1982.371] (-1991.948) * (-1997.127) (-1980.351) [-1985.538] (-1996.337) -- 0:01:16
      764300 -- (-2000.971) [-1981.925] (-1983.415) (-1992.038) * (-1996.357) [-1981.732] (-1983.439) (-1996.795) -- 0:01:16
      764400 -- (-2001.270) [-1983.432] (-1985.227) (-1991.607) * (-1997.571) [-1984.441] (-1991.597) (-1991.248) -- 0:01:16
      764500 -- (-1991.827) [-1984.411] (-1986.108) (-2001.695) * (-2001.429) [-1979.499] (-1998.593) (-1987.846) -- 0:01:16
      764600 -- (-1995.177) [-1989.485] (-1987.425) (-1996.811) * (-2002.370) [-1978.101] (-1989.954) (-1995.743) -- 0:01:16
      764700 -- (-1999.518) (-1994.667) [-1983.766] (-1995.378) * (-1996.046) [-1984.740] (-1994.375) (-1994.035) -- 0:01:16
      764800 -- (-2009.729) [-1984.648] (-1989.861) (-2000.399) * (-1995.161) [-1981.717] (-1999.112) (-1990.528) -- 0:01:16
      764900 -- (-2000.357) (-1984.604) (-1989.313) [-1997.034] * (-1995.479) [-1980.790] (-1991.957) (-1993.309) -- 0:01:16
      765000 -- [-1994.712] (-1981.249) (-1991.575) (-2004.725) * (-2009.193) (-1980.035) (-1986.029) [-1986.090] -- 0:01:16

      Average standard deviation of split frequencies: 0.002042

      765100 -- (-1996.800) [-1985.196] (-1995.134) (-1994.160) * (-2009.629) (-1978.503) [-1979.985] (-1988.724) -- 0:01:16
      765200 -- (-2001.389) [-1980.541] (-1993.499) (-1997.637) * (-2003.840) [-1977.764] (-1982.180) (-1992.059) -- 0:01:16
      765300 -- (-1997.944) [-1982.261] (-1992.472) (-1992.787) * (-1998.549) [-1984.088] (-1982.002) (-1993.055) -- 0:01:16
      765400 -- (-1996.621) [-1981.299] (-1998.135) (-1989.527) * (-2003.405) (-1982.049) [-1980.383] (-1996.619) -- 0:01:16
      765500 -- (-2002.346) [-1978.713] (-1990.697) (-1999.909) * (-2004.132) (-1989.266) [-1984.447] (-1996.679) -- 0:01:16
      765600 -- (-2001.537) [-1979.819] (-1993.899) (-2000.244) * (-2001.378) (-1991.352) (-1981.547) [-1991.267] -- 0:01:16
      765700 -- (-1997.315) [-1977.895] (-2003.308) (-1997.147) * (-2005.013) (-1980.105) [-1984.156] (-1989.299) -- 0:01:16
      765800 -- (-1996.510) [-1987.919] (-2007.389) (-1997.793) * (-1995.187) [-1983.802] (-1994.248) (-1991.466) -- 0:01:16
      765900 -- (-1993.587) [-1981.912] (-2000.016) (-1994.399) * [-1992.404] (-1987.371) (-1983.151) (-1993.370) -- 0:01:16
      766000 -- (-1991.951) [-1977.373] (-1997.981) (-1992.976) * (-1994.007) (-1986.754) [-1979.659] (-1995.937) -- 0:01:16

      Average standard deviation of split frequencies: 0.002039

      766100 -- (-1986.662) [-1982.465] (-1994.269) (-1994.824) * (-1994.131) (-1982.618) [-1979.589] (-1989.603) -- 0:01:16
      766200 -- (-1990.456) [-1983.342] (-2003.275) (-1991.284) * (-1992.395) [-1980.091] (-1979.637) (-1987.246) -- 0:01:16
      766300 -- (-1986.092) [-1978.442] (-2001.544) (-1984.375) * (-1994.000) [-1985.471] (-1983.004) (-1988.387) -- 0:01:16
      766400 -- [-1989.429] (-1982.762) (-2008.958) (-1997.041) * (-1987.909) (-1987.036) [-1981.740] (-1991.045) -- 0:01:16
      766500 -- (-1989.778) [-1980.953] (-1995.522) (-1992.642) * (-1991.433) [-1992.355] (-1977.795) (-1993.198) -- 0:01:16
      766600 -- (-1987.561) [-1981.347] (-1994.647) (-1992.131) * (-2002.838) [-1988.476] (-1987.383) (-1989.782) -- 0:01:16
      766700 -- (-1991.595) [-1982.615] (-1996.979) (-1989.857) * (-1996.817) [-1987.619] (-1985.307) (-1986.743) -- 0:01:16
      766800 -- (-1999.559) [-1983.921] (-1995.806) (-1985.063) * (-2003.254) [-1982.518] (-1981.820) (-1989.606) -- 0:01:16
      766900 -- (-1992.865) [-1983.319] (-2011.648) (-1989.601) * (-1997.789) (-1984.938) [-1984.549] (-1988.139) -- 0:01:15
      767000 -- (-1992.569) (-1982.829) (-2018.017) [-1992.111] * (-2000.560) (-1982.212) [-1990.776] (-1991.035) -- 0:01:15

      Average standard deviation of split frequencies: 0.002142

      767100 -- (-2002.678) [-1984.270] (-2014.738) (-1988.968) * (-1997.626) [-1978.879] (-1992.001) (-1992.982) -- 0:01:15
      767200 -- (-2001.621) [-1985.093] (-2000.293) (-1991.430) * (-2003.037) [-1979.675] (-1989.857) (-1991.066) -- 0:01:15
      767300 -- (-2000.847) (-1994.839) (-2006.370) [-1996.392] * (-1990.225) [-1985.885] (-1986.261) (-1989.886) -- 0:01:15
      767400 -- (-1993.867) [-1985.799] (-1990.401) (-1995.709) * (-2001.171) (-1991.472) (-1985.364) [-1986.549] -- 0:01:15
      767500 -- (-1994.644) [-1990.434] (-1998.423) (-1994.654) * (-1999.728) (-1989.835) (-1991.384) [-1984.528] -- 0:01:15
      767600 -- [-1989.497] (-1984.908) (-1999.307) (-1997.899) * [-1990.910] (-1989.789) (-1995.180) (-1986.139) -- 0:01:15
      767700 -- (-1994.314) [-1979.594] (-1996.343) (-1993.897) * (-1984.842) [-1984.375] (-1999.476) (-1988.918) -- 0:01:15
      767800 -- (-1990.260) [-1980.588] (-2002.658) (-1998.305) * (-1987.552) [-1985.770] (-2002.247) (-1987.637) -- 0:01:15
      767900 -- (-1986.204) [-1979.350] (-1992.663) (-1996.428) * (-1989.318) (-1989.227) (-2000.882) [-1988.377] -- 0:01:15
      768000 -- (-1993.333) [-1978.541] (-1996.607) (-2001.033) * (-1992.067) [-1985.624] (-1997.724) (-1998.142) -- 0:01:15

      Average standard deviation of split frequencies: 0.002122

      768100 -- (-1988.482) [-1978.131] (-2003.679) (-1999.543) * (-1993.213) [-1987.081] (-2015.441) (-2003.104) -- 0:01:15
      768200 -- (-1993.079) [-1978.442] (-2004.384) (-2000.374) * (-1999.028) [-1984.651] (-1994.165) (-2005.028) -- 0:01:15
      768300 -- (-1990.482) [-1980.154] (-2006.938) (-1996.843) * (-2002.540) [-1982.270] (-1996.651) (-1999.568) -- 0:01:15
      768400 -- (-1993.604) (-1985.841) (-2008.363) [-1990.238] * (-1987.636) [-1983.425] (-1990.062) (-1997.678) -- 0:01:15
      768500 -- (-1994.902) [-1978.473] (-2005.578) (-1994.920) * (-1997.981) [-1985.041] (-1988.703) (-1994.335) -- 0:01:15
      768600 -- (-1990.714) [-1981.457] (-2003.622) (-1989.564) * (-1998.787) [-1981.383] (-1990.475) (-1988.338) -- 0:01:15
      768700 -- (-1990.825) [-1979.329] (-1990.452) (-1996.068) * (-2000.946) [-1984.196] (-1993.043) (-1987.881) -- 0:01:15
      768800 -- (-1985.698) [-1976.641] (-1994.839) (-1995.625) * (-1997.700) [-1982.793] (-1993.676) (-1990.610) -- 0:01:15
      768900 -- (-1984.265) [-1981.660] (-2000.715) (-1999.751) * (-1992.947) [-1988.685] (-1994.526) (-1985.495) -- 0:01:15
      769000 -- (-1985.209) [-1980.134] (-2001.639) (-1996.176) * [-1989.106] (-1984.787) (-1997.819) (-1998.487) -- 0:01:15

      Average standard deviation of split frequencies: 0.002049

      769100 -- (-1983.697) [-1980.479] (-1994.382) (-1995.074) * (-1990.782) (-1987.166) (-1997.228) [-1989.701] -- 0:01:15
      769200 -- (-1986.517) [-1980.998] (-1996.087) (-1988.057) * [-1990.586] (-1990.195) (-1995.941) (-1990.061) -- 0:01:15
      769300 -- (-1983.094) [-1981.684] (-1993.718) (-1989.980) * (-1994.896) [-1983.567] (-1992.037) (-1987.173) -- 0:01:15
      769400 -- (-1984.921) (-1993.307) (-1991.220) [-1985.470] * (-2000.736) [-1989.928] (-1992.989) (-2008.263) -- 0:01:15
      769500 -- (-1985.553) [-1983.455] (-1994.325) (-1988.685) * (-1999.844) (-1985.277) (-2000.668) [-1995.541] -- 0:01:15
      769600 -- (-1983.219) [-1985.921] (-1996.950) (-1983.877) * (-1997.588) [-1985.100] (-1998.251) (-1992.810) -- 0:01:15
      769700 -- [-1982.217] (-1983.848) (-1995.923) (-1993.813) * (-1997.103) [-1984.968] (-1998.025) (-2001.049) -- 0:01:15
      769800 -- (-1995.741) [-1992.693] (-1998.207) (-1998.880) * (-2004.224) [-1983.895] (-1996.522) (-2009.007) -- 0:01:15
      769900 -- [-1993.557] (-1984.145) (-1999.040) (-1997.072) * (-2003.123) [-1984.780] (-1997.266) (-2006.723) -- 0:01:15
      770000 -- (-1993.877) (-1985.827) (-1992.520) [-1991.747] * (-1993.643) (-1993.213) [-1992.798] (-1996.649) -- 0:01:14

      Average standard deviation of split frequencies: 0.002029

      770100 -- (-1999.237) [-1982.585] (-1995.092) (-1987.042) * (-1998.264) (-1985.648) (-1993.390) [-1989.382] -- 0:01:14
      770200 -- (-2002.011) [-1990.413] (-1992.201) (-1984.534) * (-2010.236) (-1986.956) [-1988.768] (-1991.445) -- 0:01:14
      770300 -- [-1995.741] (-1984.789) (-1993.200) (-1986.086) * (-2000.607) (-1988.494) (-1990.482) [-1993.275] -- 0:01:14
      770400 -- (-1994.586) [-1984.076] (-1990.453) (-1983.106) * (-1998.838) (-1994.651) [-1983.698] (-1985.577) -- 0:01:14
      770500 -- (-1997.707) (-1985.859) (-1994.512) [-1986.170] * (-2007.081) (-1991.802) [-1985.645] (-1986.133) -- 0:01:14
      770600 -- (-1991.557) (-1980.332) (-2001.067) [-1986.792] * (-2008.244) (-1985.734) [-1989.615] (-1992.695) -- 0:01:14
      770700 -- (-1992.448) (-1982.416) (-2008.437) [-1994.953] * (-2000.131) [-1978.986] (-1990.016) (-1991.851) -- 0:01:14
      770800 -- (-1995.048) [-1979.847] (-1995.972) (-2004.067) * (-1999.499) [-1982.404] (-1989.143) (-1986.604) -- 0:01:14
      770900 -- (-1986.876) [-1977.428] (-1997.546) (-2003.079) * (-1991.461) [-1983.481] (-1995.828) (-2000.383) -- 0:01:14
      771000 -- (-1988.472) [-1979.213] (-2002.500) (-1988.720) * (-2003.678) (-1982.634) [-1987.400] (-1991.304) -- 0:01:14

      Average standard deviation of split frequencies: 0.002096

      771100 -- (-1985.291) (-1976.655) (-2005.963) [-1991.436] * (-2007.648) (-1991.799) (-1990.373) [-1993.194] -- 0:01:14
      771200 -- (-1988.889) [-1984.135] (-2005.562) (-1993.786) * (-1997.287) [-1987.639] (-1992.151) (-1994.156) -- 0:01:14
      771300 -- (-1987.671) [-1981.845] (-2002.235) (-1994.699) * (-1989.073) (-1984.639) (-1992.071) [-1985.839] -- 0:01:14
      771400 -- [-1985.684] (-1982.295) (-1992.278) (-1998.301) * (-1983.492) [-1982.135] (-1999.609) (-1984.195) -- 0:01:14
      771500 -- (-1989.218) [-1982.115] (-1996.368) (-1988.288) * (-1984.312) [-1979.199] (-1996.621) (-1994.459) -- 0:01:14
      771600 -- (-1986.259) [-1982.021] (-1999.632) (-1985.316) * (-1983.099) [-1978.163] (-1996.388) (-1987.732) -- 0:01:14
      771700 -- [-1984.913] (-1981.692) (-1999.004) (-1990.208) * (-1984.524) [-1988.142] (-1997.183) (-1992.164) -- 0:01:14
      771800 -- (-1985.926) [-1984.473] (-1993.764) (-1988.897) * (-1984.957) (-1986.436) (-1998.784) [-1982.589] -- 0:01:14
      771900 -- [-1983.968] (-1980.139) (-1999.116) (-1996.855) * [-1989.546] (-1990.295) (-2009.304) (-1984.405) -- 0:01:14
      772000 -- (-1987.856) [-1984.321] (-2000.655) (-1998.932) * (-1989.866) (-1998.489) (-2003.073) [-1980.191] -- 0:01:14

      Average standard deviation of split frequencies: 0.002058

      772100 -- [-1982.682] (-1985.519) (-1999.205) (-2004.016) * (-1991.601) (-2003.362) (-2004.040) [-1981.512] -- 0:01:14
      772200 -- [-1985.063] (-1983.036) (-1994.891) (-1997.325) * (-1992.683) (-1989.348) (-1998.353) [-1980.757] -- 0:01:14
      772300 -- [-1977.773] (-1990.535) (-1993.197) (-1994.700) * (-1988.864) (-1990.898) (-1996.926) [-1983.233] -- 0:01:14
      772400 -- [-1979.641] (-1999.717) (-1989.468) (-1997.067) * (-2000.401) [-1986.484] (-1997.308) (-1983.867) -- 0:01:14
      772500 -- [-1981.329] (-2002.631) (-1998.157) (-1998.263) * (-1995.740) (-1986.402) [-1995.428] (-1990.759) -- 0:01:14
      772600 -- [-1983.255] (-2002.048) (-1994.297) (-2012.632) * (-1994.992) (-1981.654) [-1986.781] (-1986.282) -- 0:01:14
      772700 -- [-1988.713] (-2011.844) (-1996.757) (-2002.709) * (-1993.450) [-1978.843] (-1984.757) (-1997.969) -- 0:01:14
      772800 -- (-1990.518) (-1999.330) [-1987.399] (-1995.494) * (-1993.667) (-1979.363) [-1983.235] (-1992.658) -- 0:01:14
      772900 -- [-1987.319] (-1999.402) (-1989.152) (-2006.962) * (-2000.839) [-1988.791] (-1985.049) (-1990.324) -- 0:01:14
      773000 -- [-1988.437] (-2012.160) (-1993.660) (-2001.232) * (-1994.738) (-1988.870) [-1986.301] (-2004.113) -- 0:01:14

      Average standard deviation of split frequencies: 0.002055

      773100 -- [-1986.485] (-2006.052) (-2003.089) (-2001.579) * (-2002.307) (-1993.964) [-1983.684] (-2003.615) -- 0:01:13
      773200 -- [-1987.620] (-1992.391) (-2001.422) (-1994.448) * (-1994.052) [-1991.195] (-1992.235) (-1992.708) -- 0:01:13
      773300 -- (-1987.641) (-1996.048) (-2009.805) [-1991.161] * (-1992.706) [-1987.195] (-1989.308) (-1991.262) -- 0:01:13
      773400 -- [-1984.317] (-2002.449) (-2003.984) (-1991.184) * (-1995.567) [-1982.481] (-1993.439) (-1991.246) -- 0:01:13
      773500 -- [-1986.661] (-1994.226) (-2007.862) (-1990.031) * (-1994.658) [-1987.118] (-1999.371) (-2003.104) -- 0:01:13
      773600 -- (-1988.028) (-1993.102) (-2007.930) [-1991.657] * (-1987.965) [-1982.246] (-2000.209) (-1996.956) -- 0:01:13
      773700 -- (-1990.684) (-1994.423) (-2011.488) [-1989.218] * (-1992.104) [-1980.316] (-1998.612) (-1992.714) -- 0:01:13
      773800 -- [-1988.026] (-1997.583) (-2002.759) (-1989.817) * (-1993.781) [-1978.069] (-1997.715) (-1994.210) -- 0:01:13
      773900 -- (-1989.329) (-1998.705) (-1989.951) [-1987.029] * (-1997.003) [-1976.725] (-1996.255) (-1995.951) -- 0:01:13
      774000 -- (-1992.475) (-1990.945) [-1992.152] (-2002.455) * (-1997.232) [-1981.782] (-1997.173) (-1999.798) -- 0:01:13

      Average standard deviation of split frequencies: 0.002157

      774100 -- (-1989.488) [-1988.486] (-1990.421) (-2001.934) * [-1989.897] (-1982.208) (-1991.763) (-2003.119) -- 0:01:13
      774200 -- (-1989.610) (-1986.372) [-1991.808] (-1997.053) * (-1998.441) [-1982.476] (-1987.452) (-1993.941) -- 0:01:13
      774300 -- (-1988.329) (-1995.500) (-1998.798) [-1991.335] * (-1998.967) [-1983.646] (-1992.341) (-1991.705) -- 0:01:13
      774400 -- (-1987.082) (-1990.693) (-1995.736) [-1993.843] * (-1995.029) [-1984.422] (-1993.276) (-1994.792) -- 0:01:13
      774500 -- (-1991.213) [-1986.502] (-1995.952) (-2007.597) * (-1991.599) (-1986.924) (-1996.388) [-1993.628] -- 0:01:13
      774600 -- (-1989.667) [-1991.012] (-1992.700) (-1999.656) * (-1991.449) (-1988.631) [-1993.731] (-1991.757) -- 0:01:13
      774700 -- [-1982.370] (-1997.161) (-2001.261) (-1992.856) * (-1995.142) (-1992.419) (-1994.520) [-1989.945] -- 0:01:13
      774800 -- (-1986.839) (-1993.545) (-1992.874) [-1988.390] * (-1988.734) (-1989.972) (-1989.139) [-1988.676] -- 0:01:13
      774900 -- (-1986.171) (-1985.823) (-1997.989) [-1986.135] * (-1990.416) [-1992.458] (-1992.832) (-1989.300) -- 0:01:13
      775000 -- (-1989.425) [-1985.943] (-1991.780) (-1993.333) * (-1990.997) (-1995.731) (-1988.263) [-1985.265] -- 0:01:13

      Average standard deviation of split frequencies: 0.002137

      775100 -- (-1992.287) [-1984.034] (-1991.401) (-1988.397) * (-1990.999) (-1986.951) (-1995.847) [-1984.667] -- 0:01:13
      775200 -- (-1994.975) (-1984.144) [-1989.198] (-1994.501) * (-1992.398) (-1988.427) (-1990.948) [-1983.144] -- 0:01:13
      775300 -- (-1999.901) [-1986.796] (-1988.880) (-1998.523) * (-1994.937) (-1989.173) (-1985.873) [-1980.637] -- 0:01:13
      775400 -- (-1996.245) [-1991.427] (-1990.583) (-1994.990) * (-1997.658) (-1985.950) (-1991.841) [-1978.949] -- 0:01:13
      775500 -- (-2001.588) (-1987.012) [-1991.597] (-1995.120) * (-1998.136) (-1989.334) (-1989.929) [-1983.428] -- 0:01:13
      775600 -- (-1998.384) [-1980.079] (-1997.473) (-1988.796) * (-2001.716) [-1983.478] (-1986.480) (-1994.630) -- 0:01:13
      775700 -- (-1992.234) [-1978.226] (-1987.504) (-1986.905) * (-1994.239) [-1982.971] (-1989.709) (-1990.247) -- 0:01:13
      775800 -- (-1990.014) (-1985.152) [-1988.473] (-1985.568) * (-1996.622) (-1992.304) [-1995.865] (-1996.067) -- 0:01:13
      775900 -- (-1997.744) [-1979.112] (-1992.588) (-1986.699) * (-1997.101) [-1989.259] (-1995.532) (-1996.488) -- 0:01:13
      776000 -- (-1994.715) [-1977.403] (-1995.512) (-1992.901) * (-1997.164) [-1989.344] (-1995.790) (-1992.231) -- 0:01:13

      Average standard deviation of split frequencies: 0.002117

      776100 -- (-2001.244) [-1982.594] (-2001.726) (-1982.764) * (-1996.771) (-1982.563) (-1999.432) [-1987.972] -- 0:01:12
      776200 -- (-2000.046) [-1980.045] (-2008.738) (-1979.945) * (-2000.840) [-1978.614] (-2007.264) (-1986.544) -- 0:01:12
      776300 -- (-1999.582) [-1979.591] (-1999.836) (-1988.295) * (-2000.353) (-1983.407) (-2000.063) [-1987.669] -- 0:01:12
      776400 -- (-2007.500) [-1978.245] (-1996.578) (-1987.442) * (-1994.342) [-1985.973] (-2000.751) (-1981.565) -- 0:01:12
      776500 -- (-2002.754) [-1987.434] (-1990.878) (-1993.242) * (-1997.020) [-1986.971] (-1999.738) (-1983.908) -- 0:01:12
      776600 -- (-1999.690) [-1985.055] (-2006.028) (-1978.594) * (-1992.976) (-1984.107) (-1995.811) [-1982.423] -- 0:01:12
      776700 -- (-1993.829) (-1990.347) (-2000.416) [-1977.273] * (-1997.055) (-1987.708) (-1995.462) [-1982.549] -- 0:01:12
      776800 -- (-2000.094) (-1991.390) (-1996.482) [-1979.689] * (-2002.551) (-1986.489) (-1993.341) [-1986.710] -- 0:01:12
      776900 -- (-1989.907) (-1988.183) (-1995.555) [-1980.430] * (-1999.840) (-1983.874) (-1989.683) [-1982.883] -- 0:01:12
      777000 -- (-1996.426) (-1983.756) (-1996.488) [-1980.157] * (-1995.384) (-1983.795) (-1988.580) [-1980.341] -- 0:01:12

      Average standard deviation of split frequencies: 0.002114

      777100 -- (-1993.444) [-1985.589] (-1997.235) (-1980.923) * (-1995.813) (-1988.265) (-1993.312) [-1982.606] -- 0:01:12
      777200 -- (-1995.173) (-1990.061) (-2006.942) [-1984.400] * (-1993.519) (-1992.408) (-1993.785) [-1977.875] -- 0:01:12
      777300 -- (-1988.685) (-1993.769) [-1990.368] (-1986.526) * (-1990.228) (-1997.046) (-1994.860) [-1977.745] -- 0:01:12
      777400 -- (-1989.359) [-1984.773] (-1982.724) (-1990.218) * (-1987.634) (-1990.363) (-1994.279) [-1987.006] -- 0:01:12
      777500 -- (-2006.524) (-1988.092) [-1988.474] (-1993.166) * (-1987.478) [-1986.042] (-1988.851) (-1986.749) -- 0:01:12
      777600 -- (-1997.858) (-1991.143) (-1998.355) [-1984.070] * (-1993.475) [-1986.234] (-1992.871) (-1982.929) -- 0:01:12
      777700 -- (-1996.026) [-1987.363] (-1996.866) (-1987.145) * (-1991.274) [-1979.749] (-1994.482) (-1987.308) -- 0:01:12
      777800 -- (-2001.302) (-1986.848) (-1991.771) [-1984.745] * (-1996.066) [-1980.668] (-1990.547) (-1987.255) -- 0:01:12
      777900 -- (-2003.737) (-1981.325) (-1987.193) [-1986.572] * (-1991.078) [-1982.721] (-1997.828) (-1985.081) -- 0:01:12
      778000 -- (-2005.631) (-1981.564) (-1992.238) [-1980.520] * (-1991.127) [-1984.925] (-1997.498) (-1991.992) -- 0:01:12

      Average standard deviation of split frequencies: 0.002042

      778100 -- (-2003.161) (-1983.925) (-1989.835) [-1981.711] * (-1996.762) (-1986.114) (-1996.426) [-1984.745] -- 0:01:12
      778200 -- (-1994.193) (-1988.004) [-1987.438] (-1981.067) * (-1994.758) (-1988.503) [-1990.778] (-1991.824) -- 0:01:12
      778300 -- (-2000.543) (-1985.490) (-1991.805) [-1984.209] * (-2011.331) (-1988.462) (-1995.341) [-1990.605] -- 0:01:12
      778400 -- (-1995.924) (-1987.445) (-1988.921) [-1986.914] * (-2005.941) (-1987.083) (-1999.268) [-1983.346] -- 0:01:12
      778500 -- (-1997.427) [-1986.367] (-1990.812) (-1993.850) * (-2006.881) (-1990.752) (-2003.778) [-1985.116] -- 0:01:12
      778600 -- (-1991.382) [-1978.684] (-1987.550) (-1995.681) * (-2010.586) (-1988.223) (-1996.885) [-1985.856] -- 0:01:12
      778700 -- (-1991.384) (-1987.013) [-1988.008] (-1989.811) * (-2003.116) (-1985.690) (-2000.548) [-1983.095] -- 0:01:12
      778800 -- [-1986.672] (-1983.833) (-1993.832) (-1992.947) * (-2001.766) (-1990.481) (-2001.132) [-1985.457] -- 0:01:12
      778900 -- (-1990.312) [-1987.482] (-1992.245) (-2000.957) * (-2009.867) (-1988.323) (-1998.237) [-1982.939] -- 0:01:12
      779000 -- (-1988.994) [-1980.930] (-1995.185) (-1997.448) * (-1990.042) (-1994.257) (-1999.411) [-1983.129] -- 0:01:12

      Average standard deviation of split frequencies: 0.002074

      779100 -- [-1991.971] (-1983.272) (-2000.238) (-1992.946) * (-1989.183) (-1996.288) (-1990.945) [-1980.013] -- 0:01:12
      779200 -- (-1987.859) [-1980.899] (-1997.818) (-1988.808) * (-1993.031) (-1994.541) (-1992.016) [-1981.995] -- 0:01:11
      779300 -- (-1988.221) [-1981.558] (-1995.486) (-1985.126) * (-1998.459) (-1989.076) (-1994.683) [-1987.117] -- 0:01:11
      779400 -- (-1987.572) (-1984.110) (-1990.334) [-1981.075] * (-2001.819) (-1988.003) (-1996.538) [-1980.702] -- 0:01:11
      779500 -- (-1984.042) [-1980.701] (-1988.107) (-1989.058) * (-2003.234) (-1991.411) (-1991.888) [-1980.260] -- 0:01:11
      779600 -- (-1987.093) [-1984.061] (-1991.468) (-1986.177) * (-2003.109) (-1994.934) (-2001.784) [-1982.940] -- 0:01:11
      779700 -- (-1986.226) (-1986.112) (-1994.479) [-1985.404] * (-2001.270) [-1996.825] (-2008.194) (-1984.967) -- 0:01:11
      779800 -- [-1983.906] (-1986.362) (-1990.661) (-1984.235) * (-1997.675) [-1987.976] (-2023.649) (-1991.936) -- 0:01:11
      779900 -- [-1983.600] (-1994.433) (-1994.073) (-1985.697) * (-2001.473) (-1986.751) (-2013.015) [-1984.528] -- 0:01:11
      780000 -- [-1987.140] (-1987.687) (-1991.773) (-1983.284) * (-1996.527) [-1994.252] (-2002.557) (-1987.193) -- 0:01:11

      Average standard deviation of split frequencies: 0.002089

      780100 -- (-1983.080) (-1994.491) (-1990.980) [-1981.492] * (-1998.243) [-1982.553] (-1999.093) (-1988.932) -- 0:01:11
      780200 -- (-1990.132) (-1994.635) (-1992.949) [-1978.782] * (-1999.760) [-1982.597] (-1994.439) (-1985.967) -- 0:01:11
      780300 -- (-1985.595) (-1989.920) [-1994.903] (-1979.093) * (-1992.814) (-1982.074) (-1999.249) [-1978.096] -- 0:01:11
      780400 -- [-1988.340] (-1986.531) (-1988.631) (-1980.500) * (-2004.131) [-1977.923] (-1997.536) (-1983.314) -- 0:01:11
      780500 -- (-1992.587) [-1983.968] (-1991.633) (-1983.093) * (-1999.056) (-1982.590) (-1993.352) [-1984.312] -- 0:01:11
      780600 -- (-1991.781) (-1996.116) (-1992.419) [-1989.903] * (-2008.884) [-1983.649] (-1993.313) (-1985.373) -- 0:01:11
      780700 -- (-1985.672) (-1992.400) [-1990.765] (-1985.282) * (-2003.522) [-1983.514] (-1988.716) (-1984.072) -- 0:01:11
      780800 -- [-1984.356] (-1994.566) (-1994.759) (-1995.963) * (-1995.083) [-1979.079] (-1995.457) (-1983.988) -- 0:01:11
      780900 -- (-1991.032) (-1989.185) [-1993.524] (-1998.475) * (-1999.025) [-1982.335] (-1993.705) (-1991.721) -- 0:01:11
      781000 -- (-1994.591) [-1981.819] (-1990.589) (-1993.868) * (-1995.299) [-1979.705] (-1991.495) (-2000.516) -- 0:01:11

      Average standard deviation of split frequencies: 0.002086

      781100 -- (-2005.581) (-1982.995) (-1991.474) [-1985.173] * [-1994.904] (-1982.891) (-1993.217) (-1992.291) -- 0:01:11
      781200 -- (-2004.212) [-1981.274] (-1989.696) (-1989.393) * (-1994.040) [-1987.457] (-1994.433) (-1992.031) -- 0:01:11
      781300 -- (-1996.250) [-1987.109] (-1991.048) (-1992.126) * (-1997.617) [-1984.189] (-1992.795) (-1990.325) -- 0:01:11
      781400 -- (-1997.468) (-1984.728) (-2001.076) [-1994.038] * (-1992.519) [-1985.650] (-1997.494) (-1987.658) -- 0:01:11
      781500 -- (-1998.157) [-1980.653] (-2002.496) (-1995.938) * (-1994.473) (-1993.859) (-1993.145) [-1989.088] -- 0:01:11
      781600 -- (-2002.808) [-1981.641] (-2001.837) (-1990.138) * (-1995.168) [-1989.005] (-1988.266) (-1986.320) -- 0:01:11
      781700 -- (-2001.549) (-1984.915) (-2003.405) [-1987.979] * (-1992.780) (-1992.961) (-1993.890) [-1992.123] -- 0:01:11
      781800 -- (-1996.501) [-1985.754] (-2007.212) (-1990.574) * (-1988.100) (-1991.854) (-1996.866) [-1994.960] -- 0:01:11
      781900 -- (-1994.993) [-1980.498] (-1998.651) (-1991.629) * (-1991.369) (-1984.569) [-1991.214] (-1998.446) -- 0:01:11
      782000 -- (-1992.085) [-1982.950] (-2002.749) (-1991.060) * (-1989.591) [-1983.193] (-1988.453) (-2002.101) -- 0:01:11

      Average standard deviation of split frequencies: 0.002032

      782100 -- (-2007.095) [-1983.042] (-1990.711) (-1993.996) * (-1992.242) [-1986.713] (-1986.247) (-2009.511) -- 0:01:11
      782200 -- (-2002.469) [-1984.886] (-1989.512) (-2000.998) * (-1995.063) (-1985.944) [-1983.270] (-2006.248) -- 0:01:11
      782300 -- (-1995.492) (-1981.915) (-1990.280) [-1988.387] * (-1996.835) [-1982.011] (-1985.637) (-2004.398) -- 0:01:10
      782400 -- (-1984.178) (-1989.173) (-1988.144) [-1990.013] * (-1991.969) [-1990.005] (-1986.225) (-1999.076) -- 0:01:10
      782500 -- (-1989.489) [-1989.296] (-1987.246) (-1994.060) * (-1999.543) (-1991.178) (-1992.864) [-1989.977] -- 0:01:10
      782600 -- (-1991.885) [-1984.202] (-1991.752) (-2001.643) * (-2000.590) [-1985.290] (-1989.740) (-1991.442) -- 0:01:10
      782700 -- (-1992.042) [-1987.722] (-1986.743) (-2004.661) * (-2000.279) (-1985.855) [-1989.661] (-1986.777) -- 0:01:10
      782800 -- (-1990.883) [-1988.490] (-1993.512) (-1995.961) * (-2005.395) [-1982.019] (-1989.643) (-1985.134) -- 0:01:10
      782900 -- (-1993.053) [-1986.669] (-1997.560) (-2000.267) * (-2003.241) (-1990.548) (-1991.649) [-1987.442] -- 0:01:10
      783000 -- (-1995.262) (-1985.925) [-1992.985] (-1994.902) * (-1996.346) [-1990.483] (-1993.923) (-1988.368) -- 0:01:10

      Average standard deviation of split frequencies: 0.001960

      783100 -- (-1995.555) [-1981.432] (-1995.370) (-1997.758) * (-2004.375) [-1981.527] (-1998.654) (-1983.309) -- 0:01:10
      783200 -- (-1999.123) [-1981.552] (-1986.007) (-1991.152) * (-1998.798) (-1989.402) (-1993.541) [-1983.975] -- 0:01:10
      783300 -- (-1999.233) [-1982.018] (-1985.571) (-1993.057) * (-1988.547) [-1989.649] (-1995.619) (-1988.035) -- 0:01:10
      783400 -- (-2000.661) [-1984.372] (-1982.607) (-1992.179) * (-1989.325) [-1993.342] (-1998.341) (-1985.526) -- 0:01:10
      783500 -- (-1991.505) [-1984.971] (-1984.694) (-1999.633) * (-1992.909) [-1987.578] (-2003.512) (-1984.885) -- 0:01:10
      783600 -- (-2002.831) (-1982.382) [-1983.233] (-1992.854) * (-1987.408) (-1988.255) (-2008.211) [-1986.005] -- 0:01:10
      783700 -- (-1996.359) [-1987.482] (-1987.043) (-2001.366) * (-1986.911) [-1986.067] (-2001.012) (-1987.499) -- 0:01:10
      783800 -- (-2002.964) (-1987.168) [-1980.950] (-1994.003) * (-1985.763) (-1988.674) (-1997.586) [-1994.784] -- 0:01:10
      783900 -- (-2009.615) (-1991.527) [-1980.228] (-2003.164) * (-1992.353) [-1989.456] (-1993.993) (-1998.078) -- 0:01:10
      784000 -- (-2009.241) (-1988.335) [-1984.629] (-2011.167) * (-1995.786) [-1986.348] (-1998.125) (-1989.169) -- 0:01:10

      Average standard deviation of split frequencies: 0.001992

      784100 -- (-2003.814) [-1983.176] (-1983.810) (-2010.445) * (-1992.877) [-1981.691] (-2007.099) (-1990.243) -- 0:01:10
      784200 -- (-1993.537) (-1987.915) [-1979.298] (-2006.814) * [-1986.849] (-1988.060) (-1996.204) (-2002.734) -- 0:01:10
      784300 -- (-1990.058) [-1984.425] (-1984.796) (-1998.964) * (-1986.844) [-1982.024] (-2006.025) (-2000.741) -- 0:01:10
      784400 -- [-1988.389] (-1990.295) (-1988.647) (-2005.608) * (-1983.859) [-1982.802] (-2003.968) (-1999.946) -- 0:01:10
      784500 -- (-1988.449) [-1984.597] (-1995.819) (-1993.250) * (-1985.117) [-1981.433] (-1996.859) (-1994.323) -- 0:01:10
      784600 -- [-1992.447] (-1989.755) (-1995.529) (-1992.942) * (-1990.800) [-1979.761] (-2001.545) (-1990.318) -- 0:01:10
      784700 -- (-1990.902) [-1986.340] (-1990.628) (-2003.525) * (-1995.039) [-1981.791] (-1997.284) (-1991.466) -- 0:01:10
      784800 -- (-1990.162) (-1984.643) [-1983.506] (-1995.657) * (-1988.405) (-1990.443) (-2002.101) [-1984.723] -- 0:01:10
      784900 -- (-1989.904) (-1988.650) [-1986.570] (-1999.255) * (-1990.461) [-1980.868] (-1998.843) (-1984.746) -- 0:01:10
      785000 -- [-1991.900] (-1988.621) (-1990.575) (-1998.281) * (-2004.345) (-1982.912) (-1994.424) [-1984.933] -- 0:01:10

      Average standard deviation of split frequencies: 0.002093

      785100 -- (-1990.191) [-1985.802] (-1993.149) (-1999.446) * (-1995.752) (-1985.391) (-1993.422) [-1978.369] -- 0:01:10
      785200 -- [-1992.628] (-1989.759) (-1998.107) (-1991.442) * (-1995.098) [-1980.921] (-2003.237) (-1980.624) -- 0:01:10
      785300 -- (-1985.712) (-1982.465) (-2004.702) [-1992.524] * (-1998.130) [-1979.706] (-1996.168) (-1983.480) -- 0:01:09
      785400 -- (-1987.795) [-1981.471] (-2002.503) (-1991.876) * (-1995.106) (-1978.556) (-1995.090) [-1982.257] -- 0:01:09
      785500 -- [-1988.969] (-1995.550) (-2000.718) (-1989.038) * (-1995.076) [-1981.220] (-1993.914) (-1982.046) -- 0:01:09
      785600 -- (-1987.782) [-1992.617] (-2000.486) (-1991.384) * (-1989.376) (-1983.756) (-1993.824) [-1980.956] -- 0:01:09
      785700 -- (-1991.366) [-1981.489] (-1995.205) (-1990.627) * (-1987.077) [-1986.261] (-1993.397) (-1983.529) -- 0:01:09
      785800 -- (-1988.308) [-1981.435] (-1994.171) (-1987.745) * (-1986.905) (-1985.657) (-1999.104) [-1985.070] -- 0:01:09
      785900 -- (-1981.913) (-1997.758) (-2008.240) [-1990.101] * (-1992.200) (-1988.976) (-1996.503) [-1978.991] -- 0:01:09
      786000 -- [-1982.764] (-1988.647) (-1997.279) (-1987.305) * (-1989.161) (-1988.646) (-1996.593) [-1977.051] -- 0:01:09

      Average standard deviation of split frequencies: 0.002124

      786100 -- (-1984.978) (-1996.849) [-1989.361] (-1984.561) * (-1986.918) (-1994.342) (-1990.460) [-1977.869] -- 0:01:09
      786200 -- (-1988.561) (-1995.227) (-1989.703) [-1984.549] * (-1990.006) (-1993.844) (-1993.108) [-1977.379] -- 0:01:09
      786300 -- [-1985.927] (-1993.038) (-1993.807) (-1987.184) * (-1993.890) [-1988.580] (-1992.044) (-1980.884) -- 0:01:09
      786400 -- [-1984.325] (-1987.726) (-1993.268) (-1992.840) * (-1993.341) (-1984.987) (-1990.210) [-1981.246] -- 0:01:09
      786500 -- (-1986.657) [-1987.142] (-1994.080) (-1994.410) * (-2002.175) [-1984.800] (-1996.544) (-1978.871) -- 0:01:09
      786600 -- [-1984.355] (-1994.260) (-1988.971) (-1993.269) * (-2004.440) (-1982.241) (-1995.697) [-1982.250] -- 0:01:09
      786700 -- [-1987.016] (-1991.879) (-1991.483) (-1997.426) * (-2000.854) [-1987.016] (-1987.592) (-1983.861) -- 0:01:09
      786800 -- [-1987.438] (-1995.239) (-1987.333) (-1996.023) * (-1996.695) [-1981.417] (-1987.174) (-1980.264) -- 0:01:09
      786900 -- [-1987.333] (-1992.567) (-1990.604) (-1989.071) * (-1994.409) [-1982.890] (-1992.822) (-1983.472) -- 0:01:09
      787000 -- [-1988.729] (-1998.512) (-1998.223) (-1993.461) * (-1994.426) (-1988.091) (-1992.756) [-1980.697] -- 0:01:09

      Average standard deviation of split frequencies: 0.002053

      787100 -- [-1985.452] (-2002.679) (-2005.638) (-1991.185) * (-1998.315) (-1992.631) (-1997.417) [-1981.418] -- 0:01:09
      787200 -- [-1981.050] (-1991.339) (-1999.292) (-1993.150) * (-1997.811) [-1994.162] (-1993.576) (-1983.857) -- 0:01:09
      787300 -- [-1980.326] (-1990.072) (-1997.809) (-1993.398) * (-1997.947) (-1984.689) (-1995.102) [-1985.918] -- 0:01:09
      787400 -- [-1981.050] (-1984.939) (-1990.595) (-1993.808) * (-1992.936) [-1982.960] (-1992.628) (-1988.949) -- 0:01:09
      787500 -- [-1980.858] (-1996.986) (-1985.514) (-1994.883) * (-1992.221) [-1982.486] (-1992.575) (-1995.095) -- 0:01:09
      787600 -- [-1987.788] (-2006.019) (-1991.502) (-1990.008) * (-1990.094) (-1988.408) (-1988.818) [-1982.922] -- 0:01:09
      787700 -- (-1986.114) (-2001.239) (-1991.507) [-1990.016] * (-2002.951) (-1986.089) (-1988.748) [-1988.875] -- 0:01:09
      787800 -- (-1989.097) (-1993.584) [-1993.507] (-1996.450) * (-1994.480) [-1982.496] (-1994.528) (-1995.020) -- 0:01:09
      787900 -- (-1990.458) (-2000.990) [-1990.702] (-2004.002) * (-2000.978) [-1988.022] (-2002.231) (-2000.930) -- 0:01:09
      788000 -- (-1986.545) (-1998.544) [-1982.995] (-2000.845) * (-2005.898) [-1983.709] (-1996.044) (-1986.291) -- 0:01:09

      Average standard deviation of split frequencies: 0.002085

      788100 -- (-1997.447) (-1994.025) [-1986.008] (-2000.478) * (-2003.917) (-1982.950) (-2002.335) [-1990.889] -- 0:01:09
      788200 -- (-1993.274) (-1993.016) [-1984.087] (-1999.529) * (-2004.429) (-1988.179) (-1995.522) [-1983.906] -- 0:01:09
      788300 -- (-1987.270) (-1999.370) [-1979.324] (-2003.750) * (-1997.862) (-1987.729) (-1993.037) [-1983.336] -- 0:01:09
      788400 -- (-1991.502) (-1996.681) [-1985.132] (-2004.394) * (-2005.898) (-1987.707) [-1986.791] (-1988.561) -- 0:01:08
      788500 -- [-1988.664] (-1996.444) (-1986.901) (-1999.597) * (-1996.741) [-1985.947] (-1986.645) (-2004.633) -- 0:01:08
      788600 -- (-1996.286) (-1994.944) [-1979.130] (-1993.184) * [-1985.000] (-1989.683) (-1987.901) (-1994.540) -- 0:01:08
      788700 -- (-1996.679) (-1988.038) [-1980.248] (-1996.036) * [-1989.362] (-1988.512) (-1989.359) (-1998.290) -- 0:01:08
      788800 -- (-1996.111) (-1986.965) [-1980.469] (-1996.617) * (-1995.344) (-1994.448) (-1993.031) [-1989.653] -- 0:01:08
      788900 -- (-1991.194) (-1990.262) [-1979.455] (-2004.254) * (-2002.965) (-1992.930) [-1990.454] (-1996.093) -- 0:01:08
      789000 -- (-1992.524) [-1985.559] (-1986.160) (-2004.385) * [-1989.938] (-1987.210) (-1988.632) (-1999.836) -- 0:01:08

      Average standard deviation of split frequencies: 0.002048

      789100 -- (-2007.231) (-1994.425) [-1987.330] (-1996.844) * (-1993.284) (-1993.850) [-1992.628] (-1998.667) -- 0:01:08
      789200 -- (-2014.328) [-1989.915] (-1985.707) (-2002.793) * (-1989.613) (-1994.891) (-1994.413) [-1992.682] -- 0:01:08
      789300 -- (-1989.876) (-1993.225) [-1979.001] (-2000.242) * (-1985.143) (-2002.247) (-1993.819) [-1985.678] -- 0:01:08
      789400 -- (-1988.269) (-2000.397) [-1980.660] (-1995.658) * (-1988.775) (-2000.980) [-1986.009] (-1988.273) -- 0:01:08
      789500 -- (-1982.738) (-2000.657) [-1979.737] (-1997.095) * (-1990.001) (-2007.461) [-1993.766] (-1992.359) -- 0:01:08
      789600 -- (-1982.952) (-1999.331) [-1982.813] (-1997.873) * (-1994.896) (-1995.901) [-1992.135] (-1993.519) -- 0:01:08
      789700 -- (-1985.160) (-1998.509) [-1980.708] (-1997.266) * (-1989.123) (-2000.937) (-1992.772) [-1993.933] -- 0:01:08
      789800 -- [-1987.473] (-1998.648) (-1986.168) (-2003.422) * (-1991.949) (-2003.311) (-1989.500) [-1988.103] -- 0:01:08
      789900 -- [-1985.677] (-2001.095) (-1989.784) (-1993.052) * (-1992.432) (-2004.093) (-1995.017) [-1984.747] -- 0:01:08
      790000 -- [-1983.816] (-2001.015) (-1992.921) (-1994.719) * (-2000.525) (-1994.699) [-1987.476] (-1989.305) -- 0:01:08

      Average standard deviation of split frequencies: 0.001909

      790100 -- [-1985.295] (-1992.226) (-1987.506) (-1989.539) * (-1995.731) (-1990.841) [-1988.694] (-1989.883) -- 0:01:08
      790200 -- (-1983.955) [-1990.427] (-1989.746) (-1986.541) * (-2000.517) (-2000.655) [-1984.787] (-1990.816) -- 0:01:08
      790300 -- (-1992.452) (-1993.319) (-1990.743) [-1986.470] * (-1990.815) (-1996.036) (-1986.548) [-1986.056] -- 0:01:08
      790400 -- (-1982.702) (-1998.250) (-1995.690) [-1991.431] * (-1983.639) [-1990.168] (-1991.350) (-1989.191) -- 0:01:08
      790500 -- (-1982.881) (-2008.379) [-1988.374] (-1992.419) * (-1994.057) (-1988.528) (-1993.043) [-1991.378] -- 0:01:08
      790600 -- [-1981.618] (-2001.171) (-1984.762) (-1997.097) * (-1995.346) (-1993.544) [-1985.561] (-1999.241) -- 0:01:08
      790700 -- (-1995.131) (-1993.427) [-1985.736] (-1996.829) * (-1995.246) (-1983.866) [-1984.477] (-2005.887) -- 0:01:08
      790800 -- (-1992.737) (-1992.927) [-1980.974] (-1999.039) * (-1999.369) (-1984.480) [-1989.803] (-1998.098) -- 0:01:08
      790900 -- [-1982.480] (-1998.162) (-1990.517) (-2002.955) * (-1996.362) [-1985.384] (-1993.859) (-1990.806) -- 0:01:08
      791000 -- [-1984.623] (-1991.779) (-2003.177) (-1994.565) * (-1995.814) [-1980.914] (-1990.837) (-1989.548) -- 0:01:08

      Average standard deviation of split frequencies: 0.001770

      791100 -- [-1983.417] (-1990.182) (-1993.139) (-1991.345) * (-1995.484) [-1984.520] (-1992.518) (-1990.305) -- 0:01:08
      791200 -- [-1982.821] (-1989.676) (-1995.123) (-1991.911) * (-1994.374) [-1987.409] (-1996.782) (-1995.252) -- 0:01:08
      791300 -- (-1983.672) (-1989.947) (-1987.486) [-1989.673] * (-1990.397) (-1993.167) (-1994.095) [-1990.792] -- 0:01:08
      791400 -- [-1985.172] (-2006.661) (-1989.886) (-1989.569) * (-1994.934) (-1989.841) [-1988.645] (-1993.087) -- 0:01:08
      791500 -- [-1986.618] (-1996.045) (-1987.515) (-1986.798) * [-1990.273] (-1990.864) (-1993.858) (-1992.752) -- 0:01:07
      791600 -- [-1990.528] (-1997.066) (-1986.360) (-1989.280) * (-1994.721) [-1981.973] (-1996.415) (-1992.311) -- 0:01:07
      791700 -- (-1985.239) (-2007.149) [-1983.998] (-1992.866) * (-1989.489) [-1984.548] (-1997.817) (-1991.303) -- 0:01:07
      791800 -- [-1985.455] (-2004.425) (-1985.664) (-1990.355) * (-1993.052) [-1983.534] (-2002.061) (-1996.861) -- 0:01:07
      791900 -- (-1990.998) (-2000.851) [-1986.090] (-1995.334) * (-1989.830) (-1985.762) (-1999.322) [-1987.695] -- 0:01:07
      792000 -- (-1990.794) (-2000.218) [-1983.023] (-1992.940) * (-1999.029) [-1980.978] (-2002.802) (-1981.642) -- 0:01:07

      Average standard deviation of split frequencies: 0.001768

      792100 -- (-1989.120) (-1998.742) [-1987.478] (-1992.713) * (-1995.983) [-1982.878] (-2001.273) (-1984.811) -- 0:01:07
      792200 -- (-1989.874) (-1994.264) (-1993.304) [-1987.036] * (-1991.742) (-1987.014) (-2002.684) [-1984.028] -- 0:01:07
      792300 -- (-1988.539) (-1999.226) [-1993.622] (-1998.676) * [-1987.148] (-1989.810) (-2007.434) (-1983.354) -- 0:01:07
      792400 -- (-1982.801) (-1994.478) [-1983.920] (-1996.177) * (-1986.850) [-1982.445] (-1999.333) (-1987.629) -- 0:01:07
      792500 -- [-1987.049] (-1987.904) (-1989.181) (-1994.770) * [-1982.993] (-1985.884) (-1997.883) (-1990.376) -- 0:01:07
      792600 -- [-1981.842] (-1988.984) (-1983.442) (-1992.046) * [-1990.466] (-1987.927) (-1992.053) (-1987.494) -- 0:01:07
      792700 -- [-1983.421] (-1988.754) (-1986.425) (-1996.494) * (-1991.887) (-1999.515) (-1993.374) [-1991.433] -- 0:01:07
      792800 -- (-1981.959) (-1990.323) [-1985.757] (-1997.387) * [-1981.133] (-2001.676) (-1988.842) (-1996.780) -- 0:01:07
      792900 -- (-1989.823) [-1994.262] (-1990.040) (-2002.740) * (-1987.687) [-1996.902] (-1991.590) (-1992.124) -- 0:01:07
      793000 -- (-1989.775) (-1995.983) [-1982.521] (-2001.656) * [-1982.496] (-2002.657) (-1988.247) (-1995.593) -- 0:01:07

      Average standard deviation of split frequencies: 0.001783

      793100 -- (-1986.846) (-1999.698) [-1978.952] (-2001.320) * [-1986.896] (-2008.418) (-1992.243) (-1985.571) -- 0:01:07
      793200 -- (-1983.672) [-2002.648] (-1985.741) (-1997.753) * [-1988.949] (-2004.784) (-1994.778) (-1988.342) -- 0:01:07
      793300 -- [-1980.898] (-1995.213) (-1983.848) (-2000.609) * [-1986.133] (-2001.599) (-1991.246) (-1986.069) -- 0:01:07
      793400 -- (-1982.754) (-1997.802) [-1982.767] (-1997.920) * [-1987.663] (-2008.452) (-1996.215) (-1983.829) -- 0:01:07
      793500 -- (-1982.417) (-2004.483) (-1985.045) [-1996.967] * [-1982.754] (-2003.626) (-1999.241) (-1988.718) -- 0:01:07
      793600 -- [-1986.179] (-1996.081) (-1986.357) (-1995.039) * (-1985.428) (-2003.797) (-2001.374) [-1989.700] -- 0:01:07
      793700 -- (-1985.482) (-1989.821) [-1985.450] (-1994.623) * [-1989.767] (-2004.143) (-2002.692) (-1989.078) -- 0:01:07
      793800 -- [-1980.460] (-1986.844) (-1985.513) (-1994.510) * (-1991.629) (-2003.404) (-1998.736) [-1984.367] -- 0:01:07
      793900 -- [-1980.343] (-1989.754) (-1988.572) (-1988.743) * (-1990.811) (-1992.610) (-1999.567) [-1985.934] -- 0:01:07
      794000 -- [-1981.552] (-1991.118) (-1989.254) (-1987.166) * (-1995.621) (-1997.020) (-1999.375) [-1986.476] -- 0:01:07

      Average standard deviation of split frequencies: 0.001696

      794100 -- (-1980.564) (-1990.390) [-1984.917] (-1994.492) * (-1995.112) (-1996.900) (-2005.408) [-1981.708] -- 0:01:07
      794200 -- [-1984.657] (-1990.420) (-1989.058) (-1986.362) * (-1997.985) (-1990.682) (-2007.422) [-1980.138] -- 0:01:07
      794300 -- (-1983.296) [-1986.170] (-1992.143) (-1990.088) * (-1996.450) (-1988.938) (-2002.826) [-1980.028] -- 0:01:07
      794400 -- [-1983.197] (-1991.974) (-1992.687) (-1991.682) * (-2002.060) (-1997.665) (-1992.488) [-1977.645] -- 0:01:07
      794500 -- [-1979.496] (-1995.506) (-1988.132) (-1991.112) * (-1996.375) (-1996.516) (-1990.703) [-1979.814] -- 0:01:06
      794600 -- (-1983.530) (-1992.282) [-1990.503] (-1995.645) * (-1998.052) (-1991.319) (-1990.023) [-1985.952] -- 0:01:06
      794700 -- (-1991.867) (-1992.966) [-1990.871] (-1995.968) * (-1999.280) (-1988.611) (-1999.963) [-1980.595] -- 0:01:06
      794800 -- (-1991.111) (-1993.148) [-1989.972] (-1994.653) * (-2001.659) (-1990.798) (-1997.832) [-1983.100] -- 0:01:06
      794900 -- [-1989.234] (-1993.002) (-1992.763) (-1993.838) * (-1986.305) [-1986.303] (-2005.975) (-1989.256) -- 0:01:06
      795000 -- (-2004.178) (-1999.653) (-1988.489) [-1986.553] * (-1988.652) (-1996.194) (-1998.671) [-1990.916] -- 0:01:06

      Average standard deviation of split frequencies: 0.001711

      795100 -- (-1991.583) (-2002.145) (-1993.277) [-1981.190] * (-1999.280) (-1990.617) (-2001.382) [-1988.036] -- 0:01:06
      795200 -- (-1990.770) (-1999.713) (-1986.424) [-1985.002] * (-1993.470) (-1986.697) (-1998.698) [-1986.759] -- 0:01:06
      795300 -- (-1987.649) (-1994.763) [-1988.775] (-1988.470) * (-1996.320) (-1991.998) (-1996.159) [-1989.899] -- 0:01:06
      795400 -- (-1988.745) (-1993.689) (-1986.692) [-1985.353] * (-1995.034) (-1989.025) (-1991.819) [-1983.163] -- 0:01:06
      795500 -- [-1987.780] (-1995.543) (-1986.599) (-1990.069) * (-1996.621) (-1989.057) (-1987.084) [-1983.124] -- 0:01:06
      795600 -- (-1991.356) (-1994.635) [-1985.332] (-1989.283) * (-1997.406) (-1997.019) (-1987.012) [-1990.873] -- 0:01:06
      795700 -- (-1996.528) (-1987.415) (-1984.929) [-1986.303] * (-1990.183) (-1998.292) (-1984.828) [-1983.680] -- 0:01:06
      795800 -- (-1994.684) (-1999.566) [-1982.377] (-1981.582) * (-1998.527) (-1992.381) [-1984.350] (-1987.392) -- 0:01:06
      795900 -- (-1990.028) (-1995.666) (-1984.259) [-1986.548] * (-1999.576) [-1990.753] (-1984.549) (-1987.683) -- 0:01:06
      796000 -- (-1997.734) (-2000.291) (-1985.942) [-1993.800] * (-1997.742) (-1991.810) [-1984.947] (-1986.823) -- 0:01:06

      Average standard deviation of split frequencies: 0.001709

      796100 -- (-1994.795) (-1992.778) [-1983.668] (-1994.536) * (-1995.845) (-1999.514) (-1993.414) [-1982.898] -- 0:01:06
      796200 -- (-1998.610) (-1990.204) [-1982.074] (-1997.437) * (-1999.453) (-1996.646) (-1993.867) [-1991.205] -- 0:01:06
      796300 -- (-2009.065) (-1990.555) (-1983.317) [-1994.542] * (-2001.179) (-1986.869) [-1985.283] (-1989.067) -- 0:01:06
      796400 -- (-2005.928) (-1991.856) (-1985.921) [-1993.929] * (-2001.689) (-1990.799) [-1982.878] (-1996.642) -- 0:01:06
      796500 -- (-1995.675) (-2003.709) (-1985.843) [-1989.235] * (-1998.859) (-1992.497) [-1985.390] (-1994.036) -- 0:01:06
      796600 -- (-2004.428) (-1998.797) [-1989.312] (-1990.629) * [-1996.307] (-1989.664) (-1990.397) (-1994.606) -- 0:01:06
      796700 -- (-2001.262) (-2001.166) (-1990.871) [-1997.636] * (-1994.489) (-1990.168) [-1990.311] (-1988.616) -- 0:01:06
      796800 -- (-1992.758) (-2000.705) [-1987.999] (-1998.892) * (-1990.613) (-1990.499) [-1986.366] (-1989.504) -- 0:01:06
      796900 -- (-1997.610) (-2003.381) [-1990.141] (-1999.413) * (-1997.098) [-1984.123] (-1993.016) (-1986.385) -- 0:01:06
      797000 -- (-1992.394) (-1992.150) (-1983.889) [-1997.838] * (-1997.753) (-1983.735) (-1986.903) [-1983.982] -- 0:01:06

      Average standard deviation of split frequencies: 0.001706

      797100 -- [-1982.929] (-2002.644) (-1985.515) (-1999.691) * (-1995.095) [-1987.160] (-1991.656) (-1984.832) -- 0:01:06
      797200 -- [-1984.796] (-1999.243) (-1984.502) (-2001.821) * (-1988.086) (-1995.393) [-1991.031] (-1993.727) -- 0:01:06
      797300 -- (-1990.845) (-1992.503) [-1985.853] (-2007.925) * [-1982.544] (-2003.419) (-1992.428) (-1989.568) -- 0:01:06
      797400 -- [-1987.131] (-1991.695) (-1985.182) (-1992.607) * [-1982.634] (-1999.056) (-1997.929) (-1985.820) -- 0:01:06
      797500 -- (-1986.102) (-1998.789) [-1989.476] (-1993.736) * [-1989.411] (-1997.437) (-2008.806) (-1980.479) -- 0:01:06
      797600 -- (-1983.566) (-1996.116) (-1987.823) [-1990.874] * (-1992.123) (-1993.995) (-1997.940) [-1983.943] -- 0:01:05
      797700 -- [-1978.265] (-2000.275) (-1987.630) (-1991.275) * [-1988.452] (-1995.186) (-2006.179) (-1983.836) -- 0:01:05
      797800 -- [-1982.055] (-2005.900) (-1986.931) (-1990.438) * (-1986.504) [-1984.958] (-2001.445) (-1982.942) -- 0:01:05
      797900 -- [-1983.443] (-2010.538) (-1988.042) (-1988.077) * [-1983.713] (-1997.817) (-2000.672) (-1988.478) -- 0:01:05
      798000 -- [-1982.405] (-2010.073) (-1989.383) (-2001.439) * [-1979.036] (-2008.700) (-2001.069) (-1979.253) -- 0:01:05

      Average standard deviation of split frequencies: 0.001738

      798100 -- (-1987.185) (-1999.415) [-1981.634] (-1999.295) * (-1989.321) (-2008.227) [-1996.959] (-1987.265) -- 0:01:05
      798200 -- (-1982.023) (-1997.921) [-1986.534] (-1996.849) * (-1998.051) (-2000.528) (-1992.022) [-1980.714] -- 0:01:05
      798300 -- [-1984.056] (-1992.163) (-1987.844) (-2009.504) * (-1992.658) (-1993.373) (-1993.086) [-1983.648] -- 0:01:05
      798400 -- [-1985.055] (-1997.886) (-1987.910) (-2005.763) * (-1997.285) [-1997.724] (-1993.535) (-1984.967) -- 0:01:05
      798500 -- [-1988.996] (-1990.431) (-1995.433) (-2001.400) * (-1995.952) (-1993.922) [-1987.815] (-1990.804) -- 0:01:05
      798600 -- (-1985.750) [-1991.802] (-2003.873) (-2003.631) * [-1991.744] (-1985.749) (-1991.931) (-1989.106) -- 0:01:05
      798700 -- [-1985.529] (-1985.341) (-1993.231) (-1997.597) * (-1988.984) [-1984.246] (-1989.801) (-1990.495) -- 0:01:05
      798800 -- [-1979.525] (-1993.028) (-1996.394) (-1994.512) * [-1989.615] (-1995.425) (-1991.287) (-1991.229) -- 0:01:05
      798900 -- [-1981.143] (-1991.148) (-1995.592) (-1990.879) * (-1990.167) (-1993.328) (-1990.830) [-1980.955] -- 0:01:05
      799000 -- [-1978.603] (-1997.013) (-2006.262) (-1997.330) * (-1982.716) (-1990.798) (-1986.459) [-1981.743] -- 0:01:05

      Average standard deviation of split frequencies: 0.001803

      799100 -- (-1981.039) (-2004.195) (-2003.137) [-2000.413] * (-1987.132) [-1994.311] (-1990.911) (-1982.208) -- 0:01:05
      799200 -- [-1980.158] (-1992.810) (-1996.526) (-1997.691) * (-1984.313) (-1993.809) [-1988.180] (-1984.787) -- 0:01:05
      799300 -- [-1980.767] (-2005.696) (-1988.932) (-1996.596) * [-1979.992] (-1994.384) (-1988.191) (-1982.180) -- 0:01:05
      799400 -- (-1983.180) (-1995.919) [-1982.195] (-2001.523) * [-1981.681] (-1991.122) (-1987.553) (-1979.219) -- 0:01:05
      799500 -- (-1983.504) (-2001.078) [-1981.298] (-1999.899) * [-1980.971] (-1993.320) (-1985.621) (-1980.048) -- 0:01:05
      799600 -- [-1985.313] (-2001.011) (-1985.773) (-1994.111) * (-1984.963) (-1990.963) (-1986.836) [-1989.852] -- 0:01:05
      799700 -- (-1991.726) (-2003.738) [-1983.831] (-1996.394) * (-1988.597) (-1995.677) (-1988.606) [-1989.403] -- 0:01:05
      799800 -- (-1992.180) (-2001.255) (-1983.395) [-1985.650] * (-1991.460) (-1997.979) [-1994.082] (-1992.841) -- 0:01:05
      799900 -- (-1990.605) (-2000.016) [-1986.032] (-1988.715) * [-1990.986] (-1994.483) (-1999.240) (-1993.369) -- 0:01:05
      800000 -- (-1991.499) (-1993.178) (-1985.805) [-1987.829] * [-1992.960] (-1993.225) (-2000.171) (-1992.812) -- 0:01:05

      Average standard deviation of split frequencies: 0.001818

      800100 -- (-1993.714) (-1989.787) (-1979.569) [-1987.426] * (-1986.322) (-1992.404) (-2001.922) [-1980.184] -- 0:01:05
      800200 -- [-1988.004] (-1992.539) (-1989.790) (-1985.934) * (-1989.770) (-1998.299) (-2014.117) [-1979.336] -- 0:01:05
      800300 -- (-1988.019) (-2003.465) (-1997.348) [-1988.632] * (-1993.317) (-1996.207) (-1997.755) [-1979.517] -- 0:01:05
      800400 -- (-1985.350) (-1995.607) (-1997.296) [-1988.661] * (-1984.667) (-1995.296) (-1996.609) [-1981.837] -- 0:01:05
      800500 -- (-1988.626) [-1987.517] (-1988.268) (-1998.400) * (-1987.225) (-1995.918) (-1994.561) [-1988.694] -- 0:01:05
      800600 -- (-1981.690) (-1987.449) [-1986.143] (-1997.609) * (-1991.333) [-1989.395] (-2000.965) (-1988.732) -- 0:01:05
      800700 -- [-1979.325] (-1996.067) (-1989.773) (-1992.242) * [-1981.143] (-1986.041) (-2007.764) (-1989.756) -- 0:01:04
      800800 -- [-1982.232] (-1985.462) (-1989.389) (-1992.668) * (-1984.916) (-1987.391) (-2004.205) [-1983.804] -- 0:01:04
      800900 -- (-1986.418) [-1985.018] (-1989.243) (-2001.576) * [-1988.842] (-1990.507) (-1997.543) (-1981.409) -- 0:01:04
      801000 -- (-1982.220) [-1985.381] (-1990.484) (-2006.842) * (-1988.200) (-1995.038) (-1997.003) [-1983.087] -- 0:01:04

      Average standard deviation of split frequencies: 0.001849

      801100 -- [-1985.286] (-1988.469) (-1989.238) (-2005.409) * (-1986.358) (-1994.499) (-1995.835) [-1980.058] -- 0:01:04
      801200 -- (-1980.668) (-1991.274) [-1988.258] (-2002.512) * (-1991.229) (-2000.034) (-1996.422) [-1983.645] -- 0:01:04
      801300 -- [-1984.075] (-1998.774) (-1991.756) (-2009.044) * (-2001.226) (-1994.670) (-1993.972) [-1984.138] -- 0:01:04
      801400 -- [-1986.434] (-1987.556) (-1992.665) (-2020.874) * (-1992.449) (-1997.155) (-1985.557) [-1979.781] -- 0:01:04
      801500 -- [-1984.499] (-1987.644) (-1988.202) (-1996.325) * (-1986.704) (-1996.876) (-1984.767) [-1978.995] -- 0:01:04
      801600 -- (-1990.239) [-1986.332] (-1986.656) (-1995.517) * [-1981.795] (-2001.379) (-1986.051) (-1985.072) -- 0:01:04
      801700 -- (-1993.253) (-1984.494) [-1982.882] (-2001.288) * (-1988.337) [-1993.609] (-1987.928) (-1991.907) -- 0:01:04
      801800 -- (-1992.068) [-1986.769] (-1981.000) (-2004.249) * [-1983.291] (-1995.029) (-1986.674) (-1985.655) -- 0:01:04
      801900 -- (-1990.700) [-1988.499] (-1984.380) (-1999.329) * (-1978.174) (-1992.723) (-1985.054) [-1984.909] -- 0:01:04
      802000 -- (-1994.860) [-1985.396] (-1988.982) (-2009.879) * [-1988.102] (-1992.904) (-1986.901) (-1983.085) -- 0:01:04

      Average standard deviation of split frequencies: 0.001881

      802100 -- (-1992.274) (-1995.518) [-1983.310] (-2001.347) * (-1980.863) (-1998.965) (-1988.253) [-1984.071] -- 0:01:04
      802200 -- [-1991.199] (-2000.215) (-1985.478) (-2013.902) * [-1986.348] (-2002.496) (-1999.690) (-1982.194) -- 0:01:04
      802300 -- [-1989.341] (-1995.461) (-1991.888) (-2006.736) * [-1986.532] (-2008.927) (-1993.303) (-1984.610) -- 0:01:04
      802400 -- [-1989.656] (-2002.064) (-1990.856) (-2005.129) * [-1982.859] (-2013.788) (-1992.158) (-1990.911) -- 0:01:04
      802500 -- [-1994.213] (-2002.544) (-1987.821) (-2004.275) * (-1996.050) (-2014.028) (-1998.391) [-1989.077] -- 0:01:04
      802600 -- [-1989.770] (-2003.726) (-1993.484) (-2007.047) * (-1996.212) (-2011.993) [-1988.738] (-1991.675) -- 0:01:04
      802700 -- (-1994.065) (-2006.214) [-1987.769] (-2001.877) * (-1991.109) (-2004.986) (-1988.457) [-1986.156] -- 0:01:04
      802800 -- (-1992.197) (-1996.179) [-1989.019] (-1999.312) * (-1989.621) (-2005.705) (-1987.104) [-1987.831] -- 0:01:04
      802900 -- (-1991.357) (-1997.246) [-1983.778] (-2003.769) * (-1995.826) (-1996.779) (-1988.508) [-1985.345] -- 0:01:04
      803000 -- [-1989.474] (-1995.565) (-1987.836) (-1999.089) * (-2002.293) [-1991.849] (-1992.388) (-1984.675) -- 0:01:04

      Average standard deviation of split frequencies: 0.001828

      803100 -- (-1986.755) (-1994.427) (-1991.796) [-2000.328] * (-2008.799) (-1988.069) (-1988.444) [-1984.788] -- 0:01:04
      803200 -- [-1987.279] (-1995.344) (-1997.902) (-2005.812) * (-1995.899) (-1991.659) (-1991.234) [-1981.930] -- 0:01:04
      803300 -- [-1982.791] (-1994.111) (-1993.368) (-2000.123) * (-1993.709) (-1994.718) (-1991.189) [-1987.010] -- 0:01:04
      803400 -- [-1983.092] (-1993.791) (-1988.436) (-2000.231) * (-1990.624) (-1985.285) (-1990.107) [-1990.242] -- 0:01:04
      803500 -- (-1985.070) (-1990.728) [-1988.056] (-1994.597) * (-1985.916) (-1985.486) (-1997.964) [-1982.638] -- 0:01:04
      803600 -- [-1982.565] (-1988.379) (-1993.777) (-1993.006) * (-1990.434) (-1984.744) (-2007.547) [-1987.011] -- 0:01:04
      803700 -- (-1986.694) [-1986.985] (-1999.249) (-1992.775) * (-1990.072) (-1990.057) (-2006.504) [-1991.761] -- 0:01:03
      803800 -- [-1990.055] (-1993.126) (-1997.072) (-1995.446) * [-1989.345] (-1984.199) (-1998.510) (-1987.167) -- 0:01:03
      803900 -- (-1985.284) [-1996.472] (-1992.764) (-2000.383) * (-1985.190) (-1988.746) (-1998.223) [-1983.845] -- 0:01:03
      804000 -- [-1982.561] (-1992.995) (-1993.173) (-2003.297) * (-1989.496) (-1989.629) (-1996.754) [-1987.035] -- 0:01:03

      Average standard deviation of split frequencies: 0.001775

      804100 -- (-1982.660) (-1987.106) [-1988.271] (-1994.627) * (-1988.370) [-1991.475] (-1989.939) (-1987.544) -- 0:01:03
      804200 -- [-1980.438] (-1985.943) (-1999.655) (-1989.185) * (-1994.004) (-1987.979) [-1990.816] (-1988.395) -- 0:01:03
      804300 -- [-1981.881] (-1994.455) (-1996.429) (-1990.693) * [-1990.703] (-1987.549) (-1995.825) (-1990.231) -- 0:01:03
      804400 -- [-1984.884] (-2000.523) (-1991.400) (-1991.159) * [-1987.314] (-1991.441) (-1992.649) (-1990.566) -- 0:01:03
      804500 -- [-1981.780] (-1990.375) (-2003.883) (-1993.336) * [-1988.564] (-1991.513) (-1999.001) (-1996.698) -- 0:01:03
      804600 -- [-1987.524] (-1988.783) (-1998.637) (-1999.980) * (-1989.842) (-1986.841) [-1993.665] (-1999.283) -- 0:01:03
      804700 -- [-1991.006] (-1991.581) (-1985.910) (-2003.728) * (-1986.812) (-1997.247) (-1994.925) [-1988.467] -- 0:01:03
      804800 -- (-1992.695) [-1991.205] (-1992.217) (-2003.484) * (-1990.334) (-1996.958) (-1984.974) [-1987.461] -- 0:01:03
      804900 -- (-1984.107) [-1992.877] (-1997.581) (-1996.954) * [-1988.347] (-1992.173) (-1986.026) (-1998.106) -- 0:01:03
      805000 -- [-1985.784] (-2002.267) (-2003.183) (-1993.060) * (-1992.404) [-2000.321] (-1988.500) (-1998.506) -- 0:01:03

      Average standard deviation of split frequencies: 0.001807

      805100 -- [-1979.285] (-2003.354) (-1998.513) (-1999.548) * (-1984.145) (-1999.199) (-1991.917) [-1994.836] -- 0:01:03
      805200 -- [-1979.645] (-1996.782) (-1998.956) (-1996.443) * [-1980.640] (-1994.087) (-1999.423) (-2003.594) -- 0:01:03
      805300 -- [-1982.146] (-1990.904) (-1987.487) (-1993.710) * [-1983.653] (-1986.341) (-1996.362) (-1999.510) -- 0:01:03
      805400 -- (-1987.148) (-1989.830) (-1991.513) [-1988.664] * [-1980.380] (-1981.517) (-1992.609) (-2003.022) -- 0:01:03
      805500 -- (-1988.754) [-1987.004] (-1994.948) (-1985.347) * (-1982.561) [-1979.337] (-1986.584) (-2007.366) -- 0:01:03
      805600 -- (-1987.860) [-1994.750] (-1996.065) (-1990.483) * (-1984.071) [-1981.012] (-1985.332) (-2000.498) -- 0:01:03
      805700 -- [-1991.445] (-1992.151) (-1991.301) (-1992.659) * (-1983.317) (-1980.381) [-1990.454] (-2008.194) -- 0:01:03
      805800 -- (-1998.719) (-1997.860) (-2001.108) [-1995.691] * [-1982.379] (-1986.683) (-1990.364) (-2000.837) -- 0:01:03
      805900 -- (-1994.374) (-1995.861) [-1999.148] (-1996.688) * (-1981.178) (-1988.825) [-1989.249] (-1997.500) -- 0:01:03
      806000 -- (-1987.887) (-1991.609) [-1989.266] (-2000.564) * [-1984.998] (-1986.178) (-1981.707) (-2007.384) -- 0:01:03

      Average standard deviation of split frequencies: 0.001972

      806100 -- (-1991.033) [-1992.838] (-2003.008) (-1996.662) * [-1983.706] (-2014.617) (-1983.949) (-1997.235) -- 0:01:03
      806200 -- [-1987.185] (-1987.614) (-1995.768) (-1991.546) * (-1982.009) (-2017.252) [-1987.580] (-2000.912) -- 0:01:03
      806300 -- (-1984.976) (-1989.975) (-1988.445) [-1988.550] * [-1982.988] (-2001.308) (-1985.137) (-2006.671) -- 0:01:03
      806400 -- [-1987.288] (-1991.009) (-1990.610) (-1988.169) * (-1982.037) (-2000.965) [-1985.497] (-2004.851) -- 0:01:03
      806500 -- (-1996.474) (-2008.526) [-1990.478] (-1988.997) * (-1983.327) (-1997.825) [-1983.655] (-1999.447) -- 0:01:03
      806600 -- (-1986.382) (-2001.200) [-1986.920] (-1985.356) * (-1984.367) (-1997.523) [-1984.155] (-2005.637) -- 0:01:03
      806700 -- (-1988.725) (-1998.044) [-1982.327] (-1986.978) * [-1987.051] (-2000.568) (-1990.233) (-2002.394) -- 0:01:03
      806800 -- [-1986.283] (-2001.629) (-1987.590) (-1989.362) * (-1987.931) (-1993.158) [-1988.741] (-1999.710) -- 0:01:02
      806900 -- (-1987.140) (-1998.855) [-1987.299] (-1990.146) * [-1989.502] (-1993.454) (-1996.276) (-1995.916) -- 0:01:02
      807000 -- [-1983.984] (-1996.672) (-1996.350) (-1988.968) * (-1989.685) [-1985.831] (-1992.428) (-2000.789) -- 0:01:02

      Average standard deviation of split frequencies: 0.001969

      807100 -- (-1987.879) (-1998.627) [-1990.348] (-1990.435) * (-1986.291) [-1983.984] (-1989.492) (-1999.312) -- 0:01:02
      807200 -- [-1983.391] (-2000.933) (-1990.084) (-1993.112) * (-1996.134) [-1991.110] (-1992.884) (-1994.105) -- 0:01:02
      807300 -- [-1985.632] (-1994.412) (-1993.668) (-1995.942) * (-1993.747) [-1988.828] (-1993.780) (-1989.367) -- 0:01:02
      807400 -- [-1985.530] (-1993.999) (-1994.217) (-1985.094) * (-1989.506) [-1985.944] (-1991.327) (-1987.724) -- 0:01:02
      807500 -- (-1990.090) (-1998.340) (-2001.861) [-1985.790] * (-1985.253) [-1984.520] (-1995.277) (-1987.766) -- 0:01:02
      807600 -- [-1987.131] (-1990.395) (-1994.001) (-1986.724) * (-1985.185) (-1989.603) (-1997.030) [-1988.782] -- 0:01:02
      807700 -- (-1984.139) (-1996.989) (-1995.104) [-1984.854] * [-1984.486] (-1986.904) (-1998.939) (-1992.822) -- 0:01:02
      807800 -- [-1984.471] (-1998.943) (-1999.871) (-1985.849) * [-1981.141] (-1985.693) (-2001.484) (-1990.164) -- 0:01:02
      807900 -- (-1990.063) (-1990.501) [-1986.072] (-1988.937) * [-1987.501] (-1985.132) (-2004.314) (-1993.699) -- 0:01:02
      808000 -- (-1991.457) (-1995.754) [-1988.859] (-2001.264) * [-1987.262] (-1984.314) (-2002.877) (-1994.897) -- 0:01:02

      Average standard deviation of split frequencies: 0.001933

      808100 -- (-1994.833) (-1996.899) [-1992.190] (-1999.967) * [-1980.594] (-1987.601) (-1994.137) (-1992.382) -- 0:01:02
      808200 -- [-1992.348] (-1999.008) (-1994.349) (-2000.928) * [-1979.827] (-2000.578) (-1999.556) (-1994.179) -- 0:01:02
      808300 -- (-1994.766) (-1994.606) [-1985.198] (-2004.483) * [-1982.043] (-1999.760) (-2008.007) (-1995.738) -- 0:01:02
      808400 -- [-1987.807] (-1989.639) (-1987.991) (-2002.932) * [-1979.698] (-1995.414) (-2008.169) (-1996.757) -- 0:01:02
      808500 -- [-1990.899] (-1988.353) (-1992.572) (-2000.451) * [-1981.636] (-1993.130) (-2004.972) (-2002.552) -- 0:01:02
      808600 -- (-1990.516) [-1987.939] (-1985.093) (-1996.473) * [-1979.810] (-1998.841) (-2013.525) (-1999.715) -- 0:01:02
      808700 -- (-1993.439) [-1986.734] (-1990.984) (-2006.255) * [-1984.633] (-1998.368) (-2010.087) (-1997.734) -- 0:01:02
      808800 -- (-1987.146) [-1981.428] (-1985.035) (-1999.963) * [-1984.737] (-1998.630) (-2013.807) (-1999.583) -- 0:01:02
      808900 -- (-1997.261) [-1985.178] (-1987.627) (-2002.576) * [-1983.349] (-1999.661) (-2011.049) (-2001.846) -- 0:01:02
      809000 -- (-1998.020) [-1983.516] (-1987.375) (-1993.789) * [-1986.601] (-2001.027) (-2013.250) (-2010.225) -- 0:01:02

      Average standard deviation of split frequencies: 0.001981

      809100 -- (-1999.220) [-1983.732] (-1985.505) (-1993.531) * [-1983.319] (-2004.886) (-2006.959) (-2004.328) -- 0:01:02
      809200 -- (-2001.110) [-1983.292] (-1988.182) (-1999.419) * [-1985.160] (-1992.126) (-2007.848) (-2008.410) -- 0:01:02
      809300 -- (-1996.027) (-1984.730) [-1985.326] (-1995.550) * [-1982.492] (-1985.216) (-2009.841) (-2006.386) -- 0:01:02
      809400 -- (-2001.703) (-1989.404) (-1989.796) [-1988.554] * (-1983.569) [-1978.776] (-2014.274) (-2000.661) -- 0:01:02
      809500 -- (-1999.517) (-1982.836) (-1989.773) [-1990.606] * (-1988.348) [-1983.873] (-2014.232) (-1994.472) -- 0:01:02
      809600 -- (-1994.111) [-1985.239] (-1988.379) (-1990.159) * (-1990.397) [-1982.873] (-2003.217) (-1993.067) -- 0:01:02
      809700 -- (-1988.143) [-1985.508] (-1995.174) (-1992.901) * (-1992.119) [-1978.510] (-2010.930) (-1998.827) -- 0:01:02
      809800 -- (-1986.008) [-1979.895] (-1999.994) (-1993.301) * (-1988.810) [-1980.099] (-2008.169) (-2006.679) -- 0:01:02
      809900 -- [-1989.664] (-1982.339) (-1994.380) (-2003.296) * (-1985.918) [-1982.236] (-2003.179) (-1992.430) -- 0:01:01
      810000 -- (-1991.032) [-1981.654] (-1990.245) (-2003.054) * [-1982.553] (-1983.989) (-2007.898) (-1988.814) -- 0:01:01

      Average standard deviation of split frequencies: 0.001912

      810100 -- (-1995.676) [-1980.241] (-1988.194) (-2010.244) * [-1982.614] (-1982.957) (-1997.610) (-1989.504) -- 0:01:01
      810200 -- (-1988.890) (-1982.519) [-1991.607] (-2006.120) * (-1992.751) (-1980.802) [-1992.158] (-1991.538) -- 0:01:01
      810300 -- [-1987.928] (-1985.348) (-1994.086) (-2023.825) * (-1988.236) [-1983.937] (-1993.743) (-1998.721) -- 0:01:01
      810400 -- (-2004.939) [-1985.460] (-1993.802) (-2001.820) * (-1998.250) [-1980.099] (-1989.365) (-1991.140) -- 0:01:01
      810500 -- (-2002.673) [-1988.097] (-1991.257) (-1996.450) * (-1998.039) [-1980.352] (-1992.517) (-1989.538) -- 0:01:01
      810600 -- (-1988.645) [-1984.359] (-1986.677) (-1996.717) * (-1993.962) [-1981.980] (-1994.881) (-1989.764) -- 0:01:01
      810700 -- (-1993.764) (-1984.967) (-1986.201) [-1991.833] * (-2002.415) [-1981.116] (-1992.158) (-1987.909) -- 0:01:01
      810800 -- (-1998.564) [-1980.596] (-1989.019) (-1993.448) * (-1995.362) [-1980.248] (-2002.548) (-1990.532) -- 0:01:01
      810900 -- (-1994.578) [-1980.045] (-1988.350) (-1997.685) * (-2011.918) [-1978.901] (-2001.308) (-1992.216) -- 0:01:01
      811000 -- (-1989.232) [-1984.064] (-1990.997) (-2003.129) * (-1993.431) (-1989.666) (-2001.497) [-1992.521] -- 0:01:01

      Average standard deviation of split frequencies: 0.001909

      811100 -- (-1987.358) (-1981.279) [-1985.194] (-2000.815) * [-1986.869] (-1986.940) (-2003.472) (-1992.648) -- 0:01:01
      811200 -- (-1993.716) [-1980.008] (-1987.127) (-2015.862) * (-1990.992) (-1985.558) (-1993.303) [-1988.377] -- 0:01:01
      811300 -- (-1996.779) [-1980.437] (-1997.742) (-2012.832) * (-1990.795) [-1983.633] (-1987.058) (-1996.457) -- 0:01:01
      811400 -- (-1991.509) [-1984.289] (-1991.209) (-2002.180) * (-1989.339) [-1981.213] (-1996.401) (-1997.907) -- 0:01:01
      811500 -- (-1993.681) [-1984.754] (-1990.278) (-1996.690) * (-1987.107) [-1982.106] (-2005.089) (-1994.168) -- 0:01:01
      811600 -- [-1989.423] (-1989.104) (-1990.387) (-1996.258) * (-1985.262) [-1982.373] (-2013.088) (-1992.104) -- 0:01:01
      811700 -- (-1987.767) (-1984.867) [-1990.835] (-2000.834) * (-1986.023) [-1980.842] (-2005.087) (-1995.026) -- 0:01:01
      811800 -- (-1988.429) [-1986.557] (-1991.286) (-1992.584) * (-1993.470) [-1989.088] (-2014.241) (-2002.391) -- 0:01:01
      811900 -- (-1999.871) (-1987.586) [-1991.089] (-1989.273) * (-1993.559) [-1986.675] (-2009.348) (-1998.562) -- 0:01:01
      812000 -- (-1997.988) (-1989.635) [-1996.090] (-1987.704) * [-1984.553] (-1985.727) (-2004.272) (-1990.357) -- 0:01:01

      Average standard deviation of split frequencies: 0.001907

      812100 -- (-2000.965) [-1978.833] (-2000.813) (-1990.636) * (-1989.899) [-1982.429] (-1988.570) (-1988.565) -- 0:01:01
      812200 -- (-1996.339) [-1985.020] (-2000.509) (-1995.533) * (-1991.498) [-1981.483] (-1990.383) (-1991.750) -- 0:01:01
      812300 -- (-1993.847) [-1987.270] (-1996.240) (-1988.649) * (-1986.492) [-1984.846] (-1987.432) (-2006.135) -- 0:01:01
      812400 -- (-1992.042) [-1984.728] (-1998.139) (-1990.055) * (-1988.364) (-1994.108) [-1981.390] (-2005.906) -- 0:01:01
      812500 -- (-1994.469) (-1986.502) (-1999.081) [-1990.533] * (-1988.949) (-1981.960) [-1986.348] (-2004.181) -- 0:01:01
      812600 -- (-1993.068) (-1983.923) [-1989.710] (-1994.500) * (-1987.715) [-1987.543] (-1988.979) (-1997.239) -- 0:01:01
      812700 -- (-1997.041) [-1985.723] (-1996.635) (-1997.298) * (-1996.030) (-1985.305) [-1988.160] (-2003.954) -- 0:01:01
      812800 -- (-1990.015) [-1984.932] (-1996.293) (-2006.257) * (-2002.015) [-1985.355] (-1988.404) (-1995.017) -- 0:01:01
      812900 -- (-1994.767) (-1994.840) [-1988.589] (-2000.494) * (-1999.463) [-1983.477] (-1990.623) (-1986.675) -- 0:01:00
      813000 -- (-1989.781) (-2000.098) [-1985.408] (-1988.713) * (-2002.524) (-1980.508) (-1990.013) [-1984.986] -- 0:01:00

      Average standard deviation of split frequencies: 0.001855

      813100 -- [-1990.271] (-1990.677) (-1987.014) (-1996.842) * (-1993.101) [-1990.895] (-1998.732) (-1992.655) -- 0:01:00
      813200 -- (-1990.199) (-1992.549) [-1988.614] (-2004.981) * (-1989.444) (-1989.522) [-1992.217] (-1993.762) -- 0:01:00
      813300 -- (-1989.050) (-1993.797) [-1983.398] (-1993.630) * (-1995.961) [-1985.842] (-2001.120) (-1990.355) -- 0:01:00
      813400 -- (-1988.472) (-1997.460) [-1990.889] (-1994.123) * (-1992.110) [-1985.763] (-2003.393) (-1987.307) -- 0:01:00
      813500 -- (-1991.382) (-1993.785) (-1989.750) [-1984.791] * (-1989.567) [-1985.997] (-2001.839) (-1994.093) -- 0:01:00
      813600 -- (-1997.613) (-1988.352) (-1992.782) [-1989.962] * (-1989.233) [-1987.445] (-2002.827) (-1991.188) -- 0:01:00
      813700 -- (-2010.162) (-1996.495) (-1989.307) [-1987.645] * (-1992.346) [-1988.046] (-2000.730) (-1991.303) -- 0:01:00
      813800 -- (-2009.498) [-1989.140] (-1998.857) (-1985.501) * (-1992.418) (-1994.484) (-1997.740) [-1988.568] -- 0:01:00
      813900 -- (-2006.268) (-1990.880) (-1997.814) [-1989.355] * (-1994.327) (-1992.842) (-2002.232) [-1990.109] -- 0:01:00
      814000 -- (-2001.682) (-1985.346) (-1991.630) [-1991.498] * (-1992.577) (-1988.040) [-1992.192] (-1993.966) -- 0:01:00

      Average standard deviation of split frequencies: 0.001886

      814100 -- (-1998.461) [-1986.238] (-1997.121) (-1986.025) * [-1995.570] (-1995.250) (-1997.312) (-1993.631) -- 0:01:00
      814200 -- (-1996.653) [-1986.956] (-1994.718) (-1994.477) * [-1992.467] (-1996.372) (-1996.463) (-1985.867) -- 0:01:00
      814300 -- (-1996.564) [-1983.091] (-2003.935) (-1996.883) * (-1998.453) (-1999.093) (-1998.638) [-1981.673] -- 0:01:00
      814400 -- (-2001.785) [-1979.947] (-1991.218) (-1990.751) * (-1997.141) (-1997.953) (-1999.165) [-1984.460] -- 0:01:00
      814500 -- (-1998.785) [-1978.546] (-1996.398) (-1991.767) * (-1992.075) (-1996.626) (-1995.919) [-1989.154] -- 0:01:00
      814600 -- (-1991.534) (-1981.299) (-1997.156) [-1985.808] * [-1993.163] (-1993.736) (-1996.189) (-1990.148) -- 0:01:00
      814700 -- [-1994.165] (-1983.250) (-1996.061) (-1991.919) * (-1987.268) (-1989.610) (-1995.346) [-1989.892] -- 0:01:00
      814800 -- (-1993.353) [-1981.531] (-1997.717) (-2004.907) * [-1988.197] (-1992.295) (-1993.474) (-1993.265) -- 0:01:00
      814900 -- (-1992.855) (-1987.223) [-1991.977] (-2003.603) * (-1996.015) (-1987.765) (-1990.257) [-1990.093] -- 0:01:00
      815000 -- (-1995.447) [-1984.640] (-1993.887) (-2003.957) * (-1993.213) (-1983.510) (-1991.485) [-1985.936] -- 0:01:00

      Average standard deviation of split frequencies: 0.001884

      815100 -- (-1999.017) [-1981.257] (-1989.268) (-2007.418) * (-1997.151) (-1993.849) (-1990.437) [-1990.032] -- 0:01:00
      815200 -- (-2000.122) [-1980.989] (-1993.344) (-2007.687) * (-1994.738) [-1991.490] (-2004.997) (-1990.728) -- 0:01:00
      815300 -- (-1993.962) [-1984.655] (-1990.739) (-2004.799) * (-1990.354) (-1991.896) (-1996.418) [-1989.243] -- 0:01:00
      815400 -- (-2000.712) (-1987.529) [-1989.377] (-2002.711) * (-1997.021) [-1995.577] (-1997.568) (-1986.622) -- 0:01:00
      815500 -- (-2000.487) (-1987.825) [-1988.586] (-1994.808) * (-1997.705) (-2003.313) (-1996.507) [-1989.898] -- 0:01:00
      815600 -- (-1993.035) [-1986.199] (-1991.987) (-1996.157) * (-1995.266) [-1991.387] (-1987.903) (-2003.877) -- 0:01:00
      815700 -- (-1996.419) [-1982.710] (-1989.269) (-1993.777) * (-1988.938) [-1986.894] (-1987.730) (-1996.795) -- 0:01:00
      815800 -- (-2002.068) (-1986.434) [-1988.557] (-1997.288) * (-1988.529) (-1991.592) [-1987.920] (-1994.226) -- 0:01:00
      815900 -- (-1997.034) (-1985.018) [-1986.577] (-2007.739) * [-1984.842] (-1987.309) (-1992.482) (-1992.447) -- 0:01:00
      816000 -- (-1990.341) [-1986.646] (-1987.413) (-2004.995) * (-1988.349) [-1985.621] (-1999.470) (-2003.612) -- 0:00:59

      Average standard deviation of split frequencies: 0.001964

      816100 -- [-1984.106] (-1985.306) (-1985.435) (-1997.081) * (-1985.094) [-1985.025] (-1991.961) (-2001.550) -- 0:00:59
      816200 -- [-1989.527] (-1988.490) (-1989.633) (-2009.173) * [-1985.011] (-1989.487) (-1991.933) (-1997.569) -- 0:00:59
      816300 -- [-1987.096] (-1985.594) (-1993.639) (-2001.316) * [-1984.505] (-1987.972) (-1998.120) (-2003.446) -- 0:00:59
      816400 -- [-1982.732] (-1978.739) (-1993.881) (-1996.277) * (-1988.464) [-1983.504] (-1992.339) (-2002.709) -- 0:00:59
      816500 -- (-1986.305) [-1985.565] (-1993.166) (-1992.238) * [-1978.999] (-1981.876) (-2001.047) (-1999.486) -- 0:00:59
      816600 -- (-1992.974) (-1993.451) [-1989.277] (-1996.115) * [-1979.791] (-1984.432) (-1993.186) (-1995.983) -- 0:00:59
      816700 -- (-1988.031) (-1997.109) (-1987.900) [-1992.645] * (-1988.651) [-1986.386] (-1996.089) (-1998.002) -- 0:00:59
      816800 -- [-1987.111] (-2002.605) (-1985.773) (-1990.483) * [-1985.507] (-1984.512) (-1993.999) (-1998.030) -- 0:00:59
      816900 -- [-1983.967] (-2001.872) (-1993.945) (-1993.210) * [-1982.012] (-1991.922) (-1992.613) (-1993.670) -- 0:00:59
      817000 -- [-1985.707] (-2004.015) (-1985.640) (-1996.579) * [-1977.377] (-1988.024) (-1995.199) (-1991.517) -- 0:00:59

      Average standard deviation of split frequencies: 0.001994

      817100 -- [-1990.799] (-2004.854) (-1988.379) (-2007.887) * [-1978.413] (-1988.882) (-1989.615) (-1992.275) -- 0:00:59
      817200 -- (-1987.712) (-1994.148) [-1987.880] (-1990.239) * [-1981.625] (-1993.430) (-1992.190) (-1999.984) -- 0:00:59
      817300 -- (-1990.805) (-1999.081) [-1990.249] (-1994.714) * [-1983.218] (-1994.215) (-1995.868) (-2001.206) -- 0:00:59
      817400 -- [-1991.272] (-1998.428) (-1992.905) (-1990.375) * (-1983.044) (-2001.050) [-1994.728] (-2000.224) -- 0:00:59
      817500 -- (-1993.035) (-1997.930) [-1995.041] (-1987.385) * [-1982.354] (-1996.088) (-1996.553) (-1994.453) -- 0:00:59
      817600 -- (-1992.585) (-1991.612) (-1992.978) [-1985.541] * (-1987.337) (-1997.607) (-1992.797) [-1991.766] -- 0:00:59
      817700 -- (-1992.401) (-1995.568) (-1990.905) [-1987.867] * [-1986.446] (-1994.042) (-1991.743) (-1994.972) -- 0:00:59
      817800 -- [-1992.633] (-1995.204) (-1996.151) (-1986.217) * [-1988.932] (-1990.590) (-2000.997) (-2001.667) -- 0:00:59
      817900 -- (-1995.928) (-2004.393) [-1992.393] (-1989.754) * [-1981.546] (-1981.712) (-1998.601) (-1996.024) -- 0:00:59
      818000 -- (-1987.723) (-2010.741) [-1989.411] (-1989.810) * [-1983.149] (-1988.442) (-1999.726) (-1992.022) -- 0:00:59

      Average standard deviation of split frequencies: 0.002107

      818100 -- [-1988.485] (-1999.945) (-1994.188) (-1994.045) * [-1983.490] (-1995.978) (-1998.505) (-1991.352) -- 0:00:59
      818200 -- [-1994.705] (-2000.975) (-1999.008) (-1992.559) * [-1985.444] (-1997.249) (-1995.517) (-1988.235) -- 0:00:59
      818300 -- (-1991.185) (-1998.885) (-1995.700) [-1987.631] * [-1988.191] (-1990.701) (-1990.342) (-1991.785) -- 0:00:59
      818400 -- (-1998.565) [-1999.210] (-1994.111) (-1990.475) * (-1985.838) (-1998.819) [-1987.643] (-1994.833) -- 0:00:59
      818500 -- (-2004.225) (-2006.941) (-1992.772) [-1991.876] * (-1986.096) (-2000.539) [-1988.722] (-1987.088) -- 0:00:59
      818600 -- (-2009.806) (-2002.472) [-1988.117] (-1995.841) * (-1981.283) (-1990.784) [-1988.345] (-1991.337) -- 0:00:59
      818700 -- (-1996.072) (-1998.881) (-1993.033) [-1991.628] * (-1982.553) [-1985.455] (-1990.685) (-1991.124) -- 0:00:59
      818800 -- [-1993.913] (-1997.571) (-1994.309) (-1993.235) * (-1988.910) [-1986.042] (-1991.933) (-2006.164) -- 0:00:59
      818900 -- [-1992.221] (-1997.630) (-1995.290) (-1988.167) * (-1985.914) (-1980.299) [-1983.573] (-2003.329) -- 0:00:59
      819000 -- (-1992.809) (-1995.470) (-1987.514) [-1984.194] * [-1982.305] (-1982.121) (-1987.452) (-2000.924) -- 0:00:59

      Average standard deviation of split frequencies: 0.002187

      819100 -- (-1995.838) (-1986.838) (-1986.793) [-1989.186] * (-1990.549) (-1983.445) [-1987.228] (-1996.393) -- 0:00:58
      819200 -- (-1992.867) [-1984.917] (-1989.231) (-1990.169) * (-1990.704) [-1981.291] (-1986.840) (-1994.904) -- 0:00:58
      819300 -- (-2001.246) [-1979.583] (-1993.537) (-1996.459) * [-1985.967] (-1981.121) (-1987.995) (-1996.884) -- 0:00:58
      819400 -- (-1996.753) (-1985.143) (-1993.673) [-1989.167] * (-1988.774) [-1979.602] (-1990.905) (-1995.191) -- 0:00:58
      819500 -- (-1991.753) [-1983.034] (-2000.166) (-1990.082) * (-1992.616) [-1985.736] (-1996.401) (-2002.364) -- 0:00:58
      819600 -- (-1995.608) (-1985.197) (-2018.413) [-1994.925] * [-1986.344] (-1990.528) (-1992.316) (-2001.227) -- 0:00:58
      819700 -- (-1987.080) [-1984.424] (-2001.786) (-1991.060) * [-1983.304] (-1987.326) (-1989.050) (-2001.537) -- 0:00:58
      819800 -- (-1991.637) (-1987.277) (-1993.266) [-1986.458] * [-1981.572] (-1986.511) (-1988.788) (-1998.641) -- 0:00:58
      819900 -- (-1996.435) [-1986.747] (-2004.787) (-1988.686) * [-1981.822] (-1990.471) (-1992.749) (-1994.650) -- 0:00:58
      820000 -- (-1997.664) (-1988.250) (-2002.553) [-1987.425] * (-1982.115) [-1985.746] (-1994.246) (-1995.041) -- 0:00:58

      Average standard deviation of split frequencies: 0.002201

      820100 -- (-1989.092) [-1990.511] (-1992.985) (-1988.522) * (-1985.029) [-1986.048] (-1993.724) (-1991.033) -- 0:00:58
      820200 -- (-1989.273) (-1992.464) (-1996.097) [-1987.665] * (-1985.163) [-1982.961] (-1990.091) (-1992.563) -- 0:00:58
      820300 -- [-1988.535] (-1993.848) (-1991.410) (-1994.518) * [-1982.492] (-1981.358) (-1988.382) (-1996.340) -- 0:00:58
      820400 -- (-1991.381) (-1999.389) [-1983.716] (-1992.668) * (-1982.140) [-1980.499] (-1990.966) (-1996.997) -- 0:00:58
      820500 -- (-1996.879) (-1993.023) [-1989.003] (-1985.986) * [-1983.161] (-1984.623) (-1995.073) (-2002.274) -- 0:00:58
      820600 -- (-1992.535) (-1988.099) (-1991.241) [-1995.017] * (-1986.878) [-1983.956] (-1991.434) (-2003.961) -- 0:00:58
      820700 -- [-1994.396] (-1983.326) (-1990.500) (-1985.769) * (-1986.718) [-1981.792] (-1992.144) (-2007.146) -- 0:00:58
      820800 -- (-1994.060) (-1984.994) (-1993.742) [-1987.775] * (-1983.548) [-1981.999] (-1997.277) (-1993.956) -- 0:00:58
      820900 -- (-1999.307) (-1984.932) (-1994.435) [-1988.393] * (-1983.932) [-1982.157] (-2000.330) (-1998.553) -- 0:00:58
      821000 -- (-1996.746) [-1985.984] (-1992.194) (-1986.473) * (-1993.280) [-1979.845] (-1998.683) (-1995.644) -- 0:00:58

      Average standard deviation of split frequencies: 0.002231

      821100 -- (-2002.185) (-1990.063) (-1990.369) [-1984.985] * [-1985.537] (-1981.638) (-1988.353) (-1998.393) -- 0:00:58
      821200 -- (-1997.033) (-1993.637) [-1986.191] (-1987.043) * (-1982.797) [-1983.778] (-2000.519) (-2000.196) -- 0:00:58
      821300 -- (-1991.757) (-1990.444) (-1991.282) [-1991.460] * [-1990.464] (-1979.615) (-2002.499) (-1997.704) -- 0:00:58
      821400 -- (-1991.722) [-1991.778] (-1989.577) (-1995.075) * (-1987.819) [-1979.631] (-2001.030) (-2001.933) -- 0:00:58
      821500 -- (-1986.701) (-1990.477) (-1997.016) [-1991.957] * (-1988.163) [-1979.587] (-2000.305) (-1993.161) -- 0:00:58
      821600 -- (-1986.191) [-1989.945] (-1984.783) (-1994.731) * (-1994.191) [-1977.470] (-1990.959) (-1991.412) -- 0:00:58
      821700 -- [-1983.894] (-1997.629) (-1987.999) (-2002.849) * (-1990.006) (-1983.703) (-1990.133) [-1987.652] -- 0:00:58
      821800 -- (-1984.578) (-1996.211) [-1984.571] (-1993.624) * (-1995.881) [-1984.938] (-1987.482) (-1990.372) -- 0:00:58
      821900 -- [-1982.594] (-1997.100) (-1988.809) (-1993.342) * (-1994.402) [-1980.276] (-2002.296) (-1994.715) -- 0:00:58
      822000 -- (-1985.535) (-1995.499) [-1989.664] (-1995.436) * (-1999.989) [-1982.711] (-1994.879) (-1992.479) -- 0:00:58

      Average standard deviation of split frequencies: 0.002277

      822100 -- (-1995.664) (-2006.566) [-1990.508] (-1994.900) * (-1993.667) [-1979.332] (-2002.129) (-1993.953) -- 0:00:57
      822200 -- [-1987.704] (-1999.060) (-1987.183) (-1993.758) * (-1991.129) [-1978.037] (-2003.351) (-1998.095) -- 0:00:57
      822300 -- (-1995.581) (-1998.691) [-1985.525] (-1988.555) * (-1994.410) [-1980.175] (-2011.940) (-1993.869) -- 0:00:57
      822400 -- (-1990.010) (-1990.665) (-1988.065) [-1989.602] * (-1997.776) [-1978.173] (-2006.258) (-1990.639) -- 0:00:57
      822500 -- (-1988.139) (-1989.218) [-1989.921] (-1992.168) * (-1992.582) [-1985.471] (-1993.716) (-1989.957) -- 0:00:57
      822600 -- [-1986.912] (-1988.046) (-1995.737) (-1992.135) * (-1996.764) [-1982.821] (-2003.435) (-1991.634) -- 0:00:57
      822700 -- [-1992.587] (-1983.007) (-1996.532) (-1993.904) * (-1992.907) [-1984.693] (-1996.539) (-1994.471) -- 0:00:57
      822800 -- (-1996.547) (-1989.382) [-1992.266] (-1994.308) * [-1996.075] (-1989.209) (-1995.618) (-1994.949) -- 0:00:57
      822900 -- [-1985.184] (-1989.980) (-1991.719) (-1996.881) * (-1995.638) [-1984.099] (-1992.458) (-1996.332) -- 0:00:57
      823000 -- [-1988.750] (-1990.048) (-1996.809) (-1997.111) * (-1992.086) (-1989.941) [-1996.309] (-1987.983) -- 0:00:57

      Average standard deviation of split frequencies: 0.002258

      823100 -- [-1985.134] (-1994.957) (-1993.095) (-1995.877) * (-1996.322) [-1988.295] (-1998.094) (-1987.566) -- 0:00:57
      823200 -- [-1986.335] (-1998.174) (-1992.462) (-1995.044) * (-1986.247) [-1989.417] (-2000.233) (-1986.921) -- 0:00:57
      823300 -- [-1984.707] (-1997.806) (-1994.954) (-1988.619) * [-1986.871] (-1987.081) (-1994.765) (-1987.598) -- 0:00:57
      823400 -- [-1989.876] (-2006.184) (-1992.125) (-1988.153) * (-1987.102) [-1982.820] (-2001.680) (-1991.381) -- 0:00:57
      823500 -- (-1998.215) (-2003.129) [-1987.853] (-1995.426) * (-1997.112) [-1984.220] (-2010.894) (-1989.789) -- 0:00:57
      823600 -- (-1992.200) (-1997.574) [-1985.977] (-1993.013) * (-1991.465) (-1986.378) (-1997.828) [-1987.318] -- 0:00:57
      823700 -- (-1998.756) (-1992.465) (-1988.388) [-1983.693] * (-1993.926) [-1985.421] (-1997.301) (-1984.685) -- 0:00:57
      823800 -- (-1999.717) (-1995.774) (-1998.908) [-1985.557] * (-1992.580) (-1990.111) (-2004.017) [-1987.429] -- 0:00:57
      823900 -- [-1997.302] (-1999.198) (-1991.308) (-1989.571) * (-1993.556) (-1990.946) (-2005.971) [-1985.470] -- 0:00:57
      824000 -- (-2004.441) (-1997.110) [-1993.481] (-1989.786) * (-1989.488) (-1989.036) (-2001.930) [-1984.976] -- 0:00:57

      Average standard deviation of split frequencies: 0.002125

      824100 -- (-2001.754) (-1995.451) (-1993.547) [-1992.422] * (-1989.602) (-1993.331) (-2000.979) [-1987.398] -- 0:00:57
      824200 -- (-2000.566) (-1999.052) (-1991.837) [-1991.821] * [-1988.132] (-1993.007) (-2001.951) (-1992.323) -- 0:00:57
      824300 -- (-2005.288) (-1997.457) [-1990.964] (-1992.832) * (-1988.083) (-1991.787) [-1992.287] (-1989.737) -- 0:00:57
      824400 -- (-2006.914) (-1998.604) [-1988.129] (-1997.048) * (-2000.340) (-1991.104) [-1990.332] (-1988.455) -- 0:00:57
      824500 -- (-2000.565) (-2003.604) (-1990.794) [-1987.309] * (-1997.957) (-1996.560) (-1991.485) [-1988.266] -- 0:00:57
      824600 -- (-2000.598) (-2003.478) [-1990.644] (-2000.171) * (-1994.655) (-1995.061) [-1988.601] (-1987.590) -- 0:00:57
      824700 -- (-2005.376) (-1997.263) (-1987.431) [-1991.646] * (-1990.257) (-1996.728) (-1990.686) [-1991.775] -- 0:00:57
      824800 -- (-1995.902) (-2002.164) [-1994.737] (-1994.864) * (-1985.354) [-1997.924] (-1992.736) (-1997.086) -- 0:00:57
      824900 -- (-2000.333) (-1999.994) [-1991.586] (-1989.610) * [-1982.262] (-1989.231) (-1984.873) (-1993.225) -- 0:00:57
      825000 -- (-1995.015) (-1995.963) (-1997.607) [-1989.267] * (-1982.668) (-1987.453) [-1988.586] (-2006.413) -- 0:00:57

      Average standard deviation of split frequencies: 0.002024

      825100 -- [-1989.509] (-1995.475) (-1997.187) (-1991.086) * (-1985.590) (-1989.823) (-1985.717) [-1995.364] -- 0:00:57
      825200 -- [-1989.009] (-1990.259) (-1990.127) (-1988.887) * (-1980.387) [-1987.653] (-1990.578) (-1988.726) -- 0:00:56
      825300 -- (-1989.124) (-1990.919) (-1990.628) [-1991.738] * [-1979.187] (-1988.800) (-1992.715) (-1985.773) -- 0:00:56
      825400 -- (-1991.476) (-1997.151) [-1983.286] (-1991.189) * [-1978.309] (-1993.591) (-2001.812) (-1989.654) -- 0:00:56
      825500 -- [-1983.776] (-1995.334) (-1987.760) (-1994.608) * [-1980.614] (-1993.704) (-1998.680) (-1986.596) -- 0:00:56
      825600 -- [-1989.725] (-1989.486) (-1986.368) (-1989.123) * [-1983.316] (-1985.113) (-1996.474) (-1985.681) -- 0:00:56
      825700 -- [-1993.749] (-1998.181) (-1987.989) (-1993.201) * (-1986.038) (-1982.730) [-1996.459] (-1988.836) -- 0:00:56
      825800 -- (-1987.485) (-1988.951) [-1989.668] (-1986.132) * [-1985.650] (-1986.317) (-1994.672) (-1989.711) -- 0:00:56
      825900 -- [-1986.983] (-1987.664) (-1989.874) (-1983.848) * [-1978.879] (-1993.238) (-1996.374) (-1993.194) -- 0:00:56
      826000 -- (-1985.219) (-1991.743) [-1989.147] (-1992.400) * [-1978.770] (-1986.735) (-1996.441) (-1993.997) -- 0:00:56

      Average standard deviation of split frequencies: 0.002038

      826100 -- (-1988.943) (-1996.272) (-1993.950) [-1991.774] * [-1983.934] (-1986.752) (-1993.538) (-1993.084) -- 0:00:56
      826200 -- (-1994.589) (-1995.251) [-1992.166] (-1988.675) * [-1981.307] (-1987.005) (-1989.108) (-1987.766) -- 0:00:56
      826300 -- (-1998.394) [-1985.692] (-1999.795) (-1991.576) * (-1979.587) [-1982.218] (-1993.693) (-2002.043) -- 0:00:56
      826400 -- (-1994.511) (-1987.897) (-1999.334) [-1987.198] * (-1983.048) [-1983.680] (-1989.437) (-2006.384) -- 0:00:56
      826500 -- (-2000.096) (-1987.235) (-2002.222) [-1986.661] * (-1979.177) (-1982.992) [-1985.893] (-1999.934) -- 0:00:56
      826600 -- (-1995.909) (-1986.189) (-2000.822) [-1985.173] * (-1982.107) [-1985.399] (-1986.223) (-1994.124) -- 0:00:56
      826700 -- (-1995.300) [-1996.436] (-1994.908) (-1983.400) * [-1980.445] (-1986.603) (-1993.245) (-1989.549) -- 0:00:56
      826800 -- (-1989.844) (-1993.207) (-2006.752) [-1986.564] * [-1981.662] (-1981.483) (-1996.927) (-1988.719) -- 0:00:56
      826900 -- (-1993.146) (-1996.855) (-2004.357) [-1985.956] * [-1974.971] (-1981.815) (-1994.847) (-1993.330) -- 0:00:56
      827000 -- (-1988.601) (-1995.093) (-2002.941) [-1989.673] * (-1983.099) [-1979.820] (-1991.638) (-1986.809) -- 0:00:56

      Average standard deviation of split frequencies: 0.002117

      827100 -- (-1990.633) [-1993.970] (-2001.088) (-1990.425) * [-1985.859] (-1983.963) (-1992.348) (-1988.817) -- 0:00:56
      827200 -- (-1989.985) [-1996.274] (-1994.508) (-1993.900) * (-1981.858) (-1989.234) (-1990.138) [-1987.438] -- 0:00:56
      827300 -- [-1989.419] (-1993.708) (-1996.829) (-1992.307) * [-1982.910] (-1990.559) (-1990.059) (-1992.304) -- 0:00:56
      827400 -- [-1990.302] (-2001.714) (-1998.572) (-1992.264) * [-1984.128] (-1990.282) (-1993.109) (-1986.816) -- 0:00:56
      827500 -- [-1989.549] (-2004.376) (-1994.480) (-1997.214) * (-1982.310) (-1990.494) (-2001.028) [-1986.471] -- 0:00:56
      827600 -- (-1985.929) (-1996.744) [-1990.252] (-1995.867) * [-1983.058] (-1995.186) (-1995.586) (-1990.379) -- 0:00:56
      827700 -- [-1985.122] (-1996.395) (-1992.346) (-1993.063) * (-1987.641) (-1995.572) (-2000.130) [-1991.762] -- 0:00:56
      827800 -- [-1992.296] (-2002.880) (-1998.048) (-1993.084) * (-1989.650) (-1991.665) (-2005.778) [-1989.603] -- 0:00:56
      827900 -- [-1988.278] (-2000.683) (-1994.272) (-1995.877) * [-1987.209] (-1992.117) (-2007.114) (-1989.115) -- 0:00:56
      828000 -- [-1987.985] (-1992.309) (-1990.773) (-1991.951) * [-1986.110] (-1988.107) (-2001.340) (-1995.162) -- 0:00:56

      Average standard deviation of split frequencies: 0.002114

      828100 -- (-1988.074) [-1989.864] (-1993.787) (-1988.279) * (-1988.316) [-1991.126] (-1996.897) (-1994.118) -- 0:00:56
      828200 -- (-1992.142) (-1986.120) (-2000.852) [-1983.805] * (-1986.515) [-1985.439] (-1996.318) (-1996.942) -- 0:00:56
      828300 -- (-1994.527) (-1984.942) (-1996.517) [-1986.239] * (-1986.809) [-1986.713] (-2000.999) (-2002.310) -- 0:00:55
      828400 -- (-1995.323) (-1985.138) (-2001.076) [-1989.848] * (-1986.716) [-1980.811] (-2000.218) (-1996.861) -- 0:00:55
      828500 -- [-1993.019] (-1990.764) (-2008.967) (-1993.092) * [-1986.442] (-1984.651) (-1999.314) (-1997.272) -- 0:00:55
      828600 -- (-1992.749) (-1991.765) (-2001.352) [-1991.542] * (-1987.262) [-1985.751] (-2004.006) (-1989.793) -- 0:00:55
      828700 -- (-2002.585) (-1985.549) (-2003.161) [-1992.039] * [-1986.757] (-1983.929) (-1997.361) (-1989.514) -- 0:00:56
      828800 -- (-1995.267) [-1987.360] (-1998.512) (-1993.619) * [-1980.037] (-1987.166) (-2000.881) (-1993.103) -- 0:00:55
      828900 -- (-1996.565) (-1984.798) (-1997.175) [-1993.764] * [-1982.110] (-1985.187) (-2002.699) (-1989.733) -- 0:00:55
      829000 -- [-1991.120] (-1991.279) (-2001.745) (-1993.816) * [-1982.450] (-1992.560) (-1995.328) (-1989.255) -- 0:00:55

      Average standard deviation of split frequencies: 0.002177

      829100 -- (-1994.516) [-1985.096] (-2001.313) (-2001.823) * (-1989.235) [-1993.997] (-1993.581) (-1997.245) -- 0:00:55
      829200 -- [-1990.969] (-1988.200) (-2000.521) (-2007.358) * (-1985.018) (-1996.794) [-1990.017] (-1991.937) -- 0:00:55
      829300 -- (-1994.715) (-1993.321) (-1998.870) [-1991.533] * (-1985.372) [-1988.168] (-1989.030) (-1990.127) -- 0:00:55
      829400 -- (-1996.514) (-1990.522) (-2005.220) [-1989.821] * (-1984.329) [-1985.789] (-1991.241) (-1986.369) -- 0:00:55
      829500 -- [-1989.686] (-1993.783) (-2000.306) (-1989.187) * (-1989.172) [-1988.322] (-1994.271) (-1990.882) -- 0:00:55
      829600 -- (-1985.224) (-1994.345) (-1996.540) [-1992.848] * [-1988.068] (-1993.580) (-1987.496) (-1989.251) -- 0:00:55
      829700 -- (-1986.804) (-1995.770) [-1991.190] (-1994.451) * (-1988.739) (-1988.190) (-1990.492) [-1983.278] -- 0:00:55
      829800 -- (-1993.160) (-2006.215) [-1994.350] (-1993.570) * (-1979.045) (-1987.136) (-1995.672) [-1985.671] -- 0:00:55
      829900 -- [-1988.795] (-1992.771) (-1988.479) (-1992.518) * [-1980.581] (-1982.964) (-1999.841) (-2006.472) -- 0:00:55
      830000 -- (-1993.941) [-1985.438] (-1996.698) (-1992.147) * [-1985.939] (-1984.494) (-1993.539) (-2004.142) -- 0:00:55

      Average standard deviation of split frequencies: 0.002158

      830100 -- (-1995.517) (-1987.813) (-1987.464) [-1988.982] * (-1990.559) (-1984.836) [-1992.606] (-2003.261) -- 0:00:55
      830200 -- (-2000.830) (-1994.040) [-1986.281] (-1990.757) * (-1988.195) [-1982.195] (-1995.512) (-1996.755) -- 0:00:55
      830300 -- (-2005.941) [-1985.196] (-1989.655) (-2006.258) * (-1992.144) [-1984.147] (-1990.939) (-2002.933) -- 0:00:55
      830400 -- (-1996.741) [-1983.003] (-1988.859) (-1997.669) * [-1989.791] (-1986.892) (-2001.403) (-2003.817) -- 0:00:55
      830500 -- (-1996.750) [-1984.615] (-1991.245) (-1996.299) * (-1990.936) [-1985.873] (-2005.818) (-1999.918) -- 0:00:55
      830600 -- (-2002.066) [-1984.946] (-1991.940) (-1987.272) * [-1988.828] (-1989.725) (-2008.878) (-1993.523) -- 0:00:55
      830700 -- (-2001.996) (-1986.126) (-1986.637) [-1992.898] * (-1982.139) [-1983.086] (-2013.898) (-1996.578) -- 0:00:55
      830800 -- (-2000.698) (-1985.260) (-1987.105) [-1990.023] * (-1986.572) (-1991.715) (-2018.902) [-1989.068] -- 0:00:55
      830900 -- (-2004.656) [-1990.694] (-1988.353) (-1991.639) * (-1986.849) (-1989.415) (-2017.984) [-1984.358] -- 0:00:55
      831000 -- (-1994.732) (-1990.144) [-1990.925] (-1985.618) * [-1983.866] (-2000.885) (-2010.786) (-1986.940) -- 0:00:55

      Average standard deviation of split frequencies: 0.002220

      831100 -- (-1994.969) (-1988.043) (-1992.763) [-1986.297] * [-1981.764] (-1996.869) (-2000.857) (-1989.489) -- 0:00:55
      831200 -- (-1996.064) (-1985.714) (-1997.760) [-1985.404] * (-1982.727) (-1987.321) (-1989.796) [-1985.886] -- 0:00:55
      831300 -- (-1991.990) (-1987.071) (-1996.134) [-1982.765] * (-1981.441) (-1986.642) (-1995.993) [-1985.879] -- 0:00:54
      831400 -- (-2001.154) [-1989.489] (-2000.800) (-1987.335) * (-1980.039) [-1987.410] (-1995.817) (-1994.832) -- 0:00:54
      831500 -- (-1997.892) (-1992.966) (-1997.177) [-1984.352] * [-1980.472] (-1985.089) (-1995.751) (-1990.961) -- 0:00:54
      831600 -- (-1999.110) (-1991.033) (-1990.316) [-1988.510] * [-1982.580] (-1985.960) (-2001.682) (-1992.785) -- 0:00:54
      831700 -- (-1992.945) (-1990.264) (-1995.729) [-1990.962] * (-1981.640) [-1988.961] (-2000.178) (-1994.977) -- 0:00:55
      831800 -- (-1995.392) [-1992.012] (-1995.581) (-1982.359) * [-1981.746] (-2000.596) (-1994.268) (-1997.262) -- 0:00:55
      831900 -- (-1997.243) (-1998.953) (-2001.675) [-1985.969] * [-1989.052] (-2003.130) (-1993.980) (-2000.282) -- 0:00:54
      832000 -- (-1997.537) (-1994.699) (-2006.579) [-1982.170] * [-1986.461] (-1998.971) (-1987.197) (-1992.925) -- 0:00:54

      Average standard deviation of split frequencies: 0.002088

      832100 -- (-1998.094) [-1987.197] (-1998.602) (-1994.392) * (-1985.201) (-1994.818) (-1992.986) [-1988.050] -- 0:00:54
      832200 -- (-2004.060) [-1988.018] (-1999.266) (-1989.685) * [-1981.540] (-1985.910) (-1989.719) (-1998.461) -- 0:00:54
      832300 -- (-1998.629) (-1990.709) (-2000.241) [-1988.416] * [-1982.113] (-1993.104) (-1994.739) (-1998.589) -- 0:00:54
      832400 -- (-1996.162) (-1996.552) (-1997.620) [-1983.928] * [-1983.725] (-1992.552) (-1992.218) (-2004.656) -- 0:00:54
      832500 -- (-2000.836) (-1989.919) (-1998.017) [-1981.572] * [-1982.369] (-1992.510) (-1996.294) (-2006.462) -- 0:00:54
      832600 -- (-1998.652) (-1993.120) (-2005.099) [-1983.829] * [-1980.075] (-1998.538) (-1993.874) (-1999.885) -- 0:00:54
      832700 -- (-2002.715) (-1991.908) (-1998.251) [-1982.006] * [-1981.134] (-1997.400) (-1989.876) (-2001.236) -- 0:00:54
      832800 -- (-1998.615) (-1990.337) (-1994.844) [-1982.132] * [-1982.730] (-2013.689) (-1994.300) (-2005.330) -- 0:00:54
      832900 -- (-2002.740) (-1990.480) (-1991.079) [-1981.887] * [-1981.416] (-1995.060) (-1998.174) (-1996.732) -- 0:00:54
      833000 -- (-2004.914) (-1989.227) (-2001.627) [-1983.020] * [-1978.810] (-1995.384) (-2007.591) (-1998.130) -- 0:00:54

      Average standard deviation of split frequencies: 0.002021

      833100 -- (-2008.908) (-1991.804) (-1994.432) [-1980.873] * [-1978.389] (-1991.583) (-2003.677) (-1996.062) -- 0:00:54
      833200 -- (-2000.543) (-1994.005) (-1988.604) [-1985.851] * [-1979.742] (-1993.488) (-2006.876) (-2002.198) -- 0:00:54
      833300 -- (-2002.119) (-1995.463) (-1994.193) [-1981.097] * [-1985.677] (-1998.046) (-2009.541) (-2005.995) -- 0:00:54
      833400 -- (-2005.814) (-2006.119) (-1997.905) [-1981.280] * (-1986.838) [-1990.243] (-2018.002) (-2007.123) -- 0:00:54
      833500 -- (-1995.032) (-2000.865) (-1993.047) [-1982.821] * [-1983.656] (-1999.414) (-2003.760) (-1994.561) -- 0:00:54
      833600 -- (-1995.462) (-1994.854) (-1991.453) [-1983.449] * [-1983.103] (-2006.043) (-2005.014) (-1999.290) -- 0:00:54
      833700 -- (-2001.178) (-1993.369) [-1991.383] (-1983.110) * [-1984.254] (-1992.846) (-1998.068) (-1996.996) -- 0:00:54
      833800 -- (-1994.911) (-1994.977) (-1998.726) [-1986.744] * (-1980.558) (-1988.743) (-2001.773) [-1994.762] -- 0:00:54
      833900 -- (-1992.457) (-2007.986) (-1998.181) [-1991.850] * (-1986.325) (-1991.015) [-1994.698] (-2002.622) -- 0:00:54
      834000 -- [-1989.483] (-1995.352) (-1998.553) (-1989.283) * [-1983.713] (-1993.503) (-1996.577) (-2002.118) -- 0:00:54

      Average standard deviation of split frequencies: 0.002002

      834100 -- (-1997.309) (-1990.323) (-1997.969) [-1985.456] * [-1984.673] (-1988.237) (-1990.194) (-2005.992) -- 0:00:54
      834200 -- (-1996.276) (-1991.003) (-2000.144) [-1981.097] * [-1983.459] (-1989.785) (-1988.066) (-1996.933) -- 0:00:54
      834300 -- (-1993.871) (-1997.669) (-2007.066) [-1982.346] * [-1985.627] (-1986.196) (-1989.728) (-2001.734) -- 0:00:54
      834400 -- (-1993.852) (-2007.755) (-2000.948) [-1979.516] * [-1986.545] (-1987.832) (-1990.259) (-2009.676) -- 0:00:53
      834500 -- (-1998.059) (-2000.235) (-2001.499) [-1985.369] * (-1985.772) [-1987.226] (-1990.236) (-2012.207) -- 0:00:53
      834600 -- [-1989.071] (-1999.854) (-2002.411) (-1986.352) * [-1986.555] (-1991.671) (-1990.587) (-2009.839) -- 0:00:53
      834700 -- (-1994.265) (-1996.032) (-2014.661) [-1985.194] * [-1985.083] (-1992.409) (-1998.187) (-2007.685) -- 0:00:54
      834800 -- (-1997.773) [-1993.214] (-2009.137) (-1981.427) * [-1986.156] (-1988.046) (-1996.327) (-2003.751) -- 0:00:54
      834900 -- (-2002.604) (-1993.163) (-1997.761) [-1982.722] * (-1984.299) (-1990.808) [-1989.829] (-2006.247) -- 0:00:53
      835000 -- (-1994.136) (-1999.156) (-1989.460) [-1980.388] * [-1991.077] (-1988.785) (-1990.039) (-2010.070) -- 0:00:53

      Average standard deviation of split frequencies: 0.002129

      835100 -- (-1997.512) (-1992.432) (-1988.564) [-1981.366] * (-1988.348) [-1987.027] (-1993.027) (-2001.644) -- 0:00:53
      835200 -- (-1992.716) (-1991.654) (-1984.340) [-1977.517] * [-1992.584] (-1989.897) (-1991.575) (-1998.363) -- 0:00:53
      835300 -- (-1992.566) (-1990.078) (-1992.446) [-1983.768] * (-1996.251) [-1989.086] (-1995.713) (-1993.677) -- 0:00:53
      835400 -- [-1985.643] (-1999.252) (-1991.657) (-1987.291) * (-1991.686) [-1990.700] (-1990.366) (-1997.557) -- 0:00:53
      835500 -- [-1985.715] (-1992.007) (-1993.297) (-1990.626) * [-1992.622] (-1999.070) (-1987.663) (-1993.018) -- 0:00:53
      835600 -- (-1985.220) (-1987.119) (-1996.794) [-1984.543] * (-1986.724) (-2001.336) [-1988.890] (-2000.805) -- 0:00:53
      835700 -- (-1988.749) (-1987.385) (-1994.529) [-1986.718] * [-1990.048] (-1995.201) (-1985.462) (-1998.706) -- 0:00:53
      835800 -- (-1995.300) [-1983.721] (-1997.805) (-1991.709) * [-1981.758] (-1995.033) (-1985.663) (-1998.466) -- 0:00:53
      835900 -- [-1991.573] (-1986.060) (-1991.561) (-1995.784) * [-1981.857] (-2003.984) (-1989.280) (-2000.039) -- 0:00:53
      836000 -- [-1989.589] (-1991.112) (-1997.115) (-1998.280) * (-1983.242) (-2002.942) [-1987.268] (-2001.635) -- 0:00:53

      Average standard deviation of split frequencies: 0.002078

      836100 -- [-1986.481] (-1988.353) (-2007.034) (-1995.510) * (-1986.835) (-1998.194) [-1987.689] (-1999.111) -- 0:00:53
      836200 -- (-1987.092) (-1990.923) (-1997.836) [-1988.112] * [-1975.660] (-1999.275) (-1990.217) (-1998.061) -- 0:00:53
      836300 -- (-2002.021) [-1989.707] (-1992.489) (-1989.563) * [-1989.203] (-1993.282) (-1987.679) (-1998.115) -- 0:00:53
      836400 -- (-1996.137) [-1991.255] (-1994.404) (-1986.182) * [-1989.589] (-1994.943) (-1989.932) (-1992.594) -- 0:00:53
      836500 -- (-2002.417) (-2000.431) (-1998.252) [-1984.930] * (-1996.033) (-1993.538) [-1986.639] (-1999.126) -- 0:00:53
      836600 -- (-1995.092) (-1999.841) (-1994.353) [-1984.487] * (-1991.147) (-1992.380) [-1987.027] (-2001.240) -- 0:00:53
      836700 -- (-1997.752) (-1998.583) (-1996.463) [-1985.540] * (-1996.004) (-1992.346) [-1986.657] (-2000.136) -- 0:00:53
      836800 -- (-1988.610) [-1993.755] (-1989.918) (-1990.196) * (-1989.830) [-1987.294] (-1986.419) (-2008.427) -- 0:00:53
      836900 -- (-1990.791) (-1992.146) (-1993.329) [-1987.449] * (-1988.889) (-1990.286) [-1987.176] (-1995.003) -- 0:00:53
      837000 -- (-2003.115) (-1990.546) (-2002.863) [-1991.425] * [-1985.965] (-1998.284) (-1992.443) (-1994.371) -- 0:00:53

      Average standard deviation of split frequencies: 0.002172

      837100 -- (-1995.063) (-1988.266) (-2019.808) [-1999.483] * [-1982.772] (-2008.005) (-1999.596) (-1994.262) -- 0:00:53
      837200 -- (-1993.672) [-1986.443] (-2004.735) (-1995.930) * [-1982.634] (-1999.777) (-1991.449) (-2005.142) -- 0:00:53
      837300 -- (-1994.188) [-1986.376] (-2003.786) (-1989.897) * [-1979.354] (-2003.518) (-1988.055) (-1992.263) -- 0:00:53
      837400 -- [-1983.014] (-1994.374) (-2004.529) (-1984.952) * [-1984.122] (-1991.037) (-1986.502) (-1993.364) -- 0:00:53
      837500 -- (-1985.980) (-1992.566) (-2005.037) [-1991.104] * (-1988.529) (-1989.368) [-1985.558] (-1990.089) -- 0:00:52
      837600 -- (-1993.595) [-1999.096] (-1995.771) (-1992.963) * (-1987.184) (-1999.595) [-1988.783] (-1994.921) -- 0:00:52
      837700 -- (-1990.645) (-2007.834) [-1995.015] (-1994.085) * (-1983.010) (-1994.669) (-1998.560) [-1990.465] -- 0:00:53
      837800 -- (-1986.529) (-2005.314) (-2010.862) [-1989.947] * (-1986.251) (-1991.998) (-1991.442) [-1986.567] -- 0:00:53
      837900 -- [-1982.696] (-1992.783) (-1993.000) (-1988.100) * [-1984.487] (-1996.643) (-1993.204) (-1987.813) -- 0:00:53
      838000 -- [-1985.283] (-1992.188) (-1999.267) (-1993.448) * (-1991.294) (-1995.846) (-1993.096) [-1988.510] -- 0:00:52

      Average standard deviation of split frequencies: 0.002250

      838100 -- [-1984.440] (-1994.973) (-1994.179) (-1988.546) * (-1989.387) (-1993.430) (-1995.775) [-1990.215] -- 0:00:52
      838200 -- (-1990.164) (-1995.853) (-1995.628) [-1990.493] * (-1994.131) (-2006.883) [-1989.603] (-1984.839) -- 0:00:52
      838300 -- [-1987.789] (-1997.092) (-1997.600) (-1987.759) * (-1988.827) (-2001.397) [-1993.021] (-1981.641) -- 0:00:52
      838400 -- [-1987.291] (-2000.425) (-1996.245) (-1990.369) * (-1988.154) (-1996.720) (-2001.136) [-1986.759] -- 0:00:52
      838500 -- (-1993.754) (-2004.084) (-1998.054) [-1986.584] * (-1986.662) [-1986.892] (-1997.015) (-1988.091) -- 0:00:52
      838600 -- [-1995.056] (-1998.701) (-1989.261) (-1990.283) * (-1991.426) [-1986.631] (-1995.219) (-1999.022) -- 0:00:52
      838700 -- (-1990.377) (-2002.298) (-1998.308) [-1986.496] * [-1988.010] (-1986.455) (-1990.715) (-1997.627) -- 0:00:52
      838800 -- (-1987.070) (-1999.425) (-1993.388) [-1985.621] * (-1996.173) (-1992.443) [-1983.866] (-1995.309) -- 0:00:52
      838900 -- (-1988.045) (-1994.741) (-1996.157) [-1984.378] * [-1983.739] (-1991.091) (-1982.492) (-2001.276) -- 0:00:52
      839000 -- (-1993.214) (-1995.358) [-1987.401] (-1996.235) * [-1984.368] (-1992.998) (-1985.986) (-2001.175) -- 0:00:52

      Average standard deviation of split frequencies: 0.002199

      839100 -- (-1993.573) (-1998.849) [-1987.109] (-1998.574) * (-1984.645) (-1988.900) [-1983.346] (-2005.431) -- 0:00:52
      839200 -- [-1988.372] (-1999.029) (-1989.274) (-1995.011) * [-1982.398] (-1992.983) (-1989.155) (-1995.764) -- 0:00:52
      839300 -- (-1989.898) (-2004.957) [-1985.992] (-1990.599) * [-1982.860] (-2010.899) (-1993.499) (-1994.009) -- 0:00:52
      839400 -- [-1983.945] (-2000.209) (-1987.991) (-1992.217) * [-1982.637] (-2003.087) (-1995.826) (-1996.617) -- 0:00:52
      839500 -- [-1984.363] (-2002.006) (-1985.439) (-1988.326) * [-1978.686] (-2002.462) (-1997.302) (-1994.475) -- 0:00:52
      839600 -- (-1988.665) (-2020.455) [-1988.619] (-1991.378) * [-1976.212] (-1995.423) (-1996.589) (-2000.059) -- 0:00:52
      839700 -- (-1994.110) (-2022.930) (-1987.660) [-1990.154] * (-1978.524) (-1994.377) (-1995.222) [-1990.499] -- 0:00:52
      839800 -- (-1995.544) (-2010.406) [-1990.490] (-1992.908) * (-1984.760) (-1995.996) (-1991.268) [-1990.835] -- 0:00:52
      839900 -- (-1990.777) (-2010.530) (-1990.631) [-1990.615] * [-1978.863] (-1997.549) (-1993.888) (-1989.461) -- 0:00:52
      840000 -- [-1988.180] (-1999.744) (-1989.495) (-1987.532) * [-1981.673] (-1995.784) (-2000.085) (-1999.313) -- 0:00:52

      Average standard deviation of split frequencies: 0.002212

      840100 -- (-1987.443) (-1989.952) [-1989.543] (-1991.440) * (-1987.428) [-1997.256] (-2006.659) (-2004.886) -- 0:00:52
      840200 -- (-1986.866) (-1990.432) (-1998.052) [-1989.730] * [-1988.589] (-1996.337) (-2005.196) (-1991.704) -- 0:00:52
      840300 -- [-1990.528] (-1987.998) (-1992.226) (-1997.052) * [-1990.450] (-2007.705) (-1992.593) (-1998.006) -- 0:00:52
      840400 -- (-1997.310) [-1984.426] (-1991.781) (-2005.821) * (-1992.906) (-2007.242) [-1990.320] (-1996.349) -- 0:00:52
      840500 -- (-1995.662) (-1984.428) [-1985.994] (-1995.628) * (-1998.211) (-1998.561) [-1986.620] (-1992.910) -- 0:00:51
      840600 -- (-1998.481) [-1986.289] (-1991.313) (-1991.854) * [-1996.419] (-1998.338) (-1989.421) (-1998.767) -- 0:00:51
      840700 -- (-1993.058) [-1988.227] (-1992.699) (-1994.953) * (-1998.671) (-1996.447) [-1991.735] (-1994.931) -- 0:00:52
      840800 -- [-1990.035] (-1994.587) (-1999.960) (-1988.599) * (-1995.471) (-1995.040) [-1990.048] (-1992.989) -- 0:00:52
      840900 -- (-1993.508) (-1992.875) (-1995.964) [-1990.504] * (-1995.284) (-1990.187) [-1984.183] (-1994.204) -- 0:00:52
      841000 -- (-1997.105) [-1993.616] (-2000.571) (-1993.595) * (-1994.841) (-2000.520) (-1987.579) [-1991.048] -- 0:00:51

      Average standard deviation of split frequencies: 0.002338

      841100 -- (-1995.590) [-1992.908] (-1997.693) (-2000.089) * (-1999.581) (-1988.890) [-1984.795] (-1988.996) -- 0:00:51
      841200 -- (-1998.781) (-1990.280) [-1991.098] (-1999.007) * (-1999.125) (-1991.714) [-1986.180] (-1995.225) -- 0:00:51
      841300 -- [-1988.797] (-1991.770) (-1996.444) (-1992.103) * (-1997.213) [-1989.115] (-1983.262) (-1992.790) -- 0:00:51
      841400 -- (-1992.307) [-1990.130] (-1993.082) (-1996.056) * (-2001.258) (-1989.241) [-1989.601] (-1992.381) -- 0:00:51
      841500 -- (-2004.176) (-1984.407) [-1984.410] (-1993.942) * (-1995.885) (-1993.807) (-1989.711) [-1990.642] -- 0:00:51
      841600 -- [-1994.365] (-1983.645) (-1993.832) (-1990.988) * (-1989.485) [-1998.472] (-1984.527) (-1987.929) -- 0:00:51
      841700 -- [-1988.648] (-1983.089) (-1991.734) (-1992.441) * [-1984.919] (-1998.444) (-1987.385) (-1995.786) -- 0:00:51
      841800 -- (-1990.542) [-1984.790] (-1993.815) (-1990.304) * [-1987.316] (-2006.329) (-1990.844) (-1992.445) -- 0:00:51
      841900 -- (-1998.130) [-1985.544] (-1997.401) (-1996.818) * (-1995.381) (-2017.331) [-1987.105] (-1995.935) -- 0:00:51
      842000 -- (-1993.359) (-1984.813) [-1998.042] (-1997.865) * (-1983.248) (-2002.065) [-1986.646] (-1991.807) -- 0:00:51

      Average standard deviation of split frequencies: 0.002239

      842100 -- (-1990.330) [-1983.668] (-1988.433) (-1990.768) * (-1981.153) (-2002.168) [-1991.641] (-1992.779) -- 0:00:51
      842200 -- (-1994.260) [-1984.694] (-1994.791) (-1992.195) * [-1980.742] (-2003.745) (-1988.800) (-1992.285) -- 0:00:51
      842300 -- (-1996.543) [-1985.888] (-1992.008) (-1986.477) * [-1981.493] (-1999.529) (-1988.230) (-1991.496) -- 0:00:51
      842400 -- (-1997.641) [-1982.525] (-1992.890) (-1988.060) * (-1984.682) (-2004.888) (-1998.532) [-1989.596] -- 0:00:51
      842500 -- (-1998.753) [-1980.716] (-1990.229) (-1992.763) * [-1980.452] (-2005.205) (-1994.564) (-1995.691) -- 0:00:51
      842600 -- (-1995.374) [-1985.993] (-1989.232) (-1997.103) * [-1981.915] (-1994.275) (-1998.030) (-1996.665) -- 0:00:51
      842700 -- (-1996.641) [-1980.852] (-1985.931) (-2000.768) * [-1989.549] (-1998.091) (-2002.099) (-2000.787) -- 0:00:51
      842800 -- (-1986.608) [-1979.447] (-1991.000) (-1997.634) * [-1984.945] (-1993.592) (-2000.299) (-1999.430) -- 0:00:51
      842900 -- [-1984.356] (-1980.926) (-1986.766) (-1992.792) * [-1985.339] (-1986.493) (-2003.128) (-1995.808) -- 0:00:51
      843000 -- (-1992.927) [-1985.142] (-1993.343) (-1992.965) * [-1990.068] (-1993.782) (-1985.648) (-1993.963) -- 0:00:51

      Average standard deviation of split frequencies: 0.002268

      843100 -- (-1993.336) [-1981.096] (-1997.597) (-1997.369) * (-1989.178) [-1983.347] (-1993.736) (-1996.615) -- 0:00:51
      843200 -- (-1996.046) [-1981.056] (-2000.085) (-1995.144) * (-1988.496) [-1984.604] (-1993.496) (-1995.513) -- 0:00:51
      843300 -- (-1994.875) [-1982.587] (-1999.143) (-1999.198) * [-1983.943] (-1988.718) (-2002.348) (-1999.061) -- 0:00:51
      843400 -- (-1990.629) (-1983.801) [-1988.510] (-1997.063) * (-1989.421) [-1989.802] (-1996.827) (-2003.284) -- 0:00:51
      843500 -- (-1988.232) [-1981.466] (-1992.729) (-2000.675) * (-1988.119) [-1990.703] (-1994.197) (-2008.433) -- 0:00:51
      843600 -- [-1986.367] (-1988.555) (-1999.294) (-2004.339) * [-1993.827] (-1988.534) (-1994.891) (-2001.746) -- 0:00:51
      843700 -- [-1990.301] (-1990.774) (-2005.407) (-2001.048) * (-1991.593) [-1983.430] (-1991.206) (-2000.833) -- 0:00:51
      843800 -- [-1984.833] (-1982.857) (-2009.143) (-1994.130) * (-1991.636) (-1984.966) (-1992.114) [-1994.255] -- 0:00:51
      843900 -- (-1988.608) (-1987.752) (-2006.095) [-1991.752] * [-1987.294] (-1990.604) (-1992.028) (-1996.878) -- 0:00:51
      844000 -- [-1988.978] (-1991.559) (-1991.709) (-1995.326) * [-1982.260] (-1996.704) (-1993.945) (-2003.390) -- 0:00:51

      Average standard deviation of split frequencies: 0.002266

      844100 -- [-1989.848] (-1991.170) (-1995.943) (-1997.132) * [-1980.633] (-1999.112) (-1992.892) (-1999.315) -- 0:00:50
      844200 -- (-2003.663) [-1987.424] (-1992.802) (-1988.531) * [-1981.005] (-2002.561) (-1995.032) (-1995.447) -- 0:00:50
      844300 -- (-2002.787) [-1995.984] (-1990.802) (-1991.693) * (-1990.906) (-2001.210) [-1990.970] (-1998.473) -- 0:00:50
      844400 -- (-2011.152) [-1991.956] (-1992.426) (-2002.551) * [-1985.108] (-2001.935) (-1986.936) (-1996.239) -- 0:00:50
      844500 -- (-2009.070) (-1996.438) (-1986.441) [-1994.982] * (-1994.612) (-2005.687) (-1988.591) [-1997.095] -- 0:00:50
      844600 -- (-2015.533) (-1997.524) [-1990.559] (-1992.318) * (-1995.136) (-1993.951) [-1985.761] (-1995.115) -- 0:00:50
      844700 -- (-2012.916) (-1989.201) [-1991.203] (-1990.695) * (-1995.134) (-1998.256) [-1988.125] (-1995.978) -- 0:00:50
      844800 -- (-2001.889) (-1993.038) [-1989.937] (-1996.650) * (-1994.526) (-1999.080) [-1987.367] (-1998.535) -- 0:00:50
      844900 -- (-1989.809) [-1987.477] (-1993.449) (-1998.020) * [-1991.149] (-1995.817) (-1987.486) (-1993.621) -- 0:00:50
      845000 -- [-1987.060] (-1992.043) (-1991.377) (-1999.795) * (-1991.505) (-1999.274) [-1983.635] (-1989.923) -- 0:00:50

      Average standard deviation of split frequencies: 0.002343

      845100 -- (-1989.690) [-1990.128] (-1992.975) (-2005.410) * (-1996.609) [-1986.326] (-1984.954) (-1990.350) -- 0:00:50
      845200 -- (-1987.489) (-1994.426) [-1989.438] (-2006.618) * (-2002.917) [-1991.819] (-1985.431) (-1985.742) -- 0:00:50
      845300 -- [-1985.513] (-1993.889) (-1989.280) (-1995.777) * (-1989.372) (-2002.537) [-1992.858] (-1986.001) -- 0:00:50
      845400 -- [-1983.100] (-1996.376) (-1988.091) (-1999.950) * (-1997.826) (-2007.152) (-1989.884) [-1990.139] -- 0:00:50
      845500 -- [-1991.237] (-1990.663) (-2000.873) (-1997.610) * (-1993.154) (-2008.126) (-1990.539) [-1989.157] -- 0:00:50
      845600 -- (-1985.616) [-1985.011] (-2000.262) (-2001.831) * (-1999.716) (-1997.518) (-1992.679) [-1986.366] -- 0:00:50
      845700 -- [-1991.943] (-1986.723) (-2000.242) (-1995.215) * (-1994.112) (-2001.635) [-1988.524] (-1994.748) -- 0:00:50
      845800 -- (-1986.583) [-1981.414] (-1997.951) (-1995.971) * [-1990.640] (-1996.539) (-1985.657) (-1997.592) -- 0:00:50
      845900 -- [-1987.109] (-1986.745) (-1998.219) (-1997.736) * (-1994.641) (-1987.543) [-1983.956] (-2002.893) -- 0:00:50
      846000 -- [-1986.558] (-1989.514) (-2007.857) (-1996.981) * [-1985.702] (-1990.600) (-1989.249) (-1995.120) -- 0:00:50

      Average standard deviation of split frequencies: 0.002324

      846100 -- [-1986.761] (-1998.187) (-2012.371) (-2004.812) * (-1986.683) [-1992.043] (-1991.822) (-1997.112) -- 0:00:50
      846200 -- [-1988.286] (-1986.832) (-2005.031) (-1987.137) * (-1986.995) [-1992.382] (-1999.646) (-1992.400) -- 0:00:50
      846300 -- (-1986.015) [-1986.418] (-2001.536) (-2006.013) * [-1987.633] (-1987.958) (-2007.321) (-1994.761) -- 0:00:50
      846400 -- [-1984.007] (-1996.305) (-1998.819) (-2006.190) * (-1988.689) (-1991.399) (-1999.124) [-1989.184] -- 0:00:50
      846500 -- [-1986.585] (-1992.655) (-1997.742) (-2002.250) * [-1982.406] (-1987.927) (-2004.048) (-1992.623) -- 0:00:50
      846600 -- (-1989.730) [-1990.645] (-1995.400) (-2006.466) * (-1984.154) [-1987.220] (-2000.636) (-1995.273) -- 0:00:50
      846700 -- (-1994.923) [-1988.578] (-1992.943) (-2001.863) * (-1985.679) [-1984.774] (-1994.121) (-1994.262) -- 0:00:50
      846800 -- (-1999.098) [-1986.224] (-1989.040) (-1999.910) * (-1989.683) (-1998.729) (-1990.899) [-1995.372] -- 0:00:50
      846900 -- (-2002.074) [-1983.294] (-1999.995) (-1989.576) * [-1994.663] (-2004.173) (-1989.711) (-1988.702) -- 0:00:50
      847000 -- (-1995.521) [-1983.699] (-1995.313) (-1991.385) * [-1987.277] (-1992.088) (-1998.785) (-1989.761) -- 0:00:50

      Average standard deviation of split frequencies: 0.002289

      847100 -- (-1994.263) [-1982.424] (-1996.122) (-1992.242) * (-1991.494) (-1995.913) [-1990.561] (-1992.020) -- 0:00:49
      847200 -- (-1995.629) [-1984.050] (-1996.687) (-1991.917) * [-1992.172] (-2001.548) (-1999.456) (-1999.167) -- 0:00:49
      847300 -- (-2005.558) [-1987.237] (-1990.071) (-1991.922) * [-1992.027] (-2001.385) (-1991.075) (-1999.611) -- 0:00:49
      847400 -- [-1992.221] (-1983.792) (-1994.453) (-1997.818) * (-1992.756) (-2009.880) (-1987.137) [-1996.683] -- 0:00:49
      847500 -- (-2000.559) (-1984.236) [-1997.871] (-1994.366) * (-1999.784) (-2006.291) [-1988.622] (-2000.372) -- 0:00:49
      847600 -- [-1992.035] (-1983.343) (-1992.261) (-1995.930) * (-1999.519) (-2005.077) [-1985.672] (-1996.695) -- 0:00:49
      847700 -- (-2002.386) [-1981.656] (-1992.354) (-1995.013) * (-1997.601) (-1998.845) [-1988.597] (-1994.016) -- 0:00:49
      847800 -- (-1992.853) [-1980.103] (-1998.373) (-1998.681) * (-2003.039) (-1994.590) [-1990.070] (-2001.081) -- 0:00:49
      847900 -- (-1991.353) [-1983.787] (-1997.561) (-1996.378) * (-2006.835) (-1994.756) [-1991.446] (-2000.101) -- 0:00:49
      848000 -- (-1990.797) [-1982.980] (-1995.470) (-1995.443) * (-1991.584) [-1991.321] (-1992.170) (-2007.411) -- 0:00:49

      Average standard deviation of split frequencies: 0.002271

      848100 -- (-2011.897) (-1990.643) [-1987.679] (-1996.515) * [-1995.354] (-1993.352) (-1993.967) (-2018.358) -- 0:00:49
      848200 -- (-2005.457) [-1991.049] (-1990.416) (-1997.810) * [-1991.406] (-2002.828) (-1996.479) (-2006.868) -- 0:00:49
      848300 -- (-2003.284) [-1990.267] (-1991.076) (-2000.310) * (-1989.772) (-2002.224) [-1995.259] (-2023.635) -- 0:00:49
      848400 -- (-2000.395) (-2003.710) [-1991.933] (-2003.222) * [-1988.707] (-2002.332) (-1989.700) (-2013.774) -- 0:00:49
      848500 -- [-1999.634] (-1996.313) (-1991.301) (-1996.106) * (-1993.601) (-2000.313) [-1987.383] (-2016.751) -- 0:00:49
      848600 -- (-1994.039) (-1987.766) (-1995.725) [-1988.641] * (-1990.884) (-1993.388) [-1991.322] (-2024.897) -- 0:00:49
      848700 -- (-1988.937) [-1988.386] (-1995.712) (-1987.207) * [-1992.423] (-1992.352) (-1996.981) (-2004.877) -- 0:00:49
      848800 -- [-1988.143] (-1990.922) (-1992.411) (-1991.168) * (-1987.445) [-1991.771] (-1999.021) (-2007.546) -- 0:00:49
      848900 -- (-1989.731) (-1987.573) [-1983.053] (-1986.207) * [-1982.758] (-1993.656) (-1997.419) (-2011.195) -- 0:00:49
      849000 -- (-1990.548) (-1997.803) (-1984.199) [-1985.547] * [-1985.349] (-1994.133) (-1990.812) (-2006.672) -- 0:00:49

      Average standard deviation of split frequencies: 0.002220

      849100 -- (-1997.452) (-1998.878) [-1985.971] (-1987.044) * [-1982.920] (-1998.351) (-1990.093) (-2005.016) -- 0:00:49
      849200 -- (-1993.698) (-1991.781) (-1986.121) [-1989.514] * [-1986.589] (-1996.003) (-1994.032) (-2010.187) -- 0:00:49
      849300 -- (-1991.028) (-2001.002) [-1982.870] (-1997.394) * [-1989.652] (-2008.434) (-1991.588) (-2004.520) -- 0:00:49
      849400 -- (-2000.669) (-1994.232) [-1981.557] (-1999.943) * (-1982.221) (-2005.815) [-1990.385] (-2000.472) -- 0:00:49
      849500 -- (-2000.246) (-1997.390) [-1985.847] (-1993.690) * [-1985.906] (-2012.105) (-1990.768) (-1995.276) -- 0:00:49
      849600 -- (-1999.892) (-2003.395) [-1982.909] (-1990.390) * [-1987.233] (-2001.243) (-1993.375) (-1993.003) -- 0:00:49
      849700 -- (-2002.279) (-1996.883) (-1986.533) [-1993.520] * (-1988.090) (-2008.173) (-1995.755) [-1989.120] -- 0:00:49
      849800 -- (-2004.361) (-1998.083) (-1993.035) [-1988.205] * [-1981.886] (-1999.913) (-2004.295) (-1999.889) -- 0:00:49
      849900 -- (-2001.348) (-2000.237) [-1982.035] (-1992.145) * [-1980.778] (-1991.657) (-1987.361) (-2004.810) -- 0:00:49
      850000 -- (-1997.172) (-1996.820) [-1983.318] (-1996.151) * (-1985.786) (-1989.631) [-1993.445] (-2005.759) -- 0:00:49

      Average standard deviation of split frequencies: 0.002218

      850100 -- (-1992.215) (-1994.796) (-1978.556) [-1992.740] * (-1985.569) [-1990.190] (-1992.044) (-2006.129) -- 0:00:49
      850200 -- (-1994.840) (-1994.827) [-1978.318] (-1994.282) * [-1981.545] (-1990.005) (-1991.623) (-2004.940) -- 0:00:48
      850300 -- (-1994.522) (-2001.009) [-1977.497] (-1993.535) * (-1988.024) [-1986.601] (-1989.919) (-2004.803) -- 0:00:48
      850400 -- (-1995.715) (-2005.447) [-1979.185] (-1990.608) * [-1983.407] (-1985.317) (-1985.087) (-2004.247) -- 0:00:48
      850500 -- (-2000.354) (-2000.635) [-1983.230] (-1991.476) * (-1987.139) [-1986.108] (-1984.040) (-2011.559) -- 0:00:48
      850600 -- (-1997.898) (-1991.438) [-1981.746] (-1990.820) * [-1994.003] (-1985.738) (-1996.293) (-1991.034) -- 0:00:48
      850700 -- (-1997.511) (-1992.583) [-1987.294] (-2001.034) * (-1990.008) (-1986.735) [-1987.674] (-1993.384) -- 0:00:48
      850800 -- (-1992.393) (-1995.351) [-1989.034] (-1997.476) * (-1992.643) [-1986.448] (-1988.893) (-1994.126) -- 0:00:48
      850900 -- (-1994.722) (-1992.910) [-1987.232] (-1996.416) * (-1987.863) (-1985.221) [-1982.830] (-1995.827) -- 0:00:48
      851000 -- (-1995.471) (-1998.084) [-1998.629] (-1996.380) * [-1983.231] (-1984.989) (-1981.849) (-1991.645) -- 0:00:48

      Average standard deviation of split frequencies: 0.002294

      851100 -- (-1999.498) (-1997.172) (-2003.456) [-1986.766] * (-1984.181) (-1988.860) [-1984.852] (-1992.043) -- 0:00:48
      851200 -- (-1996.031) (-1993.778) [-2000.313] (-1990.634) * (-1983.561) (-1990.478) [-1983.222] (-1991.594) -- 0:00:48
      851300 -- [-1990.777] (-1991.138) (-1991.923) (-1987.729) * (-1986.658) (-2002.761) [-1983.886] (-1986.182) -- 0:00:48
      851400 -- (-1992.670) (-1986.625) [-1991.834] (-1988.056) * (-2003.339) (-2009.128) [-1981.098] (-1994.694) -- 0:00:48
      851500 -- (-1996.286) (-1989.937) (-1985.536) [-1988.135] * (-1990.560) (-2002.959) [-1979.807] (-1990.844) -- 0:00:48
      851600 -- (-2000.654) [-1988.865] (-1991.408) (-1989.225) * (-1990.544) (-2001.228) [-1985.061] (-1988.776) -- 0:00:48
      851700 -- (-2000.828) (-1995.230) (-1988.689) [-1986.504] * [-1989.432] (-1995.986) (-1983.680) (-1987.806) -- 0:00:48
      851800 -- (-2005.345) (-1993.286) [-1988.091] (-1987.093) * (-1992.143) (-2000.097) (-1991.532) [-1991.539] -- 0:00:48
      851900 -- (-1995.049) (-1994.631) (-1991.835) [-1988.293] * (-1986.915) (-1996.948) (-1992.012) [-1988.237] -- 0:00:48
      852000 -- (-1996.136) (-1990.625) (-1992.153) [-1984.324] * (-1987.197) (-2004.789) [-1987.829] (-1993.755) -- 0:00:48

      Average standard deviation of split frequencies: 0.002244

      852100 -- (-2000.801) (-1993.535) (-1992.748) [-1986.163] * (-1984.549) (-1991.166) [-1981.216] (-1991.729) -- 0:00:48
      852200 -- (-2002.865) (-1988.029) (-1988.006) [-1985.195] * (-2005.103) (-1990.381) (-1981.666) [-1985.314] -- 0:00:48
      852300 -- (-1995.367) [-1986.273] (-1988.182) (-1987.680) * (-2007.651) (-1986.933) [-1980.615] (-1991.746) -- 0:00:48
      852400 -- (-1992.012) (-1993.697) [-1983.669] (-1986.557) * (-2008.641) (-1985.138) [-1980.526] (-1995.324) -- 0:00:48
      852500 -- (-1996.283) (-1996.767) (-1989.193) [-1986.432] * (-2008.441) (-1988.501) [-1979.879] (-1995.236) -- 0:00:48
      852600 -- (-1987.411) (-1991.520) (-1992.798) [-1986.356] * (-2003.457) (-1994.124) [-1980.372] (-1994.436) -- 0:00:48
      852700 -- (-1992.255) (-1989.701) (-2000.423) [-1987.607] * (-1999.547) (-1998.507) [-1980.926] (-2001.375) -- 0:00:48
      852800 -- (-1984.214) (-1991.072) (-2005.697) [-1988.863] * (-2004.677) (-1998.195) [-1977.469] (-2010.066) -- 0:00:48
      852900 -- [-1987.918] (-1993.205) (-2002.086) (-1993.940) * (-2012.156) (-1996.530) [-1982.743] (-2006.341) -- 0:00:48
      853000 -- (-1990.928) (-1990.079) (-2003.033) [-1992.873] * (-2001.283) (-1987.843) [-1984.749] (-2003.884) -- 0:00:48

      Average standard deviation of split frequencies: 0.002210

      853100 -- (-1990.427) (-1997.676) (-1988.003) [-1982.395] * (-2004.964) (-1983.521) [-1981.812] (-1999.029) -- 0:00:48
      853200 -- [-1987.519] (-1989.772) (-1984.478) (-1990.632) * (-1995.974) (-1987.784) [-1982.246] (-2004.358) -- 0:00:48
      853300 -- (-1985.583) (-1992.579) [-1982.920] (-1984.557) * (-1998.276) (-1988.408) [-1985.102] (-1994.793) -- 0:00:47
      853400 -- (-1991.998) [-1988.980] (-1985.543) (-1980.220) * (-2000.975) [-1987.688] (-1982.082) (-1996.847) -- 0:00:47
      853500 -- (-1991.048) (-1989.952) [-1987.256] (-1990.294) * (-2000.252) (-1990.709) [-1982.013] (-2005.372) -- 0:00:47
      853600 -- (-1983.789) (-1987.342) [-1980.579] (-1992.976) * (-2002.780) (-1989.957) (-1981.080) [-2004.421] -- 0:00:47
      853700 -- (-1989.971) (-1993.442) [-1981.997] (-1991.142) * (-2003.906) [-1987.567] (-1976.453) (-1993.749) -- 0:00:47
      853800 -- (-1993.065) [-1986.602] (-1986.573) (-1983.459) * (-1994.786) (-1995.175) [-1981.579] (-2011.288) -- 0:00:47
      853900 -- (-1987.131) (-1988.849) (-1985.081) [-1982.465] * (-1989.538) (-1990.602) [-1982.457] (-1998.065) -- 0:00:47
      854000 -- [-1983.683] (-2002.960) (-1988.280) (-1985.872) * [-1988.673] (-1995.342) (-1984.519) (-1993.397) -- 0:00:47

      Average standard deviation of split frequencies: 0.002208

      854100 -- (-1987.109) (-2002.994) (-1988.665) [-1982.850] * (-1987.978) (-1990.002) (-1984.813) [-1986.919] -- 0:00:47
      854200 -- (-1994.271) (-2004.644) (-1991.082) [-1984.755] * (-1982.464) (-1987.748) [-1982.724] (-1994.603) -- 0:00:47
      854300 -- [-1997.007] (-1989.298) (-1993.124) (-1984.355) * [-1983.599] (-1992.282) (-1982.574) (-1998.898) -- 0:00:47
      854400 -- (-1991.314) (-1989.548) (-1991.201) [-1978.053] * (-1988.786) [-1986.486] (-1986.537) (-2001.708) -- 0:00:47
      854500 -- (-1995.729) (-1984.626) (-1990.719) [-1977.686] * [-1983.176] (-1983.763) (-1992.949) (-1997.963) -- 0:00:47
      854600 -- (-1999.478) (-1990.683) (-2007.114) [-1982.069] * [-1983.366] (-1985.865) (-2002.725) (-2008.199) -- 0:00:47
      854700 -- (-1990.398) [-1987.238] (-1996.874) (-1979.133) * (-1985.080) [-1987.877] (-1996.694) (-2005.119) -- 0:00:47
      854800 -- [-1991.521] (-1988.510) (-2001.061) (-1980.341) * [-1984.586] (-1989.081) (-1987.804) (-1997.915) -- 0:00:47
      854900 -- (-1991.955) (-1989.958) [-1993.134] (-1981.859) * [-1988.309] (-1992.563) (-1982.306) (-2005.343) -- 0:00:47
      855000 -- (-1992.315) (-1992.178) (-1989.092) [-1984.162] * (-2000.565) (-1998.768) [-1980.081] (-1991.981) -- 0:00:47

      Average standard deviation of split frequencies: 0.002394

      855100 -- (-2000.192) (-1989.567) (-1989.911) [-1983.573] * (-2007.689) (-1996.258) [-1979.769] (-1988.493) -- 0:00:47
      855200 -- (-2002.234) (-1985.648) (-1987.981) [-1980.254] * (-2006.863) (-1998.746) [-1980.877] (-1990.717) -- 0:00:47
      855300 -- (-1990.519) (-1987.916) (-1991.201) [-1982.314] * (-1992.640) (-2004.519) [-1983.309] (-1983.554) -- 0:00:47
      855400 -- (-1990.829) [-1984.232] (-1987.122) (-1991.686) * (-1985.447) (-1988.648) [-1981.020] (-1984.916) -- 0:00:47
      855500 -- (-1989.548) (-1987.158) [-1986.460] (-1986.195) * [-1989.595] (-1986.688) (-1985.492) (-1986.524) -- 0:00:47
      855600 -- (-1991.894) (-1991.545) (-1988.815) [-1984.700] * (-1985.658) (-1990.027) (-1988.181) [-1984.965] -- 0:00:47
      855700 -- (-1991.865) (-1998.660) [-1982.552] (-1984.165) * (-1986.222) (-1988.930) (-1984.701) [-1980.754] -- 0:00:47
      855800 -- (-1996.350) (-1988.826) [-1982.077] (-1986.751) * (-1988.451) (-1983.502) (-1983.699) [-1987.216] -- 0:00:47
      855900 -- (-1992.973) (-1990.223) [-1981.496] (-1990.438) * (-1985.221) (-1986.752) [-1980.899] (-1990.096) -- 0:00:47
      856000 -- [-1993.364] (-1995.337) (-1982.954) (-1989.555) * (-1989.876) (-1985.268) [-1979.354] (-1981.754) -- 0:00:47

      Average standard deviation of split frequencies: 0.002423

      856100 -- (-1990.739) (-1990.341) (-1988.936) [-1981.413] * (-1986.640) (-1988.695) [-1980.147] (-1990.341) -- 0:00:47
      856200 -- [-1987.036] (-1990.831) (-1989.981) (-1983.278) * (-1988.159) [-1988.092] (-1982.998) (-1989.053) -- 0:00:47
      856300 -- (-1986.184) (-1992.832) (-1989.038) [-1982.669] * (-1990.102) (-1983.209) [-1980.524] (-1990.772) -- 0:00:46
      856400 -- (-1988.085) (-1999.767) (-1993.225) [-1985.341] * [-1991.089] (-1993.137) (-1983.817) (-1992.977) -- 0:00:46
      856500 -- (-1987.457) (-1995.703) (-2014.740) [-1984.446] * (-1989.745) [-1985.465] (-1978.456) (-1996.038) -- 0:00:46
      856600 -- (-1988.676) (-1995.812) (-2008.223) [-1976.843] * (-1985.727) (-1993.511) [-1983.675] (-1989.855) -- 0:00:46
      856700 -- (-1995.037) (-1999.841) (-1995.735) [-1978.390] * (-1985.199) (-1992.802) [-1983.010] (-1991.745) -- 0:00:46
      856800 -- [-1997.641] (-1996.645) (-1994.475) (-1978.708) * (-1987.579) [-1999.238] (-1985.948) (-2002.307) -- 0:00:46
      856900 -- (-1988.338) (-1994.592) (-2014.592) [-1981.812] * (-1983.170) (-1993.694) [-1979.787] (-1998.101) -- 0:00:46
      857000 -- (-1990.372) (-1990.343) (-2009.913) [-1982.142] * (-1985.279) (-1987.001) [-1980.208] (-1984.547) -- 0:00:46

      Average standard deviation of split frequencies: 0.002388

      857100 -- (-1993.321) (-1991.205) (-2006.479) [-1985.123] * (-1984.983) (-1987.890) [-1977.790] (-1991.920) -- 0:00:46
      857200 -- (-1999.459) [-1986.023] (-2009.770) (-1981.231) * (-1991.126) (-1990.336) [-1981.298] (-1991.133) -- 0:00:46
      857300 -- (-1993.949) (-1988.343) (-1996.869) [-1982.895] * [-1984.940] (-1991.965) (-1976.897) (-1983.574) -- 0:00:46
      857400 -- (-1996.889) [-1986.567] (-2000.359) (-1989.805) * [-1989.172] (-1997.559) (-1980.165) (-1987.379) -- 0:00:46
      857500 -- (-1991.741) (-1991.909) (-1987.161) [-1988.679] * (-1994.972) (-1997.958) (-1990.715) [-1986.255] -- 0:00:46
      857600 -- (-1992.229) (-1997.674) [-1979.218] (-1994.262) * (-1995.230) (-2001.445) [-1985.133] (-1989.323) -- 0:00:46
      857700 -- (-1994.079) (-1993.005) [-1978.557] (-1994.035) * (-1993.443) [-1989.860] (-1991.969) (-1989.904) -- 0:00:46
      857800 -- (-1994.347) (-1994.142) [-1977.000] (-1992.974) * (-1997.932) (-1991.170) (-1986.253) [-1988.476] -- 0:00:46
      857900 -- (-1990.059) (-1992.949) (-1980.907) [-1994.045] * (-1994.765) [-1991.475] (-1990.182) (-1985.072) -- 0:00:46
      858000 -- (-1988.635) (-1993.751) [-1982.401] (-2003.378) * (-1986.838) [-1991.288] (-1986.711) (-1995.685) -- 0:00:46

      Average standard deviation of split frequencies: 0.002417

      858100 -- (-1985.591) (-1990.899) [-1982.047] (-2002.245) * [-1990.687] (-1993.860) (-1992.615) (-1996.207) -- 0:00:46
      858200 -- (-1984.505) (-1997.443) [-1982.380] (-1999.268) * (-1991.386) (-2003.947) (-1983.088) [-1993.644] -- 0:00:46
      858300 -- [-1985.203] (-1997.842) (-1982.503) (-2002.085) * (-1989.992) (-2007.465) [-1982.365] (-1987.737) -- 0:00:46
      858400 -- [-1986.652] (-1997.490) (-1982.687) (-2000.319) * (-1992.406) (-2011.016) [-1981.261] (-1990.668) -- 0:00:46
      858500 -- [-1987.264] (-1996.386) (-1985.289) (-2000.900) * (-1997.729) (-1995.060) (-1980.851) [-1993.616] -- 0:00:46
      858600 -- [-1987.557] (-1997.850) (-1985.630) (-1994.508) * (-1992.984) (-1990.984) [-1981.513] (-1996.689) -- 0:00:46
      858700 -- [-1985.976] (-1993.120) (-1988.615) (-2001.854) * (-1994.331) (-1992.283) (-1988.293) [-1987.029] -- 0:00:46
      858800 -- (-1986.309) (-1997.044) [-1987.049] (-1997.623) * (-1997.738) (-1995.899) (-1981.277) [-1988.055] -- 0:00:46
      858900 -- [-1989.866] (-1997.263) (-1993.233) (-2005.441) * (-1998.218) (-1994.903) (-1984.366) [-1980.232] -- 0:00:46
      859000 -- (-1988.099) [-1995.855] (-1994.887) (-2006.627) * (-1995.283) (-2000.776) [-1981.804] (-1990.345) -- 0:00:46

      Average standard deviation of split frequencies: 0.002398

      859100 -- (-1993.739) (-1998.926) [-1994.138] (-1998.910) * (-1990.286) (-1998.243) [-1986.079] (-1985.902) -- 0:00:46
      859200 -- (-1993.279) [-1994.613] (-1985.970) (-1996.378) * (-1994.655) (-1993.032) (-1992.643) [-1983.685] -- 0:00:46
      859300 -- [-1989.407] (-1992.880) (-1989.297) (-1997.196) * (-1988.276) [-1993.005] (-1986.566) (-1983.267) -- 0:00:46
      859400 -- (-1987.923) (-1994.377) [-1985.361] (-2007.676) * [-1989.637] (-1998.858) (-1985.559) (-1991.739) -- 0:00:45
      859500 -- (-1990.544) (-2000.101) [-1980.867] (-2004.790) * [-1987.349] (-1997.562) (-2006.153) (-1989.678) -- 0:00:45
      859600 -- [-1988.507] (-2001.613) (-1980.607) (-2003.912) * (-1983.924) (-1998.835) (-1988.600) [-1984.604] -- 0:00:45
      859700 -- [-1984.891] (-2001.990) (-1982.655) (-2001.115) * (-1980.405) (-1994.742) [-1987.663] (-1986.358) -- 0:00:45
      859800 -- [-1985.022] (-1997.017) (-1987.898) (-1998.269) * [-1981.776] (-1994.470) (-1990.679) (-1986.546) -- 0:00:45
      859900 -- [-1985.522] (-1989.008) (-1982.863) (-2003.058) * [-1984.369] (-1992.157) (-1991.166) (-1995.777) -- 0:00:45
      860000 -- (-1988.658) (-1992.573) (-1983.236) [-1992.749] * [-1978.146] (-2001.641) (-1986.898) (-1995.046) -- 0:00:45

      Average standard deviation of split frequencies: 0.002396

      860100 -- [-1989.377] (-2001.344) (-1992.212) (-1997.968) * [-1984.521] (-1996.160) (-1996.008) (-1998.111) -- 0:00:45
      860200 -- (-1983.828) (-1995.340) (-1992.818) [-1997.707] * (-1993.913) (-1998.129) [-1988.075] (-1994.396) -- 0:00:45
      860300 -- [-1985.488] (-1995.099) (-1994.921) (-1992.702) * (-1989.953) (-2003.228) [-1989.879] (-2006.253) -- 0:00:45
      860400 -- (-1989.496) (-1994.161) [-1988.843] (-1997.453) * [-1989.113] (-1996.467) (-1987.519) (-1992.882) -- 0:00:45
      860500 -- (-2009.535) (-1998.182) [-1994.540] (-1996.173) * (-1992.414) (-1991.100) [-1983.382] (-2008.557) -- 0:00:45
      860600 -- (-1998.267) [-1999.911] (-1987.653) (-2001.055) * (-1995.551) [-1989.653] (-1994.240) (-1989.633) -- 0:00:45
      860700 -- (-1990.965) (-2001.130) [-1981.968] (-1984.743) * (-1993.209) (-1992.372) (-1984.425) [-1989.196] -- 0:00:45
      860800 -- [-1991.689] (-1995.133) (-1991.102) (-1989.474) * (-1986.920) (-1992.715) (-1987.572) [-1985.289] -- 0:00:45
      860900 -- [-1984.326] (-1996.563) (-1996.272) (-1987.030) * [-1986.523] (-1997.210) (-1988.889) (-1986.082) -- 0:00:45
      861000 -- [-1988.741] (-1997.057) (-1988.747) (-1989.337) * [-1981.380] (-1999.663) (-1987.822) (-1985.825) -- 0:00:45

      Average standard deviation of split frequencies: 0.002455

      861100 -- (-1995.444) (-1994.511) [-1985.351] (-1990.876) * [-1982.850] (-1997.217) (-1985.467) (-1989.195) -- 0:00:45
      861200 -- (-2000.074) [-1997.098] (-1990.589) (-1994.030) * [-1980.029] (-1996.680) (-1981.287) (-1993.541) -- 0:00:45
      861300 -- (-2003.514) (-2000.235) [-1983.266] (-1990.178) * [-1978.687] (-1993.261) (-1986.809) (-1984.868) -- 0:00:45
      861400 -- (-1998.770) (-1994.487) [-1982.586] (-1994.276) * [-1979.583] (-1997.137) (-1987.178) (-1983.569) -- 0:00:45
      861500 -- (-2006.801) (-1999.234) [-1981.198] (-1996.650) * (-1985.094) (-1996.593) (-1987.160) [-1986.515] -- 0:00:45
      861600 -- (-2010.535) (-1990.276) [-1985.513] (-1998.551) * (-1979.543) (-2006.635) (-1983.083) [-1986.915] -- 0:00:45
      861700 -- (-2005.032) (-1992.360) [-1985.817] (-1992.709) * (-1985.000) (-2009.918) [-1988.212] (-1987.091) -- 0:00:45
      861800 -- (-1996.805) (-1992.099) [-1983.625] (-1997.524) * [-1988.263] (-2005.938) (-1985.039) (-1994.992) -- 0:00:45
      861900 -- (-1998.654) (-1987.750) [-1988.268] (-1989.663) * (-1991.406) (-1997.330) [-1981.272] (-1989.328) -- 0:00:45
      862000 -- (-2001.160) (-1987.715) [-1981.720] (-1994.115) * (-1993.572) (-1994.740) [-1979.780] (-1988.799) -- 0:00:45

      Average standard deviation of split frequencies: 0.002609

      862100 -- (-2004.090) (-1991.021) [-1979.552] (-1988.075) * (-1991.866) (-1993.401) [-1981.613] (-1987.724) -- 0:00:45
      862200 -- (-2004.278) (-1989.134) [-1981.642] (-1995.995) * (-1995.710) (-1995.965) (-1983.921) [-1984.116] -- 0:00:45
      862300 -- (-2004.607) (-1987.132) [-1985.313] (-1999.686) * (-1994.387) (-2000.896) (-1979.363) [-1981.131] -- 0:00:45
      862400 -- (-1999.947) (-1983.712) [-1982.718] (-1997.673) * (-1991.160) (-2002.488) [-1981.320] (-1980.617) -- 0:00:44
      862500 -- (-2001.850) [-1991.970] (-1982.867) (-1993.713) * (-1979.919) (-1997.944) [-1984.333] (-1988.274) -- 0:00:44
      862600 -- [-1990.730] (-1986.794) (-1982.433) (-1990.349) * (-1980.532) (-1999.535) [-1985.617] (-1994.068) -- 0:00:44
      862700 -- (-1993.453) [-1989.490] (-1990.602) (-1990.104) * [-1979.608] (-2002.915) (-1987.926) (-1999.726) -- 0:00:44
      862800 -- (-1995.499) [-1989.346] (-2001.263) (-1989.736) * (-1978.376) (-1996.069) [-1983.291] (-2000.253) -- 0:00:44
      862900 -- (-1998.202) (-1990.966) (-2010.712) [-1987.330] * [-1982.586] (-1996.035) (-1985.562) (-1997.557) -- 0:00:44
      863000 -- (-1999.461) [-1993.481] (-1992.914) (-1993.261) * [-1981.485] (-1990.534) (-1986.981) (-1995.694) -- 0:00:44

      Average standard deviation of split frequencies: 0.002731

      863100 -- (-1995.753) (-1990.180) [-1992.821] (-1986.079) * [-1980.868] (-1999.386) (-1983.801) (-1993.801) -- 0:00:44
      863200 -- (-1991.555) [-1985.264] (-1990.052) (-1987.637) * [-1980.113] (-1994.327) (-1989.884) (-1995.160) -- 0:00:44
      863300 -- (-1995.645) [-1987.213] (-1992.231) (-1986.814) * (-1983.145) [-1993.849] (-1992.541) (-1995.469) -- 0:00:44
      863400 -- (-2001.563) [-1988.880] (-1987.755) (-1983.541) * (-1982.709) (-1991.505) [-1988.040] (-1990.819) -- 0:00:44
      863500 -- (-1997.667) (-1990.275) (-1993.524) [-1988.237] * (-1981.700) (-2003.303) (-1992.577) [-1984.817] -- 0:00:44
      863600 -- (-1996.901) (-1993.717) (-1999.746) [-1986.602] * [-1980.836] (-2012.653) (-1987.874) (-1991.958) -- 0:00:44
      863700 -- (-1994.694) (-1987.809) (-1994.356) [-1992.014] * (-1981.764) (-1991.579) [-1984.380] (-1993.000) -- 0:00:44
      863800 -- (-2002.018) (-1994.406) (-1994.282) [-1991.579] * [-1983.744] (-1993.333) (-1988.671) (-1991.288) -- 0:00:44
      863900 -- (-1999.482) (-1995.876) (-1997.231) [-1989.767] * [-1989.455] (-1993.657) (-1995.939) (-1986.360) -- 0:00:44
      864000 -- (-2008.465) (-1998.924) (-2001.860) [-1995.129] * [-1987.573] (-1992.481) (-2001.868) (-1989.927) -- 0:00:44

      Average standard deviation of split frequencies: 0.002728

      864100 -- (-2005.776) [-1991.558] (-1997.051) (-1992.928) * (-1988.237) (-1986.501) (-2000.973) [-1980.737] -- 0:00:44
      864200 -- (-1992.087) [-1990.397] (-1989.417) (-1999.131) * (-1997.190) (-1986.606) (-1999.061) [-1983.814] -- 0:00:44
      864300 -- (-1997.256) (-1997.653) [-1991.309] (-1992.650) * (-1998.494) [-1987.239] (-1996.054) (-1985.086) -- 0:00:44
      864400 -- (-1995.913) (-1995.161) [-1987.947] (-1992.589) * (-1985.887) (-1990.818) (-1995.913) [-1979.815] -- 0:00:44
      864500 -- (-2000.749) (-1987.692) (-1990.358) [-1987.285] * (-1993.564) (-2000.051) (-1994.776) [-1980.985] -- 0:00:44
      864600 -- (-1998.406) (-1993.370) (-1990.075) [-1989.825] * (-1991.343) (-1994.754) (-1991.651) [-1982.560] -- 0:00:44
      864700 -- (-2009.399) (-1995.961) [-1994.621] (-1990.012) * (-1995.700) (-1990.409) (-1994.210) [-1978.969] -- 0:00:44
      864800 -- (-1999.136) [-1989.406] (-1988.128) (-1990.204) * (-1990.808) (-1989.564) (-1997.343) [-1980.452] -- 0:00:44
      864900 -- (-1998.138) (-1992.788) [-1992.267] (-1997.636) * (-1992.719) (-1987.086) (-2006.699) [-1984.898] -- 0:00:44
      865000 -- (-2000.756) (-1990.267) [-1981.975] (-1991.119) * [-1987.038] (-1993.629) (-2008.862) (-1986.057) -- 0:00:44

      Average standard deviation of split frequencies: 0.002724

      865100 -- (-2002.646) (-1988.908) (-1987.048) [-1981.217] * [-1990.522] (-1991.880) (-2003.505) (-1991.159) -- 0:00:44
      865200 -- (-2021.386) [-1987.083] (-1998.908) (-1986.663) * [-1988.147] (-1989.231) (-2000.449) (-1988.227) -- 0:00:44
      865300 -- (-1998.822) (-1990.985) (-1993.072) [-1983.515] * (-1991.408) [-1985.106] (-1995.694) (-1989.010) -- 0:00:44
      865400 -- (-1992.337) (-1989.024) (-1994.092) [-1983.523] * [-1994.746] (-1989.204) (-1995.664) (-1987.826) -- 0:00:44
      865500 -- [-1987.686] (-1988.759) (-1999.577) (-1985.636) * (-1998.100) (-1988.914) (-1997.423) [-1988.191] -- 0:00:43
      865600 -- (-1989.747) [-1986.888] (-1992.108) (-1983.380) * (-2003.959) (-1992.062) (-1996.566) [-1986.772] -- 0:00:43
      865700 -- (-1989.152) (-1987.445) (-1989.816) [-1979.515] * (-1999.927) (-1985.957) (-2000.105) [-1978.759] -- 0:00:43
      865800 -- (-2002.527) (-1994.940) [-1981.501] (-1983.382) * (-2008.029) [-1984.845] (-1996.982) (-1977.929) -- 0:00:43
      865900 -- (-1993.212) (-1988.634) (-1986.250) [-1982.791] * (-2002.906) (-1987.051) (-2001.236) [-1981.366] -- 0:00:43
      866000 -- (-1989.929) (-1988.365) [-1984.362] (-1986.825) * (-1998.861) (-1990.771) (-2015.958) [-1984.028] -- 0:00:43

      Average standard deviation of split frequencies: 0.002752

      866100 -- (-1990.234) [-1990.409] (-1988.027) (-1984.685) * (-1997.658) (-1987.169) (-1994.328) [-1989.605] -- 0:00:43
      866200 -- (-1986.043) (-1989.629) [-1981.094] (-1984.767) * (-2004.569) (-1985.634) (-1989.784) [-1986.263] -- 0:00:43
      866300 -- (-1989.218) (-1991.257) (-1979.514) [-1987.321] * (-1999.553) (-1988.283) (-1993.390) [-1987.866] -- 0:00:43
      866400 -- (-1989.719) (-1990.618) [-1979.885] (-1987.951) * (-2002.930) [-1986.630] (-1994.394) (-1990.728) -- 0:00:43
      866500 -- [-1988.085] (-1995.109) (-1983.359) (-1984.729) * (-1992.954) [-1988.523] (-1997.412) (-1988.729) -- 0:00:43
      866600 -- [-1989.935] (-1986.724) (-1985.785) (-1991.963) * (-1994.432) [-1991.117] (-1999.368) (-1998.623) -- 0:00:43
      866700 -- (-1989.585) (-1989.890) [-1985.214] (-1988.156) * (-1995.752) [-1990.756] (-2009.842) (-1984.396) -- 0:00:43
      866800 -- (-1991.782) (-1990.834) [-1984.204] (-1988.288) * (-1992.225) (-1991.137) (-1997.199) [-1984.689] -- 0:00:43
      866900 -- (-1993.522) (-1997.423) [-1981.019] (-1992.232) * (-1994.749) (-1997.374) (-2004.441) [-1983.531] -- 0:00:43
      867000 -- (-1988.182) (-2003.195) [-1983.438] (-1987.808) * (-1991.220) (-1994.039) (-2003.893) [-1987.154] -- 0:00:43

      Average standard deviation of split frequencies: 0.002671

      867100 -- [-1986.929] (-2016.091) (-1987.136) (-1985.163) * (-1991.918) (-1995.437) (-1990.758) [-1988.279] -- 0:00:43
      867200 -- (-1988.209) (-2011.964) (-1986.387) [-1980.544] * [-1990.652] (-1994.553) (-1993.508) (-1991.054) -- 0:00:43
      867300 -- (-1986.559) (-2014.343) [-1979.654] (-1983.610) * [-1990.922] (-1991.228) (-1998.385) (-1992.661) -- 0:00:43
      867400 -- (-1988.078) (-1992.649) [-1980.997] (-1983.609) * (-1989.355) [-1988.722] (-2001.420) (-1987.047) -- 0:00:43
      867500 -- (-1997.637) (-1991.136) (-1982.789) [-1985.850] * [-1986.609] (-1993.604) (-1993.556) (-1984.879) -- 0:00:43
      867600 -- (-1992.449) (-1988.741) [-1988.016] (-1988.053) * (-1990.149) (-1994.557) (-1994.632) [-1989.622] -- 0:00:43
      867700 -- (-1995.960) (-1991.884) (-1993.237) [-1995.771] * (-1987.814) (-1991.742) (-1996.813) [-1987.442] -- 0:00:43
      867800 -- (-1994.140) (-1998.125) (-1989.970) [-1991.723] * (-1992.004) (-1992.860) (-2005.268) [-1989.384] -- 0:00:43
      867900 -- (-1997.753) (-1996.798) [-1985.802] (-1987.946) * (-1992.255) [-1993.198] (-1997.508) (-1988.709) -- 0:00:43
      868000 -- (-2000.994) (-2003.817) (-1983.525) [-1981.964] * (-1998.962) (-2001.012) [-1991.458] (-1985.009) -- 0:00:43

      Average standard deviation of split frequencies: 0.002606

      868100 -- (-1991.472) (-2000.274) (-1980.700) [-1980.059] * (-1990.850) [-1984.924] (-1990.762) (-1988.409) -- 0:00:43
      868200 -- (-1994.576) (-1999.944) (-1986.779) [-1987.965] * (-1994.752) (-1986.377) (-1996.691) [-1988.478] -- 0:00:43
      868300 -- (-1991.550) (-1995.062) [-1985.186] (-1982.103) * (-1991.766) (-1986.689) (-2002.967) [-1983.747] -- 0:00:43
      868400 -- (-1987.922) (-1999.042) (-1985.086) [-1982.164] * (-1997.377) (-1986.552) (-2009.531) [-1986.490] -- 0:00:43
      868500 -- (-1994.291) (-1995.456) (-1984.925) [-1981.372] * (-1994.626) (-1989.690) (-2003.140) [-1986.260] -- 0:00:43
      868600 -- [-1993.340] (-1998.673) (-1985.175) (-1985.069) * (-1993.151) (-1997.928) (-2007.890) [-1986.129] -- 0:00:42
      868700 -- (-2006.339) (-1994.859) (-1984.950) [-1984.298] * (-1996.411) (-1997.670) (-1997.657) [-1988.320] -- 0:00:42
      868800 -- (-1995.676) (-1994.506) (-1979.451) [-1982.283] * (-1994.342) (-1997.835) (-1998.123) [-1990.210] -- 0:00:42
      868900 -- (-1999.106) (-1992.124) [-1981.480] (-1981.698) * (-1990.969) (-1995.442) (-1996.546) [-1983.883] -- 0:00:42
      869000 -- (-1992.899) (-2002.120) [-1984.066] (-1987.996) * (-1994.863) (-1996.216) (-1992.171) [-1977.991] -- 0:00:42

      Average standard deviation of split frequencies: 0.002526

      869100 -- (-1994.348) (-1999.668) [-1981.986] (-1986.012) * [-1991.585] (-1992.292) (-1988.355) (-1978.878) -- 0:00:42
      869200 -- (-1993.565) (-2001.659) [-1985.250] (-1993.526) * (-1997.481) [-1986.062] (-1994.715) (-1980.101) -- 0:00:42
      869300 -- (-1994.471) (-2001.791) [-1983.283] (-1994.470) * (-1988.251) [-1987.699] (-2001.320) (-1983.871) -- 0:00:42
      869400 -- (-1986.119) (-2004.904) (-1988.576) [-1985.716] * (-1995.246) (-1987.261) (-1998.555) [-1982.461] -- 0:00:42
      869500 -- (-1991.120) (-1997.735) [-1989.693] (-1984.561) * (-1994.694) (-1987.909) (-1998.212) [-1986.670] -- 0:00:42
      869600 -- [-1987.563] (-2007.592) (-1991.874) (-1988.571) * (-1989.107) (-1986.710) (-2002.295) [-1982.776] -- 0:00:42
      869700 -- (-1989.647) (-2004.379) (-1989.911) [-1982.896] * (-1993.356) (-1994.756) (-1993.836) [-1983.479] -- 0:00:42
      869800 -- (-1991.729) (-1990.512) [-1981.642] (-1982.618) * (-1990.781) (-1996.631) (-1994.653) [-1981.972] -- 0:00:42
      869900 -- (-1992.652) (-1992.438) [-1981.669] (-1981.503) * (-1987.759) (-2003.788) (-1990.695) [-1979.520] -- 0:00:42
      870000 -- (-1996.350) (-1986.902) [-1978.463] (-1983.278) * (-1990.966) (-1999.680) (-1997.387) [-1985.592] -- 0:00:42

      Average standard deviation of split frequencies: 0.002492

      870100 -- (-1994.100) (-1990.398) (-1979.803) [-1984.121] * [-1985.648] (-1995.097) (-1998.489) (-1980.131) -- 0:00:42
      870200 -- (-2011.584) (-1984.245) [-1977.955] (-1982.060) * [-1988.982] (-2009.180) (-1999.136) (-1990.106) -- 0:00:42
      870300 -- (-2018.120) (-1980.689) (-1983.597) [-1982.838] * (-1993.821) (-2004.169) (-1997.776) [-1989.108] -- 0:00:42
      870400 -- (-2002.362) (-1982.896) (-1988.869) [-1983.378] * (-1990.020) (-2011.332) [-1990.969] (-1995.341) -- 0:00:42
      870500 -- (-1998.938) (-1985.393) [-1990.679] (-1986.703) * [-1985.630] (-1993.610) (-1999.043) (-1988.882) -- 0:00:42
      870600 -- (-2002.469) (-1989.868) [-1983.208] (-1979.013) * [-1987.573] (-1998.131) (-1991.964) (-1986.332) -- 0:00:42
      870700 -- (-2001.662) (-1991.426) [-1983.361] (-1981.865) * [-1987.027] (-2000.257) (-1992.253) (-1992.100) -- 0:00:42
      870800 -- (-1994.669) (-1985.682) (-1986.276) [-1981.815] * [-1988.672] (-2001.052) (-1992.946) (-1985.308) -- 0:00:42
      870900 -- (-1992.880) [-1988.425] (-1985.835) (-1984.082) * (-1993.055) (-1998.167) (-1995.210) [-1983.993] -- 0:00:42
      871000 -- (-1998.062) [-1986.970] (-1993.280) (-1988.571) * (-1993.396) (-1993.795) [-1985.509] (-1987.283) -- 0:00:42

      Average standard deviation of split frequencies: 0.002535

      871100 -- (-1998.498) [-1986.908] (-1990.743) (-1990.405) * (-1993.783) (-1989.660) (-1990.037) [-1982.194] -- 0:00:42
      871200 -- (-1993.709) [-1981.986] (-1990.287) (-1985.617) * (-1989.275) (-1990.941) [-1983.915] (-1982.985) -- 0:00:42
      871300 -- (-1988.110) (-1987.127) (-1994.223) [-1987.006] * (-1987.702) (-1988.161) (-1993.768) [-1984.957] -- 0:00:42
      871400 -- (-1989.840) [-1984.986] (-1993.584) (-1990.079) * (-1995.284) (-1989.041) (-1986.915) [-1984.278] -- 0:00:42
      871500 -- (-1992.529) [-1985.612] (-1990.464) (-1984.888) * (-1987.174) (-1995.665) (-1993.970) [-1982.822] -- 0:00:42
      871600 -- (-1996.766) (-1992.414) (-1994.229) [-1986.430] * (-1987.201) [-1992.928] (-1997.587) (-1983.303) -- 0:00:41
      871700 -- [-1985.521] (-1989.268) (-1992.978) (-1985.874) * (-1992.371) [-1990.612] (-1993.091) (-1982.923) -- 0:00:41
      871800 -- (-1988.874) (-1992.319) [-1986.623] (-1994.937) * (-1994.037) (-1988.993) (-1993.211) [-1982.116] -- 0:00:41
      871900 -- (-1996.986) (-1989.531) [-1988.097] (-1995.001) * (-1991.436) (-1996.589) (-2000.773) [-1982.700] -- 0:00:41
      872000 -- (-2002.353) (-1996.665) (-1987.538) [-1985.024] * (-1986.987) [-1993.777] (-2003.773) (-1989.161) -- 0:00:41

      Average standard deviation of split frequencies: 0.002548

      872100 -- (-2000.221) (-1993.291) (-1984.866) [-1988.091] * (-1988.976) (-1994.947) (-1993.194) [-1985.546] -- 0:00:41
      872200 -- (-2006.881) (-1993.031) (-1982.867) [-1987.940] * [-1989.812] (-1992.484) (-1989.442) (-1985.438) -- 0:00:41
      872300 -- (-1989.910) (-1988.377) [-1983.118] (-1993.479) * (-1997.319) (-1992.359) (-1997.360) [-1984.683] -- 0:00:41
      872400 -- (-2004.419) (-1995.066) [-1983.619] (-1996.126) * (-1999.834) (-1994.632) (-2011.454) [-1982.625] -- 0:00:41
      872500 -- (-2009.629) (-1983.062) [-1978.583] (-1994.218) * (-1997.280) [-1995.401] (-2001.240) (-1989.957) -- 0:00:41
      872600 -- (-2008.856) (-1982.482) [-1983.294] (-1989.595) * [-1993.767] (-1993.578) (-1998.513) (-1993.172) -- 0:00:41
      872700 -- (-1999.925) (-1980.109) [-1981.948] (-1995.269) * [-1985.307] (-1993.438) (-1998.829) (-1995.408) -- 0:00:41
      872800 -- (-1999.423) [-1986.378] (-1981.133) (-1991.118) * [-1984.638] (-1989.986) (-1996.733) (-1991.761) -- 0:00:41
      872900 -- (-1995.993) [-1983.562] (-1987.804) (-1982.691) * (-1987.727) (-1991.985) [-1997.254] (-1994.784) -- 0:00:41
      873000 -- (-2003.419) [-1980.837] (-1985.137) (-1981.932) * (-1995.006) [-1992.335] (-1991.942) (-1997.214) -- 0:00:41

      Average standard deviation of split frequencies: 0.002576

      873100 -- (-2008.205) (-1987.751) (-1986.511) [-1982.071] * [-1991.570] (-1996.831) (-1992.690) (-1999.698) -- 0:00:41
      873200 -- (-2001.999) (-1987.857) [-1981.390] (-1986.023) * (-1996.542) [-1996.796] (-1988.324) (-1993.775) -- 0:00:41
      873300 -- (-1999.290) (-1992.877) [-1983.566] (-1982.403) * (-2000.382) (-1993.092) [-1992.606] (-1993.429) -- 0:00:41
      873400 -- (-2006.304) (-1993.530) [-1982.343] (-1983.021) * (-2004.678) [-1990.639] (-1996.932) (-1988.331) -- 0:00:41
      873500 -- (-2003.688) (-1992.177) [-1985.010] (-1980.487) * (-2005.221) (-1993.484) (-1999.217) [-1984.013] -- 0:00:41
      873600 -- (-1994.518) [-1984.584] (-1987.920) (-1984.680) * [-2000.646] (-1992.211) (-2002.311) (-1983.080) -- 0:00:41
      873700 -- (-2000.364) [-1982.643] (-1989.447) (-1988.086) * (-2000.514) (-1989.337) (-1994.327) [-1983.389] -- 0:00:41
      873800 -- (-2000.065) [-1981.664] (-2001.273) (-1984.027) * (-2001.333) (-1993.411) (-1989.206) [-1985.177] -- 0:00:41
      873900 -- [-1992.612] (-1984.710) (-1994.978) (-1989.614) * (-1992.031) [-1994.060] (-1993.152) (-1987.788) -- 0:00:41
      874000 -- (-1999.714) [-1980.400] (-1990.975) (-1984.861) * (-1995.293) (-1994.153) (-1990.938) [-1988.396] -- 0:00:41

      Average standard deviation of split frequencies: 0.002496

      874100 -- (-1998.000) [-1981.102] (-1989.048) (-1990.629) * (-2015.021) (-1988.183) (-1996.682) [-1989.345] -- 0:00:41
      874200 -- (-1990.481) (-1984.574) (-1986.369) [-1984.788] * (-1999.401) (-1987.854) [-1992.288] (-2001.975) -- 0:00:41
      874300 -- (-1992.419) (-1995.561) [-1986.240] (-1983.043) * (-2002.229) [-1987.981] (-1992.391) (-2003.468) -- 0:00:41
      874400 -- (-1991.918) (-1991.760) [-1986.228] (-1979.695) * (-2002.876) [-1991.480] (-1989.249) (-2009.694) -- 0:00:41
      874500 -- (-2005.561) (-1995.124) [-1992.647] (-1989.604) * (-1993.680) [-1992.274] (-1998.762) (-2003.927) -- 0:00:41
      874600 -- (-1998.528) (-1993.098) [-1987.887] (-1986.697) * [-1987.605] (-1995.460) (-2002.528) (-1992.961) -- 0:00:41
      874700 -- (-1997.291) [-1985.893] (-1993.192) (-1986.719) * [-1990.080] (-1999.186) (-1999.142) (-1997.032) -- 0:00:40
      874800 -- (-2002.571) (-1988.450) (-1990.923) [-1989.161] * (-1992.388) [-1993.171] (-1998.680) (-1990.844) -- 0:00:40
      874900 -- (-2001.095) (-1989.548) (-1991.490) [-1980.197] * (-1998.681) [-1987.767] (-2001.947) (-1989.629) -- 0:00:40
      875000 -- (-1994.477) (-1983.418) (-1996.020) [-1980.839] * [-2001.685] (-1995.487) (-2001.850) (-1993.975) -- 0:00:40

      Average standard deviation of split frequencies: 0.002447

      875100 -- (-1992.825) [-1984.293] (-1991.047) (-1982.973) * (-2000.759) [-1993.645] (-2005.884) (-1995.339) -- 0:00:40
      875200 -- (-1987.343) [-1981.517] (-1985.997) (-1981.993) * [-1996.129] (-1992.419) (-2003.887) (-1991.880) -- 0:00:40
      875300 -- (-1985.890) (-1994.132) [-1990.835] (-1983.362) * (-2004.221) [-1984.889] (-2013.497) (-2003.974) -- 0:00:40
      875400 -- (-1986.554) (-1995.416) [-1986.174] (-1983.097) * (-2005.172) [-1990.639] (-2007.778) (-1991.957) -- 0:00:40
      875500 -- (-1985.382) (-1995.113) [-1983.049] (-1990.994) * (-1999.043) [-1990.093] (-1994.984) (-1993.854) -- 0:00:40
      875600 -- (-1989.090) (-1997.928) [-1984.412] (-1997.154) * (-2005.274) [-1990.903] (-1996.093) (-1992.350) -- 0:00:40
      875700 -- (-1987.967) (-1991.295) (-1989.060) [-1988.363] * (-1992.882) (-1989.988) (-1994.176) [-1989.097] -- 0:00:40
      875800 -- [-1990.533] (-1990.367) (-1989.494) (-1988.982) * (-1998.494) [-1988.501] (-1997.214) (-1989.176) -- 0:00:40
      875900 -- (-1988.882) (-1993.503) [-1986.394] (-1993.785) * (-1994.649) (-1992.371) (-1996.487) [-1991.707] -- 0:00:40
      876000 -- (-1988.012) [-1990.309] (-1987.041) (-2002.077) * (-1991.735) [-1987.957] (-1997.469) (-1995.339) -- 0:00:40

      Average standard deviation of split frequencies: 0.002383

      876100 -- (-1989.840) (-1986.571) [-1988.678] (-2002.598) * (-1989.083) [-1986.363] (-1991.007) (-1991.484) -- 0:00:40
      876200 -- (-1992.875) (-1990.463) [-1984.515] (-1995.336) * (-1995.552) [-1985.903] (-1991.933) (-1999.559) -- 0:00:40
      876300 -- (-1997.289) (-1991.880) (-1984.812) [-1988.380] * (-1990.039) [-1984.639] (-1995.295) (-2005.203) -- 0:00:40
      876400 -- (-1997.421) (-1995.172) (-1991.136) [-1991.340] * (-1997.511) [-1982.253] (-1998.872) (-2001.850) -- 0:00:40
      876500 -- (-2002.601) (-1992.234) [-1994.049] (-1983.123) * (-1992.762) [-1985.396] (-2000.103) (-2005.427) -- 0:00:40
      876600 -- (-2007.278) (-1993.826) (-1990.576) [-1982.906] * (-1995.071) [-1986.968] (-1994.514) (-1993.950) -- 0:00:40
      876700 -- (-1996.636) (-1998.976) (-1994.264) [-1980.578] * (-1993.927) [-1987.697] (-1989.579) (-2001.249) -- 0:00:40
      876800 -- (-1996.256) (-2003.556) (-1997.063) [-1984.096] * (-1995.633) [-1988.619] (-1991.843) (-2004.027) -- 0:00:40
      876900 -- (-2001.240) (-2002.025) (-1992.801) [-1983.457] * (-1991.499) [-1984.194] (-1994.482) (-1990.944) -- 0:00:40
      877000 -- (-2001.469) (-2004.623) (-1993.946) [-1980.599] * (-1993.425) [-1984.042] (-2005.335) (-1987.963) -- 0:00:40

      Average standard deviation of split frequencies: 0.002426

      877100 -- (-2002.133) (-2000.492) (-1994.478) [-1980.314] * (-1991.206) [-1986.649] (-1992.758) (-1995.769) -- 0:00:40
      877200 -- (-1998.217) (-1994.563) (-1998.847) [-1981.906] * (-1992.818) (-1995.405) (-1993.804) [-1992.781] -- 0:00:40
      877300 -- (-1997.227) [-1986.457] (-1999.058) (-1985.665) * (-1995.404) [-1988.253] (-2003.810) (-1991.510) -- 0:00:40
      877400 -- (-1989.392) (-1989.013) (-1994.353) [-1981.280] * (-1995.332) [-1987.887] (-1993.543) (-1989.270) -- 0:00:40
      877500 -- (-1988.354) (-1983.790) (-2001.919) [-1980.841] * (-1994.920) (-1991.598) (-1996.034) [-1983.619] -- 0:00:40
      877600 -- (-1997.296) (-1983.636) (-2003.098) [-1984.498] * (-1991.796) (-1994.371) (-1986.486) [-1984.089] -- 0:00:40
      877700 -- (-1991.325) (-1987.598) (-1996.744) [-1982.648] * (-1994.019) (-1994.336) [-1982.732] (-1991.928) -- 0:00:39
      877800 -- (-1994.073) (-1990.602) (-1987.497) [-1985.865] * (-1991.454) (-1988.720) [-1989.263] (-2002.936) -- 0:00:39
      877900 -- (-2001.530) [-1982.873] (-1995.934) (-1989.343) * (-1994.887) [-1984.826] (-1986.785) (-1997.604) -- 0:00:39
      878000 -- (-1998.067) [-1982.603] (-1993.300) (-1986.431) * (-1989.281) (-1983.648) [-1987.649] (-1994.217) -- 0:00:39

      Average standard deviation of split frequencies: 0.002485

      878100 -- (-1995.459) [-1984.112] (-1993.588) (-1985.488) * (-1990.275) (-1989.839) [-1985.685] (-1996.737) -- 0:00:39
      878200 -- (-1995.030) (-1984.196) (-1989.925) [-1983.284] * (-1996.676) (-1989.457) [-1986.699] (-1996.194) -- 0:00:39
      878300 -- (-1998.663) (-1983.022) (-1994.453) [-1985.961] * [-1988.462] (-1990.496) (-1985.890) (-2010.275) -- 0:00:39
      878400 -- (-1995.209) (-1986.918) (-1990.214) [-1985.396] * [-1988.719] (-1990.196) (-1991.295) (-2003.043) -- 0:00:39
      878500 -- [-1991.389] (-1985.652) (-1995.417) (-1984.287) * (-1987.363) [-1986.076] (-1989.386) (-1999.525) -- 0:00:39
      878600 -- (-1997.660) (-1984.123) [-1988.635] (-1988.099) * (-1995.276) [-1983.898] (-1996.672) (-1991.589) -- 0:00:39
      878700 -- (-1994.153) (-1990.515) [-1984.476] (-1986.127) * [-1992.430] (-1988.948) (-1998.937) (-1989.914) -- 0:00:39
      878800 -- (-2000.974) (-1993.047) (-1991.006) [-1987.869] * (-1996.109) [-1989.940] (-1995.362) (-1993.631) -- 0:00:39
      878900 -- (-1994.231) [-1984.660] (-1994.599) (-1989.058) * (-1996.479) [-1991.237] (-1999.671) (-1989.982) -- 0:00:39
      879000 -- (-1991.264) (-1993.982) [-1987.794] (-2001.632) * (-1995.686) (-1989.327) (-1998.158) [-1989.183] -- 0:00:39

      Average standard deviation of split frequencies: 0.002558

      879100 -- (-1992.191) [-1983.628] (-1990.880) (-2007.810) * (-1996.540) [-1986.478] (-1995.055) (-1988.294) -- 0:00:39
      879200 -- [-1993.855] (-1990.673) (-1988.826) (-2002.309) * (-1993.638) (-1988.978) [-1988.409] (-1998.046) -- 0:00:39
      879300 -- (-1989.385) [-1988.510] (-1990.306) (-1992.281) * [-1987.782] (-1987.999) (-1993.485) (-1989.874) -- 0:00:39
      879400 -- (-2004.528) [-1987.741] (-1991.263) (-1995.093) * (-1991.377) (-1998.477) (-1991.345) [-1984.878] -- 0:00:39
      879500 -- (-2006.585) [-1983.546] (-1993.962) (-1983.444) * (-1985.196) (-1994.615) [-1990.680] (-1991.812) -- 0:00:39
      879600 -- (-2011.688) (-1984.176) [-1993.995] (-1988.560) * [-1986.127] (-1995.107) (-1994.034) (-1989.997) -- 0:00:39
      879700 -- (-2003.930) (-1986.960) (-1992.867) [-1984.571] * [-1986.410] (-1999.561) (-1990.978) (-1997.837) -- 0:00:39
      879800 -- (-1996.820) [-1985.467] (-1983.890) (-1980.563) * [-1988.890] (-1998.069) (-1989.128) (-1999.514) -- 0:00:39
      879900 -- (-2015.034) [-1984.632] (-1987.355) (-1985.794) * [-1988.565] (-1994.579) (-1998.078) (-1991.634) -- 0:00:39
      880000 -- (-2009.760) (-1993.188) (-1986.342) [-1984.062] * [-1988.443] (-2004.964) (-1994.486) (-1991.393) -- 0:00:39

      Average standard deviation of split frequencies: 0.002586

      880100 -- (-2001.596) (-1982.840) (-1990.124) [-1991.626] * [-1985.580] (-2000.946) (-2003.267) (-1985.042) -- 0:00:39
      880200 -- (-2001.662) (-1978.332) (-1995.945) [-1992.832] * (-1990.873) (-2002.110) (-2002.658) [-1986.170] -- 0:00:39
      880300 -- (-2007.483) [-1979.056] (-1998.836) (-1991.904) * (-1990.870) (-2003.266) (-2009.611) [-1983.106] -- 0:00:39
      880400 -- (-1993.225) [-1981.350] (-1988.196) (-1994.169) * (-1999.336) (-1993.566) (-2000.344) [-1983.768] -- 0:00:39
      880500 -- (-1990.743) [-1983.039] (-1990.559) (-1997.571) * (-1996.427) (-1999.713) (-1997.902) [-1984.588] -- 0:00:39
      880600 -- (-1990.866) [-1983.220] (-2000.650) (-1992.450) * (-1989.574) (-2003.827) (-2006.109) [-1987.511] -- 0:00:39
      880700 -- (-1988.003) [-1985.391] (-2008.065) (-1990.629) * (-1990.713) (-1999.962) (-2002.679) [-1985.632] -- 0:00:39
      880800 -- (-1991.627) [-1987.519] (-2004.038) (-1991.305) * (-1988.429) (-1992.492) (-2002.467) [-1986.663] -- 0:00:38
      880900 -- (-1995.502) (-1983.994) (-2000.789) [-1986.162] * [-1988.585] (-1996.521) (-2007.557) (-1988.237) -- 0:00:38
      881000 -- [-1983.993] (-1979.826) (-2004.550) (-1992.200) * (-1991.735) (-1995.773) (-2002.267) [-1983.369] -- 0:00:38

      Average standard deviation of split frequencies: 0.002553

      881100 -- [-1990.789] (-1983.794) (-1997.808) (-1993.082) * (-1989.719) (-1999.329) (-1999.201) [-1984.102] -- 0:00:38
      881200 -- (-1993.968) [-1978.764] (-1993.734) (-1996.514) * [-1991.882] (-1998.964) (-1993.677) (-1986.421) -- 0:00:38
      881300 -- (-2001.229) [-1981.171] (-1997.723) (-1991.702) * [-1987.558] (-1996.047) (-1998.460) (-1987.365) -- 0:00:38
      881400 -- (-2000.163) [-1986.202] (-1998.311) (-1995.230) * (-1986.346) (-1991.068) [-1985.078] (-1987.136) -- 0:00:38
      881500 -- (-1998.317) [-1987.371] (-2000.348) (-1988.863) * [-1985.583] (-1986.969) (-1986.378) (-2005.383) -- 0:00:38
      881600 -- (-1994.015) [-1987.084] (-1996.466) (-1995.286) * (-1992.190) [-1991.535] (-1987.391) (-2001.990) -- 0:00:38
      881700 -- (-1998.175) [-1980.693] (-2002.544) (-1987.422) * [-1985.779] (-1989.322) (-1991.757) (-1990.064) -- 0:00:38
      881800 -- (-1992.878) [-1986.216] (-2018.179) (-1986.857) * [-1985.454] (-1988.015) (-1991.026) (-1988.185) -- 0:00:38
      881900 -- (-1992.826) (-1982.390) (-2018.647) [-1988.026] * (-1989.313) (-1993.172) (-2001.468) [-1990.407] -- 0:00:38
      882000 -- (-1992.072) [-1980.057] (-2004.047) (-1987.310) * (-1998.111) (-2000.093) (-2001.882) [-1990.252] -- 0:00:38

      Average standard deviation of split frequencies: 0.002473

      882100 -- (-1990.218) [-1979.996] (-2001.203) (-1995.625) * [-1991.363] (-2000.691) (-2002.936) (-1992.671) -- 0:00:38
      882200 -- (-1989.952) (-1989.176) (-2003.793) [-2001.176] * (-1983.220) (-2003.601) [-1988.390] (-1991.415) -- 0:00:38
      882300 -- (-1990.691) (-1996.733) (-1999.243) [-1990.145] * [-1986.475] (-2000.905) (-1997.299) (-1993.085) -- 0:00:38
      882400 -- (-2001.324) (-1995.114) (-1990.226) [-1995.093] * [-1989.453] (-1997.573) (-1998.219) (-1994.027) -- 0:00:38
      882500 -- [-1996.398] (-1990.586) (-1993.602) (-1986.326) * (-1989.702) [-1995.207] (-1995.019) (-1992.233) -- 0:00:38
      882600 -- (-2000.637) (-1986.654) [-1990.752] (-1983.973) * [-1987.177] (-1994.804) (-1994.744) (-1992.772) -- 0:00:38
      882700 -- (-1997.366) [-1979.832] (-1997.566) (-1985.289) * [-1988.301] (-1993.638) (-1994.748) (-1996.098) -- 0:00:38
      882800 -- (-2008.026) (-1979.395) (-2006.238) [-1987.824] * (-1990.464) [-1984.609] (-2004.911) (-1991.480) -- 0:00:38
      882900 -- (-1991.990) [-1981.687] (-1992.734) (-1990.429) * (-1991.205) (-1990.484) (-1997.152) [-1996.790] -- 0:00:38
      883000 -- (-1991.188) (-1983.325) (-1988.532) [-1985.522] * [-1991.977] (-1991.524) (-2005.511) (-1994.015) -- 0:00:38

      Average standard deviation of split frequencies: 0.002486

      883100 -- (-1991.486) (-1983.707) (-1996.555) [-1982.552] * (-1985.991) (-1994.952) (-2006.850) [-1999.133] -- 0:00:38
      883200 -- (-1997.576) (-1983.221) (-1999.845) [-1984.960] * [-1991.734] (-1995.820) (-2000.417) (-2004.567) -- 0:00:38
      883300 -- (-2003.915) [-1982.054] (-1996.604) (-1983.282) * (-1986.890) [-1992.639] (-1996.568) (-2004.094) -- 0:00:38
      883400 -- (-1999.492) (-1984.580) (-1998.386) [-1982.023] * (-1987.965) (-1995.611) [-2000.382] (-1998.029) -- 0:00:38
      883500 -- (-2003.509) (-1989.388) (-1995.171) [-1983.518] * [-1986.521] (-1989.451) (-1995.409) (-1991.026) -- 0:00:38
      883600 -- [-1993.368] (-1992.378) (-1995.765) (-1983.913) * [-1984.883] (-1993.607) (-1989.881) (-1997.197) -- 0:00:38
      883700 -- (-1995.274) (-1993.031) [-1987.460] (-1989.659) * (-1984.372) [-1986.939] (-1995.817) (-1998.366) -- 0:00:38
      883800 -- (-1990.891) (-1991.299) (-1985.491) [-1991.614] * [-1988.151] (-1989.108) (-1988.735) (-1992.339) -- 0:00:37
      883900 -- (-1989.750) [-1985.954] (-1991.504) (-1989.692) * (-1993.919) (-1992.027) [-1985.608] (-1993.623) -- 0:00:37
      884000 -- (-1997.033) (-1988.128) [-1988.739] (-1984.866) * (-1996.420) [-1985.152] (-1988.969) (-1993.680) -- 0:00:37

      Average standard deviation of split frequencies: 0.002392

      884100 -- (-1997.550) (-1984.849) [-1985.894] (-1984.729) * (-2004.537) (-1991.077) [-1982.586] (-1991.700) -- 0:00:38
      884200 -- (-1998.771) (-1991.063) [-1983.989] (-1989.234) * (-1997.625) (-1999.394) [-1985.007] (-1990.826) -- 0:00:37
      884300 -- (-1994.347) [-1989.069] (-1987.979) (-1996.423) * (-1993.987) (-1995.511) [-1986.132] (-1990.345) -- 0:00:37
      884400 -- (-2002.033) (-1988.222) [-1986.545] (-1985.762) * (-2000.194) (-1987.812) [-1986.241] (-1999.495) -- 0:00:37
      884500 -- (-1996.978) (-1992.434) [-1984.751] (-1994.603) * (-1996.603) [-1996.254] (-1985.436) (-2006.299) -- 0:00:37
      884600 -- (-2007.702) [-1986.230] (-1987.984) (-1984.626) * (-1993.998) (-1990.807) [-1985.206] (-2000.714) -- 0:00:37
      884700 -- (-1991.290) (-1987.542) (-1987.991) [-1986.352] * (-1991.068) (-1997.304) [-1988.484] (-2000.658) -- 0:00:37
      884800 -- (-1989.902) (-1996.698) [-1985.023] (-1994.549) * [-1992.342] (-1992.875) (-1985.941) (-1990.355) -- 0:00:37
      884900 -- (-1991.024) [-1991.788] (-1989.386) (-1988.376) * (-1988.650) (-1992.179) (-1985.919) [-1990.886] -- 0:00:37
      885000 -- (-1989.512) (-1995.095) (-1988.409) [-1986.008] * [-1980.425] (-1999.521) (-1985.612) (-2006.695) -- 0:00:37

      Average standard deviation of split frequencies: 0.002389

      885100 -- (-1991.869) [-1990.873] (-1992.555) (-1989.749) * (-1991.474) (-2002.458) [-1988.107] (-2005.103) -- 0:00:37
      885200 -- (-2000.350) (-1992.876) [-1990.650] (-1989.918) * (-1989.588) [-1992.841] (-1993.861) (-2002.253) -- 0:00:37
      885300 -- (-1995.171) (-1998.041) (-1989.948) [-1988.534] * (-1989.457) [-1995.123] (-1992.727) (-2003.684) -- 0:00:37
      885400 -- (-1992.782) (-1998.642) (-1992.044) [-1985.594] * [-1989.836] (-1990.613) (-1994.967) (-2000.545) -- 0:00:37
      885500 -- (-1993.371) (-1990.555) (-1993.515) [-1983.700] * (-1989.763) (-1995.596) [-1987.012] (-1999.687) -- 0:00:37
      885600 -- (-1998.637) (-1999.849) (-1989.105) [-1984.823] * (-1985.604) (-1992.159) [-1984.553] (-2002.918) -- 0:00:37
      885700 -- (-1993.158) (-1997.915) [-1990.371] (-1983.871) * (-1985.302) (-1989.262) [-1981.200] (-1999.974) -- 0:00:37
      885800 -- (-1995.133) (-2003.495) (-1989.529) [-1981.965] * (-1980.767) (-1990.721) [-1980.325] (-2009.351) -- 0:00:37
      885900 -- (-1994.388) (-1994.990) (-1994.057) [-1980.860] * [-1983.201] (-1990.410) (-1984.083) (-1996.449) -- 0:00:37
      886000 -- (-1991.370) (-1995.155) (-1991.672) [-1978.747] * (-1979.135) (-1990.698) [-1975.498] (-2000.258) -- 0:00:37

      Average standard deviation of split frequencies: 0.002447

      886100 -- [-1997.794] (-1996.823) (-2004.120) (-1979.797) * [-1979.175] (-1990.108) (-1979.945) (-2005.756) -- 0:00:37
      886200 -- (-2006.813) (-1996.594) (-1999.260) [-1981.574] * [-1978.452] (-1993.148) (-1983.388) (-1995.480) -- 0:00:37
      886300 -- (-1995.168) (-1991.618) (-1997.893) [-1988.450] * (-1980.557) [-1994.902] (-1985.487) (-1999.778) -- 0:00:37
      886400 -- (-1989.058) (-1988.135) (-1997.135) [-1983.822] * (-1980.006) (-1991.814) (-1987.355) [-1993.739] -- 0:00:37
      886500 -- [-1993.912] (-1985.757) (-1995.187) (-1987.068) * [-1980.784] (-1993.620) (-1996.881) (-1999.366) -- 0:00:37
      886600 -- (-1993.711) [-1985.598] (-2001.305) (-1982.416) * (-1978.223) (-1994.832) [-1989.318] (-2003.796) -- 0:00:37
      886700 -- (-1995.485) [-1984.260] (-2001.956) (-1987.243) * [-1980.200] (-1990.340) (-1987.665) (-1993.126) -- 0:00:37
      886800 -- (-1999.841) (-1981.033) (-1996.528) [-1984.077] * [-1981.449] (-1993.836) (-1985.496) (-1997.398) -- 0:00:37
      886900 -- [-1993.199] (-1987.597) (-1992.251) (-1991.511) * (-1986.285) (-1991.195) [-1986.087] (-1992.807) -- 0:00:36
      887000 -- (-1992.033) (-1984.576) (-1988.543) [-1984.326] * (-1989.926) (-1991.558) [-1989.115] (-1996.539) -- 0:00:36

      Average standard deviation of split frequencies: 0.002490

      887100 -- (-1991.073) (-1985.846) (-1988.373) [-1981.056] * (-1997.295) [-1994.172] (-1988.909) (-1998.192) -- 0:00:37
      887200 -- (-1993.030) [-1984.687] (-1992.836) (-1988.421) * (-1991.019) (-1990.807) [-1989.986] (-1998.933) -- 0:00:36
      887300 -- (-1991.553) [-1984.029] (-1994.648) (-1998.277) * [-1992.206] (-1993.743) (-1996.194) (-1999.774) -- 0:00:36
      887400 -- (-1990.556) [-1980.111] (-1991.079) (-1982.153) * [-1982.753] (-1999.917) (-1997.179) (-2003.278) -- 0:00:36
      887500 -- (-1992.404) [-1983.119] (-1992.070) (-1987.704) * [-1981.775] (-1995.062) (-1996.461) (-2003.112) -- 0:00:36
      887600 -- (-2001.378) [-1982.876] (-1992.129) (-1986.841) * [-1984.758] (-1996.864) (-2008.679) (-1997.087) -- 0:00:36
      887700 -- (-2003.315) [-1977.936] (-1990.064) (-1986.599) * (-1982.773) [-1990.922] (-2014.516) (-1996.418) -- 0:00:36
      887800 -- (-1990.995) [-1979.998] (-1994.927) (-1992.404) * [-1983.646] (-1996.510) (-2004.352) (-1995.029) -- 0:00:36
      887900 -- (-1998.171) [-1986.077] (-2002.571) (-1994.361) * [-1986.571] (-2000.044) (-1999.133) (-2000.154) -- 0:00:36
      888000 -- (-1993.936) (-1990.159) (-2004.470) [-1995.235] * [-1979.218] (-1990.271) (-1999.327) (-2003.666) -- 0:00:36

      Average standard deviation of split frequencies: 0.002533

      888100 -- (-1992.450) (-1984.364) [-1995.024] (-1995.783) * (-1983.939) [-1988.076] (-2004.252) (-1996.687) -- 0:00:36
      888200 -- (-1992.501) [-1989.467] (-1996.739) (-2001.360) * [-1984.637] (-1986.128) (-1998.791) (-2000.080) -- 0:00:36
      888300 -- (-1998.859) (-1998.800) [-1989.981] (-1996.569) * (-1986.787) [-1995.291] (-2007.431) (-1998.041) -- 0:00:36
      888400 -- (-1997.945) (-1992.391) [-1988.128] (-1999.861) * (-1985.467) (-1997.968) [-1990.953] (-1998.898) -- 0:00:36
      888500 -- (-1995.175) [-1983.503] (-1987.997) (-1993.802) * [-1981.221] (-1990.207) (-1990.933) (-2003.368) -- 0:00:36
      888600 -- (-2006.382) (-1989.384) [-1989.259] (-1991.345) * (-1982.407) [-1990.896] (-1988.064) (-2005.914) -- 0:00:36
      888700 -- (-1997.241) (-1993.494) (-1986.435) [-1993.754] * [-1985.077] (-1988.368) (-1988.998) (-1996.106) -- 0:00:36
      888800 -- (-2000.025) [-1989.618] (-1989.609) (-1993.794) * (-1994.934) (-1990.372) [-1989.621] (-1997.222) -- 0:00:36
      888900 -- (-1999.712) [-1986.121] (-1990.454) (-1987.840) * (-1988.077) (-1992.688) [-1994.809] (-1991.748) -- 0:00:36
      889000 -- (-1998.388) (-1986.552) (-1987.496) [-1985.705] * (-1989.498) (-1998.774) (-1994.376) [-1988.544] -- 0:00:36

      Average standard deviation of split frequencies: 0.002469

      889100 -- (-1992.897) (-1987.850) (-1992.026) [-1982.981] * (-1990.598) [-1991.179] (-1990.492) (-2002.961) -- 0:00:36
      889200 -- (-1998.706) [-1989.970] (-1993.913) (-1983.109) * (-1993.961) (-1995.558) [-1987.522] (-1999.686) -- 0:00:36
      889300 -- (-1993.806) [-1984.329] (-1982.950) (-1991.825) * (-1989.063) (-1996.707) [-1991.855] (-1993.067) -- 0:00:36
      889400 -- (-1994.785) (-1979.075) (-1984.853) [-1985.746] * (-1990.260) (-1993.764) [-1990.664] (-1991.929) -- 0:00:36
      889500 -- (-2001.205) [-1980.448] (-1986.583) (-1988.210) * (-2004.417) [-1990.540] (-1980.661) (-1995.121) -- 0:00:36
      889600 -- (-1994.299) [-1981.103] (-1986.131) (-1989.983) * (-2003.729) (-1989.685) [-1980.644] (-1998.615) -- 0:00:36
      889700 -- (-2004.894) [-1984.478] (-1997.219) (-1993.309) * (-1989.546) (-1998.831) [-1984.673] (-2005.014) -- 0:00:36
      889800 -- (-1995.437) [-1983.150] (-1988.962) (-1996.303) * [-1987.245] (-1992.053) (-1983.840) (-1993.676) -- 0:00:36
      889900 -- (-1996.755) (-1983.971) [-1993.095] (-1990.774) * (-1988.446) (-1999.197) [-1982.730] (-1996.523) -- 0:00:36
      890000 -- (-1993.951) (-1986.749) [-1990.229] (-1995.001) * (-1986.801) (-2010.484) [-1982.677] (-1994.067) -- 0:00:36

      Average standard deviation of split frequencies: 0.002466

      890100 -- (-1990.637) [-1981.279] (-1999.509) (-1999.730) * [-1989.656] (-2012.576) (-1989.170) (-1998.347) -- 0:00:36
      890200 -- (-1998.488) [-1986.460] (-1996.123) (-1997.330) * [-1982.873] (-1998.656) (-1995.669) (-1990.183) -- 0:00:36
      890300 -- (-1986.810) (-1995.709) [-1990.130] (-1985.437) * [-1984.207] (-1992.538) (-2002.512) (-1993.898) -- 0:00:35
      890400 -- (-1989.374) (-2006.567) (-1995.608) [-1984.103] * [-1979.688] (-1993.050) (-2004.198) (-2002.589) -- 0:00:35
      890500 -- (-1995.418) [-1986.948] (-1998.543) (-1985.113) * (-1984.964) (-1992.877) [-1991.044] (-2002.016) -- 0:00:35
      890600 -- (-1993.695) (-1988.793) (-2001.773) [-1982.084] * [-1985.336] (-1992.919) (-1990.878) (-1998.758) -- 0:00:35
      890700 -- (-1993.295) (-1980.993) (-2002.643) [-1981.343] * [-1980.205] (-1995.310) (-1997.590) (-1987.755) -- 0:00:35
      890800 -- (-1994.301) [-1982.175] (-1997.548) (-1986.323) * [-1982.448] (-1999.967) (-1991.398) (-1988.269) -- 0:00:35
      890900 -- (-1998.723) [-1987.118] (-2001.429) (-1993.813) * [-1986.728] (-1998.820) (-1993.130) (-1992.126) -- 0:00:35
      891000 -- (-2003.811) (-1992.834) (-1987.720) [-1984.740] * [-1995.114] (-1994.878) (-1995.536) (-1989.828) -- 0:00:35

      Average standard deviation of split frequencies: 0.002448

      891100 -- (-2008.448) (-1993.580) (-1989.378) [-1986.786] * [-1997.920] (-1998.069) (-2003.056) (-1989.731) -- 0:00:35
      891200 -- (-1998.616) (-1985.394) [-1987.908] (-1986.495) * (-1990.924) (-1995.221) (-1994.258) [-1985.738] -- 0:00:35
      891300 -- (-1999.317) (-1995.070) (-1989.564) [-1987.268] * (-1994.777) (-2001.151) [-1995.777] (-1984.664) -- 0:00:35
      891400 -- (-1989.206) [-1994.814] (-1988.705) (-1984.978) * (-1994.171) (-1991.450) (-1993.993) [-1989.834] -- 0:00:35
      891500 -- (-1995.050) [-1985.937] (-1989.406) (-1990.364) * (-1989.263) [-1986.204] (-2006.092) (-1994.608) -- 0:00:35
      891600 -- (-1995.732) (-1995.088) [-1992.677] (-1989.446) * (-1986.214) (-1990.816) (-1994.296) [-1991.176] -- 0:00:35
      891700 -- [-1991.045] (-1993.834) (-1996.900) (-1998.952) * (-1986.779) (-2001.602) (-1995.789) [-1992.980] -- 0:00:35
      891800 -- [-1992.105] (-1984.576) (-1996.569) (-1998.631) * [-1989.241] (-1997.062) (-1995.511) (-1994.360) -- 0:00:35
      891900 -- (-1992.564) [-1983.255] (-1987.398) (-1991.386) * (-1993.922) (-1995.611) [-1986.437] (-1992.799) -- 0:00:35
      892000 -- (-2003.248) [-1981.088] (-1995.773) (-1990.692) * (-1991.260) (-1983.767) [-1981.112] (-1998.690) -- 0:00:35

      Average standard deviation of split frequencies: 0.002370

      892100 -- (-1996.269) (-1983.749) (-1989.563) [-1992.712] * (-1993.671) (-1984.880) [-1981.232] (-2000.220) -- 0:00:35
      892200 -- (-1997.236) [-1984.266] (-1998.140) (-1991.361) * (-1992.423) (-1982.277) [-1980.784] (-1995.404) -- 0:00:35
      892300 -- (-2001.841) [-1986.885] (-2000.286) (-1992.081) * (-1987.968) (-1990.014) [-1984.656] (-1994.035) -- 0:00:35
      892400 -- (-2005.920) [-1989.452] (-2002.241) (-1999.321) * (-1988.804) (-1992.999) [-1984.626] (-1994.859) -- 0:00:35
      892500 -- (-2003.526) [-1984.608] (-1994.276) (-2002.624) * (-1987.167) [-1990.768] (-1996.163) (-1994.028) -- 0:00:35
      892600 -- (-1999.186) [-1982.358] (-1999.778) (-1999.985) * (-1993.311) (-1990.979) [-1982.182] (-1989.064) -- 0:00:35
      892700 -- (-1990.216) [-1982.399] (-1996.332) (-1990.444) * (-1996.471) (-1991.343) [-1983.451] (-1987.859) -- 0:00:35
      892800 -- (-1992.326) [-1985.529] (-2004.854) (-1989.379) * (-1992.785) [-1982.312] (-1982.258) (-1992.621) -- 0:00:35
      892900 -- (-1994.239) [-1983.235] (-2001.812) (-1991.798) * (-1987.286) (-1986.809) [-1978.418] (-1996.496) -- 0:00:35
      893000 -- (-1996.673) [-1982.319] (-2001.136) (-1993.790) * [-1984.782] (-1991.280) (-1984.625) (-1989.311) -- 0:00:35

      Average standard deviation of split frequencies: 0.002307

      893100 -- (-2004.859) [-1982.208] (-1992.919) (-1995.986) * (-1988.987) (-1991.048) [-1989.882] (-1984.762) -- 0:00:35
      893200 -- (-1995.770) [-1982.953] (-1999.286) (-1987.605) * (-1988.645) [-1990.293] (-1991.077) (-1994.375) -- 0:00:35
      893300 -- (-2000.806) [-1984.507] (-1996.708) (-1993.508) * (-1988.810) [-1986.824] (-1984.015) (-2002.539) -- 0:00:34
      893400 -- (-2005.424) (-1988.312) (-1998.107) [-1991.148] * (-1991.079) (-1985.637) [-1984.398] (-2005.119) -- 0:00:34
      893500 -- (-2000.714) [-1986.794] (-1994.802) (-1992.854) * (-1989.689) (-1994.550) [-1980.300] (-2018.200) -- 0:00:34
      893600 -- (-2009.402) [-1985.249] (-1994.472) (-1987.863) * (-1987.060) (-1997.853) [-1984.361] (-2016.854) -- 0:00:34
      893700 -- (-2006.063) [-1981.109] (-1995.826) (-1989.653) * [-1984.303] (-2005.428) (-1985.304) (-2001.530) -- 0:00:34
      893800 -- (-2008.120) (-1983.289) (-1996.779) [-1986.838] * (-1993.387) (-1999.557) [-1979.078] (-1998.617) -- 0:00:34
      893900 -- (-2000.141) (-1985.722) (-2002.158) [-1987.848] * (-1988.824) (-1991.265) [-1985.104] (-1992.850) -- 0:00:34
      894000 -- (-2000.693) [-1982.189] (-1997.671) (-1990.327) * (-1991.057) (-1992.776) [-1988.003] (-1999.490) -- 0:00:34

      Average standard deviation of split frequencies: 0.002290

      894100 -- (-2004.756) (-1981.383) (-1995.569) [-1989.160] * (-1997.968) [-1990.704] (-1984.868) (-1989.490) -- 0:00:34
      894200 -- (-2000.339) [-1983.560] (-1990.975) (-1995.669) * [-1993.331] (-1992.593) (-1984.567) (-1996.091) -- 0:00:34
      894300 -- (-1988.217) [-1991.341] (-2000.612) (-1998.430) * (-1986.741) [-1990.925] (-1986.213) (-2002.560) -- 0:00:34
      894400 -- (-1988.459) [-1985.863] (-1997.182) (-1988.223) * [-1981.025] (-1991.909) (-1988.444) (-1996.940) -- 0:00:34
      894500 -- (-1989.356) [-1986.372] (-2006.765) (-1991.019) * (-1984.992) [-1993.461] (-1991.983) (-1998.417) -- 0:00:34
      894600 -- (-1993.996) (-1984.828) (-1985.787) [-1986.370] * [-1979.056] (-1995.440) (-1994.025) (-2003.238) -- 0:00:34
      894700 -- (-1992.838) (-1989.297) (-1988.470) [-1981.794] * [-1979.505] (-1994.540) (-1994.070) (-1993.196) -- 0:00:34
      894800 -- (-2003.862) (-1989.446) (-2004.136) [-1986.470] * [-1978.913] (-1993.062) (-1988.673) (-1995.030) -- 0:00:34
      894900 -- (-2005.616) (-1992.937) (-1995.958) [-1992.959] * (-1981.956) (-2001.009) (-1985.526) [-1990.527] -- 0:00:34
      895000 -- (-2012.223) [-1988.648] (-1996.674) (-1993.049) * (-1987.135) (-1998.255) [-1986.140] (-1991.913) -- 0:00:34

      Average standard deviation of split frequencies: 0.002302

      895100 -- (-2010.360) [-1982.786] (-1991.488) (-1992.449) * (-1991.060) (-1995.985) (-1985.201) [-1988.900] -- 0:00:34
      895200 -- (-2006.145) [-1986.404] (-1992.262) (-1994.606) * [-1983.681] (-1991.942) (-1985.779) (-1984.742) -- 0:00:34
      895300 -- (-2004.100) [-1983.630] (-1994.257) (-1990.986) * (-1989.717) (-1992.833) [-1985.194] (-2000.542) -- 0:00:34
      895400 -- (-2012.249) (-1981.187) (-1991.619) [-1984.973] * [-1984.166] (-1992.359) (-1986.435) (-1992.573) -- 0:00:34
      895500 -- (-2004.614) (-1988.595) (-1995.647) [-1987.466] * (-1990.373) (-1994.881) [-1986.543] (-1998.709) -- 0:00:34
      895600 -- (-2000.148) (-1986.500) (-1995.689) [-1988.723] * (-1987.188) (-1995.851) [-1984.147] (-1992.828) -- 0:00:34
      895700 -- (-1999.972) (-1986.422) [-1988.079] (-1990.268) * (-1987.579) (-1996.565) (-1987.968) [-1992.163] -- 0:00:34
      895800 -- (-1996.524) [-1983.019] (-1996.489) (-1995.339) * (-1986.540) [-1985.916] (-1987.328) (-1993.928) -- 0:00:34
      895900 -- [-1995.192] (-1984.306) (-1994.129) (-1987.275) * (-1992.176) [-1990.797] (-1987.890) (-1998.285) -- 0:00:34
      896000 -- (-1996.698) (-1987.998) [-1984.683] (-1989.548) * (-1993.290) (-1991.948) [-1987.685] (-2001.388) -- 0:00:34

      Average standard deviation of split frequencies: 0.002269

      896100 -- [-1986.327] (-1988.600) (-1991.733) (-1994.921) * (-1994.197) (-1994.172) [-1983.054] (-1990.230) -- 0:00:34
      896200 -- (-1995.398) [-1985.374] (-1991.950) (-1985.632) * (-1993.871) (-1992.444) (-1988.420) [-1987.268] -- 0:00:34
      896300 -- (-1991.812) (-1985.532) [-1992.303] (-1993.800) * (-1986.268) (-1991.209) (-1986.778) [-1989.204] -- 0:00:34
      896400 -- (-1987.047) (-1987.778) [-1995.421] (-2001.576) * (-1990.058) (-1994.130) [-1985.886] (-2001.305) -- 0:00:33
      896500 -- [-1988.683] (-1988.011) (-1996.338) (-2002.273) * (-1994.048) [-1992.171] (-1985.192) (-1996.310) -- 0:00:33
      896600 -- (-1991.274) (-1983.845) [-1987.300] (-1996.158) * [-1985.893] (-1994.091) (-1986.220) (-2002.720) -- 0:00:33
      896700 -- (-1993.084) (-1984.016) [-1988.743] (-1997.935) * (-1986.810) [-1994.137] (-1985.294) (-1994.095) -- 0:00:33
      896800 -- [-1991.022] (-1988.587) (-1992.998) (-1992.636) * (-1993.657) (-1996.782) [-1987.568] (-1996.483) -- 0:00:33
      896900 -- (-1988.831) [-1986.331] (-1993.439) (-1991.217) * (-1988.939) (-1993.385) [-1982.445] (-1992.424) -- 0:00:33
      897000 -- (-1992.557) (-1991.250) (-2000.839) [-1986.715] * [-1983.974] (-1996.978) (-1985.280) (-1998.273) -- 0:00:33

      Average standard deviation of split frequencies: 0.002252

      897100 -- (-1987.765) (-1987.658) (-2010.448) [-1982.481] * (-1981.162) (-2000.464) [-1984.416] (-1995.257) -- 0:00:33
      897200 -- (-1988.237) (-1988.466) (-1995.127) [-1981.267] * (-1991.745) (-2010.570) [-1997.220] (-1996.913) -- 0:00:33
      897300 -- (-1993.955) (-1985.514) (-2002.537) [-1985.678] * (-1982.432) (-2006.040) [-1984.693] (-1996.507) -- 0:00:33
      897400 -- [-1990.118] (-1993.944) (-2001.687) (-1985.495) * [-1979.805] (-2003.118) (-1986.830) (-1999.751) -- 0:00:33
      897500 -- (-1990.866) (-1983.898) (-1994.284) [-1983.564] * [-1987.833] (-2005.555) (-1986.442) (-1999.935) -- 0:00:33
      897600 -- (-1987.952) (-1988.177) (-1994.883) [-1980.157] * [-1988.987] (-2001.315) (-1990.298) (-1998.486) -- 0:00:33
      897700 -- (-1988.850) (-1987.874) (-1998.137) [-1983.444] * (-1989.122) (-1994.113) [-1988.482] (-2005.353) -- 0:00:33
      897800 -- [-1992.592] (-1991.525) (-1997.166) (-1987.101) * [-1987.874] (-1989.358) (-1979.854) (-2007.965) -- 0:00:33
      897900 -- (-1995.754) (-1993.547) [-1992.707] (-1984.491) * (-1983.580) (-1992.965) [-1980.763] (-1999.569) -- 0:00:33
      898000 -- (-1993.953) (-1987.429) (-1991.764) [-1986.870] * (-1986.719) [-1992.221] (-1983.939) (-2003.425) -- 0:00:33

      Average standard deviation of split frequencies: 0.002249

      898100 -- (-1988.270) (-1993.600) (-1997.388) [-1991.852] * (-1991.856) [-1994.877] (-1984.537) (-2001.917) -- 0:00:33
      898200 -- [-1989.820] (-1984.615) (-1992.415) (-1985.569) * (-1985.921) (-1991.731) [-1982.538] (-1992.926) -- 0:00:33
      898300 -- (-1993.045) [-1983.465] (-1994.065) (-1991.521) * [-1983.001] (-1997.770) (-1984.716) (-1989.962) -- 0:00:33
      898400 -- (-1990.458) [-1983.903] (-1999.882) (-1995.384) * [-1985.711] (-1995.034) (-1990.643) (-1993.236) -- 0:00:33
      898500 -- (-1995.645) (-1979.770) (-1996.378) [-1992.722] * [-1978.485] (-1996.546) (-1990.282) (-1998.199) -- 0:00:33
      898600 -- (-2002.028) [-1982.523] (-1998.449) (-1994.128) * (-1978.891) [-1996.941] (-1993.237) (-2003.885) -- 0:00:33
      898700 -- (-2005.652) (-1982.552) (-1997.483) [-1985.441] * (-1983.883) (-1992.827) (-1988.650) [-1999.498] -- 0:00:33
      898800 -- (-2003.228) [-1983.095] (-2000.216) (-1984.561) * [-1983.128] (-1999.131) (-1990.274) (-2001.426) -- 0:00:33
      898900 -- (-1998.360) [-1982.184] (-2000.518) (-1985.650) * (-1983.322) [-1993.958] (-1993.166) (-2001.200) -- 0:00:33
      899000 -- (-2003.637) [-1986.780] (-2002.670) (-1993.471) * (-1985.037) (-1988.225) [-1989.121] (-1999.617) -- 0:00:33

      Average standard deviation of split frequencies: 0.002187

      899100 -- (-2021.044) [-1986.936] (-2007.238) (-1984.886) * [-1986.034] (-1993.282) (-1987.817) (-1998.332) -- 0:00:33
      899200 -- (-2012.962) (-1988.812) (-2004.447) [-1980.094] * (-1985.129) (-1999.710) [-1985.924] (-2007.187) -- 0:00:33
      899300 -- (-2010.248) [-1984.136] (-1996.861) (-1979.994) * [-1983.541] (-1996.247) (-1982.835) (-1998.808) -- 0:00:33
      899400 -- (-2010.503) (-1994.183) (-1998.234) [-1975.871] * [-1980.975] (-1989.526) (-1991.519) (-1995.431) -- 0:00:32
      899500 -- (-1996.007) (-1996.605) (-1999.746) [-1982.285] * (-1984.582) [-1993.989] (-1986.221) (-1994.115) -- 0:00:32
      899600 -- (-1998.492) [-1993.521] (-1999.205) (-1983.094) * [-1985.349] (-1991.443) (-1992.327) (-1995.662) -- 0:00:32
      899700 -- (-1998.643) (-1984.909) (-1997.733) [-1980.913] * [-1986.250] (-1992.988) (-1990.452) (-1993.809) -- 0:00:32
      899800 -- (-2002.169) (-1989.946) (-1999.047) [-1984.685] * [-1990.522] (-1997.948) (-1986.766) (-1992.856) -- 0:00:32
      899900 -- (-1999.509) (-1990.095) (-1990.443) [-1982.259] * (-1994.295) (-1995.753) (-1986.503) [-1988.236] -- 0:00:32
      900000 -- (-2006.888) (-1983.496) (-2002.233) [-1986.828] * [-1988.017] (-1991.388) (-1983.783) (-1986.092) -- 0:00:32

      Average standard deviation of split frequencies: 0.002170

      900100 -- (-2013.469) [-1987.268] (-1998.554) (-1991.242) * (-1986.873) (-1990.909) [-1975.597] (-1986.814) -- 0:00:32
      900200 -- (-2013.543) [-1991.955] (-1989.572) (-1989.332) * (-1993.586) (-1992.865) [-1982.865] (-1992.612) -- 0:00:32
      900300 -- (-2006.209) (-1992.363) (-1992.902) [-1984.795] * (-1982.774) (-1991.590) [-1979.726] (-1983.140) -- 0:00:32
      900400 -- (-1999.448) (-1994.847) (-1988.629) [-1983.437] * [-1980.395] (-1991.478) (-1979.135) (-1987.114) -- 0:00:32
      900500 -- (-1996.037) (-1995.148) [-1989.593] (-1987.265) * (-1982.404) (-2001.981) (-1981.732) [-1989.937] -- 0:00:32
      900600 -- (-1986.651) (-1991.557) (-1996.086) [-1985.424] * [-1982.973] (-1991.225) (-1981.227) (-1989.894) -- 0:00:32
      900700 -- (-1987.190) (-1996.068) [-1988.693] (-1983.384) * [-1983.752] (-1992.663) (-1986.443) (-1993.656) -- 0:00:32
      900800 -- (-1994.649) (-2000.900) (-1988.340) [-1978.750] * (-1985.040) (-2001.628) [-1980.219] (-1995.973) -- 0:00:32
      900900 -- (-1998.467) (-1993.699) (-1987.892) [-1980.916] * (-1986.822) (-1997.677) (-1985.356) [-1988.866] -- 0:00:32
      901000 -- (-2005.414) (-1994.466) (-1989.073) [-1982.123] * [-1985.545] (-1998.122) (-1981.501) (-1993.430) -- 0:00:32

      Average standard deviation of split frequencies: 0.002287

      901100 -- (-1992.581) (-1999.996) (-1999.452) [-1983.886] * (-1987.634) (-1997.438) [-1982.793] (-1996.250) -- 0:00:32
      901200 -- [-1993.277] (-1995.081) (-1993.163) (-1978.231) * [-1986.974] (-1993.978) (-1987.389) (-1993.279) -- 0:00:32
      901300 -- (-1998.538) (-1992.202) (-1991.570) [-1980.121] * (-1992.298) (-2006.245) (-1985.166) [-1992.534] -- 0:00:32
      901400 -- (-1995.143) (-1993.828) (-1997.309) [-1983.255] * (-1983.038) (-2001.544) [-1990.452] (-1991.954) -- 0:00:32
      901500 -- (-1996.916) [-1984.294] (-1996.082) (-1986.010) * [-1981.031] (-2013.534) (-1989.338) (-1986.123) -- 0:00:32
      901600 -- (-1997.602) [-1982.145] (-1990.924) (-1991.952) * [-1982.202] (-2007.243) (-1995.029) (-1986.162) -- 0:00:32
      901700 -- (-2001.532) [-1984.409] (-1993.169) (-1991.775) * [-1983.864] (-1998.783) (-1997.883) (-1984.287) -- 0:00:32
      901800 -- (-1997.978) [-1985.418] (-2000.407) (-1994.424) * [-1981.698] (-1998.723) (-1996.761) (-1982.121) -- 0:00:32
      901900 -- (-1992.742) [-1982.393] (-1998.058) (-1993.677) * (-1986.918) (-2006.161) [-1983.328] (-1981.913) -- 0:00:32
      902000 -- (-1999.277) [-1979.080] (-1993.691) (-1983.462) * (-1986.002) (-1997.506) [-1981.373] (-1992.339) -- 0:00:32

      Average standard deviation of split frequencies: 0.002239

      902100 -- (-2006.865) (-1984.201) (-1998.151) [-1983.296] * [-1981.428] (-1999.564) (-1981.320) (-1988.800) -- 0:00:32
      902200 -- (-2000.293) (-1989.399) (-1995.288) [-1987.367] * [-1979.832] (-1997.229) (-1986.815) (-1987.767) -- 0:00:32
      902300 -- [-2000.944] (-1991.333) (-1994.033) (-1993.256) * (-1977.364) (-2000.243) [-1986.358] (-1987.240) -- 0:00:32
      902400 -- (-2001.884) (-1991.438) [-1988.163] (-1986.651) * [-1981.742] (-1994.165) (-1987.125) (-1995.806) -- 0:00:32
      902500 -- (-1999.253) [-1986.343] (-1984.649) (-1987.798) * [-1983.516] (-1994.339) (-1995.878) (-1997.999) -- 0:00:31
      902600 -- (-1997.363) [-1981.545] (-1987.488) (-1984.745) * [-1982.705] (-1987.407) (-1992.127) (-1994.342) -- 0:00:31
      902700 -- (-1997.539) (-1982.456) (-1988.877) [-1986.167] * (-1990.117) (-1991.449) [-1984.454] (-1991.011) -- 0:00:31
      902800 -- (-1998.496) [-1982.423] (-1992.261) (-1985.723) * (-1987.985) (-1992.161) (-2006.569) [-1989.965] -- 0:00:31
      902900 -- (-2002.159) [-1976.616] (-1994.735) (-1985.834) * (-1989.108) (-1999.838) [-1993.393] (-1988.766) -- 0:00:31
      903000 -- (-1996.582) [-1979.125] (-1991.225) (-1982.813) * (-1987.179) (-1997.983) [-1987.182] (-1993.865) -- 0:00:31

      Average standard deviation of split frequencies: 0.002162

      903100 -- (-2004.395) (-1979.737) (-2002.880) [-1987.835] * (-1993.220) (-1992.561) [-1986.894] (-1991.591) -- 0:00:31
      903200 -- (-1999.077) [-1983.406] (-1996.383) (-1986.969) * (-1992.722) (-1992.259) (-1985.756) [-1989.670] -- 0:00:31
      903300 -- (-1998.456) (-1992.155) (-1994.054) [-1987.538] * (-1989.314) (-1996.396) [-1975.593] (-1997.894) -- 0:00:31
      903400 -- [-1987.391] (-1987.536) (-1994.925) (-1996.025) * (-1990.061) (-1999.595) [-1980.735] (-1990.016) -- 0:00:31
      903500 -- (-1988.131) [-1983.733] (-1989.661) (-2000.809) * (-1994.292) (-1995.655) [-1982.250] (-1994.654) -- 0:00:31
      903600 -- [-1987.713] (-1984.450) (-1990.296) (-1997.700) * (-1985.648) (-1998.318) [-1979.533] (-1987.524) -- 0:00:31
      903700 -- [-1988.398] (-1987.204) (-1990.145) (-1988.155) * (-1987.501) (-1991.919) (-1984.445) [-1989.879] -- 0:00:31
      903800 -- [-1990.968] (-1987.651) (-1990.533) (-1988.380) * [-1983.335] (-1987.136) (-1994.858) (-1988.689) -- 0:00:31
      903900 -- [-1991.434] (-1986.789) (-1990.262) (-1986.045) * [-1980.105] (-1993.523) (-1997.152) (-1993.686) -- 0:00:31
      904000 -- (-1990.137) (-2006.113) (-1987.769) [-1983.087] * (-1982.943) (-1995.364) (-1996.115) [-1987.762] -- 0:00:31

      Average standard deviation of split frequencies: 0.002115

      904100 -- (-1991.429) (-1993.195) (-1993.495) [-1983.329] * [-1984.919] (-2009.724) (-1994.670) (-1988.852) -- 0:00:31
      904200 -- (-1992.648) (-1985.733) (-1996.835) [-1986.302] * [-1981.022] (-2003.589) (-1995.178) (-1991.655) -- 0:00:31
      904300 -- [-1988.970] (-1986.941) (-2005.400) (-1984.685) * (-1985.357) (-1999.061) [-1986.009] (-1992.586) -- 0:00:31
      904400 -- (-1988.129) [-1992.614] (-2005.898) (-1980.502) * (-1986.446) (-1995.532) [-1984.858] (-1996.642) -- 0:00:31
      904500 -- [-1995.146] (-1991.356) (-1995.828) (-1992.481) * (-1993.273) (-1996.264) (-1984.462) [-1993.795] -- 0:00:31
      904600 -- (-2000.733) [-1991.339] (-1992.021) (-2005.845) * (-1991.370) (-1994.411) [-1983.517] (-1993.916) -- 0:00:31
      904700 -- (-1991.892) [-1984.461] (-1992.158) (-1996.648) * [-1986.913] (-1994.609) (-1984.544) (-1995.447) -- 0:00:31
      904800 -- (-1994.255) [-1986.304] (-1987.427) (-1991.312) * (-1989.209) (-1998.849) [-1980.159] (-1999.957) -- 0:00:31
      904900 -- (-1992.861) (-1982.661) [-1984.482] (-1982.922) * (-1997.792) (-2008.958) [-1980.612] (-1993.150) -- 0:00:31
      905000 -- (-1994.028) (-1988.294) (-1987.342) [-1982.310] * (-1996.400) (-2006.379) (-1982.502) [-1989.489] -- 0:00:31

      Average standard deviation of split frequencies: 0.002187

      905100 -- (-1985.890) (-1992.258) (-1985.181) [-1979.391] * (-1988.555) (-2009.397) [-1983.294] (-1992.765) -- 0:00:31
      905200 -- (-1985.560) (-1997.238) (-1988.288) [-1979.274] * [-1985.627] (-2003.420) (-1980.491) (-1995.737) -- 0:00:31
      905300 -- (-1989.009) (-2000.299) (-1987.994) [-1981.077] * (-1983.447) (-1990.306) [-1979.400] (-1999.513) -- 0:00:31
      905400 -- (-1983.935) (-1998.383) (-1990.544) [-1986.533] * (-1980.841) (-1991.403) (-1978.467) [-1996.850] -- 0:00:31
      905500 -- (-1981.844) (-1997.799) [-1986.484] (-1987.933) * [-1976.151] (-1988.269) (-1978.389) (-1998.942) -- 0:00:30
      905600 -- [-1982.927] (-2000.205) (-1988.226) (-1985.208) * [-1978.937] (-1989.867) (-1981.128) (-1996.297) -- 0:00:30
      905700 -- [-1989.499] (-1998.954) (-1983.887) (-1988.087) * [-1980.332] (-1992.495) (-1982.363) (-1991.148) -- 0:00:30
      905800 -- (-1991.615) (-1994.041) (-1987.860) [-1981.926] * (-1983.200) (-1988.843) [-1976.150] (-1998.800) -- 0:00:30
      905900 -- [-1982.875] (-1991.557) (-1988.593) (-1980.555) * (-1979.379) (-1992.434) [-1982.267] (-2008.571) -- 0:00:30
      906000 -- [-1986.545] (-1986.562) (-1986.941) (-1984.489) * [-1979.604] (-2001.764) (-1983.722) (-2003.504) -- 0:00:30

      Average standard deviation of split frequencies: 0.002215

      906100 -- (-1988.245) [-1982.451] (-1997.274) (-1989.047) * (-1981.231) (-1996.441) [-1983.217] (-2005.699) -- 0:00:30
      906200 -- (-1988.362) [-1983.455] (-1996.616) (-1986.042) * [-1974.955] (-1996.796) (-1986.249) (-2001.489) -- 0:00:30
      906300 -- (-1992.327) [-1984.091] (-2001.592) (-1985.302) * [-1980.351] (-1994.786) (-1985.838) (-1996.306) -- 0:00:30
      906400 -- (-2000.004) (-1985.185) (-1999.554) [-1985.400] * [-1981.762] (-2002.746) (-1982.206) (-1996.399) -- 0:00:30
      906500 -- (-1995.436) (-1983.378) (-1998.411) [-1982.498] * (-1988.087) (-1999.145) [-1983.747] (-1992.443) -- 0:00:30
      906600 -- (-1984.958) [-1985.449] (-1994.727) (-1983.865) * (-1989.700) (-1992.444) [-1981.726] (-2001.583) -- 0:00:30
      906700 -- (-1991.787) (-1992.490) (-1995.118) [-1982.205] * (-1977.892) (-1993.538) [-1982.866] (-1996.410) -- 0:00:30
      906800 -- (-1991.900) [-1991.623] (-1992.288) (-1986.162) * [-1978.986] (-1996.119) (-1995.303) (-1992.223) -- 0:00:30
      906900 -- (-1992.162) [-1987.063] (-1992.106) (-1990.658) * [-1978.961] (-1991.256) (-1995.836) (-1994.730) -- 0:00:30
      907000 -- (-1990.517) [-1986.912] (-1987.754) (-1986.650) * [-1981.149] (-1993.682) (-1992.014) (-1992.742) -- 0:00:30

      Average standard deviation of split frequencies: 0.002227

      907100 -- (-1989.897) (-1999.352) (-1992.708) [-1988.289] * (-1981.131) [-1985.989] (-1988.901) (-1991.082) -- 0:00:30
      907200 -- (-1996.189) (-2001.695) (-1992.245) [-1981.642] * [-1979.957] (-1985.382) (-1990.205) (-1999.884) -- 0:00:30
      907300 -- (-1999.739) (-1994.551) (-1995.354) [-1986.186] * [-1985.146] (-1982.230) (-1993.041) (-1995.886) -- 0:00:30
      907400 -- (-2007.011) (-1995.768) [-1989.922] (-1988.773) * [-1979.360] (-1987.852) (-1986.877) (-2006.602) -- 0:00:30
      907500 -- (-2000.107) (-1999.180) [-1992.669] (-1986.915) * [-1981.763] (-1992.885) (-1993.463) (-1999.798) -- 0:00:30
      907600 -- (-2012.524) (-1998.248) (-1999.156) [-1994.689] * [-1983.991] (-1993.120) (-1988.899) (-2002.712) -- 0:00:30
      907700 -- (-2003.512) [-1991.386] (-1996.646) (-1991.106) * (-1985.935) (-1988.811) [-1985.170] (-1991.303) -- 0:00:30
      907800 -- (-1996.951) (-1995.203) (-1998.652) [-1989.337] * (-1990.235) [-1991.496] (-1983.482) (-1996.944) -- 0:00:30
      907900 -- (-1993.994) (-1996.397) (-1991.109) [-1987.762] * [-1978.505] (-1990.551) (-1979.374) (-1998.986) -- 0:00:30
      908000 -- (-1995.676) (-1999.023) (-1990.605) [-1981.047] * [-1979.066] (-1998.249) (-1980.988) (-1998.205) -- 0:00:30

      Average standard deviation of split frequencies: 0.002328

      908100 -- (-1989.631) (-1994.739) (-1993.012) [-1979.712] * (-1988.497) (-1991.827) [-1986.843] (-2004.939) -- 0:00:30
      908200 -- (-1991.355) (-1992.208) (-1992.004) [-1981.290] * (-1988.187) (-1992.204) [-1987.062] (-2004.455) -- 0:00:30
      908300 -- (-1990.528) (-2000.616) (-1990.821) [-1983.572] * (-1992.499) [-1988.158] (-1991.140) (-1996.274) -- 0:00:30
      908400 -- (-1993.243) (-2002.301) (-1989.772) [-1983.369] * [-1989.749] (-1988.581) (-1984.262) (-1997.479) -- 0:00:30
      908500 -- (-1989.371) (-2005.059) (-1990.300) [-1980.850] * (-1992.830) (-1995.633) [-1981.268] (-1998.258) -- 0:00:30
      908600 -- [-1980.080] (-1989.274) (-1985.517) (-1983.828) * (-1991.220) (-1989.465) [-1980.601] (-2003.935) -- 0:00:29
      908700 -- [-1979.605] (-1993.873) (-1984.136) (-1984.364) * (-1994.001) (-1998.269) [-1981.796] (-2008.957) -- 0:00:29
      908800 -- [-1981.794] (-1992.050) (-1988.390) (-1986.713) * (-1989.291) (-1993.541) [-1985.642] (-2000.787) -- 0:00:29
      908900 -- [-1981.100] (-1994.897) (-1992.232) (-1994.099) * (-1988.604) [-1997.040] (-1990.504) (-2001.295) -- 0:00:29
      909000 -- (-1983.852) (-1993.231) [-1989.775] (-1985.397) * (-1991.752) (-1995.692) (-1987.226) [-1991.106] -- 0:00:29

      Average standard deviation of split frequencies: 0.002326

      909100 -- [-1979.527] (-1994.645) (-1996.791) (-1988.694) * (-1989.246) [-1984.588] (-1987.323) (-1989.086) -- 0:00:29
      909200 -- [-1980.739] (-1989.301) (-1993.788) (-1985.819) * [-1986.183] (-1989.829) (-1990.482) (-1987.871) -- 0:00:29
      909300 -- [-1979.566] (-1990.858) (-1996.538) (-1987.166) * (-1986.044) (-1989.513) [-1982.441] (-1989.500) -- 0:00:29
      909400 -- [-1982.902] (-1994.021) (-1995.839) (-1988.967) * (-1989.775) [-1991.980] (-1984.913) (-1996.602) -- 0:00:29
      909500 -- [-1979.807] (-2000.484) (-1995.646) (-1989.135) * (-1983.720) (-1990.677) [-1989.270] (-1991.121) -- 0:00:29
      909600 -- (-1975.817) (-1999.091) (-2003.932) [-1987.963] * [-1986.993] (-1993.241) (-1989.233) (-1993.929) -- 0:00:29
      909700 -- [-1980.722] (-2000.554) (-1991.157) (-1994.582) * (-1990.454) (-1997.158) [-1989.953] (-1988.295) -- 0:00:29
      909800 -- [-1979.412] (-2000.008) (-1989.843) (-1991.777) * (-1996.868) [-1993.208] (-1992.764) (-1990.703) -- 0:00:29
      909900 -- [-1978.981] (-1991.177) (-1990.912) (-1994.407) * (-1991.061) (-1992.662) (-1997.064) [-1988.957] -- 0:00:29
      910000 -- [-1981.355] (-1987.196) (-1992.559) (-2005.367) * (-1998.034) (-1990.244) (-1993.537) [-1992.583] -- 0:00:29

      Average standard deviation of split frequencies: 0.002220

      910100 -- [-1978.821] (-1983.573) (-1990.124) (-2004.628) * (-1995.037) [-1989.082] (-1992.209) (-1990.752) -- 0:00:29
      910200 -- (-1982.775) [-1985.728] (-1987.880) (-2004.503) * (-1999.635) [-1989.240] (-1994.617) (-1984.677) -- 0:00:29
      910300 -- [-1989.384] (-1994.372) (-1988.800) (-1992.602) * (-2000.852) (-1986.305) (-1996.312) [-1984.560] -- 0:00:29
      910400 -- (-1992.632) (-1998.531) [-1994.952] (-1989.086) * (-1997.910) [-1989.349] (-1999.793) (-1983.736) -- 0:00:29
      910500 -- [-1982.589] (-1990.552) (-1997.657) (-1988.041) * (-1992.525) (-1987.395) (-1999.476) [-1983.087] -- 0:00:29
      910600 -- (-1984.332) (-1983.667) (-2011.412) [-1987.631] * [-1997.376] (-1989.199) (-1992.995) (-1984.645) -- 0:00:29
      910700 -- [-1980.716] (-1987.929) (-2009.486) (-1989.253) * (-1995.259) (-1988.413) [-1987.730] (-1991.223) -- 0:00:29
      910800 -- [-1981.620] (-1990.023) (-1997.903) (-1994.757) * (-1991.022) (-1985.054) [-1985.561] (-1995.330) -- 0:00:29
      910900 -- (-1986.784) (-1985.988) (-1994.652) [-1987.796] * (-1994.879) [-1984.765] (-1986.797) (-2001.989) -- 0:00:29
      911000 -- [-1985.438] (-1982.148) (-1995.530) (-2003.933) * (-1995.320) (-1987.655) (-1984.981) [-1993.814] -- 0:00:29

      Average standard deviation of split frequencies: 0.002188

      911100 -- (-1993.385) [-1986.415] (-1994.504) (-1989.754) * [-1992.352] (-1987.509) (-1985.865) (-1995.640) -- 0:00:29
      911200 -- (-1996.277) (-1993.908) (-2006.930) [-1986.824] * [-1988.731] (-1992.704) (-1990.982) (-1993.112) -- 0:00:29
      911300 -- (-1994.551) [-1991.361] (-1994.350) (-1992.188) * (-1988.926) (-1991.900) [-1986.031] (-1994.713) -- 0:00:29
      911400 -- (-1985.592) [-1990.641] (-1999.595) (-1996.287) * (-1991.057) (-1988.100) [-1983.700] (-2002.304) -- 0:00:29
      911500 -- (-1985.190) [-1983.223] (-1994.939) (-1996.819) * [-1990.348] (-1992.718) (-1990.828) (-1998.045) -- 0:00:29
      911600 -- (-1986.312) (-1984.041) [-1993.220] (-1999.939) * [-1989.882] (-1994.689) (-1988.019) (-1993.924) -- 0:00:28
      911700 -- (-1981.235) [-1980.968] (-1992.256) (-1998.396) * (-1990.333) (-1998.300) [-1987.007] (-2003.174) -- 0:00:28
      911800 -- (-1984.859) [-1981.685] (-1995.288) (-1995.574) * [-1990.118] (-1998.519) (-1992.848) (-1990.816) -- 0:00:28
      911900 -- (-1985.000) [-1983.796] (-2004.417) (-1999.899) * (-1991.415) (-2003.903) [-1989.525] (-1997.552) -- 0:00:28
      912000 -- (-1989.623) [-1978.978] (-2003.850) (-1996.606) * [-1987.899] (-1997.123) (-1984.768) (-1996.496) -- 0:00:28

      Average standard deviation of split frequencies: 0.002171

      912100 -- (-1988.241) [-1978.799] (-2010.702) (-1997.714) * (-1993.541) (-1998.875) [-1981.758] (-2009.794) -- 0:00:28
      912200 -- (-1985.464) [-1976.687] (-2008.297) (-1994.917) * (-1989.987) (-1994.358) [-1985.029] (-2006.365) -- 0:00:28
      912300 -- [-1981.252] (-1978.448) (-1995.641) (-2000.012) * (-1986.474) (-1991.061) [-1983.144] (-2012.987) -- 0:00:28
      912400 -- [-1980.863] (-1979.867) (-1990.885) (-2002.539) * (-1991.988) [-1990.417] (-1982.990) (-2012.064) -- 0:00:28
      912500 -- [-1985.238] (-1987.904) (-1997.454) (-1997.857) * (-1989.966) (-1996.076) [-1986.490] (-2011.789) -- 0:00:28
      912600 -- (-1986.833) [-1980.487] (-1994.902) (-1998.372) * [-1990.533] (-2006.831) (-1985.730) (-1993.745) -- 0:00:28
      912700 -- [-1988.961] (-1983.060) (-1994.682) (-1995.875) * (-1990.776) (-2007.851) [-1982.688] (-1991.215) -- 0:00:28
      912800 -- [-1984.617] (-1986.698) (-1996.270) (-1996.013) * (-1993.632) (-2009.034) [-1980.333] (-1992.015) -- 0:00:28
      912900 -- (-1987.461) (-1987.254) (-1995.371) [-1996.263] * (-1988.807) (-2002.633) [-1991.940] (-1990.663) -- 0:00:28
      913000 -- [-1985.766] (-1980.440) (-2001.570) (-1997.493) * [-1985.320] (-2010.024) (-1993.991) (-1986.468) -- 0:00:28

      Average standard deviation of split frequencies: 0.002168

      913100 -- [-1977.623] (-1980.099) (-1998.653) (-1996.269) * (-1986.839) (-1999.321) (-1985.099) [-1990.019] -- 0:00:28
      913200 -- [-1978.858] (-1985.890) (-1993.564) (-1996.983) * (-1985.995) (-1994.671) (-1983.664) [-1987.287] -- 0:00:28
      913300 -- [-1979.481] (-1981.767) (-1993.492) (-1988.680) * (-1998.946) (-2001.237) [-1980.372] (-1996.326) -- 0:00:28
      913400 -- (-1981.837) [-1984.690] (-1995.864) (-2001.056) * (-1994.309) (-2005.403) (-1982.788) [-1994.436] -- 0:00:28
      913500 -- (-1983.219) [-1983.659] (-1993.290) (-1993.821) * (-1986.836) (-2003.207) [-1982.489] (-1996.334) -- 0:00:28
      913600 -- (-1983.097) [-1983.212] (-1992.342) (-1993.125) * (-1985.725) (-1997.544) [-1978.895] (-1991.298) -- 0:00:28
      913700 -- (-1984.251) [-1991.287] (-1998.015) (-1994.555) * (-1985.098) (-1995.971) [-1984.617] (-1990.232) -- 0:00:28
      913800 -- (-1981.513) (-1985.848) [-1992.248] (-2005.898) * (-1995.417) (-1997.506) (-1986.762) [-1990.972] -- 0:00:28
      913900 -- [-1981.474] (-1991.539) (-1990.785) (-1995.499) * (-1998.347) (-1995.702) [-1981.768] (-1998.095) -- 0:00:28
      914000 -- [-1981.346] (-1988.327) (-1989.413) (-1997.832) * (-1993.787) (-1991.925) [-1983.591] (-1994.887) -- 0:00:28

      Average standard deviation of split frequencies: 0.002166

      914100 -- [-1980.942] (-1989.680) (-1989.897) (-1996.179) * [-1988.321] (-1991.916) (-1987.404) (-1994.515) -- 0:00:28
      914200 -- [-1981.567] (-1988.275) (-1994.474) (-1989.688) * (-1988.676) (-1987.567) [-1984.589] (-2000.383) -- 0:00:28
      914300 -- (-1988.508) [-1983.262] (-1990.456) (-1994.611) * (-1991.295) (-1986.237) [-1987.124] (-1992.711) -- 0:00:28
      914400 -- (-1992.470) (-1990.521) [-1993.815] (-1992.452) * (-1990.762) (-1981.999) [-1988.749] (-1989.419) -- 0:00:28
      914500 -- [-1984.071] (-1987.875) (-1997.247) (-1991.959) * [-1985.458] (-1984.910) (-1990.779) (-1996.190) -- 0:00:28
      914600 -- (-1984.724) (-1988.642) (-2000.250) [-1994.140] * [-1983.477] (-1984.344) (-1996.705) (-1992.016) -- 0:00:28
      914700 -- [-1983.766] (-1993.974) (-1995.949) (-1989.327) * (-1990.730) [-1984.946] (-2008.053) (-1990.763) -- 0:00:27
      914800 -- [-1984.141] (-1986.576) (-1994.131) (-1997.931) * (-1990.652) [-1987.492] (-2007.213) (-1992.957) -- 0:00:27
      914900 -- (-1987.376) [-1991.458] (-1999.225) (-1991.864) * (-1993.159) [-1984.378] (-2012.508) (-1991.252) -- 0:00:27
      915000 -- (-1985.527) [-1987.249] (-2002.745) (-1990.636) * [-1994.774] (-1987.671) (-2001.182) (-1987.611) -- 0:00:27

      Average standard deviation of split frequencies: 0.002104

      915100 -- (-1988.606) [-1996.783] (-2000.977) (-1991.769) * (-2000.475) [-1988.039] (-1992.442) (-2001.141) -- 0:00:27
      915200 -- (-1983.174) (-1989.645) (-1993.514) [-1984.575] * (-2000.599) [-1986.964] (-1988.377) (-1991.437) -- 0:00:27
      915300 -- (-1984.493) [-1987.669] (-1991.902) (-1985.375) * (-1994.848) (-1988.988) [-1989.329] (-1995.427) -- 0:00:27
      915400 -- [-1978.885] (-1988.513) (-2002.641) (-1991.154) * [-1987.406] (-1994.733) (-1993.351) (-1999.425) -- 0:00:27
      915500 -- [-1977.617] (-1991.083) (-1997.253) (-1992.218) * (-1994.250) (-2007.148) [-1993.678] (-1998.430) -- 0:00:27
      915600 -- [-1981.387] (-1999.262) (-2003.251) (-1996.267) * (-1995.604) (-2004.148) (-1994.872) [-1992.317] -- 0:00:27
      915700 -- [-1979.197] (-1996.274) (-2000.724) (-1990.495) * (-1988.988) (-2002.165) [-1993.560] (-1994.250) -- 0:00:27
      915800 -- (-1984.111) (-1992.007) (-2003.901) [-1989.942] * (-1993.159) (-1994.423) [-1993.442] (-1990.142) -- 0:00:27
      915900 -- (-1985.559) [-1988.785] (-2010.054) (-1994.725) * (-1999.286) [-1984.903] (-1996.315) (-1991.477) -- 0:00:27
      916000 -- [-1982.807] (-1989.100) (-2003.636) (-1991.224) * (-2004.217) (-1987.295) (-1994.901) [-1984.128] -- 0:00:27

      Average standard deviation of split frequencies: 0.002044

      916100 -- [-1979.837] (-1985.285) (-2000.242) (-1992.349) * (-2004.344) [-1986.850] (-1999.789) (-1986.134) -- 0:00:27
      916200 -- [-1982.549] (-1988.150) (-1994.072) (-1996.242) * (-1994.285) (-1987.665) (-2004.767) [-1982.428] -- 0:00:27
      916300 -- (-1988.525) (-1992.899) [-1987.190] (-1993.403) * (-1993.465) [-1989.405] (-1991.515) (-1984.064) -- 0:00:27
      916400 -- (-1995.367) (-1991.958) (-1984.604) [-1987.324] * (-2000.237) (-1991.588) (-1992.317) [-1987.954] -- 0:00:27
      916500 -- (-1997.905) (-1999.329) (-1984.235) [-1993.950] * (-1991.406) (-1988.950) [-1988.554] (-1997.649) -- 0:00:27
      916600 -- (-1989.281) (-1991.462) (-1982.386) [-1990.128] * [-1988.518] (-1990.756) (-1990.525) (-1992.106) -- 0:00:27
      916700 -- (-1989.469) (-1991.484) [-1981.459] (-1988.050) * (-1984.672) (-1987.471) (-1991.422) [-2000.415] -- 0:00:27
      916800 -- [-1991.376] (-1994.728) (-1986.625) (-1990.391) * [-1985.229] (-1989.476) (-1990.248) (-2001.914) -- 0:00:27
      916900 -- (-1990.256) [-1995.049] (-1993.930) (-1991.415) * (-1995.427) (-1987.296) (-1990.533) [-1990.547] -- 0:00:27
      917000 -- [-1991.317] (-1992.856) (-1989.648) (-1996.706) * (-2005.343) (-1987.020) [-1988.206] (-1990.311) -- 0:00:27

      Average standard deviation of split frequencies: 0.002012

      917100 -- (-1991.985) [-1997.487] (-1991.352) (-1995.738) * [-1993.474] (-1993.580) (-1994.264) (-1992.405) -- 0:00:27
      917200 -- (-1990.234) (-2012.664) (-1994.362) [-1992.955] * [-1986.898] (-1990.706) (-1988.279) (-1988.198) -- 0:00:27
      917300 -- [-1988.734] (-1998.523) (-1992.383) (-1992.321) * (-1988.760) (-2000.978) (-2000.823) [-1989.986] -- 0:00:27
      917400 -- (-1989.694) (-2010.017) [-1991.432] (-1992.248) * (-1989.399) [-1991.810] (-2002.824) (-1990.043) -- 0:00:27
      917500 -- (-1993.191) (-2014.421) (-1990.636) [-1989.895] * (-1987.980) (-1990.163) (-2007.636) [-1987.981] -- 0:00:27
      917600 -- (-1988.713) (-2003.432) (-1993.494) [-1989.439] * (-1986.311) [-1987.823] (-1995.594) (-1986.948) -- 0:00:27
      917700 -- (-1993.302) (-2012.010) [-1992.966] (-1988.548) * (-1987.302) (-1990.300) [-1995.064] (-1987.264) -- 0:00:26
      917800 -- (-1994.283) (-1998.654) (-1989.904) [-1989.040] * (-1986.744) (-1991.986) (-1998.320) [-1986.623] -- 0:00:26
      917900 -- (-1998.791) (-2002.480) [-1985.244] (-1997.502) * (-1998.166) [-1986.240] (-1993.780) (-1986.343) -- 0:00:26
      918000 -- (-1996.604) (-1995.803) [-1983.989] (-1995.622) * [-1988.528] (-1997.030) (-1987.009) (-1989.912) -- 0:00:26

      Average standard deviation of split frequencies: 0.002010

      918100 -- (-2005.162) (-1997.534) [-1986.774] (-1989.249) * (-1995.647) (-1994.671) (-1990.090) [-1987.292] -- 0:00:26
      918200 -- (-2002.288) [-1986.399] (-1988.939) (-1994.735) * [-1990.389] (-1989.713) (-2002.094) (-1991.483) -- 0:00:26
      918300 -- (-1991.898) [-1988.629] (-1991.332) (-1992.957) * (-1987.190) [-1986.499] (-1993.886) (-1992.534) -- 0:00:26
      918400 -- [-1986.314] (-1992.872) (-1987.663) (-1997.640) * (-1990.169) (-1987.179) (-1993.206) [-1990.454] -- 0:00:26
      918500 -- (-1992.581) [-1995.391] (-1988.659) (-1997.066) * [-1987.309] (-1994.921) (-1993.109) (-1998.998) -- 0:00:26
      918600 -- (-1988.510) (-1989.371) [-1987.731] (-2002.614) * [-1988.699] (-1997.111) (-1995.841) (-1998.090) -- 0:00:26
      918700 -- (-1987.461) [-1984.756] (-1987.721) (-1992.865) * [-1986.125] (-1993.431) (-1988.407) (-1992.822) -- 0:00:26
      918800 -- (-1995.373) (-1990.149) [-1985.354] (-1991.195) * [-1987.723] (-1998.477) (-1992.591) (-2011.636) -- 0:00:26
      918900 -- (-1991.724) (-1984.678) (-1988.542) [-1986.938] * [-1987.700] (-1992.817) (-1998.081) (-1991.693) -- 0:00:26
      919000 -- (-1982.505) [-1979.166] (-1989.908) (-1984.399) * [-1992.676] (-1990.738) (-1998.018) (-1996.937) -- 0:00:26

      Average standard deviation of split frequencies: 0.002037

      919100 -- (-1987.002) [-1979.903] (-1987.614) (-1984.712) * (-1993.543) [-1989.297] (-2012.134) (-1987.279) -- 0:00:26
      919200 -- (-1985.462) [-1982.926] (-1989.546) (-1992.670) * (-1986.584) (-1987.186) (-2000.984) [-1990.136] -- 0:00:26
      919300 -- (-1985.170) [-1990.236] (-1988.626) (-1985.754) * (-1990.129) [-1986.016] (-2001.961) (-1987.626) -- 0:00:26
      919400 -- [-1987.023] (-1991.650) (-1984.849) (-1992.887) * (-1991.138) (-1988.435) (-2008.248) [-1984.986] -- 0:00:26
      919500 -- (-1985.792) (-1992.138) (-1984.267) [-1988.420] * (-1994.472) (-1994.120) (-2001.012) [-1988.067] -- 0:00:26
      919600 -- (-1985.620) (-1989.925) [-1984.806] (-1986.029) * (-1995.510) (-1987.973) (-1998.565) [-1987.251] -- 0:00:26
      919700 -- (-1987.891) [-1986.110] (-1985.430) (-1989.030) * [-1990.888] (-1992.344) (-1991.427) (-1992.527) -- 0:00:26
      919800 -- [-1986.069] (-1987.981) (-1990.439) (-1989.917) * (-1999.673) (-1994.308) (-1996.638) [-1991.693] -- 0:00:26
      919900 -- (-1987.753) (-1981.126) (-2000.202) [-1988.586] * (-1998.791) (-1994.569) (-1996.906) [-1991.199] -- 0:00:26
      920000 -- (-1988.449) [-1977.161] (-1991.191) (-2000.706) * (-1995.452) (-1994.889) [-1990.381] (-1994.407) -- 0:00:26

      Average standard deviation of split frequencies: 0.002093

      920100 -- [-1986.846] (-1975.062) (-1989.473) (-1998.863) * [-1989.763] (-1998.107) (-1993.505) (-1993.046) -- 0:00:26
      920200 -- [-1982.633] (-1981.569) (-1997.049) (-1991.635) * (-1992.713) (-1993.056) [-1987.224] (-1991.482) -- 0:00:26
      920300 -- [-1980.698] (-1982.825) (-1989.748) (-1993.407) * (-2002.971) (-1988.112) [-1988.871] (-1995.565) -- 0:00:26
      920400 -- [-1980.212] (-1988.571) (-1990.275) (-1990.683) * (-1997.112) [-1988.965] (-1990.163) (-1990.853) -- 0:00:26
      920500 -- (-1991.788) [-1982.036] (-1994.616) (-1986.045) * (-1995.659) [-1989.733] (-1990.928) (-1990.137) -- 0:00:26
      920600 -- (-1998.589) (-1991.097) (-1993.724) [-1984.940] * (-1998.244) (-1986.540) [-1987.225] (-1989.980) -- 0:00:26
      920700 -- (-1994.871) (-1987.192) (-1987.603) [-1985.406] * (-1995.783) (-1994.604) [-1988.050] (-1991.216) -- 0:00:26
      920800 -- (-2002.307) [-1988.340] (-1988.763) (-1990.001) * (-1994.404) (-1993.432) (-1992.642) [-1992.400] -- 0:00:25
      920900 -- (-1990.382) [-1984.251] (-2006.364) (-1990.954) * (-1992.919) (-1993.100) (-1998.270) [-1988.105] -- 0:00:25
      921000 -- (-1983.071) [-1987.535] (-2006.663) (-1983.254) * (-2002.137) (-2001.718) (-1991.021) [-1987.507] -- 0:00:25

      Average standard deviation of split frequencies: 0.002032

      921100 -- [-1981.562] (-1985.809) (-2007.622) (-1989.195) * [-1990.967] (-1998.895) (-1997.320) (-1987.382) -- 0:00:25
      921200 -- [-1989.072] (-1988.882) (-2013.474) (-1993.626) * [-1986.336] (-1995.546) (-1992.048) (-1996.858) -- 0:00:25
      921300 -- (-1990.799) (-1987.431) (-2002.761) [-1996.386] * (-1985.519) (-1998.248) [-1995.556] (-1995.242) -- 0:00:25
      921400 -- (-1984.390) (-1990.008) (-1998.373) [-1994.675] * (-1992.833) (-2001.385) [-1994.500] (-2000.742) -- 0:00:25
      921500 -- [-1981.429] (-1990.514) (-1999.372) (-1996.875) * [-1985.792] (-1989.981) (-1994.456) (-1997.120) -- 0:00:25
      921600 -- [-1985.579] (-1994.936) (-1998.552) (-1996.901) * (-1991.063) (-1988.988) [-1988.649] (-1998.454) -- 0:00:25
      921700 -- [-1982.903] (-2002.062) (-1999.302) (-1990.467) * (-1993.524) (-1989.616) [-1991.269] (-2000.960) -- 0:00:25
      921800 -- [-1985.917] (-2007.968) (-2002.296) (-1986.041) * (-2005.278) [-1988.562] (-2005.577) (-1996.496) -- 0:00:25
      921900 -- [-1982.236] (-2006.729) (-1994.513) (-1985.486) * (-1999.982) [-1987.800] (-2002.218) (-2015.527) -- 0:00:25
      922000 -- (-1986.253) (-1998.224) (-1993.933) [-1989.033] * (-1997.128) [-1991.758] (-2009.938) (-2011.654) -- 0:00:25

      Average standard deviation of split frequencies: 0.002001

      922100 -- [-1985.480] (-2000.331) (-1990.039) (-2000.716) * (-1994.358) [-1991.083] (-1995.073) (-2013.415) -- 0:00:25
      922200 -- (-1982.784) (-1990.056) (-1995.060) [-1991.976] * [-1994.308] (-1988.525) (-1997.195) (-2007.344) -- 0:00:25
      922300 -- (-1989.508) [-1987.195] (-1996.975) (-1998.555) * (-1996.920) [-1990.380] (-1998.392) (-2000.440) -- 0:00:25
      922400 -- [-1988.773] (-1986.321) (-2001.747) (-1990.153) * (-1993.159) [-1983.862] (-2001.266) (-1998.513) -- 0:00:25
      922500 -- (-1988.358) (-1986.795) (-2001.978) [-1990.958] * (-1994.586) [-1990.225] (-2005.105) (-1990.055) -- 0:00:25
      922600 -- (-1991.397) [-1985.164] (-1999.454) (-1990.736) * (-1992.893) [-1983.743] (-2003.716) (-1992.013) -- 0:00:25
      922700 -- [-1987.163] (-1987.156) (-2003.201) (-1991.178) * (-1995.952) (-1986.322) (-1999.585) [-1990.590] -- 0:00:25
      922800 -- [-1980.240] (-1987.450) (-1995.875) (-1989.929) * (-1998.115) (-1989.668) (-2000.918) [-1987.905] -- 0:00:25
      922900 -- (-1976.837) (-1990.643) (-1992.714) [-1986.766] * [-1997.632] (-1987.723) (-2006.168) (-1993.573) -- 0:00:25
      923000 -- [-1980.040] (-1987.735) (-2007.148) (-1990.615) * [-1989.902] (-1989.616) (-2001.805) (-1992.510) -- 0:00:25

      Average standard deviation of split frequencies: 0.002013

      923100 -- [-1981.905] (-1993.808) (-2002.377) (-1999.515) * [-1988.503] (-1988.671) (-1992.949) (-1995.499) -- 0:00:25
      923200 -- (-1981.280) (-1999.301) (-1995.415) [-1991.510] * [-1997.266] (-1988.307) (-1992.320) (-1997.042) -- 0:00:25
      923300 -- [-1982.857] (-2007.060) (-1991.488) (-1987.736) * (-1990.356) [-1996.601] (-2005.745) (-1999.527) -- 0:00:25
      923400 -- [-1981.529] (-2006.374) (-1992.815) (-1989.718) * [-1984.015] (-1993.806) (-2012.132) (-2009.003) -- 0:00:25
      923500 -- [-1985.753] (-2011.805) (-1991.901) (-1983.560) * [-1984.238] (-1995.614) (-2007.480) (-1997.228) -- 0:00:25
      923600 -- (-1986.637) (-2001.279) [-1995.281] (-1984.257) * [-1979.208] (-1993.136) (-1995.663) (-1991.531) -- 0:00:25
      923700 -- [-1983.821] (-2006.175) (-1996.011) (-1987.799) * [-1981.143] (-1994.955) (-1999.289) (-1990.581) -- 0:00:25
      923800 -- [-1984.403] (-2018.575) (-1996.093) (-1986.299) * [-1982.154] (-1988.181) (-1995.029) (-1990.405) -- 0:00:24
      923900 -- [-1984.788] (-2022.448) (-2001.245) (-1988.775) * [-1977.025] (-1993.085) (-1995.491) (-1989.524) -- 0:00:24
      924000 -- [-1989.934] (-2024.017) (-1996.459) (-1987.780) * [-1985.214] (-1993.564) (-1986.324) (-1988.893) -- 0:00:24

      Average standard deviation of split frequencies: 0.002011

      924100 -- [-1982.737] (-2017.086) (-1994.071) (-1987.676) * (-1986.802) (-1997.245) (-1985.209) [-1989.699] -- 0:00:24
      924200 -- (-1985.536) (-2013.216) [-1988.218] (-1986.488) * (-1982.520) (-1998.863) [-1991.230] (-1998.007) -- 0:00:24
      924300 -- [-1982.042] (-2013.217) (-1983.772) (-1990.725) * [-1981.923] (-1997.857) (-1997.338) (-1993.713) -- 0:00:24
      924400 -- (-1985.689) (-2012.988) (-1989.030) [-1990.422] * [-1979.047] (-1990.352) (-1998.595) (-1996.941) -- 0:00:24
      924500 -- (-1984.419) (-2001.123) [-1985.133] (-1995.752) * [-1976.143] (-1990.603) (-2011.486) (-1988.538) -- 0:00:24
      924600 -- (-2000.851) (-2003.351) (-1990.471) [-1989.326] * [-1977.490] (-1990.478) (-2018.910) (-1988.215) -- 0:00:24
      924700 -- (-1993.954) (-2000.798) [-1993.650] (-1991.865) * [-1983.009] (-1985.713) (-2016.447) (-1988.852) -- 0:00:24
      924800 -- (-1994.470) (-1995.069) [-1986.474] (-1994.452) * [-1981.478] (-1984.626) (-2007.018) (-1986.205) -- 0:00:24
      924900 -- [-1983.509] (-1997.304) (-1995.050) (-1992.648) * (-1981.002) [-1984.594] (-2007.606) (-1987.121) -- 0:00:24
      925000 -- [-1987.265] (-1995.492) (-1993.269) (-1987.224) * (-1984.705) [-1981.709] (-2002.060) (-1986.343) -- 0:00:24

      Average standard deviation of split frequencies: 0.002067

      925100 -- (-1985.777) [-1995.263] (-1995.919) (-1997.254) * (-1992.593) [-1980.977] (-1999.885) (-1989.217) -- 0:00:24
      925200 -- [-1988.073] (-1996.517) (-1996.561) (-2002.053) * [-1986.527] (-1986.348) (-2004.062) (-1992.666) -- 0:00:24
      925300 -- [-1985.976] (-2000.540) (-1998.453) (-2002.665) * [-1982.623] (-1983.741) (-1999.781) (-1994.452) -- 0:00:24
      925400 -- [-1992.834] (-2003.639) (-1992.057) (-1995.030) * [-1982.503] (-1987.333) (-1987.401) (-2003.454) -- 0:00:24
      925500 -- [-1985.976] (-2002.334) (-1995.398) (-1997.951) * (-1985.115) [-1986.496] (-1992.575) (-1996.542) -- 0:00:24
      925600 -- [-1984.257] (-2000.832) (-1998.757) (-1993.343) * [-1981.865] (-1986.105) (-1993.270) (-2002.497) -- 0:00:24
      925700 -- [-1986.065] (-2007.816) (-1997.321) (-1985.386) * (-1987.709) [-1988.312] (-1998.910) (-1995.415) -- 0:00:24
      925800 -- (-1986.783) (-1996.763) (-1996.916) [-1986.666] * (-1984.740) [-1988.687] (-1990.440) (-1991.638) -- 0:00:24
      925900 -- [-1999.364] (-1999.327) (-2005.105) (-1986.539) * (-1988.161) [-1980.729] (-1989.613) (-1996.038) -- 0:00:24
      926000 -- [-1983.960] (-1989.881) (-1997.347) (-1988.256) * (-1992.107) [-1980.238] (-1992.271) (-1997.072) -- 0:00:24

      Average standard deviation of split frequencies: 0.002007

      926100 -- (-1991.631) (-1996.079) (-2001.190) [-1987.182] * (-1985.777) [-1980.161] (-2001.350) (-1996.446) -- 0:00:24
      926200 -- [-1991.478] (-1998.582) (-2000.296) (-1988.837) * (-1983.582) [-1982.523] (-1997.978) (-1996.252) -- 0:00:24
      926300 -- [-1989.871] (-1994.873) (-1995.517) (-1986.857) * (-1986.367) [-1987.274] (-1993.272) (-2000.637) -- 0:00:24
      926400 -- (-1998.543) (-1993.100) (-1997.162) [-1986.446] * (-1990.491) (-1987.543) [-1991.512] (-1995.284) -- 0:00:24
      926500 -- (-1998.709) (-2000.182) (-1991.943) [-1985.486] * (-1983.093) [-1983.700] (-1997.649) (-1994.776) -- 0:00:24
      926600 -- (-1999.905) (-2000.459) (-1986.530) [-1986.669] * [-1982.930] (-1985.267) (-1995.571) (-1997.352) -- 0:00:24
      926700 -- (-2003.192) [-1998.749] (-1987.462) (-1987.017) * [-1981.671] (-1986.424) (-1997.750) (-1989.936) -- 0:00:24
      926800 -- (-1996.259) [-1994.876] (-1984.587) (-1999.601) * [-1978.574] (-1996.417) (-1993.259) (-1994.991) -- 0:00:24
      926900 -- (-2007.250) (-1991.412) (-1987.718) [-1989.482] * [-1981.038] (-1986.704) (-1993.335) (-1992.678) -- 0:00:23
      927000 -- (-2003.850) (-1993.172) (-1988.366) [-1989.931] * [-1985.396] (-1984.057) (-1992.786) (-1993.322) -- 0:00:23

      Average standard deviation of split frequencies: 0.002063

      927100 -- (-2004.613) [-1995.399] (-1998.893) (-1992.508) * (-1986.166) (-1986.029) [-1988.064] (-1995.869) -- 0:00:23
      927200 -- (-1994.146) [-1992.850] (-1987.556) (-1997.973) * (-1983.186) [-1982.354] (-1990.018) (-2002.520) -- 0:00:23
      927300 -- (-1996.570) (-1990.512) [-1984.125] (-1996.825) * (-1982.879) [-1986.957] (-1995.782) (-1997.849) -- 0:00:23
      927400 -- (-1995.326) (-1994.029) [-1989.038] (-2005.545) * [-1985.139] (-1984.978) (-2003.478) (-1992.562) -- 0:00:23
      927500 -- (-1994.933) (-1995.459) [-1991.744] (-1998.503) * (-1986.617) (-1991.916) (-1998.358) [-1985.783] -- 0:00:23
      927600 -- [-1986.132] (-2002.882) (-1993.064) (-1995.783) * (-1984.069) [-1985.340] (-1994.035) (-1987.655) -- 0:00:23
      927700 -- [-1984.142] (-1991.818) (-1989.540) (-1999.408) * (-1984.269) (-1982.314) (-2001.972) [-1990.554] -- 0:00:23
      927800 -- [-1986.322] (-1987.918) (-1989.775) (-2004.276) * (-1980.681) [-1981.409] (-1997.970) (-1995.799) -- 0:00:23
      927900 -- (-1991.396) [-1983.888] (-1987.784) (-1996.515) * (-1985.248) [-1980.585] (-1999.215) (-1992.788) -- 0:00:23
      928000 -- (-1989.468) [-1984.323] (-1993.953) (-2003.357) * (-1986.988) [-1979.644] (-1999.797) (-1991.902) -- 0:00:23

      Average standard deviation of split frequencies: 0.002003

      928100 -- [-1988.767] (-1985.649) (-1990.754) (-1991.940) * [-1983.928] (-1978.743) (-1989.663) (-1991.554) -- 0:00:23
      928200 -- [-1989.230] (-1989.188) (-1986.826) (-1997.614) * [-1979.837] (-1986.514) (-1990.851) (-1992.614) -- 0:00:23
      928300 -- (-1988.736) (-1987.382) [-1992.675] (-1989.608) * (-1983.820) (-1990.542) (-1987.581) [-1992.825] -- 0:00:23
      928400 -- (-1994.822) (-1989.642) [-1990.011] (-1993.559) * (-1989.379) (-1991.654) (-1986.470) [-1988.808] -- 0:00:23
      928500 -- (-1993.797) (-1992.444) (-1993.963) [-1990.333] * (-1985.568) (-1992.592) [-1989.089] (-1992.971) -- 0:00:23
      928600 -- [-1986.197] (-1990.405) (-1988.682) (-1999.335) * [-1982.858] (-2003.912) (-1988.275) (-1993.959) -- 0:00:23
      928700 -- [-1985.063] (-1998.859) (-1991.595) (-1998.847) * (-1983.088) (-1993.981) [-1986.905] (-1991.999) -- 0:00:23
      928800 -- (-1988.130) [-1984.555] (-1994.058) (-1998.495) * (-1987.783) (-1996.481) (-1993.403) [-1989.971] -- 0:00:23
      928900 -- [-1985.509] (-1985.543) (-1999.536) (-2000.556) * [-1981.190] (-1989.538) (-1992.732) (-1992.007) -- 0:00:23
      929000 -- [-1985.055] (-1985.385) (-2003.160) (-1999.260) * (-1979.646) [-1982.402] (-2000.818) (-1988.998) -- 0:00:23

      Average standard deviation of split frequencies: 0.002044

      929100 -- [-1982.814] (-1989.286) (-1999.302) (-2000.964) * [-1979.931] (-1980.372) (-1995.569) (-1994.460) -- 0:00:23
      929200 -- (-1991.120) [-1990.671] (-2006.543) (-1998.985) * [-1981.620] (-1988.098) (-1995.227) (-1993.907) -- 0:00:23
      929300 -- (-1982.714) (-1995.965) (-1995.719) [-2002.298] * [-1984.397] (-1984.116) (-1991.743) (-1995.614) -- 0:00:23
      929400 -- [-1984.559] (-1994.564) (-2005.898) (-1991.806) * [-1983.740] (-1985.771) (-1995.064) (-2000.747) -- 0:00:23
      929500 -- (-1984.433) (-1994.880) (-1994.473) [-1991.644] * (-1981.822) [-1982.526] (-1998.441) (-2004.902) -- 0:00:23
      929600 -- [-1983.068] (-1997.937) (-1996.551) (-1990.571) * [-1980.578] (-1979.162) (-1999.103) (-1992.569) -- 0:00:23
      929700 -- (-1989.370) (-2006.687) (-1996.195) [-1987.469] * [-1979.472] (-1978.361) (-1997.363) (-1988.694) -- 0:00:23
      929800 -- (-1991.277) (-2003.129) [-1986.967] (-1992.248) * (-1985.043) [-1980.238] (-1999.519) (-1988.231) -- 0:00:23
      929900 -- (-1990.100) (-1999.922) (-1995.633) [-1988.740] * (-1984.520) [-1982.796] (-1999.294) (-1996.493) -- 0:00:22
      930000 -- (-1991.150) (-1991.563) (-1995.194) [-1989.761] * [-1984.164] (-1988.302) (-1993.833) (-2000.497) -- 0:00:22

      Average standard deviation of split frequencies: 0.001969

      930100 -- (-1990.561) (-1991.825) (-1998.801) [-1985.316] * (-1990.936) [-1991.060] (-1994.875) (-1999.664) -- 0:00:22
      930200 -- (-1996.197) (-1991.743) [-1990.722] (-1990.955) * (-1996.780) [-1984.226] (-2001.796) (-1993.706) -- 0:00:22
      930300 -- [-1991.168] (-1997.999) (-1995.228) (-1990.842) * (-1993.084) (-1984.206) (-1998.244) [-1989.312] -- 0:00:22
      930400 -- (-1999.413) [-1994.186] (-2001.606) (-1994.410) * [-1985.802] (-1994.147) (-1997.342) (-1992.435) -- 0:00:22
      930500 -- (-1998.746) (-1987.813) (-1993.138) [-1988.184] * (-1989.159) [-1988.439] (-1993.604) (-1990.286) -- 0:00:22
      930600 -- (-1998.866) (-1988.037) (-1993.710) [-1986.733] * (-1986.833) [-1989.029] (-1995.588) (-1994.786) -- 0:00:22
      930700 -- (-1996.895) [-1986.709] (-1997.928) (-1993.844) * (-1980.922) [-1983.916] (-1997.147) (-2003.125) -- 0:00:22
      930800 -- (-1994.451) (-1986.634) (-1994.306) [-1988.797] * [-1983.586] (-1983.816) (-1996.495) (-1999.721) -- 0:00:22
      930900 -- (-1995.100) (-1994.749) (-2006.958) [-1991.667] * (-1987.753) [-1990.790] (-1999.899) (-1999.091) -- 0:00:22
      931000 -- (-1998.980) [-1994.331] (-2005.490) (-1997.398) * (-1995.639) [-1994.846] (-2000.242) (-1995.150) -- 0:00:22

      Average standard deviation of split frequencies: 0.002010

      931100 -- [-1987.566] (-1991.905) (-2008.636) (-1995.765) * [-1994.126] (-1997.985) (-1994.733) (-1996.417) -- 0:00:22
      931200 -- [-1984.647] (-1998.104) (-1999.110) (-1989.880) * (-1985.549) (-2000.325) [-1990.648] (-1995.112) -- 0:00:22
      931300 -- (-1985.366) (-2000.797) [-1997.309] (-1992.877) * (-1991.881) (-2002.820) [-1983.607] (-1993.179) -- 0:00:22
      931400 -- [-1984.415] (-1997.809) (-2000.744) (-1999.975) * [-1985.212] (-2000.818) (-1995.104) (-1990.441) -- 0:00:22
      931500 -- (-1987.182) [-1992.082] (-1999.053) (-1991.854) * [-1987.275] (-2003.305) (-1993.221) (-1989.764) -- 0:00:22
      931600 -- (-1999.747) [-1999.407] (-1999.288) (-1990.229) * (-1982.484) (-1995.694) [-1991.005] (-1990.062) -- 0:00:22
      931700 -- (-1991.516) (-2003.605) (-1997.408) [-1991.589] * (-1983.578) (-1997.461) [-1985.432] (-1994.380) -- 0:00:22
      931800 -- (-1978.722) (-2003.353) (-1998.698) [-1991.012] * [-1984.810] (-1992.946) (-1988.386) (-1992.996) -- 0:00:22
      931900 -- (-1980.326) (-2006.702) (-1999.911) [-1993.929] * [-1984.495] (-1993.787) (-1986.082) (-1994.723) -- 0:00:22
      932000 -- [-1986.014] (-2010.329) (-1994.833) (-1995.722) * [-1978.807] (-2000.677) (-1987.919) (-1991.561) -- 0:00:22

      Average standard deviation of split frequencies: 0.001922

      932100 -- [-1987.107] (-1991.915) (-1995.357) (-1993.570) * [-1979.374] (-2000.235) (-1985.894) (-1991.831) -- 0:00:22
      932200 -- (-1992.479) (-2007.055) (-1991.189) [-1995.600] * [-1978.640] (-2002.985) (-2002.419) (-1996.556) -- 0:00:22
      932300 -- (-1987.983) (-2000.009) (-2001.224) [-1997.193] * [-1978.370] (-1999.488) (-2002.550) (-1996.719) -- 0:00:22
      932400 -- [-1982.135] (-1996.957) (-2005.020) (-2002.466) * [-1980.417] (-1996.436) (-2007.762) (-1988.016) -- 0:00:22
      932500 -- [-1989.538] (-1990.740) (-1997.710) (-2016.398) * [-1983.960] (-2002.571) (-1998.500) (-1992.721) -- 0:00:22
      932600 -- (-1990.379) [-1992.687] (-1992.078) (-2017.780) * [-1984.583] (-1993.910) (-2003.602) (-1994.977) -- 0:00:22
      932700 -- [-1983.643] (-1989.908) (-1991.006) (-2013.247) * (-1987.428) (-2001.554) (-1996.491) [-1987.177] -- 0:00:22
      932800 -- [-1983.811] (-1997.747) (-1992.513) (-2000.320) * (-1999.362) [-1991.908] (-1995.942) (-1990.335) -- 0:00:22
      932900 -- (-1986.245) (-1998.876) [-1993.737] (-2005.415) * (-1996.220) [-1985.476] (-1992.913) (-1984.884) -- 0:00:22
      933000 -- [-1983.549] (-1988.597) (-1989.230) (-1995.588) * (-1992.701) (-1985.071) (-1992.873) [-1991.181] -- 0:00:21

      Average standard deviation of split frequencies: 0.001934

      933100 -- (-1990.703) [-1991.669] (-1984.638) (-2001.200) * (-1998.074) (-1993.455) [-1987.721] (-1991.629) -- 0:00:21
      933200 -- [-1984.366] (-1989.351) (-1991.734) (-2003.703) * (-1992.045) (-1999.232) [-1993.045] (-1990.792) -- 0:00:21
      933300 -- [-1981.520] (-1993.558) (-1998.415) (-2001.445) * (-1999.873) (-1996.830) (-1993.098) [-1990.501] -- 0:00:21
      933400 -- (-1984.275) (-2008.857) [-1995.306] (-1995.222) * [-1998.874] (-1999.739) (-2001.726) (-1987.236) -- 0:00:21
      933500 -- [-1984.805] (-2006.943) (-1991.696) (-1999.065) * (-1996.800) (-1994.688) (-1995.281) [-1988.100] -- 0:00:21
      933600 -- (-1981.071) [-1996.745] (-1999.514) (-1998.569) * (-1993.214) (-1990.767) (-1991.719) [-1986.259] -- 0:00:21
      933700 -- [-1981.480] (-1995.567) (-1999.268) (-1992.437) * [-1978.998] (-1982.904) (-1990.089) (-1985.605) -- 0:00:21
      933800 -- [-1981.334] (-1990.006) (-1997.420) (-1999.105) * (-1979.940) [-1982.267] (-1996.302) (-1991.848) -- 0:00:21
      933900 -- [-1985.325] (-1996.251) (-1993.269) (-1990.071) * (-1983.313) [-1984.867] (-1996.407) (-1995.448) -- 0:00:21
      934000 -- [-1985.382] (-1993.754) (-1994.381) (-1993.675) * (-1994.682) [-1979.418] (-1993.722) (-1996.601) -- 0:00:21

      Average standard deviation of split frequencies: 0.001961

      934100 -- (-1984.585) (-1994.841) [-1995.137] (-1993.197) * (-1992.631) [-1980.555] (-1998.310) (-1994.059) -- 0:00:21
      934200 -- [-1986.401] (-1995.193) (-1993.713) (-1992.333) * (-1989.528) [-1979.661] (-2001.438) (-1993.438) -- 0:00:21
      934300 -- (-1983.737) (-1993.090) [-1991.361] (-1987.933) * (-1987.872) (-1978.838) [-1996.031] (-1993.409) -- 0:00:21
      934400 -- (-1982.023) [-1992.945] (-1998.132) (-1995.933) * (-1989.045) [-1978.457] (-1998.511) (-1996.150) -- 0:00:21
      934500 -- [-1983.034] (-1996.871) (-1990.293) (-2000.518) * (-1985.648) [-1977.780] (-1991.982) (-1991.294) -- 0:00:21
      934600 -- [-1980.758] (-1998.692) (-1989.081) (-2008.848) * (-1990.758) [-1976.985] (-1997.138) (-1997.096) -- 0:00:21
      934700 -- (-1979.375) [-1991.953] (-1995.655) (-1997.120) * (-1989.044) [-1977.548] (-2004.357) (-1990.404) -- 0:00:21
      934800 -- [-1980.423] (-1990.654) (-1997.391) (-1999.325) * (-1985.158) (-1992.795) [-1995.566] (-1990.325) -- 0:00:21
      934900 -- [-1982.094] (-1988.112) (-1998.398) (-1992.225) * [-1983.329] (-1988.853) (-1998.681) (-1990.647) -- 0:00:21
      935000 -- [-1979.234] (-1994.136) (-1991.744) (-1990.845) * (-1992.753) [-1983.159] (-1992.690) (-1993.147) -- 0:00:21

      Average standard deviation of split frequencies: 0.001987

      935100 -- (-1982.734) (-1991.658) [-1987.204] (-2001.514) * (-1984.120) [-1985.640] (-2001.317) (-1997.130) -- 0:00:21
      935200 -- [-1985.703] (-1991.115) (-1990.688) (-1993.539) * (-1983.588) [-1981.979] (-2001.803) (-2008.211) -- 0:00:21
      935300 -- (-1988.116) (-1986.059) [-1990.608] (-1986.620) * (-1985.236) [-1983.574] (-2008.640) (-2007.640) -- 0:00:21
      935400 -- (-1985.615) [-1987.034] (-1989.871) (-1986.633) * (-1981.797) [-1979.622] (-1997.850) (-2002.724) -- 0:00:21
      935500 -- (-1986.035) [-1991.336] (-1986.769) (-1991.467) * [-1992.076] (-1982.678) (-2003.034) (-2001.220) -- 0:00:21
      935600 -- (-1987.873) (-1994.439) (-1989.557) [-1987.056] * (-1988.008) [-1983.933] (-2009.893) (-2000.853) -- 0:00:21
      935700 -- (-1984.053) [-1993.508] (-1991.759) (-1991.829) * (-1988.996) [-1983.429] (-2004.864) (-2002.243) -- 0:00:21
      935800 -- [-1986.370] (-1996.330) (-1994.513) (-1991.988) * (-1989.593) [-1982.037] (-2010.936) (-2009.738) -- 0:00:21
      935900 -- [-1980.134] (-1990.074) (-1994.664) (-1992.915) * [-1984.761] (-1979.546) (-1997.057) (-2006.520) -- 0:00:21
      936000 -- [-1977.881] (-1999.916) (-1995.109) (-1998.329) * (-1987.028) [-1979.087] (-1992.478) (-2004.190) -- 0:00:20

      Average standard deviation of split frequencies: 0.001985

      936100 -- [-1978.439] (-1989.877) (-1996.129) (-1996.999) * (-1985.215) [-1980.549] (-1993.691) (-2016.274) -- 0:00:20
      936200 -- [-1983.227] (-1993.611) (-1992.728) (-1996.321) * (-1995.026) [-1985.336] (-1994.334) (-2009.470) -- 0:00:20
      936300 -- [-1985.991] (-1998.161) (-1994.663) (-1991.968) * [-1988.875] (-1978.523) (-1998.430) (-2004.842) -- 0:00:20
      936400 -- [-1978.183] (-1997.533) (-1991.033) (-1992.465) * [-1981.848] (-1982.893) (-1996.566) (-2000.885) -- 0:00:20
      936500 -- [-1980.872] (-2003.160) (-1996.236) (-1993.121) * (-1984.845) [-1990.922] (-1998.882) (-1990.313) -- 0:00:20
      936600 -- [-1981.773] (-1991.899) (-1987.232) (-1991.648) * [-1985.493] (-1991.257) (-1998.104) (-2000.179) -- 0:00:20
      936700 -- [-1979.111] (-1991.663) (-1992.266) (-1996.762) * (-1982.429) (-1991.449) [-1993.981] (-2001.556) -- 0:00:20
      936800 -- [-1981.284] (-1988.591) (-2002.548) (-1990.833) * [-1980.833] (-1994.743) (-1993.936) (-1998.047) -- 0:00:20
      936900 -- [-1979.149] (-1999.921) (-2001.578) (-1992.911) * [-1980.377] (-2000.989) (-1994.928) (-1996.376) -- 0:00:20
      937000 -- [-1984.869] (-1993.455) (-2001.282) (-1990.123) * [-1980.205] (-1997.040) (-1988.106) (-1994.438) -- 0:00:20

      Average standard deviation of split frequencies: 0.001969

      937100 -- [-1985.054] (-1995.594) (-2002.505) (-1989.061) * [-1981.437] (-1994.583) (-1990.107) (-1997.151) -- 0:00:20
      937200 -- [-1982.208] (-1990.583) (-2005.887) (-1997.222) * (-1986.897) (-2000.911) [-1992.575] (-1994.110) -- 0:00:20
      937300 -- (-1986.445) [-1987.571] (-2005.590) (-1995.160) * (-1989.855) (-1993.284) [-1990.275] (-1993.144) -- 0:00:20
      937400 -- (-1987.306) (-1987.921) (-2001.008) [-1986.528] * (-1996.584) (-1993.722) [-1991.370] (-1989.645) -- 0:00:20
      937500 -- [-1988.746] (-2007.183) (-1995.849) (-1986.686) * [-1993.327] (-2003.800) (-1995.315) (-1987.162) -- 0:00:20
      937600 -- [-1988.177] (-1995.621) (-1990.840) (-1991.213) * (-1990.856) [-1991.472] (-1999.768) (-1987.515) -- 0:00:20
      937700 -- [-1983.655] (-1989.379) (-1988.673) (-1987.516) * (-1996.179) (-1986.189) (-1996.822) [-1983.670] -- 0:00:20
      937800 -- [-1985.547] (-1991.337) (-1988.689) (-1986.619) * (-1997.337) [-1985.674] (-1999.580) (-1988.472) -- 0:00:20
      937900 -- [-1982.985] (-1993.571) (-1986.752) (-1987.591) * (-1992.455) (-1987.035) (-1999.097) [-1989.826] -- 0:00:20
      938000 -- (-1986.143) (-1996.592) (-1995.028) [-1984.443] * (-1994.691) (-2002.006) (-1995.008) [-1990.139] -- 0:00:20

      Average standard deviation of split frequencies: 0.001953

      938100 -- [-1985.251] (-1992.543) (-1994.143) (-1990.324) * (-1989.420) (-1983.948) (-1995.438) [-1988.205] -- 0:00:20
      938200 -- [-1976.419] (-2003.802) (-2000.976) (-1989.432) * (-1999.886) (-1988.060) (-2000.481) [-1982.254] -- 0:00:20
      938300 -- [-1979.826] (-1995.945) (-2001.602) (-1991.557) * (-1995.161) (-1988.809) (-2009.066) [-1986.405] -- 0:00:20
      938400 -- [-1986.634] (-1997.982) (-2000.829) (-1990.791) * (-1988.950) [-1987.128] (-2005.160) (-1988.609) -- 0:00:20
      938500 -- [-1985.756] (-2007.686) (-1996.063) (-1992.552) * (-1993.958) [-1981.468] (-1998.027) (-1988.054) -- 0:00:20
      938600 -- [-1982.066] (-2002.248) (-1996.506) (-1994.146) * [-1987.332] (-1986.211) (-2001.984) (-1992.580) -- 0:00:20
      938700 -- [-1984.942] (-2012.856) (-1995.730) (-1996.139) * [-1986.612] (-1993.049) (-1997.390) (-2005.905) -- 0:00:20
      938800 -- (-1989.932) (-2001.566) (-2006.448) [-1991.688] * [-1983.497] (-1995.310) (-1995.840) (-1999.971) -- 0:00:20
      938900 -- [-1987.374] (-2001.209) (-2000.933) (-1992.563) * [-1986.188] (-2003.734) (-1992.197) (-1992.684) -- 0:00:20
      939000 -- [-1986.273] (-1992.622) (-1997.697) (-1995.519) * (-1986.484) (-1996.740) (-1996.922) [-1984.995] -- 0:00:20

      Average standard deviation of split frequencies: 0.001907

      939100 -- [-1981.864] (-1994.223) (-1998.327) (-2000.293) * (-1983.759) (-1991.462) (-1997.278) [-1984.306] -- 0:00:19
      939200 -- [-1981.863] (-1996.898) (-1991.553) (-2000.751) * (-1978.897) (-1990.829) (-1994.531) [-1983.765] -- 0:00:19
      939300 -- [-1981.051] (-1986.434) (-1993.421) (-1997.954) * [-1980.707] (-1993.835) (-2004.466) (-1992.652) -- 0:00:19
      939400 -- [-1981.258] (-1987.220) (-1993.697) (-1994.769) * [-1981.162] (-1989.547) (-1996.366) (-1992.513) -- 0:00:19
      939500 -- [-1984.727] (-1990.379) (-2000.311) (-1995.844) * [-1983.789] (-1991.827) (-1990.340) (-1995.812) -- 0:00:19
      939600 -- (-1982.233) [-1986.647] (-2001.264) (-1993.444) * (-1984.134) (-1991.912) (-1987.884) [-1995.992] -- 0:00:19
      939700 -- (-1984.948) [-1985.156] (-1999.205) (-1993.456) * [-1988.801] (-1991.147) (-1988.388) (-2001.020) -- 0:00:19
      939800 -- [-1983.781] (-1988.986) (-1991.116) (-1990.708) * (-1989.152) (-1991.840) [-1987.679] (-1996.891) -- 0:00:19
      939900 -- [-1984.049] (-1994.006) (-1998.949) (-1992.889) * (-1992.876) [-1990.535] (-1992.822) (-1989.879) -- 0:00:19
      940000 -- [-1982.930] (-1992.594) (-2000.773) (-2003.745) * [-1989.663] (-1982.826) (-1994.664) (-1989.517) -- 0:00:19

      Average standard deviation of split frequencies: 0.001934

      940100 -- [-1984.229] (-2005.722) (-2005.243) (-1999.220) * (-1988.640) [-1984.681] (-1994.096) (-1995.796) -- 0:00:19
      940200 -- [-1984.262] (-2001.066) (-1999.911) (-2008.788) * (-1987.240) [-1985.065] (-1994.840) (-1992.577) -- 0:00:19
      940300 -- [-1980.673] (-1998.306) (-1994.830) (-2003.317) * [-1982.189] (-1984.453) (-2000.914) (-1997.206) -- 0:00:19
      940400 -- [-1979.148] (-1988.733) (-1998.959) (-2003.277) * [-1982.443] (-1993.202) (-1997.922) (-2002.637) -- 0:00:19
      940500 -- [-1984.307] (-1989.310) (-1992.403) (-2003.285) * [-1979.803] (-1994.007) (-2003.951) (-2011.894) -- 0:00:19
      940600 -- [-1982.259] (-1995.677) (-1997.970) (-1992.291) * [-1980.926] (-1984.724) (-1994.511) (-2010.057) -- 0:00:19
      940700 -- [-1985.688] (-2007.264) (-1990.030) (-1991.140) * (-1981.631) (-1983.131) [-1991.487] (-2008.962) -- 0:00:19
      940800 -- [-1979.935] (-1995.544) (-2002.752) (-1997.338) * (-1982.537) [-1984.513] (-1994.785) (-1998.562) -- 0:00:19
      940900 -- [-1980.679] (-1992.536) (-1999.940) (-1999.069) * (-1986.404) [-1987.235] (-1993.515) (-1993.400) -- 0:00:19
      941000 -- [-1981.287] (-1989.761) (-2002.670) (-1996.115) * [-1986.676] (-1987.164) (-1994.588) (-2005.365) -- 0:00:19

      Average standard deviation of split frequencies: 0.001989

      941100 -- (-1983.562) [-1990.254] (-1998.514) (-1996.468) * (-1987.331) [-1981.436] (-1988.419) (-1999.290) -- 0:00:19
      941200 -- (-1994.751) (-1995.945) (-1994.818) [-1989.856] * (-1986.754) [-1980.344] (-1990.175) (-2001.498) -- 0:00:19
      941300 -- (-1999.823) (-1995.333) (-1994.964) [-1990.278] * (-1992.167) (-1985.147) [-1987.780] (-2002.273) -- 0:00:19
      941400 -- (-1998.379) [-1989.945] (-2007.829) (-1989.287) * (-1992.735) [-1980.415] (-1987.395) (-1998.297) -- 0:00:19
      941500 -- (-1997.669) [-1989.996] (-1997.222) (-2000.778) * (-2000.234) [-1980.466] (-1993.902) (-2005.861) -- 0:00:19
      941600 -- (-1999.357) (-1993.046) [-1991.641] (-1989.599) * (-2001.385) [-1980.658] (-1989.936) (-2001.723) -- 0:00:19
      941700 -- (-1992.806) (-1993.033) [-1988.147] (-1990.512) * (-1997.248) [-1986.185] (-1986.795) (-2001.207) -- 0:00:19
      941800 -- (-1990.252) (-1998.258) [-1990.734] (-1983.730) * (-1996.155) (-1985.149) (-1991.599) [-1995.819] -- 0:00:19
      941900 -- (-1987.162) (-2005.212) [-1986.475] (-1990.183) * (-1990.716) (-1997.962) (-1988.548) [-1992.466] -- 0:00:19
      942000 -- [-1990.944] (-1997.568) (-1992.620) (-1988.308) * (-1989.347) (-1997.291) [-1985.012] (-1991.924) -- 0:00:19

      Average standard deviation of split frequencies: 0.002030

      942100 -- (-1987.097) [-1986.610] (-2004.819) (-1991.323) * [-1991.917] (-1991.762) (-1992.133) (-1988.420) -- 0:00:18
      942200 -- (-1989.006) (-1989.109) (-2000.688) [-1989.534] * (-1992.584) [-1994.128] (-1989.784) (-1989.233) -- 0:00:18
      942300 -- (-1993.026) [-1986.899] (-2000.260) (-1985.408) * [-1980.087] (-1992.765) (-1987.821) (-1995.713) -- 0:00:18
      942400 -- [-1996.967] (-1993.511) (-1995.098) (-1986.345) * [-1983.319] (-1986.429) (-1994.469) (-1987.572) -- 0:00:18
      942500 -- (-1990.355) (-1994.124) (-1994.626) [-1988.129] * (-1982.467) [-1988.180] (-1999.064) (-1989.462) -- 0:00:18
      942600 -- (-1994.913) [-1987.876] (-1999.582) (-1989.955) * [-1984.960] (-1985.008) (-2002.319) (-1993.644) -- 0:00:18
      942700 -- [-1990.192] (-1993.833) (-1990.111) (-1989.519) * [-1985.499] (-1984.390) (-1993.364) (-1997.376) -- 0:00:18
      942800 -- (-1993.082) (-1996.131) (-1996.244) [-1991.739] * [-1981.162] (-1987.320) (-1986.198) (-1994.042) -- 0:00:18
      942900 -- [-1983.941] (-1991.836) (-1988.544) (-1990.617) * (-1985.304) [-1985.932] (-1987.798) (-1987.942) -- 0:00:18
      943000 -- (-1994.311) [-1993.276] (-1989.489) (-1997.418) * [-1988.593] (-1999.696) (-1983.795) (-1991.862) -- 0:00:18

      Average standard deviation of split frequencies: 0.002028

      943100 -- (-1990.994) (-1999.166) [-1990.192] (-1995.846) * (-1992.222) (-2000.087) [-1982.122] (-1994.306) -- 0:00:18
      943200 -- (-1991.482) (-1993.287) [-1996.252] (-1990.833) * (-1990.622) (-1997.184) [-1981.310] (-1994.438) -- 0:00:18
      943300 -- (-1997.816) (-1995.700) [-1989.457] (-1988.470) * (-1988.934) (-1990.774) [-1982.823] (-1995.687) -- 0:00:18
      943400 -- (-1999.650) (-2001.838) (-1988.661) [-1986.443] * (-1996.706) (-1984.763) [-1986.205] (-1994.861) -- 0:00:18
      943500 -- (-1999.909) (-2006.355) (-1991.142) [-1986.285] * (-1984.233) [-1982.320] (-1986.967) (-1990.595) -- 0:00:18
      943600 -- (-1997.297) (-2007.275) [-1993.374] (-1988.504) * (-1988.555) [-1991.270] (-2000.854) (-1999.763) -- 0:00:18
      943700 -- [-1985.153] (-2012.775) (-1986.726) (-1988.796) * [-1985.015] (-1996.239) (-1987.819) (-2001.929) -- 0:00:18
      943800 -- [-1986.523] (-2001.861) (-1987.958) (-1997.398) * [-1982.559] (-1991.797) (-1990.250) (-1997.504) -- 0:00:18
      943900 -- [-1986.017] (-2002.693) (-1992.517) (-1996.848) * [-1984.744] (-1984.666) (-1987.204) (-1998.337) -- 0:00:18
      944000 -- [-1987.755] (-1996.917) (-1997.340) (-1988.554) * [-1984.466] (-1982.828) (-1987.803) (-1994.005) -- 0:00:18

      Average standard deviation of split frequencies: 0.002026

      944100 -- [-1984.899] (-2002.235) (-2017.153) (-1988.533) * (-1985.561) [-1984.988] (-1988.935) (-1991.751) -- 0:00:18
      944200 -- [-1990.152] (-2002.184) (-2005.842) (-1987.768) * (-1986.908) [-1987.025] (-1987.869) (-1996.309) -- 0:00:18
      944300 -- (-1997.565) (-1998.886) (-2003.929) [-1988.188] * [-1987.128] (-1985.785) (-1982.826) (-1996.900) -- 0:00:18
      944400 -- [-1994.972] (-1998.650) (-2000.868) (-1986.525) * (-1985.410) (-1987.798) [-1980.494] (-1992.003) -- 0:00:18
      944500 -- [-1991.765] (-1992.672) (-2004.806) (-1987.733) * (-1987.287) (-1990.930) [-1985.395] (-1988.940) -- 0:00:18
      944600 -- (-1991.882) (-1995.610) (-2002.237) [-1988.448] * (-1986.425) (-1992.432) (-1990.002) [-1990.326] -- 0:00:18
      944700 -- (-1991.494) (-1992.664) (-2005.053) [-1990.659] * (-1988.088) (-1989.036) [-1982.796] (-2004.390) -- 0:00:18
      944800 -- [-1985.349] (-1989.905) (-2003.349) (-1993.553) * (-1990.081) (-1984.180) [-1981.897] (-1995.233) -- 0:00:18
      944900 -- [-1986.039] (-1990.928) (-2004.733) (-1991.147) * [-1986.684] (-1988.142) (-1984.909) (-1989.522) -- 0:00:18
      945000 -- [-1986.138] (-1994.927) (-1998.463) (-1990.321) * (-1998.569) (-1983.825) [-1986.399] (-1989.052) -- 0:00:18

      Average standard deviation of split frequencies: 0.002109

      945100 -- [-1982.682] (-1992.191) (-1993.585) (-1985.314) * [-1993.610] (-1990.037) (-1985.757) (-1995.424) -- 0:00:18
      945200 -- [-1982.218] (-1985.903) (-1993.953) (-1990.511) * (-1995.852) (-1985.970) [-1982.666] (-1995.911) -- 0:00:17
      945300 -- (-1984.364) [-1990.457] (-1996.161) (-1989.661) * (-1985.857) (-1987.515) [-1984.692] (-1986.664) -- 0:00:17
      945400 -- [-1986.597] (-1993.382) (-1994.573) (-1991.020) * (-1987.850) (-1996.763) [-1980.276] (-1992.044) -- 0:00:17
      945500 -- [-1985.757] (-1996.093) (-1991.099) (-1992.482) * (-1987.113) (-1994.959) [-1981.646] (-1998.541) -- 0:00:17
      945600 -- [-1983.134] (-1985.380) (-1993.817) (-1991.079) * (-1989.020) (-1995.887) [-1984.261] (-1998.639) -- 0:00:17
      945700 -- (-1992.164) [-1983.774] (-2002.452) (-1998.005) * [-1985.389] (-1996.532) (-1983.018) (-1992.089) -- 0:00:17
      945800 -- (-2002.102) (-1988.984) [-1997.335] (-1999.848) * (-1994.273) (-1998.430) [-1984.236] (-1991.157) -- 0:00:17
      945900 -- (-1995.607) [-1990.699] (-1997.531) (-1996.062) * (-1995.654) (-2001.149) [-1985.408] (-1986.341) -- 0:00:17
      946000 -- (-2010.975) [-1992.611] (-1994.318) (-2001.925) * [-1985.544] (-1997.290) (-1979.199) (-1989.566) -- 0:00:17

      Average standard deviation of split frequencies: 0.002007

      946100 -- (-2005.039) [-1990.348] (-1997.445) (-1996.577) * (-1985.427) (-1991.096) (-1987.385) [-1987.199] -- 0:00:17
      946200 -- (-1990.004) [-1989.739] (-1992.807) (-1991.338) * (-1989.864) (-2000.547) [-1983.518] (-1988.941) -- 0:00:17
      946300 -- (-1994.567) [-1989.224] (-1997.665) (-1994.664) * (-1992.134) (-1997.055) [-1989.384] (-1989.366) -- 0:00:17
      946400 -- (-1993.697) [-1988.715] (-2001.687) (-1988.841) * (-1991.266) (-1993.612) [-1982.819] (-1987.835) -- 0:00:17
      946500 -- (-1986.917) (-1990.937) [-1989.087] (-1991.728) * (-1998.069) (-1992.185) (-1986.754) [-1985.240] -- 0:00:17
      946600 -- [-1989.684] (-1985.798) (-1999.384) (-1989.686) * (-2002.683) (-1994.867) (-1988.914) [-1985.859] -- 0:00:17
      946700 -- (-1982.970) (-1991.577) (-2000.248) [-1985.528] * (-1996.347) (-1989.209) (-1983.726) [-1983.654] -- 0:00:17
      946800 -- (-1985.321) (-1993.750) (-1995.541) [-1984.926] * (-2004.586) (-1990.475) [-1984.002] (-1987.965) -- 0:00:17
      946900 -- [-1982.346] (-1995.636) (-1990.595) (-1986.047) * (-2004.105) (-1999.074) [-1987.467] (-1988.749) -- 0:00:17
      947000 -- [-1986.755] (-1999.527) (-1989.341) (-1988.028) * (-1999.402) (-1996.492) [-1982.715] (-1992.047) -- 0:00:17

      Average standard deviation of split frequencies: 0.002005

      947100 -- [-1989.324] (-1997.835) (-1990.559) (-1989.735) * (-2004.666) (-1996.914) [-1982.256] (-1989.275) -- 0:00:17
      947200 -- [-1993.131] (-1997.763) (-1991.396) (-1988.426) * (-1996.354) (-1996.704) [-1984.280] (-1992.566) -- 0:00:17
      947300 -- [-1997.976] (-1996.307) (-1994.443) (-1997.119) * (-1992.831) (-2007.464) (-1983.695) [-1989.453] -- 0:00:17
      947400 -- (-1993.226) (-1998.976) [-1988.462] (-1995.406) * (-1989.371) (-1998.519) [-1980.048] (-1993.659) -- 0:00:17
      947500 -- [-1993.330] (-1999.882) (-1990.664) (-1983.978) * (-1984.459) (-2006.976) [-1981.890] (-1988.747) -- 0:00:17
      947600 -- (-2000.910) (-1998.518) (-1996.854) [-1985.285] * (-1989.025) (-2003.075) [-1987.846] (-1993.936) -- 0:00:17
      947700 -- (-2005.328) [-1990.917] (-1990.161) (-1991.077) * (-1992.958) (-2003.780) [-1982.126] (-1997.120) -- 0:00:17
      947800 -- (-2001.307) [-1987.604] (-1992.634) (-2002.314) * (-1992.673) (-2004.784) [-1984.427] (-1998.935) -- 0:00:17
      947900 -- (-1989.293) (-1989.815) [-1991.675] (-2006.204) * (-1988.203) (-2006.439) [-1980.671] (-1997.884) -- 0:00:17
      948000 -- (-1986.507) (-1992.408) [-1987.827] (-2011.859) * (-1985.763) (-1996.046) [-1992.253] (-2002.142) -- 0:00:17

      Average standard deviation of split frequencies: 0.001989

      948100 -- [-1984.673] (-1997.995) (-1995.126) (-1999.317) * [-1986.750] (-1998.629) (-1993.690) (-2000.054) -- 0:00:17
      948200 -- [-1993.720] (-1998.582) (-1997.489) (-1991.082) * [-1985.225] (-1986.174) (-1993.664) (-1999.176) -- 0:00:16
      948300 -- [-1994.376] (-1999.773) (-1996.931) (-1995.295) * (-2001.001) (-1993.106) [-1985.782] (-1998.179) -- 0:00:16
      948400 -- [-1987.097] (-1993.297) (-1998.704) (-2012.793) * (-1994.213) (-1989.349) [-1982.515] (-2005.673) -- 0:00:16
      948500 -- (-1990.810) [-1992.772] (-2004.196) (-1998.733) * (-1995.534) (-1994.828) [-1981.102] (-2004.061) -- 0:00:16
      948600 -- (-1991.575) [-1988.867] (-2005.993) (-1992.702) * (-1990.133) (-2003.903) [-1982.871] (-2000.690) -- 0:00:16
      948700 -- [-1992.688] (-1992.689) (-2002.891) (-1986.671) * [-1992.100] (-2010.587) (-1981.721) (-1998.766) -- 0:00:16
      948800 -- (-1986.610) (-1992.714) (-2001.857) [-1990.351] * (-1990.315) (-2011.528) [-1985.532] (-1996.115) -- 0:00:16
      948900 -- [-1983.131] (-1995.281) (-1993.762) (-1994.532) * (-1994.619) (-2006.805) [-1984.779] (-2002.959) -- 0:00:16
      949000 -- (-1984.067) [-1993.007] (-1994.020) (-1994.298) * (-1999.009) (-2002.043) [-1989.957] (-1990.726) -- 0:00:16

      Average standard deviation of split frequencies: 0.002001

      949100 -- [-1981.731] (-1995.025) (-1988.331) (-2007.628) * (-1997.425) (-1993.256) [-1989.370] (-1992.384) -- 0:00:16
      949200 -- [-1982.488] (-1996.051) (-1987.137) (-2000.572) * (-1994.367) (-1999.088) (-1985.418) [-1985.821] -- 0:00:16
      949300 -- [-1983.491] (-1996.606) (-1987.119) (-1997.877) * (-1993.979) (-1995.023) [-1978.916] (-1995.001) -- 0:00:16
      949400 -- (-1983.363) (-2006.880) (-1983.164) [-1989.863] * (-2001.874) (-1994.762) [-1983.434] (-1985.026) -- 0:00:16
      949500 -- [-1982.123] (-2008.624) (-1989.292) (-1990.736) * (-1994.979) (-1996.189) [-1985.817] (-1989.915) -- 0:00:16
      949600 -- [-1982.083] (-1999.764) (-1986.864) (-1995.794) * (-1991.628) (-1995.579) [-1983.219] (-1991.306) -- 0:00:16
      949700 -- (-1983.645) (-1996.108) [-1989.227] (-1996.260) * (-1987.895) (-1997.493) [-1983.796] (-1985.979) -- 0:00:16
      949800 -- (-1995.493) (-1999.046) (-1991.100) [-1997.906] * (-1987.434) (-1995.861) (-1999.352) [-1987.697] -- 0:00:16
      949900 -- (-1989.289) (-2002.978) (-1993.247) [-1985.337] * (-1995.626) (-1992.909) [-1978.317] (-1992.065) -- 0:00:16
      950000 -- [-1985.590] (-1992.278) (-1993.151) (-1990.526) * (-1981.944) (-1993.521) [-1980.449] (-1997.047) -- 0:00:16

      Average standard deviation of split frequencies: 0.002027

      950100 -- [-1980.018] (-1989.497) (-1997.282) (-1998.470) * [-1987.025] (-1998.086) (-1988.324) (-1993.969) -- 0:00:16
      950200 -- [-1981.895] (-1998.407) (-1994.934) (-1999.350) * (-1988.444) (-1996.840) [-1984.232] (-1991.173) -- 0:00:16
      950300 -- [-1985.003] (-1988.835) (-1998.608) (-2005.522) * [-1991.988] (-1990.249) (-1979.015) (-1993.395) -- 0:00:16
      950400 -- [-1980.254] (-1985.201) (-1997.755) (-2003.916) * (-1994.998) (-1995.783) [-1981.710] (-1993.537) -- 0:00:16
      950500 -- [-1985.246] (-1985.986) (-2002.478) (-2006.571) * (-1990.792) (-1996.016) [-1983.434] (-1996.843) -- 0:00:16
      950600 -- (-1983.264) [-1986.775] (-1991.398) (-2000.501) * (-1995.009) (-1992.298) [-1982.590] (-1997.885) -- 0:00:16
      950700 -- (-1981.617) (-1990.439) [-1989.422] (-1997.224) * (-1998.548) (-2000.054) [-1981.299] (-1994.896) -- 0:00:16
      950800 -- [-1981.686] (-1998.750) (-1993.256) (-1995.349) * (-1996.151) [-1988.397] (-1984.107) (-2002.434) -- 0:00:16
      950900 -- [-1983.509] (-2001.134) (-1996.240) (-1996.792) * (-1994.521) (-1998.273) [-1983.956] (-2000.970) -- 0:00:16
      951000 -- [-1985.450] (-2001.537) (-1989.318) (-1997.829) * (-1996.186) (-1993.243) [-1986.773] (-2003.995) -- 0:00:16

      Average standard deviation of split frequencies: 0.001954

      951100 -- [-1984.092] (-1987.495) (-1991.778) (-1996.467) * (-1995.545) (-1992.881) [-1985.996] (-2001.230) -- 0:00:16
      951200 -- [-1983.312] (-1990.908) (-1994.152) (-1993.399) * (-1999.819) [-1995.298] (-1985.947) (-1999.060) -- 0:00:16
      951300 -- (-1993.278) (-1991.178) [-1993.379] (-1990.844) * (-1996.867) (-1997.538) [-1985.657] (-1998.438) -- 0:00:15
      951400 -- (-1988.885) (-1992.251) [-1993.442] (-1995.775) * (-2003.291) (-1991.649) [-1984.747] (-2001.433) -- 0:00:15
      951500 -- [-1986.494] (-1997.422) (-1993.458) (-1994.483) * (-2002.487) (-1995.959) [-1984.664] (-2001.519) -- 0:00:15
      951600 -- (-1999.268) (-1999.723) (-1986.575) [-1994.858] * (-1994.231) (-2001.162) (-1984.030) [-1992.963] -- 0:00:15
      951700 -- [-1993.421] (-1999.244) (-1996.204) (-1998.690) * (-1993.183) (-1995.846) [-1987.456] (-1998.112) -- 0:00:15
      951800 -- [-1987.825] (-1997.183) (-1992.295) (-2000.683) * (-1987.656) (-1995.129) [-1982.917] (-2006.111) -- 0:00:15
      951900 -- [-1989.225] (-2000.498) (-1999.805) (-1998.353) * (-1988.870) (-1992.330) [-1986.469] (-1997.608) -- 0:00:15
      952000 -- (-1987.421) [-1994.460] (-1997.275) (-2002.266) * (-1996.563) (-1991.594) [-1984.538] (-2004.727) -- 0:00:15

      Average standard deviation of split frequencies: 0.002108

      952100 -- [-1993.131] (-1994.272) (-1998.706) (-1997.527) * (-1988.504) (-1993.005) [-1992.129] (-2004.948) -- 0:00:15
      952200 -- (-1992.905) (-1995.832) (-1991.097) [-1994.115] * (-1992.664) (-1991.682) [-1983.689] (-2005.368) -- 0:00:15
      952300 -- (-1995.063) (-1999.026) [-1991.125] (-1990.153) * [-1997.945] (-1992.174) (-1987.992) (-1998.449) -- 0:00:15
      952400 -- (-1993.942) (-1994.788) [-1986.439] (-1989.687) * (-1992.219) [-1991.224] (-1986.731) (-1994.992) -- 0:00:15
      952500 -- (-1987.441) (-1992.930) [-1987.360] (-1991.662) * [-1990.734] (-1993.162) (-1987.602) (-1998.470) -- 0:00:15
      952600 -- (-1987.124) (-1999.647) [-1988.050] (-1991.258) * (-1995.004) (-2006.468) [-1980.049] (-2003.658) -- 0:00:15
      952700 -- [-1989.153] (-1999.313) (-1993.429) (-1993.458) * (-1995.163) (-1998.881) [-1981.809] (-1991.780) -- 0:00:15
      952800 -- (-1989.634) (-1994.423) [-1991.741] (-1989.318) * (-2000.020) (-2003.454) [-1983.411] (-1992.793) -- 0:00:15
      952900 -- (-1995.007) (-1993.732) (-1992.083) [-1991.854] * (-1997.487) (-2006.877) [-1986.252] (-2000.302) -- 0:00:15
      953000 -- (-1995.473) [-1985.926] (-2000.052) (-1987.294) * (-1992.943) (-2007.992) [-1991.036] (-2006.526) -- 0:00:15

      Average standard deviation of split frequencies: 0.002077

      953100 -- (-1989.356) (-1997.368) (-2003.748) [-1993.675] * (-1993.910) (-2014.508) [-1988.283] (-2000.945) -- 0:00:15
      953200 -- [-1986.365] (-1995.943) (-2017.599) (-1990.898) * (-1986.389) (-2017.786) (-1998.564) [-1998.837] -- 0:00:15
      953300 -- [-1987.147] (-1987.558) (-2009.130) (-1993.643) * [-1984.903] (-2003.193) (-2000.295) (-1994.476) -- 0:00:15
      953400 -- (-1988.711) [-1985.729] (-2001.322) (-1998.533) * [-1985.595] (-2012.430) (-1990.575) (-1995.686) -- 0:00:15
      953500 -- (-1989.208) [-1986.150] (-1994.053) (-1996.970) * [-1988.541] (-2019.673) (-1990.382) (-1992.825) -- 0:00:15
      953600 -- (-1988.780) (-1988.142) (-2001.701) [-1991.336] * [-1985.825] (-2017.690) (-1988.511) (-1992.912) -- 0:00:15
      953700 -- (-1995.462) (-1990.850) (-2002.163) [-1987.768] * [-1982.288] (-2000.442) (-1987.938) (-1989.295) -- 0:00:15
      953800 -- (-1998.762) (-1994.044) (-1998.037) [-1992.449] * [-1985.856] (-2004.252) (-1988.243) (-1989.115) -- 0:00:15
      953900 -- (-1997.934) (-1990.956) [-1993.158] (-1990.795) * [-1990.870] (-2007.400) (-1993.639) (-1993.478) -- 0:00:15
      954000 -- (-1993.129) (-1992.765) [-1987.771] (-1997.750) * (-1985.409) (-1994.683) [-1984.008] (-1990.067) -- 0:00:15

      Average standard deviation of split frequencies: 0.002019

      954100 -- (-1994.820) [-1989.537] (-1990.406) (-1987.298) * [-1985.460] (-1990.041) (-1983.841) (-2005.181) -- 0:00:15
      954200 -- (-1999.922) (-1993.188) (-1992.675) [-1987.570] * (-1995.234) (-1990.703) [-1985.910] (-2002.303) -- 0:00:15
      954300 -- [-1995.666] (-1994.822) (-1993.494) (-1995.162) * (-1995.679) (-1991.184) (-1982.143) [-1999.143] -- 0:00:14
      954400 -- (-1999.485) (-1994.422) [-1990.124] (-1998.985) * (-2001.219) [-1989.963] (-1987.488) (-1998.676) -- 0:00:14
      954500 -- (-1999.547) [-2001.229] (-1987.963) (-1996.933) * (-1998.053) (-1986.312) (-1989.739) [-1989.715] -- 0:00:14
      954600 -- (-2004.935) (-2003.438) [-1987.664] (-1999.451) * (-1995.460) (-1992.332) (-1989.631) [-1983.943] -- 0:00:14
      954700 -- (-1998.571) [-1997.058] (-1990.070) (-1997.493) * (-1995.578) (-1990.501) (-1990.119) [-1985.914] -- 0:00:14
      954800 -- (-2000.930) (-1996.852) [-1986.416] (-1996.046) * (-1999.542) [-1983.651] (-1993.493) (-1987.305) -- 0:00:14
      954900 -- (-2000.175) (-1993.470) [-1989.605] (-1997.623) * (-1996.461) (-1994.405) (-1997.596) [-1989.540] -- 0:00:14
      955000 -- (-1986.900) (-1998.840) [-1989.024] (-1997.795) * (-2006.276) (-1999.164) [-1996.165] (-1988.755) -- 0:00:14

      Average standard deviation of split frequencies: 0.002073

      955100 -- [-1986.384] (-1992.585) (-1993.559) (-1998.981) * (-2000.475) (-1990.988) (-1990.142) [-1986.690] -- 0:00:14
      955200 -- (-1993.036) [-1991.419] (-1990.648) (-1991.338) * (-1991.992) [-1989.631] (-1987.762) (-1997.029) -- 0:00:14
      955300 -- (-1999.624) [-1993.423] (-1993.056) (-1990.252) * (-1994.667) [-1994.004] (-1986.900) (-1996.524) -- 0:00:14
      955400 -- (-2003.602) (-2000.754) (-1993.199) [-1986.118] * (-1991.578) (-1991.150) (-1985.615) [-1994.170] -- 0:00:14
      955500 -- (-2001.601) (-2018.271) (-1986.897) [-1987.082] * (-1994.616) (-1987.054) [-1986.165] (-1991.253) -- 0:00:14
      955600 -- (-2004.318) (-2006.929) [-1988.858] (-1996.781) * [-1995.514] (-1985.808) (-1990.292) (-1990.892) -- 0:00:14
      955700 -- (-1998.451) (-1998.108) [-1986.023] (-1997.364) * (-1991.288) (-1997.822) (-1984.868) [-1982.716] -- 0:00:14
      955800 -- (-2008.462) (-2001.463) [-1986.379] (-1993.686) * (-1988.971) (-1997.175) (-1985.876) [-1984.525] -- 0:00:14
      955900 -- (-2000.055) (-1997.015) (-1985.998) [-1984.299] * (-1996.545) (-1993.319) [-1990.229] (-1989.218) -- 0:00:14
      956000 -- (-1994.720) (-2002.619) [-1990.307] (-1990.978) * (-1989.205) (-2000.092) [-1985.202] (-1992.197) -- 0:00:14

      Average standard deviation of split frequencies: 0.001958

      956100 -- (-1992.120) (-1996.489) [-1986.692] (-1990.466) * (-1993.495) (-1993.648) [-1984.910] (-1983.569) -- 0:00:14
      956200 -- [-1986.557] (-1996.698) (-1995.066) (-1984.929) * (-1999.209) (-1994.672) (-1983.738) [-1982.083] -- 0:00:14
      956300 -- [-1986.574] (-2008.030) (-1989.379) (-1985.531) * (-1998.651) (-2000.186) (-1980.825) [-1982.480] -- 0:00:14
      956400 -- (-1987.343) (-2006.254) (-1991.938) [-1987.033] * (-2000.524) (-1996.970) [-1983.257] (-1985.100) -- 0:00:14
      956500 -- (-1991.164) (-2014.068) [-1987.906] (-1986.166) * (-1993.065) (-1993.708) (-1983.748) [-1981.600] -- 0:00:14
      956600 -- (-1992.205) (-2006.853) [-1985.417] (-1989.077) * (-1989.140) (-1989.179) [-1979.871] (-1981.485) -- 0:00:14
      956700 -- (-1995.142) (-1995.378) [-1985.988] (-1991.024) * (-1991.634) (-1992.929) (-1985.777) [-1982.553] -- 0:00:14
      956800 -- (-1993.978) (-1993.425) (-1986.629) [-1993.173] * (-1997.002) (-1998.040) (-1984.831) [-1978.890] -- 0:00:14
      956900 -- (-1994.260) [-1990.768] (-1987.082) (-1998.950) * (-2001.220) (-1995.997) (-1981.343) [-1979.766] -- 0:00:14
      957000 -- (-1997.995) [-1986.738] (-1986.656) (-1993.316) * (-1990.669) (-1994.482) [-1984.192] (-1982.320) -- 0:00:14

      Average standard deviation of split frequencies: 0.001928

      957100 -- (-1999.859) [-1989.826] (-1994.113) (-1990.013) * (-1994.043) (-1994.788) [-1979.613] (-1985.013) -- 0:00:14
      957200 -- (-1998.678) [-1984.555] (-2000.600) (-1989.902) * (-1987.625) (-2000.865) [-1979.743] (-1995.304) -- 0:00:14
      957300 -- (-1996.172) [-1985.317] (-1993.079) (-1990.730) * (-1986.170) (-1998.339) [-1978.399] (-1987.281) -- 0:00:14
      957400 -- (-1999.948) (-1988.973) [-1988.980] (-2003.210) * [-1989.899] (-1990.163) (-1984.813) (-1989.676) -- 0:00:13
      957500 -- (-2010.200) [-1988.686] (-1993.803) (-1996.517) * (-1988.573) [-1987.451] (-1981.101) (-2001.406) -- 0:00:13
      957600 -- (-2001.897) (-1988.096) [-1989.791] (-1997.830) * [-1988.625] (-1992.260) (-1984.834) (-1994.928) -- 0:00:13
      957700 -- (-1998.268) [-1989.706] (-1992.929) (-1999.039) * (-1986.244) (-1984.936) [-1981.133] (-1991.293) -- 0:00:13
      957800 -- (-1999.624) (-1994.220) [-1992.058] (-1994.315) * (-1997.041) (-1995.081) [-1983.315] (-1991.278) -- 0:00:13
      957900 -- (-1996.554) (-2000.506) [-1988.071] (-1992.660) * [-1990.349] (-1992.603) (-1983.688) (-1995.688) -- 0:00:13
      958000 -- [-1991.804] (-1995.401) (-1987.485) (-2002.271) * (-1992.247) (-1998.891) [-1981.665] (-1991.112) -- 0:00:13

      Average standard deviation of split frequencies: 0.001940

      958100 -- [-1992.297] (-2000.274) (-1988.397) (-2005.059) * (-1988.156) (-2008.362) [-1983.599] (-1993.675) -- 0:00:13
      958200 -- (-1997.632) (-2009.494) [-1983.030] (-1998.815) * (-1992.360) (-2002.947) [-1985.721] (-1987.900) -- 0:00:13
      958300 -- (-2001.467) (-2002.458) [-1983.736] (-1996.300) * (-1996.710) (-1997.412) [-1987.069] (-1990.432) -- 0:00:13
      958400 -- (-2005.192) (-2004.866) [-1987.711] (-1988.615) * (-1993.849) (-1996.847) [-1983.637] (-1985.075) -- 0:00:13
      958500 -- (-1994.568) (-2013.408) [-1984.648] (-1986.038) * (-1993.379) (-1988.894) [-1983.814] (-1985.108) -- 0:00:13
      958600 -- (-1993.145) (-1999.668) (-1987.256) [-1986.269] * (-1990.083) (-1997.131) [-1985.545] (-1998.374) -- 0:00:13
      958700 -- (-1996.600) (-1996.075) (-1988.193) [-1988.945] * (-1993.126) (-1988.701) [-1992.718] (-2008.121) -- 0:00:13
      958800 -- (-1983.012) (-1988.176) [-1984.660] (-1989.419) * [-1990.127] (-1986.426) (-1990.218) (-2004.110) -- 0:00:13
      958900 -- (-1984.569) (-1988.466) (-1988.821) [-1988.577] * (-1997.556) (-1994.352) [-1984.793] (-1994.657) -- 0:00:13
      959000 -- [-1985.092] (-1988.963) (-1993.158) (-1993.789) * (-1993.524) (-1989.327) [-1983.233] (-1989.559) -- 0:00:13

      Average standard deviation of split frequencies: 0.001882

      959100 -- [-1985.109] (-1988.391) (-1986.749) (-1994.806) * (-1991.175) (-1987.724) [-1983.758] (-1993.244) -- 0:00:13
      959200 -- (-1989.785) (-1989.669) [-1989.869] (-1996.110) * (-1998.021) (-1985.022) (-1986.570) [-1990.789] -- 0:00:13
      959300 -- (-1992.376) (-1989.385) [-1990.738] (-1996.863) * (-1994.992) [-1984.420] (-1996.268) (-1989.295) -- 0:00:13
      959400 -- (-1994.665) (-1987.035) [-1989.587] (-2000.212) * (-1991.468) (-1988.807) [-1985.810] (-2000.989) -- 0:00:13
      959500 -- (-1999.584) (-1992.183) [-1987.429] (-2001.956) * [-1990.180] (-1995.431) (-2001.421) (-2000.229) -- 0:00:13
      959600 -- (-1992.736) (-1991.111) [-1986.027] (-1999.543) * (-1988.950) (-1998.816) [-1987.524] (-1992.967) -- 0:00:13
      959700 -- (-1992.752) (-1990.206) [-1984.304] (-1999.476) * [-1990.511] (-1994.688) (-1988.621) (-1996.443) -- 0:00:13
      959800 -- (-1994.829) (-1998.846) [-1983.118] (-1999.714) * (-1994.818) (-2012.856) [-1982.611] (-2003.000) -- 0:00:13
      959900 -- (-1993.914) (-2001.021) [-1982.225] (-1987.555) * (-1993.873) (-2000.257) [-1984.837] (-1994.606) -- 0:00:13
      960000 -- (-1989.374) (-1996.783) (-1989.277) [-1985.279] * (-1995.796) (-1997.719) [-1987.258] (-1985.173) -- 0:00:13

      Average standard deviation of split frequencies: 0.001936

      960100 -- (-1994.026) (-1999.042) [-1987.515] (-1991.002) * (-2000.818) (-2000.270) (-1984.270) [-1983.916] -- 0:00:13
      960200 -- (-2006.757) (-1996.832) [-1988.287] (-1996.949) * (-2001.195) (-1998.699) (-1983.743) [-1983.636] -- 0:00:13
      960300 -- (-2017.816) (-1994.736) (-1983.958) [-1994.934] * (-1996.970) (-1994.607) [-1983.892] (-1987.168) -- 0:00:13
      960400 -- (-2020.459) (-1990.887) [-1983.286] (-1993.879) * (-1993.501) (-1997.409) (-1987.007) [-1983.511] -- 0:00:12
      960500 -- (-2004.404) (-1988.368) [-1985.367] (-1994.547) * (-2004.291) (-1996.717) (-1989.629) [-1986.773] -- 0:00:12
      960600 -- (-2002.158) (-1993.976) (-1984.969) [-1994.268] * (-1999.472) (-1996.243) (-1989.565) [-1982.955] -- 0:00:12
      960700 -- (-1996.490) (-1998.454) [-1983.630] (-1993.744) * (-1988.535) (-1993.855) (-1984.602) [-1982.155] -- 0:00:12
      960800 -- (-1995.645) (-1997.709) [-1980.865] (-1993.709) * (-1989.929) (-1994.563) (-1984.006) [-1980.187] -- 0:00:12
      960900 -- (-1993.980) (-1997.546) [-1991.820] (-1989.355) * (-2000.349) (-1992.894) [-1982.898] (-1984.900) -- 0:00:12
      961000 -- (-1992.666) (-1997.427) (-1987.524) [-1989.767] * (-1993.710) [-1986.935] (-1989.807) (-1989.133) -- 0:00:12

      Average standard deviation of split frequencies: 0.001920

      961100 -- (-1988.084) (-1995.026) [-1986.764] (-1991.532) * (-2003.634) (-1983.539) [-1986.956] (-1996.442) -- 0:00:12
      961200 -- (-1995.271) (-2001.929) [-1981.809] (-1989.835) * (-2009.039) (-1992.618) [-1981.232] (-1993.958) -- 0:00:12
      961300 -- (-1990.690) (-1994.330) [-1989.411] (-1989.305) * (-1999.654) (-1990.858) [-1983.075] (-1990.262) -- 0:00:12
      961400 -- (-2000.115) (-2005.157) [-1994.084] (-1993.246) * (-2007.921) (-2002.852) (-1985.635) [-1990.597] -- 0:00:12
      961500 -- [-1996.903] (-1994.359) (-1994.989) (-1997.587) * (-2000.929) (-1994.742) [-1981.122] (-1985.558) -- 0:00:12
      961600 -- (-1989.667) (-2000.386) (-1988.379) [-1989.863] * (-1998.109) (-1992.547) (-1978.552) [-1987.526] -- 0:00:12
      961700 -- (-1992.290) (-2004.767) [-1982.259] (-1988.092) * (-1993.626) (-2000.109) (-1988.184) [-1983.511] -- 0:00:12
      961800 -- [-1990.173] (-1993.500) (-1983.999) (-1996.048) * (-1988.281) (-2002.346) (-1981.583) [-1989.961] -- 0:00:12
      961900 -- (-1988.296) (-1987.791) [-1979.300] (-2001.402) * [-1984.810] (-1994.177) (-1992.053) (-2002.739) -- 0:00:12
      962000 -- (-1996.053) (-1984.061) [-1979.870] (-1991.118) * [-1983.615] (-1994.947) (-1987.633) (-1986.292) -- 0:00:12

      Average standard deviation of split frequencies: 0.001988

      962100 -- (-1997.377) [-1982.129] (-1981.244) (-1992.521) * [-1982.345] (-1991.161) (-1985.024) (-1984.907) -- 0:00:12
      962200 -- (-1989.891) (-1988.935) [-1979.962] (-1997.863) * (-1980.195) (-1991.957) (-1990.514) [-1991.491] -- 0:00:12
      962300 -- (-1992.755) (-1990.616) [-1983.361] (-1997.076) * [-1982.956] (-1992.489) (-1989.651) (-1995.675) -- 0:00:12
      962400 -- (-1993.476) (-1994.522) [-1982.587] (-1991.158) * (-1987.821) (-1990.991) [-1980.119] (-2003.930) -- 0:00:12
      962500 -- (-1998.108) (-1994.247) (-1985.786) [-1988.309] * (-1986.277) (-1991.404) [-1993.462] (-1991.542) -- 0:00:12
      962600 -- (-2003.610) (-1990.098) [-1985.183] (-2004.014) * [-1982.842] (-1998.504) (-1995.086) (-1995.424) -- 0:00:12
      962700 -- (-1996.338) [-1990.724] (-1983.132) (-1990.372) * (-1982.584) (-1995.779) (-1996.166) [-1989.053] -- 0:00:12
      962800 -- (-1997.784) (-1988.380) [-1986.248] (-1990.090) * [-1984.059] (-1991.234) (-1999.125) (-1984.771) -- 0:00:12
      962900 -- (-2004.326) (-1985.100) (-1986.181) [-1993.624] * (-1985.770) (-1999.244) (-1987.628) [-1983.186] -- 0:00:12
      963000 -- (-2004.923) (-1994.043) [-1990.589] (-1985.532) * [-1981.430] (-1999.438) (-1988.744) (-1982.853) -- 0:00:12

      Average standard deviation of split frequencies: 0.001986

      963100 -- (-1998.238) (-2004.298) [-1986.176] (-1985.891) * (-1985.021) (-1988.963) (-1989.240) [-1981.405] -- 0:00:12
      963200 -- (-1999.752) (-2000.149) (-1979.683) [-1990.703] * (-1987.132) (-1996.105) [-1987.514] (-1984.792) -- 0:00:12
      963300 -- (-2004.504) [-1991.952] (-1981.745) (-1995.400) * [-1982.849] (-1996.621) (-1991.397) (-1984.090) -- 0:00:12
      963400 -- (-1999.399) (-1989.971) [-1983.313] (-1990.962) * (-1987.291) (-1997.937) [-1986.508] (-1981.171) -- 0:00:12
      963500 -- (-1997.811) (-1992.106) [-1980.719] (-1993.137) * (-1983.331) (-1998.789) [-1984.699] (-1985.505) -- 0:00:11
      963600 -- (-1994.288) (-1985.788) [-1981.156] (-1993.706) * [-1980.978] (-2002.127) (-1980.018) (-1991.923) -- 0:00:11
      963700 -- (-1996.342) [-1985.482] (-1984.761) (-2001.300) * [-1979.740] (-2005.723) (-1983.879) (-1990.178) -- 0:00:11
      963800 -- (-1990.356) (-1989.609) [-1982.366] (-2001.218) * [-1979.429] (-1996.743) (-1982.608) (-1989.510) -- 0:00:11
      963900 -- [-1986.562] (-1990.914) (-1988.002) (-1994.755) * (-1978.211) (-1998.941) [-1985.474] (-1989.128) -- 0:00:11
      964000 -- [-1987.378] (-1989.977) (-2002.755) (-1995.095) * (-1987.784) (-1994.982) [-1983.090] (-1983.781) -- 0:00:11

      Average standard deviation of split frequencies: 0.002068

      964100 -- [-1984.501] (-2001.808) (-1999.861) (-1990.962) * (-1981.051) (-1993.903) (-1983.061) [-1981.395] -- 0:00:11
      964200 -- (-1987.974) (-1994.624) (-1998.445) [-1985.990] * (-1983.592) (-1997.008) [-1987.037] (-1986.593) -- 0:00:11
      964300 -- [-1988.445] (-1995.690) (-2002.681) (-1990.916) * (-1988.278) (-2004.764) (-1989.768) [-1983.690] -- 0:00:11
      964400 -- (-1993.900) (-1996.468) (-1999.711) [-1990.372] * (-1992.791) (-1994.161) (-1989.528) [-1983.532] -- 0:00:11
      964500 -- (-1993.925) (-1993.612) (-2003.588) [-1985.408] * (-1987.048) (-1993.856) (-1986.732) [-1989.816] -- 0:00:11
      964600 -- (-1991.393) [-1986.289] (-2001.508) (-1989.856) * [-1982.217] (-1998.958) (-1987.191) (-1988.254) -- 0:00:11
      964700 -- (-1993.219) (-1997.113) (-1996.091) [-1993.083] * [-1984.413] (-1991.534) (-1985.682) (-1989.776) -- 0:00:11
      964800 -- (-2001.588) (-2002.270) (-2000.687) [-1998.880] * [-1985.225] (-1994.168) (-1981.784) (-1989.016) -- 0:00:11
      964900 -- (-2000.054) (-1995.811) (-1992.330) [-1988.949] * (-1996.191) (-1995.229) [-1978.842] (-1989.684) -- 0:00:11
      965000 -- (-1995.195) (-1993.793) (-1993.955) [-1988.944] * (-2004.605) (-1993.300) [-1985.421] (-1991.865) -- 0:00:11

      Average standard deviation of split frequencies: 0.001912

      965100 -- (-1990.780) (-1995.025) (-1992.074) [-1988.929] * (-1988.637) (-1996.087) [-1984.101] (-1993.285) -- 0:00:11
      965200 -- [-1992.980] (-1992.425) (-1997.590) (-1992.762) * [-1985.686] (-1995.397) (-1982.471) (-1985.114) -- 0:00:11
      965300 -- [-1988.556] (-1994.012) (-1999.726) (-1995.635) * (-1985.798) (-1996.650) (-1993.249) [-1985.709] -- 0:00:11
      965400 -- [-1987.437] (-1993.784) (-2002.420) (-1990.374) * [-1983.738] (-1990.058) (-1992.369) (-1991.034) -- 0:00:11
      965500 -- (-1992.362) (-1997.655) [-1997.190] (-1994.155) * [-1984.132] (-1996.898) (-1983.022) (-1998.437) -- 0:00:11
      965600 -- [-1987.793] (-1991.284) (-2006.184) (-1991.811) * [-1979.402] (-1993.764) (-1987.470) (-1996.087) -- 0:00:11
      965700 -- (-1998.176) [-1993.946] (-2011.095) (-1991.694) * [-1980.738] (-1994.669) (-1983.449) (-1993.982) -- 0:00:11
      965800 -- (-1995.109) [-1989.709] (-2006.807) (-1990.798) * [-1981.176] (-1994.561) (-1986.914) (-2001.232) -- 0:00:11
      965900 -- [-1991.685] (-1987.700) (-2005.870) (-1992.667) * (-1981.235) [-1986.168] (-1995.225) (-2003.751) -- 0:00:11
      966000 -- (-2010.267) [-1986.255] (-1991.551) (-2004.287) * (-1983.819) (-1993.141) (-2003.940) [-1998.055] -- 0:00:11

      Average standard deviation of split frequencies: 0.001854

      966100 -- (-1995.874) [-1988.502] (-1990.541) (-1998.107) * [-1982.286] (-1986.305) (-1990.450) (-1995.774) -- 0:00:11
      966200 -- (-1998.381) [-1985.738] (-1986.742) (-1991.029) * (-1983.429) (-1988.863) [-1986.105] (-2003.394) -- 0:00:11
      966300 -- (-2006.076) (-1986.579) [-1983.729] (-1992.600) * (-1986.253) (-2005.410) [-1984.502] (-1995.014) -- 0:00:11
      966400 -- (-1997.459) (-1989.681) (-1989.369) [-1990.402] * [-1981.487] (-1999.984) (-1989.272) (-1997.132) -- 0:00:11
      966500 -- (-2005.835) [-1982.788] (-1995.148) (-1990.767) * (-1976.696) (-1996.264) [-1983.386] (-1990.288) -- 0:00:10
      966600 -- (-2010.373) [-1984.369] (-1985.699) (-1991.882) * [-1978.222] (-1995.060) (-1987.768) (-1988.412) -- 0:00:10
      966700 -- (-2007.689) (-1991.096) [-1985.750] (-1995.701) * [-1979.846] (-1993.890) (-1987.919) (-1986.393) -- 0:00:10
      966800 -- (-2009.245) (-1990.237) [-1986.896] (-1994.544) * (-1982.372) (-2003.394) (-1980.220) [-1983.334] -- 0:00:10
      966900 -- (-2006.554) (-1987.190) [-1990.458] (-1997.944) * (-1980.985) (-2004.448) [-1981.505] (-1991.805) -- 0:00:10
      967000 -- (-1996.720) [-1986.562] (-1993.491) (-1992.658) * (-1990.265) (-2012.372) [-1979.636] (-1986.630) -- 0:00:10

      Average standard deviation of split frequencies: 0.001936

      967100 -- (-2000.196) [-1986.167] (-1996.255) (-1986.874) * (-1986.532) (-2008.985) (-1985.386) [-1986.221] -- 0:00:10
      967200 -- (-2003.434) (-1984.988) [-1987.939] (-1989.380) * (-1985.983) (-2013.506) [-1982.358] (-1996.980) -- 0:00:10
      967300 -- (-2003.501) (-1986.401) (-1988.957) [-1987.351] * [-1989.683] (-2014.603) (-1979.708) (-1997.559) -- 0:00:10
      967400 -- (-1998.895) (-1993.685) [-1989.129] (-1988.119) * [-1986.937] (-2004.847) (-1983.447) (-1997.295) -- 0:00:10
      967500 -- (-1998.473) [-1986.862] (-1993.564) (-1989.478) * [-1986.873] (-2001.914) (-1993.938) (-1989.220) -- 0:00:10
      967600 -- (-1995.232) (-1985.520) (-1990.735) [-1985.254] * [-1985.288] (-1998.039) (-1985.411) (-1995.177) -- 0:00:10
      967700 -- (-1998.142) [-1987.319] (-1997.034) (-1982.166) * [-1982.546] (-1991.366) (-1986.023) (-1998.422) -- 0:00:10
      967800 -- [-1987.797] (-1992.058) (-2004.009) (-1983.239) * [-1985.790] (-1993.563) (-1989.421) (-2007.507) -- 0:00:10
      967900 -- (-1991.143) (-1991.626) (-1999.290) [-1987.488] * (-1983.551) (-1994.796) [-1993.801] (-2013.625) -- 0:00:10
      968000 -- (-1989.162) (-1991.199) (-1999.865) [-1984.219] * [-1978.698] (-1992.145) (-1996.214) (-2002.211) -- 0:00:10

      Average standard deviation of split frequencies: 0.001906

      968100 -- [-1995.542] (-1996.893) (-1997.427) (-1987.366) * [-1978.246] (-1989.127) (-1998.379) (-1997.573) -- 0:00:10
      968200 -- [-1990.383] (-1998.769) (-1999.523) (-1987.049) * (-1981.418) (-1989.069) [-1985.541] (-1999.943) -- 0:00:10
      968300 -- (-1997.032) (-1996.563) (-1997.369) [-1985.763] * (-1981.130) (-1991.272) (-1995.857) [-1988.900] -- 0:00:10
      968400 -- (-1997.411) (-2006.427) (-1991.582) [-1982.901] * (-1991.190) (-1986.932) (-1990.115) [-1985.325] -- 0:00:10
      968500 -- (-1993.758) (-1994.855) (-1990.396) [-1986.138] * (-1991.503) [-1986.461] (-1990.115) (-1989.869) -- 0:00:10
      968600 -- (-1994.552) [-1988.306] (-1984.954) (-1985.397) * [-1988.062] (-1989.286) (-1987.413) (-1997.095) -- 0:00:10
      968700 -- (-1986.589) (-1987.785) (-1984.666) [-1989.231] * (-1998.497) (-1990.992) [-1985.810] (-1988.393) -- 0:00:10
      968800 -- (-1990.100) [-1987.081] (-1990.180) (-1994.400) * (-1995.853) (-1989.688) (-1981.446) [-1984.154] -- 0:00:10
      968900 -- (-1993.949) [-1988.316] (-1985.249) (-1991.495) * (-1989.912) (-1990.469) [-1982.805] (-1984.464) -- 0:00:10
      969000 -- (-2006.087) (-1989.903) [-1984.495] (-1993.823) * (-1987.194) (-2001.517) [-1979.524] (-1982.832) -- 0:00:10

      Average standard deviation of split frequencies: 0.001918

      969100 -- (-2002.318) (-1986.167) [-1984.701] (-1993.085) * (-1992.813) (-2006.145) [-1981.082] (-1986.992) -- 0:00:10
      969200 -- (-2000.986) (-1991.793) (-1984.559) [-1993.058] * (-1990.980) (-2010.355) [-1982.967] (-1988.235) -- 0:00:10
      969300 -- (-1993.701) (-1989.727) [-1989.231] (-1992.250) * (-1992.138) (-2009.417) (-1988.978) [-1988.636] -- 0:00:10
      969400 -- (-1997.914) (-1992.878) [-1984.995] (-1994.232) * (-1987.545) (-2001.722) [-1987.151] (-1980.007) -- 0:00:10
      969500 -- (-1996.479) (-1989.510) [-1985.122] (-1996.654) * (-1988.108) (-2003.047) (-1992.133) [-1982.147] -- 0:00:10
      969600 -- (-1990.620) (-1987.717) [-1981.935] (-1996.757) * (-1989.941) [-1996.496] (-1989.454) (-1990.260) -- 0:00:09
      969700 -- (-1992.932) (-1991.293) [-1985.039] (-1996.052) * (-1987.722) (-2005.966) (-1992.634) [-1991.917] -- 0:00:09
      969800 -- [-1993.262] (-1993.669) (-1983.935) (-1997.477) * [-1983.552] (-2004.637) (-1989.632) (-1995.577) -- 0:00:09
      969900 -- (-2001.288) (-1993.231) [-1985.677] (-1993.220) * [-1982.860] (-2005.941) (-1995.176) (-1989.844) -- 0:00:09
      970000 -- (-2002.562) (-1995.623) [-1983.946] (-1994.833) * (-1990.474) (-2001.661) (-1999.230) [-1987.724] -- 0:00:09

      Average standard deviation of split frequencies: 0.001874

      970100 -- (-1998.277) (-1995.596) [-1985.368] (-1989.995) * (-1989.733) (-1992.203) (-1995.667) [-1989.871] -- 0:00:09
      970200 -- (-1990.792) (-1999.401) [-1986.267] (-1997.009) * [-1985.167] (-2003.257) (-1989.155) (-1985.269) -- 0:00:09
      970300 -- (-1994.317) (-2012.229) [-1988.135] (-1988.191) * [-1980.083] (-2000.389) (-1984.734) (-1990.648) -- 0:00:09
      970400 -- (-2008.691) (-1999.844) (-1990.140) [-1982.441] * [-1981.050] (-1991.285) (-1984.884) (-1998.441) -- 0:00:09
      970500 -- [-1999.778] (-1996.147) (-1990.473) (-1990.429) * [-1983.514] (-1992.832) (-1989.985) (-1991.187) -- 0:00:09
      970600 -- (-2000.201) (-1991.699) [-1986.355] (-1987.724) * [-1983.810] (-1996.049) (-1986.012) (-1990.592) -- 0:00:09
      970700 -- (-1992.046) (-1993.178) [-1980.080] (-1985.906) * [-1982.176] (-1994.730) (-1991.689) (-1987.313) -- 0:00:09
      970800 -- (-1999.095) (-2000.738) [-1986.913] (-1987.810) * (-1980.969) (-1992.854) (-1989.430) [-1983.504] -- 0:00:09
      970900 -- (-2002.215) (-2001.902) (-1990.059) [-1988.776] * [-1985.544] (-1992.453) (-1993.014) (-1984.047) -- 0:00:09
      971000 -- (-1996.989) (-1994.276) [-1981.921] (-1986.989) * (-1987.484) (-1992.383) (-1990.538) [-1983.555] -- 0:00:09

      Average standard deviation of split frequencies: 0.001844

      971100 -- (-1995.302) (-2000.553) (-1986.160) [-1985.881] * (-1991.637) (-1992.742) [-1986.270] (-1990.761) -- 0:00:09
      971200 -- [-1992.482] (-2000.709) (-1998.878) (-1988.833) * [-1986.626] (-1990.906) (-1982.587) (-1989.257) -- 0:00:09
      971300 -- (-2002.461) (-1996.578) [-1986.305] (-1990.791) * (-1991.716) (-1997.266) (-1984.706) [-1987.693] -- 0:00:09
      971400 -- (-1996.249) (-1996.801) (-1986.014) [-1989.080] * (-1992.003) (-2000.929) [-1981.307] (-1984.870) -- 0:00:09
      971500 -- (-1995.418) (-1995.090) [-1982.422] (-1997.029) * (-1990.077) (-1993.980) [-1979.744] (-1987.148) -- 0:00:09
      971600 -- (-1992.907) [-1986.831] (-1986.812) (-1992.580) * (-1985.032) (-2002.729) [-1981.870] (-1983.810) -- 0:00:09
      971700 -- (-1997.550) (-2000.287) (-1987.584) [-1995.859] * (-1989.067) (-1996.339) [-1977.707] (-1994.131) -- 0:00:09
      971800 -- (-2000.483) (-2000.854) [-1984.471] (-1989.882) * [-1987.973] (-1991.702) (-1980.578) (-1992.577) -- 0:00:09
      971900 -- (-1993.323) (-1990.357) [-1988.100] (-1991.578) * (-2001.790) (-1991.473) [-1979.403] (-1998.544) -- 0:00:09
      972000 -- (-1997.775) (-1998.560) [-1988.074] (-1993.500) * (-1995.198) (-1990.972) [-1980.472] (-1994.956) -- 0:00:09

      Average standard deviation of split frequencies: 0.001898

      972100 -- (-1997.141) (-2009.395) [-1991.995] (-1998.695) * (-1990.711) (-1993.614) [-1983.993] (-1989.550) -- 0:00:09
      972200 -- (-2002.014) (-2001.820) [-1989.417] (-1992.405) * [-1985.162] (-1999.355) (-1984.972) (-1986.039) -- 0:00:09
      972300 -- (-1998.070) (-1998.242) [-1986.250] (-1992.091) * (-1991.444) (-1990.601) (-1988.022) [-1983.597] -- 0:00:09
      972400 -- (-1995.060) (-1997.781) [-1982.792] (-1992.830) * (-1984.054) (-1994.030) (-1984.856) [-1986.422] -- 0:00:09
      972500 -- (-1993.136) (-1995.679) [-1983.144] (-1997.929) * (-1991.450) (-1988.641) (-1982.355) [-1981.304] -- 0:00:09
      972600 -- (-1996.095) [-1991.981] (-1984.548) (-1990.831) * (-1993.831) (-1988.388) [-1979.469] (-1983.885) -- 0:00:08
      972700 -- (-1997.972) (-1994.874) [-1986.389] (-1986.491) * (-1993.212) (-1992.481) (-1987.530) [-1984.943] -- 0:00:08
      972800 -- (-1996.406) (-1996.122) (-1990.093) [-1987.603] * (-1997.216) (-1996.663) [-1980.792] (-1986.296) -- 0:00:08
      972900 -- (-2000.042) (-1997.248) (-1990.381) [-1985.610] * (-1996.462) (-1994.464) [-1980.086] (-1991.343) -- 0:00:08
      973000 -- (-1998.771) (-1989.398) (-1985.029) [-1984.818] * (-2000.753) (-1990.647) [-1977.089] (-1999.534) -- 0:00:08

      Average standard deviation of split frequencies: 0.002062

      973100 -- (-2000.686) [-1988.441] (-1989.719) (-1985.586) * (-2000.302) (-1993.222) [-1977.429] (-1999.066) -- 0:00:08
      973200 -- (-2006.664) [-1983.013] (-1991.866) (-1987.173) * (-1998.317) (-1996.653) [-1980.697] (-2007.797) -- 0:00:08
      973300 -- (-1999.627) [-1987.569] (-1993.517) (-1986.833) * (-1989.581) (-1991.395) [-1978.405] (-1995.971) -- 0:00:08
      973400 -- (-1999.893) (-1991.508) [-1993.214] (-1990.983) * (-1990.186) (-1993.248) [-1980.163] (-1995.620) -- 0:00:08
      973500 -- (-1997.102) [-1991.569] (-1999.516) (-1990.970) * (-1988.641) (-2002.082) [-1983.485] (-1996.926) -- 0:00:08
      973600 -- (-1998.596) [-1989.283] (-2000.134) (-1994.461) * [-1987.827] (-1993.605) (-1987.465) (-1996.399) -- 0:00:08
      973700 -- (-1997.259) [-1988.329] (-1997.371) (-1999.658) * [-1980.750] (-2002.533) (-1990.855) (-1999.713) -- 0:00:08
      973800 -- (-1996.580) [-1992.606] (-1999.665) (-2004.972) * [-1983.963] (-2010.233) (-1985.107) (-1995.454) -- 0:00:08
      973900 -- [-1997.212] (-1992.888) (-1993.015) (-2004.698) * [-1985.332] (-2000.228) (-1989.253) (-1991.349) -- 0:00:08
      974000 -- (-1998.947) [-1984.237] (-1991.706) (-2004.259) * [-1980.520] (-1992.195) (-1982.885) (-2001.839) -- 0:00:08

      Average standard deviation of split frequencies: 0.002088

      974100 -- (-1994.470) (-1985.809) [-1987.756] (-1999.203) * [-1986.741] (-1992.509) (-1990.576) (-2000.151) -- 0:00:08
      974200 -- (-1995.402) (-1988.121) (-1997.242) [-1994.818] * (-1987.820) (-1988.935) [-1985.319] (-1999.670) -- 0:00:08
      974300 -- (-2001.940) [-1983.812] (-1990.388) (-1997.236) * (-1987.868) (-1989.375) [-1982.834] (-2009.374) -- 0:00:08
      974400 -- (-1997.088) [-1983.382] (-1988.568) (-2000.854) * [-1984.809] (-1994.847) (-1984.184) (-2010.988) -- 0:00:08
      974500 -- (-1996.977) [-1983.900] (-1993.300) (-1998.418) * [-1984.529] (-1992.770) (-1983.926) (-2008.806) -- 0:00:08
      974600 -- (-1997.235) [-1986.742] (-2001.167) (-2010.333) * [-1990.193] (-1988.356) (-1984.380) (-2001.340) -- 0:00:08
      974700 -- (-1995.314) [-1987.818] (-1999.439) (-2002.120) * [-1984.211] (-1989.095) (-1989.129) (-2001.673) -- 0:00:08
      974800 -- (-1994.428) (-1989.697) (-1991.345) [-1994.999] * [-1984.304] (-1989.085) (-1991.946) (-1999.703) -- 0:00:08
      974900 -- [-1989.185] (-1985.944) (-1994.508) (-1993.166) * [-1982.118] (-1986.950) (-1989.439) (-1996.694) -- 0:00:08
      975000 -- [-1989.943] (-1986.844) (-1992.961) (-1998.832) * (-1987.187) (-1988.926) [-1983.575] (-1993.017) -- 0:00:08

      Average standard deviation of split frequencies: 0.001989

      975100 -- (-1987.960) (-1987.975) [-1993.269] (-1999.404) * (-1991.145) (-1988.619) [-1982.952] (-1993.623) -- 0:00:08
      975200 -- (-1990.683) (-1994.076) [-1986.732] (-1998.315) * (-1989.514) (-2005.517) [-1977.128] (-2000.766) -- 0:00:08
      975300 -- (-1990.510) [-1985.960] (-1984.636) (-2005.881) * (-1986.871) (-2005.324) [-1976.924] (-2008.126) -- 0:00:08
      975400 -- (-1985.470) [-1988.423] (-1983.726) (-1998.409) * (-1990.357) (-1997.786) [-1979.996] (-1995.459) -- 0:00:08
      975500 -- [-1982.197] (-1992.344) (-1982.646) (-2000.646) * (-1987.724) (-1999.616) [-1980.933] (-1992.208) -- 0:00:08
      975600 -- [-1979.940] (-1996.596) (-1987.934) (-1995.837) * (-1986.877) (-1998.744) [-1979.613] (-2001.269) -- 0:00:08
      975700 -- [-1977.119] (-1998.980) (-1990.375) (-1997.991) * (-1985.073) [-1989.250] (-1979.242) (-2004.755) -- 0:00:07
      975800 -- [-1982.616] (-1993.544) (-1996.356) (-2012.004) * [-1981.053] (-1994.894) (-1978.594) (-2004.522) -- 0:00:07
      975900 -- [-1986.746] (-1998.589) (-2000.243) (-1995.262) * (-1992.064) (-1988.018) (-1982.755) [-1995.378] -- 0:00:07
      976000 -- (-1981.074) [-1987.750] (-1992.531) (-1997.542) * (-1992.664) [-1983.705] (-1986.844) (-1994.354) -- 0:00:07

      Average standard deviation of split frequencies: 0.002125

      976100 -- [-1978.337] (-1994.109) (-2001.153) (-1996.693) * (-1993.645) (-1983.770) [-1978.989] (-2000.655) -- 0:00:07
      976200 -- [-1979.329] (-1994.387) (-1995.679) (-1996.462) * (-1985.310) (-1986.890) [-1988.719] (-2004.462) -- 0:00:07
      976300 -- [-1981.362] (-1999.773) (-1991.087) (-1986.257) * (-1983.388) (-1986.945) [-1983.159] (-1998.311) -- 0:00:07
      976400 -- (-1990.420) (-1992.598) (-1990.679) [-1991.189] * (-1982.972) (-1987.299) [-1979.731] (-1990.810) -- 0:00:07
      976500 -- [-1985.798] (-1984.757) (-1991.085) (-1987.961) * [-1978.310] (-2001.249) (-1987.195) (-1986.388) -- 0:00:07
      976600 -- (-1983.033) (-1989.569) [-1987.881] (-1998.473) * (-1987.799) (-1993.380) [-1980.259] (-1983.915) -- 0:00:07
      976700 -- [-1982.701] (-1992.159) (-1997.638) (-1994.051) * (-1984.167) (-1994.238) (-1987.685) [-1979.720] -- 0:00:07
      976800 -- (-1989.077) (-1984.670) [-1991.624] (-2001.004) * [-1981.114] (-1991.256) (-1989.353) (-1981.370) -- 0:00:07
      976900 -- [-1984.758] (-1987.840) (-1990.565) (-2002.427) * (-1987.742) (-2000.500) (-1984.478) [-1980.007] -- 0:00:07
      977000 -- (-1985.237) (-1991.387) [-1982.179] (-1998.758) * (-1986.683) (-1992.714) (-1990.200) [-1981.143] -- 0:00:07

      Average standard deviation of split frequencies: 0.002178

      977100 -- (-1987.583) (-1995.136) [-1976.340] (-1993.750) * (-2000.849) (-1997.316) [-1984.488] (-1983.242) -- 0:00:07
      977200 -- (-1984.700) (-2001.693) [-1977.473] (-1991.558) * (-2002.675) (-1998.985) (-1987.821) [-1989.048] -- 0:00:07
      977300 -- (-1989.175) (-1994.922) [-1977.339] (-1993.175) * (-1993.364) (-1991.418) (-1995.872) [-1982.584] -- 0:00:07
      977400 -- [-1982.230] (-1998.863) (-1982.514) (-2001.069) * [-1993.395] (-1995.282) (-1985.614) (-1987.652) -- 0:00:07
      977500 -- (-1981.236) (-1999.022) [-1982.508] (-1994.501) * (-1986.536) (-1993.857) [-1982.228] (-1984.617) -- 0:00:07
      977600 -- [-1977.843] (-1991.919) (-1988.662) (-1991.220) * (-1986.888) (-1994.649) [-1979.331] (-1981.041) -- 0:00:07
      977700 -- (-1981.250) (-1990.644) [-1982.620] (-1989.518) * (-1983.391) (-1992.639) [-1978.760] (-1981.071) -- 0:00:07
      977800 -- [-1984.684] (-1995.506) (-1988.460) (-1993.596) * (-1981.125) (-1990.845) (-1978.945) [-1982.916] -- 0:00:07
      977900 -- [-1986.530] (-1996.672) (-1986.749) (-2000.955) * [-1978.852] (-1993.457) (-1980.594) (-1982.184) -- 0:00:07
      978000 -- [-1987.266] (-1991.191) (-1987.209) (-2007.522) * (-1980.772) (-1994.304) (-1978.707) [-1984.223] -- 0:00:07

      Average standard deviation of split frequencies: 0.002217

      978100 -- [-1987.017] (-1993.554) (-1981.009) (-2003.275) * (-1981.962) (-1995.656) [-1982.273] (-1988.616) -- 0:00:07
      978200 -- (-1994.584) (-1992.347) [-1980.177] (-1999.937) * [-1983.398] (-1996.969) (-1988.230) (-1988.782) -- 0:00:07
      978300 -- [-1985.725] (-1988.791) (-1981.542) (-1998.755) * [-1983.718] (-2001.064) (-1988.188) (-1988.537) -- 0:00:07
      978400 -- (-1991.878) (-1992.982) [-1983.166] (-2002.203) * (-1983.620) (-1997.717) [-1984.143] (-1989.813) -- 0:00:07
      978500 -- (-2006.297) (-2000.448) [-1982.057] (-2005.937) * (-1983.371) (-1996.924) [-1983.388] (-1990.488) -- 0:00:07
      978600 -- (-1989.811) (-1998.223) [-1982.064] (-1993.579) * (-1990.661) (-2010.119) [-1981.190] (-1994.075) -- 0:00:07
      978700 -- (-1982.142) (-2001.495) [-1982.706] (-1990.357) * (-1996.034) (-2012.439) [-1981.938] (-1991.183) -- 0:00:06
      978800 -- [-1980.033] (-1997.747) (-1984.319) (-1993.211) * [-1994.765] (-2009.120) (-1983.820) (-1988.734) -- 0:00:06
      978900 -- [-1983.343] (-1995.400) (-1988.030) (-1995.517) * (-1988.278) (-2004.191) [-1981.994] (-1987.170) -- 0:00:06
      979000 -- [-1986.422] (-1991.134) (-1993.717) (-2005.839) * (-1983.829) (-2001.100) [-1981.781] (-1987.190) -- 0:00:06

      Average standard deviation of split frequencies: 0.002160

      979100 -- (-1987.781) (-1996.895) [-1992.170] (-1997.198) * (-1990.923) (-2003.963) [-1982.895] (-1984.852) -- 0:00:06
      979200 -- (-1980.350) (-1991.389) [-1987.785] (-2002.215) * (-2000.985) (-1997.973) [-1982.038] (-1996.243) -- 0:00:06
      979300 -- (-1987.936) (-1993.072) [-1985.811] (-2006.609) * [-1986.401] (-2001.730) (-1983.251) (-1990.478) -- 0:00:06
      979400 -- [-1981.595] (-1993.793) (-1982.017) (-2002.998) * (-1983.032) (-2010.382) [-1985.662] (-1994.626) -- 0:00:06
      979500 -- (-1984.622) (-1992.244) [-1979.118] (-1997.515) * [-1984.041] (-1999.740) (-1981.813) (-1987.262) -- 0:00:06
      979600 -- (-1984.905) (-1999.115) [-1982.343] (-1992.195) * [-1980.045] (-1999.071) (-1984.807) (-1986.499) -- 0:00:06
      979700 -- [-1987.145] (-1995.176) (-1982.646) (-1996.565) * [-1982.073] (-1998.804) (-1986.264) (-1986.859) -- 0:00:06
      979800 -- (-1986.179) (-1999.884) [-1985.771] (-1995.922) * (-1987.522) (-1997.041) [-1977.401] (-1998.064) -- 0:00:06
      979900 -- (-1994.666) (-1997.272) [-1981.761] (-1998.094) * (-1980.761) (-1996.047) [-1980.191] (-1995.688) -- 0:00:06
      980000 -- (-1994.443) (-1995.732) [-1983.506] (-1999.641) * (-1981.289) (-1995.243) [-1980.979] (-1979.340) -- 0:00:06

      Average standard deviation of split frequencies: 0.002116

      980100 -- (-1994.434) (-1997.393) [-1980.967] (-2000.543) * (-1979.934) (-1994.883) [-1982.337] (-1979.340) -- 0:00:06
      980200 -- [-1996.330] (-1996.365) (-1986.478) (-1994.470) * (-1983.946) (-1991.444) (-1983.189) [-1985.497] -- 0:00:06
      980300 -- (-1989.814) (-2001.765) [-1992.293] (-1997.452) * (-1979.860) (-1987.500) [-1986.311] (-1984.998) -- 0:00:06
      980400 -- (-1991.105) (-2001.072) [-1991.061] (-1991.617) * (-1983.893) [-1988.124] (-1988.175) (-1984.612) -- 0:00:06
      980500 -- (-1995.530) (-2000.930) (-1986.498) [-1991.763] * (-1990.546) (-1994.550) (-1994.356) [-1981.569] -- 0:00:06
      980600 -- (-1995.062) (-2003.835) [-1982.739] (-1994.754) * (-1989.868) (-1998.057) (-1987.611) [-1983.311] -- 0:00:06
      980700 -- (-2001.392) (-1998.110) [-1983.606] (-1990.482) * [-1987.999] (-1992.143) (-1993.948) (-1983.288) -- 0:00:06
      980800 -- (-2004.611) (-2013.269) [-1979.870] (-1991.155) * (-1985.144) (-1992.996) (-1987.486) [-1985.767] -- 0:00:06
      980900 -- (-2003.626) (-2009.961) [-1980.502] (-1990.192) * (-1984.322) (-1993.802) [-1988.993] (-1991.624) -- 0:00:06
      981000 -- (-2000.338) (-2004.938) [-1983.490] (-1989.219) * [-1982.778] (-1988.332) (-1989.571) (-1991.865) -- 0:00:06

      Average standard deviation of split frequencies: 0.002073

      981100 -- (-1987.338) (-1994.794) [-1979.614] (-1987.350) * [-1984.926] (-1988.618) (-1999.781) (-1994.875) -- 0:00:06
      981200 -- (-1986.083) [-1992.654] (-1990.243) (-1994.596) * [-1981.383] (-1986.808) (-2000.803) (-1991.843) -- 0:00:06
      981300 -- (-1987.099) (-1991.318) (-1986.352) [-1985.265] * [-1980.462] (-1984.211) (-1994.478) (-1997.750) -- 0:00:06
      981400 -- (-1986.062) [-1988.156] (-1994.513) (-1996.321) * [-1979.271] (-1989.117) (-1989.779) (-2004.869) -- 0:00:06
      981500 -- (-1993.038) [-1983.172] (-1985.600) (-1989.496) * [-1981.035] (-1989.404) (-1985.261) (-1995.309) -- 0:00:06
      981600 -- [-1987.634] (-1990.219) (-1994.642) (-1992.753) * (-1985.201) (-2002.337) [-1982.933] (-1999.505) -- 0:00:06
      981700 -- [-1987.913] (-1991.460) (-1997.281) (-1990.530) * [-1983.017] (-1998.071) (-1987.750) (-1999.419) -- 0:00:06
      981800 -- [-1989.501] (-1996.232) (-2000.327) (-1987.156) * [-1984.049] (-1990.386) (-1989.747) (-2002.269) -- 0:00:05
      981900 -- [-1986.730] (-1990.330) (-1991.129) (-1985.953) * [-1987.325] (-1991.944) (-1994.180) (-2006.933) -- 0:00:05
      982000 -- (-1985.001) [-1988.173] (-1995.830) (-1987.031) * (-1985.885) [-1986.322] (-1992.607) (-2008.055) -- 0:00:05

      Average standard deviation of split frequencies: 0.002180

      982100 -- (-1992.319) (-1987.035) [-1989.808] (-1990.250) * (-1984.315) (-1994.788) [-1988.069] (-1988.705) -- 0:00:05
      982200 -- (-1986.373) [-1986.784] (-1991.050) (-1992.869) * [-1981.145] (-1986.714) (-1993.024) (-1985.775) -- 0:00:05
      982300 -- (-1992.715) [-1988.333] (-1990.893) (-1992.581) * (-1984.756) [-1986.002] (-1987.774) (-1989.695) -- 0:00:05
      982400 -- (-1993.153) [-1988.144] (-1989.417) (-1991.487) * [-1982.757] (-1984.100) (-1985.829) (-1995.890) -- 0:00:05
      982500 -- [-1991.229] (-1986.842) (-1989.377) (-1992.045) * (-1987.082) (-1993.245) [-1981.371] (-1993.643) -- 0:00:05
      982600 -- (-1992.626) (-1991.573) [-1982.064] (-1999.362) * [-1987.352] (-2000.750) (-1986.966) (-1992.560) -- 0:00:05
      982700 -- (-1994.451) [-1989.612] (-1981.498) (-1997.084) * [-1985.794] (-2000.987) (-1988.969) (-1993.794) -- 0:00:05
      982800 -- (-2001.852) (-1987.164) [-1986.642] (-2004.247) * (-1983.206) (-1995.915) [-1983.291] (-1988.757) -- 0:00:05
      982900 -- (-1999.974) (-1989.548) [-1981.299] (-1999.022) * [-1981.989] (-1994.155) (-1977.888) (-1987.003) -- 0:00:05
      983000 -- (-1998.810) (-1993.218) [-1981.408] (-2001.059) * [-1987.082] (-1995.961) (-1976.888) (-1985.407) -- 0:00:05

      Average standard deviation of split frequencies: 0.002151

      983100 -- (-2001.429) (-1989.614) [-1979.004] (-1999.715) * (-1980.385) (-1994.676) [-1980.221] (-1997.793) -- 0:00:05
      983200 -- (-2006.097) (-1989.014) [-1980.676] (-1997.564) * (-1980.445) (-1992.880) [-1984.058] (-1988.268) -- 0:00:05
      983300 -- (-2000.118) (-1991.702) [-1982.870] (-1994.768) * [-1980.930] (-1994.220) (-1978.158) (-1984.882) -- 0:00:05
      983400 -- (-1997.579) (-1995.030) (-1987.552) [-1990.293] * (-1991.447) (-1991.321) [-1979.683] (-1990.942) -- 0:00:05
      983500 -- (-1996.700) (-1994.608) [-1983.240] (-1992.489) * (-1991.091) (-1991.696) [-1976.556] (-1994.091) -- 0:00:05
      983600 -- (-2006.351) [-1988.948] (-1985.926) (-1994.796) * (-1997.438) (-1996.353) [-1981.169] (-1985.005) -- 0:00:05
      983700 -- (-1999.224) (-1989.093) [-1986.789] (-1997.827) * (-1995.550) (-1993.594) [-1976.116] (-1992.274) -- 0:00:05
      983800 -- (-1994.659) (-1991.190) [-1985.248] (-1993.094) * (-1993.500) (-1991.046) [-1979.015] (-1980.671) -- 0:00:05
      983900 -- (-1996.501) [-1995.561] (-1981.212) (-1995.156) * (-1988.526) (-1995.999) (-1982.992) [-1977.227] -- 0:00:05
      984000 -- (-2001.456) (-1996.468) [-1976.796] (-1996.409) * (-1997.320) (-1993.928) [-1985.158] (-1982.240) -- 0:00:05

      Average standard deviation of split frequencies: 0.002217

      984100 -- (-2005.431) (-1992.228) [-1983.887] (-2001.135) * (-1997.323) (-2004.532) [-1981.150] (-1981.440) -- 0:00:05
      984200 -- (-2000.852) (-1989.005) [-1986.570] (-1997.957) * (-1997.246) (-2000.657) (-1981.729) [-1979.811] -- 0:00:05
      984300 -- (-1987.126) [-1988.212] (-1987.456) (-2009.725) * (-1991.319) (-1997.102) (-1981.143) [-1977.150] -- 0:00:05
      984400 -- (-1996.127) (-1990.170) [-1987.124] (-2001.499) * (-1992.363) (-1995.528) (-1984.109) [-1979.295] -- 0:00:05
      984500 -- (-1993.002) (-1993.571) [-1983.594] (-1991.760) * (-1986.385) (-1994.669) [-1982.476] (-1985.319) -- 0:00:05
      984600 -- (-1990.131) (-1995.821) [-1984.144] (-1988.886) * (-1984.564) (-1991.848) (-1989.682) [-1977.289] -- 0:00:05
      984700 -- (-2002.503) (-1989.162) [-1982.527] (-1992.286) * [-1979.797] (-1987.430) (-1998.165) (-1984.502) -- 0:00:05
      984800 -- (-2002.589) (-1991.478) [-1984.257] (-1995.975) * [-1980.663] (-1990.043) (-1995.433) (-1984.347) -- 0:00:05
      984900 -- (-2017.861) [-1992.174] (-1983.506) (-1998.821) * [-1982.506] (-1996.242) (-1989.921) (-1987.448) -- 0:00:04
      985000 -- (-2022.655) (-1990.851) [-1982.507] (-1987.460) * [-1982.808] (-1999.353) (-1991.987) (-1990.985) -- 0:00:04

      Average standard deviation of split frequencies: 0.002310

      985100 -- (-2014.987) (-1989.576) [-1983.969] (-1988.105) * (-1980.079) (-2001.075) (-1999.703) [-1978.687] -- 0:00:04
      985200 -- (-2006.672) (-1989.157) [-1983.412] (-1992.104) * (-1984.833) (-2004.049) (-1987.412) [-1982.605] -- 0:00:04
      985300 -- (-1997.548) (-1996.128) [-1980.511] (-1990.040) * (-1988.105) (-1991.565) [-1989.887] (-1986.650) -- 0:00:04
      985400 -- (-1998.580) (-1991.832) [-1983.191] (-1991.910) * [-1992.749] (-1994.203) (-1987.332) (-1986.988) -- 0:00:04
      985500 -- (-2005.354) (-1996.627) [-1984.622] (-1997.370) * (-1987.781) (-1985.050) [-1992.661] (-1987.788) -- 0:00:04
      985600 -- (-2001.834) (-1996.086) [-1987.061] (-2000.522) * [-1981.930] (-1990.616) (-1996.577) (-1988.716) -- 0:00:04
      985700 -- (-1996.480) (-1993.555) [-1982.291] (-1994.753) * (-1982.971) (-1998.967) (-1992.461) [-1984.871] -- 0:00:04
      985800 -- (-1996.147) (-1996.659) [-1980.424] (-1990.309) * [-1982.521] (-1998.580) (-2004.907) (-1984.229) -- 0:00:04
      985900 -- (-2007.511) (-1996.749) [-1982.182] (-1992.540) * [-1985.980] (-1998.925) (-2001.749) (-1980.926) -- 0:00:04
      986000 -- (-1998.949) (-1988.943) [-1991.743] (-1997.594) * [-1980.267] (-1993.113) (-1998.966) (-1986.192) -- 0:00:04

      Average standard deviation of split frequencies: 0.002336

      986100 -- (-1998.972) (-1987.273) [-1984.744] (-2002.642) * (-1984.286) (-1998.356) (-1994.027) [-1988.466] -- 0:00:04
      986200 -- (-2002.864) (-1986.706) [-1979.564] (-2002.736) * (-1981.145) (-1992.159) (-1992.171) [-1986.144] -- 0:00:04
      986300 -- (-1997.216) (-1987.867) [-1984.341] (-1989.722) * (-1985.708) [-1984.856] (-1991.098) (-1990.089) -- 0:00:04
      986400 -- (-1998.163) (-1985.808) (-1994.344) [-1992.817] * [-1989.014] (-1987.460) (-1998.633) (-1991.399) -- 0:00:04
      986500 -- (-1990.477) (-1988.724) [-1993.793] (-1989.483) * [-1984.442] (-1992.971) (-1995.711) (-1985.944) -- 0:00:04
      986600 -- (-2001.992) [-1985.172] (-1988.794) (-1990.039) * [-1984.553] (-1993.588) (-1984.886) (-1993.549) -- 0:00:04
      986700 -- (-2000.069) [-1984.330] (-1993.948) (-1994.090) * [-1983.568] (-1989.226) (-1989.306) (-1983.043) -- 0:00:04
      986800 -- [-1998.310] (-1989.141) (-1985.844) (-1991.289) * [-1983.371] (-1987.344) (-1988.389) (-1987.306) -- 0:00:04
      986900 -- (-2004.142) (-1993.796) [-1986.453] (-1993.626) * [-1983.359] (-1986.376) (-1987.495) (-1978.831) -- 0:00:04
      987000 -- (-2001.651) (-1992.800) [-1987.194] (-1994.756) * [-1983.661] (-1993.035) (-1990.811) (-1987.277) -- 0:00:04

      Average standard deviation of split frequencies: 0.002319

      987100 -- (-2004.844) (-1993.205) (-1990.536) [-1986.210] * (-1987.997) (-1992.873) (-1986.552) [-1980.176] -- 0:00:04
      987200 -- (-1997.929) (-1991.051) [-1986.454] (-1993.464) * (-1983.960) (-1984.016) (-1985.501) [-1983.038] -- 0:00:04
      987300 -- (-2000.330) [-1988.941] (-1989.629) (-1994.890) * (-1989.806) (-1989.084) (-1989.589) [-1984.251] -- 0:00:04
      987400 -- (-1995.321) (-1985.677) (-1990.622) [-1988.378] * (-1989.734) (-1993.426) (-1991.969) [-1980.067] -- 0:00:04
      987500 -- (-1992.867) [-1988.239] (-1998.384) (-1998.459) * (-1989.513) (-2008.071) (-1992.654) [-1981.578] -- 0:00:04
      987600 -- (-1993.282) (-1995.019) [-1992.648] (-1995.000) * (-1995.517) (-1992.299) (-1992.407) [-1981.343] -- 0:00:04
      987700 -- (-1996.077) (-1990.835) [-1988.552] (-1991.301) * (-1992.810) (-2005.480) (-1991.862) [-1980.606] -- 0:00:04
      987800 -- (-2000.301) (-1990.143) [-1986.160] (-1988.120) * (-1989.422) (-2000.246) [-1988.614] (-1984.526) -- 0:00:04
      987900 -- [-1987.790] (-1986.480) (-1986.641) (-1985.351) * (-1992.532) (-2002.323) [-1985.450] (-1985.090) -- 0:00:03
      988000 -- (-1991.215) [-1986.033] (-1990.272) (-1987.219) * (-2001.573) (-2001.945) [-1987.905] (-1989.580) -- 0:00:03

      Average standard deviation of split frequencies: 0.002344

      988100 -- (-1990.435) (-1988.183) (-1998.628) [-1983.542] * (-1994.638) (-1992.824) [-1990.751] (-1988.809) -- 0:00:03
      988200 -- (-1991.992) (-1991.849) (-1999.068) [-1986.483] * (-1998.026) (-1992.159) (-1990.779) [-1988.675] -- 0:00:03
      988300 -- [-1988.482] (-1998.020) (-1998.336) (-1985.144) * [-1984.042] (-1989.869) (-1994.557) (-1987.485) -- 0:00:03
      988400 -- (-1989.078) (-1999.057) [-1990.908] (-1990.222) * [-1988.606] (-1998.075) (-1993.012) (-1989.991) -- 0:00:03
      988500 -- (-1999.590) (-1995.372) (-1988.584) [-1986.695] * (-1991.403) (-2000.112) (-1991.943) [-1989.485] -- 0:00:03
      988600 -- (-1989.086) (-1994.584) (-1987.282) [-1988.533] * (-1987.514) [-1995.179] (-1993.503) (-1990.922) -- 0:00:03
      988700 -- (-1993.151) (-1993.482) [-1983.704] (-1992.478) * (-1989.349) (-1990.908) (-1999.639) [-1990.753] -- 0:00:03
      988800 -- (-1990.756) (-1998.639) [-1984.358] (-1990.586) * (-1992.747) (-1991.931) (-1996.881) [-1994.666] -- 0:00:03
      988900 -- (-1990.875) (-1993.850) [-1982.813] (-1988.400) * (-1993.581) [-1992.476] (-1993.311) (-2000.120) -- 0:00:03
      989000 -- [-1984.069] (-1994.409) (-1981.455) (-1986.028) * [-1986.180] (-1991.193) (-1987.524) (-1996.761) -- 0:00:03

      Average standard deviation of split frequencies: 0.002369

      989100 -- [-1987.586] (-1997.195) (-1985.945) (-1989.562) * [-1985.194] (-1994.899) (-1987.775) (-1989.549) -- 0:00:03
      989200 -- (-1998.685) (-1997.983) (-1996.368) [-1993.313] * (-1983.987) (-1991.544) [-1985.501] (-1988.441) -- 0:00:03
      989300 -- [-1995.233] (-2002.829) (-1998.209) (-1987.192) * (-1989.021) (-1991.748) [-1984.780] (-1989.679) -- 0:00:03
      989400 -- (-1995.606) (-2004.899) (-1988.744) [-1990.946] * (-1993.994) (-1995.520) [-1987.528] (-1984.058) -- 0:00:03
      989500 -- (-1990.510) (-2008.209) [-1985.441] (-1993.005) * (-2001.319) [-1988.182] (-2000.297) (-1983.583) -- 0:00:03
      989600 -- [-1981.336] (-1999.683) (-1995.568) (-1986.267) * (-1989.906) (-1984.255) (-1996.640) [-1980.568] -- 0:00:03
      989700 -- (-1989.507) (-1997.873) (-1994.562) [-1984.961] * [-1986.502] (-1993.211) (-1984.798) (-1981.121) -- 0:00:03
      989800 -- [-1989.712] (-2003.198) (-1997.024) (-1989.790) * (-1996.111) (-2001.721) (-1983.735) [-1977.329] -- 0:00:03
      989900 -- [-1985.395] (-2000.126) (-1990.284) (-1989.522) * (-2003.917) (-2001.876) (-1986.506) [-1976.100] -- 0:00:03
      990000 -- (-1985.876) [-1996.021] (-1988.586) (-1988.126) * (-1995.906) (-2004.204) (-1988.449) [-1977.560] -- 0:00:03

      Average standard deviation of split frequencies: 0.002367

      990100 -- (-1991.953) (-2000.887) [-1983.360] (-1989.951) * (-1993.549) (-1996.429) (-1988.431) [-1979.972] -- 0:00:03
      990200 -- (-1989.085) (-1996.766) [-1983.832] (-1990.728) * (-1990.338) (-1990.293) (-1980.077) [-1980.094] -- 0:00:03
      990300 -- (-2003.091) [-1988.134] (-1982.926) (-1994.286) * [-1989.396] (-1994.084) (-1982.478) (-1983.589) -- 0:00:03
      990400 -- (-2000.631) (-1988.480) [-1983.981] (-1991.252) * (-1986.738) (-1999.853) [-1983.509] (-1986.249) -- 0:00:03
      990500 -- (-1997.741) (-1989.532) [-1984.204] (-1997.293) * (-1981.268) (-1992.448) (-1989.562) [-1979.874] -- 0:00:03
      990600 -- (-1998.861) (-1994.239) [-1985.672] (-1994.462) * [-1982.581] (-1988.143) (-1994.020) (-1979.132) -- 0:00:03
      990700 -- (-1989.491) [-1990.182] (-1986.954) (-1989.535) * [-1987.111] (-1987.261) (-2002.404) (-1980.942) -- 0:00:03
      990800 -- [-1985.787] (-1991.373) (-1991.312) (-1998.703) * (-1983.864) (-1992.746) (-1990.115) [-1979.110] -- 0:00:03
      990900 -- (-1986.620) (-1987.902) [-1988.162] (-1993.400) * (-1984.077) (-1991.352) (-1989.911) [-1983.516] -- 0:00:02
      991000 -- [-1984.108] (-1985.902) (-1989.473) (-1992.936) * (-1987.355) (-1990.495) [-1989.159] (-1981.394) -- 0:00:02

      Average standard deviation of split frequencies: 0.002337

      991100 -- (-1984.919) [-1982.933] (-1991.050) (-1990.217) * (-1986.961) (-1984.549) (-1993.213) [-1981.958] -- 0:00:02
      991200 -- [-1986.457] (-1986.154) (-1988.129) (-1999.505) * [-1981.684] (-1991.139) (-1989.190) (-1981.568) -- 0:00:02
      991300 -- (-1990.548) (-1993.988) [-1984.366] (-1999.118) * (-1985.756) (-1984.122) (-1979.919) [-1979.956] -- 0:00:02
      991400 -- [-1994.696] (-1995.353) (-1990.381) (-1998.957) * (-1991.254) (-1985.134) [-1988.248] (-1984.180) -- 0:00:02
      991500 -- (-1982.809) (-1990.814) (-1982.547) [-1988.561] * (-1987.323) (-1991.943) [-1986.414] (-1985.455) -- 0:00:02
      991600 -- (-1982.764) (-1991.888) [-1987.512] (-1988.633) * (-1998.984) (-1986.423) (-1989.129) [-1986.130] -- 0:00:02
      991700 -- (-1985.204) (-1996.461) [-1980.898] (-1989.997) * (-1990.408) (-1988.701) (-1981.670) [-1985.244] -- 0:00:02
      991800 -- [-1985.720] (-1989.600) (-1987.751) (-1991.204) * (-1996.018) (-1991.676) [-1978.563] (-1988.336) -- 0:00:02
      991900 -- [-1983.049] (-1997.001) (-1991.936) (-2003.097) * (-1995.122) (-1988.123) [-1978.043] (-1991.711) -- 0:00:02
      992000 -- (-1986.164) (-1990.645) [-1981.186] (-1993.339) * (-2000.951) (-1989.025) (-1987.490) [-1980.492] -- 0:00:02

      Average standard deviation of split frequencies: 0.002376

      992100 -- [-1980.617] (-1995.079) (-1980.345) (-2003.547) * (-2000.764) (-1987.768) (-1993.017) [-1981.199] -- 0:00:02
      992200 -- [-1983.670] (-2001.008) (-1983.168) (-2009.127) * (-1995.333) (-1993.871) (-1994.194) [-1986.122] -- 0:00:02
      992300 -- [-1985.163] (-2002.192) (-1985.270) (-1998.632) * (-1990.634) (-1993.467) (-1995.353) [-1979.323] -- 0:00:02
      992400 -- (-1988.224) (-1999.148) [-1984.618] (-2000.370) * (-1989.979) (-1997.355) (-1988.151) [-1977.256] -- 0:00:02
      992500 -- [-1985.861] (-1996.610) (-1984.111) (-2010.226) * [-1987.184] (-1996.607) (-1990.039) (-1977.933) -- 0:00:02
      992600 -- [-1992.643] (-2000.124) (-1983.573) (-2004.015) * (-1994.838) (-1992.697) (-1983.034) [-1977.725] -- 0:00:02
      992700 -- (-2003.771) (-2002.072) [-1983.574] (-2012.528) * (-1986.764) (-1990.183) (-1984.991) [-1983.784] -- 0:00:02
      992800 -- (-1992.474) [-1993.745] (-1991.262) (-2011.128) * (-1992.307) (-1994.521) [-1981.033] (-1984.393) -- 0:00:02
      992900 -- (-1997.449) [-1988.701] (-1987.417) (-2009.721) * (-1989.587) [-1987.840] (-1983.306) (-1984.264) -- 0:00:02
      993000 -- (-2001.992) [-1989.414] (-1995.189) (-2008.359) * [-1983.218] (-1992.800) (-1986.877) (-1988.531) -- 0:00:02

      Average standard deviation of split frequencies: 0.002319

      993100 -- (-2001.860) [-1994.133] (-1993.773) (-2001.095) * (-1988.051) (-2009.228) [-1979.211] (-1986.895) -- 0:00:02
      993200 -- (-1989.060) (-1995.318) (-1996.054) [-1992.734] * (-1986.970) (-2000.982) (-1982.019) [-1984.839] -- 0:00:02
      993300 -- [-1987.976] (-1998.116) (-1996.863) (-1992.624) * (-1988.235) (-2007.525) (-1982.050) [-1982.662] -- 0:00:02
      993400 -- [-1987.069] (-1998.809) (-1998.383) (-1994.412) * (-1985.777) (-2004.699) (-1995.686) [-1979.951] -- 0:00:02
      993500 -- [-1982.627] (-1997.804) (-1998.258) (-2003.919) * (-1988.454) (-2003.009) [-1984.513] (-1979.542) -- 0:00:02
      993600 -- [-1980.764] (-1991.171) (-1994.306) (-2002.646) * (-1988.286) (-1996.696) (-1986.870) [-1982.220] -- 0:00:02
      993700 -- [-1991.434] (-1992.776) (-1997.138) (-1997.283) * (-1991.071) (-1988.892) (-1992.342) [-1981.860] -- 0:00:02
      993800 -- (-2001.367) (-1993.913) (-1993.677) [-1989.936] * (-1983.820) (-1994.015) (-1990.174) [-1987.353] -- 0:00:02
      993900 -- (-2003.414) (-1994.525) [-1985.699] (-1990.228) * (-1988.746) (-1997.493) [-1982.798] (-1992.691) -- 0:00:02
      994000 -- (-1995.230) (-1994.591) [-1988.994] (-1991.077) * (-1992.711) (-1993.886) [-1979.859] (-1985.879) -- 0:00:01

      Average standard deviation of split frequencies: 0.002317

      994100 -- (-1988.133) (-1993.109) [-1988.717] (-1998.668) * (-1992.582) (-1997.994) [-1977.414] (-1986.652) -- 0:00:01
      994200 -- (-1986.998) [-1994.295] (-1990.718) (-1998.420) * (-1983.619) (-1993.463) [-1986.435] (-1984.433) -- 0:00:01
      994300 -- [-1981.433] (-1992.049) (-1993.739) (-1995.578) * (-1992.214) (-1992.645) (-1992.954) [-1995.625] -- 0:00:01
      994400 -- (-1987.978) [-1989.426] (-1991.888) (-2005.401) * (-1992.240) [-1992.811] (-1985.989) (-2006.550) -- 0:00:01
      994500 -- (-1987.450) [-1987.302] (-1998.118) (-2012.247) * (-2005.490) [-1982.783] (-1990.402) (-2000.480) -- 0:00:01
      994600 -- [-1987.876] (-1990.920) (-1988.800) (-2008.268) * (-2000.288) [-1985.206] (-1992.979) (-1997.396) -- 0:00:01
      994700 -- (-1998.937) [-1983.071] (-1998.704) (-2002.267) * (-2000.376) (-1986.849) [-1984.230] (-1997.096) -- 0:00:01
      994800 -- (-1993.985) [-1981.703] (-1996.127) (-2002.188) * (-1997.747) [-1984.102] (-1983.013) (-1990.464) -- 0:00:01
      994900 -- (-1993.445) [-1983.184] (-1992.795) (-2001.665) * (-1993.373) (-1983.120) [-1978.103] (-1999.444) -- 0:00:01
      995000 -- (-2004.539) [-1987.176] (-1992.714) (-1994.470) * (-1986.284) [-1982.830] (-1984.434) (-1993.307) -- 0:00:01

      Average standard deviation of split frequencies: 0.002314

      995100 -- (-1995.535) [-1985.239] (-1990.428) (-2001.399) * (-1987.609) (-1983.910) (-1985.410) [-1990.983] -- 0:00:01
      995200 -- (-2006.328) (-1989.877) (-1993.148) [-1987.989] * (-1991.543) [-1980.866] (-1990.446) (-1995.386) -- 0:00:01
      995300 -- (-1994.331) (-1988.445) (-2008.336) [-1983.853] * (-1992.682) [-1981.411] (-1986.097) (-2009.663) -- 0:00:01
      995400 -- (-1988.652) (-1987.697) (-2001.440) [-1987.513] * (-1991.300) (-1983.371) [-1980.419] (-2002.476) -- 0:00:01
      995500 -- (-1993.181) (-1985.210) (-1993.263) [-1985.472] * (-1992.702) [-1978.446] (-1985.663) (-1999.965) -- 0:00:01
      995600 -- (-1996.393) (-1989.240) (-1985.942) [-1983.467] * (-1992.214) (-1981.747) [-1980.798] (-1992.293) -- 0:00:01
      995700 -- (-2002.823) (-1994.343) (-1994.306) [-1980.194] * [-1989.848] (-1977.397) (-1983.667) (-2000.670) -- 0:00:01
      995800 -- (-1999.372) (-1986.896) (-1998.689) [-1978.425] * (-1997.361) [-1980.286] (-1989.678) (-2006.653) -- 0:00:01
      995900 -- (-1997.358) (-1994.226) (-2004.864) [-1983.041] * (-1995.331) [-1979.055] (-1994.542) (-1993.685) -- 0:00:01
      996000 -- (-2000.290) (-1995.786) (-1998.832) [-1990.829] * (-1993.928) [-1983.409] (-1990.243) (-1992.692) -- 0:00:01

      Average standard deviation of split frequencies: 0.002420

      996100 -- (-2013.419) (-1991.771) (-1995.701) [-1979.286] * (-1996.690) (-1990.142) [-1987.976] (-1996.134) -- 0:00:01
      996200 -- (-1995.189) (-1984.618) (-1998.217) [-1978.754] * (-1989.486) [-1988.861] (-1982.947) (-1992.567) -- 0:00:01
      996300 -- (-1991.058) (-1989.240) (-2003.950) [-1983.936] * (-1992.816) (-1992.289) (-1987.384) [-1985.674] -- 0:00:01
      996400 -- (-1988.374) (-1990.505) (-2004.629) [-1981.805] * (-1997.842) (-1989.995) (-1987.660) [-1983.493] -- 0:00:01
      996500 -- (-1991.662) (-1992.353) (-2002.279) [-1982.818] * (-1995.434) [-1986.486] (-1988.693) (-1981.477) -- 0:00:01
      996600 -- (-1990.602) (-1993.752) (-1993.660) [-1987.262] * (-1993.437) (-1991.866) (-1989.390) [-1980.531] -- 0:00:01
      996700 -- (-1990.152) (-1996.773) (-1987.294) [-1981.927] * (-1990.473) (-1993.031) (-1983.992) [-1982.047] -- 0:00:01
      996800 -- (-2002.061) [-1989.660] (-1988.823) (-1990.661) * (-1993.411) (-2007.137) [-1986.025] (-1980.610) -- 0:00:01
      996900 -- (-1999.052) [-1990.134] (-1990.653) (-1985.265) * (-1994.373) (-2007.281) (-1984.228) [-1982.894] -- 0:00:01
      997000 -- (-1992.956) (-1995.075) (-1997.239) [-1984.987] * (-1990.321) (-2011.405) (-1985.593) [-1986.136] -- 0:00:00

      Average standard deviation of split frequencies: 0.002431

      997100 -- (-1993.924) [-1989.248] (-1995.939) (-1989.171) * (-1988.259) (-2008.430) (-1978.159) [-1983.595] -- 0:00:00
      997200 -- [-1987.029] (-1988.225) (-1996.618) (-1987.590) * (-1987.498) (-2009.005) [-1979.905] (-1984.973) -- 0:00:00
      997300 -- (-1993.173) [-1988.236] (-1994.305) (-1989.570) * (-1986.414) (-2000.940) [-1981.212] (-1995.969) -- 0:00:00
      997400 -- (-1997.568) [-1992.513] (-2000.258) (-1999.331) * (-1987.444) (-1990.488) [-1981.296] (-1995.457) -- 0:00:00
      997500 -- (-1999.502) [-1989.633] (-2004.816) (-1997.519) * (-1989.684) [-1986.686] (-1985.443) (-1993.935) -- 0:00:00
      997600 -- (-1997.999) (-1989.872) (-2002.057) [-1996.270] * (-1990.692) (-1986.776) (-1985.217) [-1984.804] -- 0:00:00
      997700 -- [-1992.100] (-1996.491) (-1999.424) (-1994.326) * (-1989.136) (-1989.153) (-1984.825) [-1984.680] -- 0:00:00
      997800 -- (-1995.065) (-1998.097) [-1993.674] (-1993.388) * (-1994.985) (-1991.805) (-1984.688) [-1981.029] -- 0:00:00
      997900 -- (-1987.115) (-1996.780) [-1990.025] (-1996.253) * (-1996.771) (-1990.731) (-1986.689) [-1977.727] -- 0:00:00
      998000 -- (-1988.789) (-2002.212) [-2000.708] (-1998.953) * (-2002.862) (-1989.829) (-1983.798) [-1977.672] -- 0:00:00

      Average standard deviation of split frequencies: 0.002577

      998100 -- [-1984.033] (-1990.175) (-1993.803) (-1991.031) * (-1988.345) (-1991.181) (-1990.168) [-1983.069] -- 0:00:00
      998200 -- (-1987.829) (-1990.928) (-2002.826) [-1987.049] * (-1984.961) (-1994.249) (-1988.324) [-1992.594] -- 0:00:00
      998300 -- [-1986.959] (-1991.494) (-2003.184) (-1990.688) * (-1984.436) [-1997.507] (-1992.601) (-2000.758) -- 0:00:00
      998400 -- [-1984.793] (-1998.621) (-2000.016) (-1991.911) * [-1985.787] (-1991.556) (-1991.270) (-1990.262) -- 0:00:00
      998500 -- (-1992.042) (-1990.441) (-1999.372) [-1986.713] * (-1983.508) [-1988.501] (-1994.663) (-2000.320) -- 0:00:00
      998600 -- (-1988.262) (-1991.241) (-1993.388) [-1984.164] * [-1987.286] (-1984.542) (-1987.455) (-1995.272) -- 0:00:00
      998700 -- (-1989.111) (-1989.160) (-1989.599) [-1981.219] * (-1986.418) (-1984.415) [-1984.640] (-1987.361) -- 0:00:00
      998800 -- (-1992.322) (-2000.168) (-1990.309) [-1979.669] * [-1988.296] (-1987.913) (-1983.286) (-1985.249) -- 0:00:00
      998900 -- [-1991.468] (-2000.924) (-1994.777) (-1981.211) * (-1985.889) (-1986.915) (-1979.467) [-1981.518] -- 0:00:00
      999000 -- (-1985.881) (-2000.824) (-1996.355) [-1979.557] * (-1989.861) (-1996.601) [-1980.973] (-1981.002) -- 0:00:00

      Average standard deviation of split frequencies: 0.002548

      999100 -- [-1988.309] (-1994.284) (-2001.202) (-1988.749) * (-1991.929) (-1990.346) [-1985.920] (-1986.904) -- 0:00:00
      999200 -- (-1993.198) (-1988.591) (-2007.781) [-1984.525] * (-1990.489) (-2000.676) [-1984.620] (-1993.754) -- 0:00:00
      999300 -- [-1994.082] (-1984.417) (-2004.242) (-1985.713) * (-1993.833) (-2010.787) (-1984.523) [-1994.070] -- 0:00:00
      999400 -- (-1991.292) (-1993.662) (-2002.783) [-1984.846] * (-2003.232) (-2006.131) (-1986.033) [-1994.003] -- 0:00:00
      999500 -- [-1990.107] (-1990.647) (-1998.704) (-1991.648) * (-2004.631) (-2000.267) [-1987.554] (-2000.493) -- 0:00:00
      999600 -- [-1990.379] (-1993.343) (-1996.650) (-1994.220) * (-2002.800) (-2001.022) [-1981.892] (-1988.946) -- 0:00:00
      999700 -- (-1992.978) [-1993.407] (-1992.472) (-1995.307) * (-2007.900) (-1993.936) [-1982.393] (-1992.491) -- 0:00:00
      999800 -- (-1993.155) [-1992.714] (-1998.089) (-1998.098) * (-2002.444) (-1990.642) [-1985.659] (-1989.542) -- 0:00:00
      999900 -- (-1991.781) [-1989.732] (-2000.069) (-2001.884) * (-2004.229) (-2002.298) [-1984.008] (-1993.835) -- 0:00:00
      1000000 -- [-1991.253] (-1994.087) (-2007.827) (-1995.489) * (-2009.866) (-2005.868) [-1980.825] (-1999.653) -- 0:00:00

      Average standard deviation of split frequencies: 0.002491

      Analysis completed in 329 seconds
      Analysis used 329.01 seconds of CPU time
      Likelihood of best state for "cold" chain of run 1 was -1973.33
      Likelihood of best state for "cold" chain of run 2 was -1974.02
      Acceptance rates for the moves in the "cold" chain of run 1:
         With prob.  Chain accepted changes to
           57.31 %   param. 1 (revmat) with Dirichlet proposal
           21.73 %   param. 2 (state frequencies) with Dirichlet proposal
           82.69 %   param. 3 (gamma shape) with multiplier
           90.54 %   param. 4 (gamma shape) with multiplier
           70.36 %   param. 5 (prop. invar. sites) with sliding window
           12.47 %   param. 6 (topology and branch lengths) with extending TBR
           25.42 %   param. 6 (topology and branch lengths) with LOCAL
      Acceptance rates for the moves in the "cold" chain of run 2:
         With prob.  Chain accepted changes to
           57.72 %   param. 1 (revmat) with Dirichlet proposal
           21.66 %   param. 2 (state frequencies) with Dirichlet proposal
           82.96 %   param. 3 (gamma shape) with multiplier
           90.54 %   param. 4 (gamma shape) with multiplier
           70.18 %   param. 5 (prop. invar. sites) with sliding window
           12.46 %   param. 6 (topology and branch lengths) with extending TBR
           25.30 %   param. 6 (topology and branch lengths) with LOCAL

      Chain swap information for run 1:

                   1       2       3       4 
           ----------------------------------
         1 |            0.57    0.30    0.15 
         2 |  166417            0.64    0.39 
         3 |  166662  166998            0.69 
         4 |  166514  166549  166860         

      Chain swap information for run 2:

                   1       2       3       4 
           ----------------------------------
         1 |            0.57    0.30    0.15 
         2 |  167128            0.64    0.39 
         3 |  166316  166540            0.69 
         4 |  166215  166914  166887         

      Upper diagonal: Proportion of successful state exchanges between chains
      Lower diagonal: Number of attempted state exchanges between chains

      Chain information:

        ID -- Heat 
       -----------
         1 -- 1.00  (cold chain)
         2 -- 0.83 
         3 -- 0.71 
         4 -- 0.62 

      Heat = 1 / (1 + T * (ID - 1))
         (where T = 0.20 is the temperature and ID is the chain number)
      Setting sump burnin to 2500
      Summarizing parameters in files /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
      Writing output to screen but not to file ('Printtofile = No')
      UNIX line termination
      Longest line length = 176
      Found 10001 parameter lines in file "/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p"
      Of the 10001 lines, 7501 of them will be summarized (starting at line 2503)
      (Only the last set of lines will be read, in case multiple
      parameter blocks are present in the same file.)
      7501 rows and 16 columns in each row
      Expecting the same layout in all subsequent files
      Successfully read 7501 lines from last parameter block of file 1
      Successfully read 7501 lines from last parameter block of file 2

      Below are rough plots of the generation (x-axis) versus the log   
      probability of observing the data (y-axis). You can use these     
      graphs to determine what the burn in for your analysis should be. 
      When the log probability starts to plateau you may be at station- 
      arity. Sample trees and parameters after the log probability      
      plateaus. Of course, this is not a guarantee that you are at sta- 
      tionarity. Also examine the convergence diagnostics provided by   
      the 'sump' and 'sumt' commands for all the parameters in your     
      model. Remember that the burn in is the number of samples to dis- 
      card. There are a total of ngen / samplefreq samples taken during 
      a MCMC analysis.                                                  

      Overlay plot for both runs:
      (1 = Run number 1; 2 = Run number 2; * = Both runs)

   +------------------------------------------------------------+ -1983.04
   |                                                          2 |
   |                                                            |
   |      221  2       1   2    1         11                 2  |
   |1            2      1 1          2      2 2                2|
   |  2    1          1  1          2        1      2   * 2     |
   | 1   21 2 21    11      2 2 2           121 2 2        2  1 |
   |2  2     *  *1*12      11      *   21      1     1          |
   |     1            2  2     1 12     22 2     2  1 1     2   |
   |                    2 2   1  2             2       1 1      |
   |          1              * 2       1 1      1    2 2       1|
   |  1 1            2            1       2                1    |
   | 2             2   2             12           11  2   1  1  |
   |                                1 1            2     2  1   |
   |    2                                        1              |
   |   1                                                        |
   +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1988.93
   ^                                                            ^
   250000                                                       1000000


      Estimated marginal likelihoods for runs sampled in files
         "/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         (Use the harmonic mean for Bayes factor comparisons of models)

      Run   Arithmetic mean   Harmonic mean
      --------------------------------------
        1       -1980.50          -1997.15
        2       -1980.38          -1998.75
      --------------------------------------
      TOTAL     -1980.44          -1998.24
      --------------------------------------


      Model parameter summaries over the runs sampled in files
         "/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         (Summaries are based on a total of 15002 samples from 2 runs)
         (Each run produced 10001 samples of which 7501 samples were included)

                                                     95% Cred. Interval
                                                   ----------------------
      Parameter          Mean        Variance       Lower         Upper         Median       PSRF *
      ---------------------------------------------------------------------------------------------
      TL{all}           0.265317      0.000885      0.212000      0.329000      0.263000      1.000
      r(A<->C){all}     0.101350      0.000840      0.051181      0.164004      0.098791      1.000
      r(A<->G){all}     0.168862      0.001157      0.109084      0.242242      0.166530      1.000
      r(A<->T){all}     0.210862      0.002079      0.129527      0.306510      0.208112      1.000
      r(C<->G){all}     0.094341      0.000483      0.056313      0.141940      0.092704      1.000
      r(C<->T){all}     0.340278      0.002551      0.245988      0.442625      0.338700      1.000
      r(G<->T){all}     0.084306      0.000597      0.042649      0.137257      0.082479      1.002
      pi(A){all}        0.216659      0.000197      0.189988      0.244904      0.216516      1.000
      pi(C){all}        0.261869      0.000218      0.233643      0.291465      0.261522      1.000
      pi(G){all}        0.316085      0.000245      0.286490      0.346889      0.315873      1.000
      pi(T){all}        0.205388      0.000185      0.179485      0.232576      0.205199      1.000
      alpha{1,2}       28.084679   2735.050281      0.173688    179.276444      0.846342      1.003
      alpha{3}        100.482318   3261.914324      7.034359    194.807984     99.861952      1.000
      pinvar{all}       0.694802      0.009037      0.471945      0.815786      0.712470      1.003
      ---------------------------------------------------------------------------------------------
      * Convergence diagnostic (PSRF = Potential scale reduction factor [Gelman
        and Rubin, 1992], uncorrected) should approach 1 as runs converge. The
        values may be unreliable if you have a small number of samples. PSRF should
        only be used as a rough guide to convergence since all the assumptions
        that allow one to interpret it as a scale reduction factor are not met in
        the phylogenetic context.
      Setting sumt burnin to 2500
      Summarizing trees in files "/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
      UNIX line termination
      Examining first file ...
      Found one tree block in file "/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 10001 trees in last block
      Expecting the same number of trees in the last tree block of all files

      Tree reading status:

      0      10      20      30      40      50      60      70      80      90     100
      v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
      *********************************************************************************

      Read a total of 20002 trees in 2 files (sampling 15002 of them)
         (Each file contained 10001 trees of which 7501 were sampled)
                                                                                   
      General explanation:                                                          
                                                                                   
      A taxon bibartition is specified by removing a branch, thereby dividing the   
      species into those to the left and those to the right of the branch. Here,    
      taxa to one side of the removed branch are denoted "." and those to the     
      other side are denoted "*". The output includes the bipartition number      
      (ID; sorted from highest to lowest probability), bipartition (e.g., ...**..), 
      number of times the bipartition was observed (#obs), the posterior probabil-  
      ity of the bipartition, and, if branch lengths were recorded on the trees in  
      the file, the average (Mean(v)) and variance (Var(v)) of the lengths. Each    
      "." or "*" in the bipartition represents a taxon that is to the left or   
      right of the removed branch. A list of the taxa in the bipartition is given   
      before the list of bipartitions. If you summarize several independent analy-  
      ses, convergence diagnostics are presented for both the posterior probabil-   
      ities of bipartitions (bipartition or split frequencies) and branch lengths   
      (if recorded on the trees in the files). In the former case, the diagnostic is
      the standard deviation of the partition frequencies (Stdev(s)), in the second 
      case it is the potential scale reduction factor (PSRF) of Gelman and Rubin    
      (1992). Stdev(s) is expected to approach 0 and PSRF is expected to approach 1 
      as runs converge onto the posterior probability distribution. Note that these 
      values may be unreliable if the partition is not present in all runs (the     
      last column indicates the number of runs that sampled the partition if more   
      than one run is summarized). The PSRF is also sensitive to small sample       
      sizes and it should only be considered a rough guide to convergence since     
      some of the assumptions allowing one to interpret it as a true potential      
      scale reduction factor are violated in the phylogenetic context.              
                                                                                    
      List of taxa in bipartitions:                                                 
                                                                                   
         1 -- C1
         2 -- C2
         3 -- C3
         4 -- C4
         5 -- C5
         6 -- C6
         7 -- C7
         8 -- C8
                                                                                   
      Summary statistics for taxon bipartitions:                                

      ID -- Partition  #obs    Probab.  Stdev(s)   Mean(v)   Var(v)    PSRF  Nruns
      ----------------------------------------------------------------------------
       1 -- ......*.   15002  1.000000  0.000000  0.037842  0.000088  1.000    2
       2 -- .......*   15002  1.000000  0.000000  0.034736  0.000072  1.000    2
       3 -- ...*....   15002  1.000000  0.000000  0.015735  0.000034  1.000    2
       4 -- .****.**   15002  1.000000  0.000000  0.017335  0.000034  1.000    2
       5 -- .*******   15002  1.000000  0.000000  0.028873  0.000058  1.000    2
       6 -- .*......   15002  1.000000  0.000000  0.040243  0.000092  1.000    2
       7 -- ..*.....   15002  1.000000  0.000000  0.024509  0.000051  1.000    2
       8 -- .....*..   15002  1.000000  0.000000  0.013615  0.000028  1.000    2
       9 -- ....*...   15002  1.000000  0.000000  0.021023  0.000042  1.000    2
      10 -- .**.....   14930  0.995201  0.000189  0.011195  0.000026  1.000    2
      11 -- ....*..*   14508  0.967071  0.003959  0.008054  0.000019  1.001    2
      12 -- ...*..*.   14326  0.954939  0.000000  0.009387  0.000020  1.000    2
      13 -- ...**.**    9896  0.659645  0.008107  0.003303  0.000006  1.000    2
      14 -- .**.*..*    2466  0.164378  0.001131  0.003365  0.000009  1.000    2
      15 -- .***..*.    2081  0.138715  0.004054  0.002765  0.000006  1.000    2
      ----------------------------------------------------------------------------


      Clade credibility values:

      /------------------------------------------------------------------------ C1 (1)
      |                                                                               
      |------------------------------------------------------------------------ C6 (6)
      |                                                                               
      +                                                     /------------------ C2 (2)
      |                 /----------------100----------------+                         
      |                 |                                   \------------------ C3 (3)
      |                 |                                                             
      \-------100-------+                                   /------------------ C4 (4)
                        |                 /--------95-------+                         
                        |                 |                 \------------------ C7 (7)
                        \--------66-------+                                           
                                          |                 /------------------ C5 (5)
                                          \--------97-------+                         
                                                            \------------------ C8 (8)
                                                                                      

      Phylogram:

      /------------------------------ C1 (1)
      |                                                                               
      |-------------- C6 (6)
      |                                                                               
      +                             /------------------------------------------ C2 (2)
      |                 /-----------+                                                 
      |                 |           \-------------------------- C3 (3)
      |                 |                                                             
      \-----------------+            /----------------- C4 (4)
                        |   /--------+                                                
                        |   |        \---------------------------------------- C7 (7)
                        \---+                                                         
                            |       /---------------------- C5 (5)
                            \-------+                                                 
                                    \------------------------------------ C8 (8)
                                                                                      
      |----------| 0.010 expected changes per site

      Calculating tree probabilities...

      Credible sets of trees (70 trees sampled):
         90 % credible set contains 3 trees
         95 % credible set contains 7 trees
         99 % credible set contains 22 trees
   Exiting MrBayes block
   Reached end of file

   Tasks completed, exiting program because mode is noninteractive
   To return control to the command line after completion of file processing, 
   set mode to interactive with 'mb -i <filename>' (i is for interactive)
   or use 'set mode=interactive'

MrBayes output code: 0

CODONML in paml version 4.5, December 2011

----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
      TTC |       TCC |       TAC |       TGC
Leu L TTA |       TCA | *** * TAA | *** * TGA
      TTG |       TCG |       TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
      CTC |       CCC |       CAC |       CGC
      CTA |       CCA | Gln Q CAA |       CGA
      CTG |       CCG |       CAG |       CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
      ATC |       ACC |       AAC |       AGC
      ATA |       ACA | Lys K AAA | Arg R AGA
Met M ATG |       ACG |       AAG |       AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
      GTC |       GCC |       GAC |       GGC
      GTA |       GCA | Glu E GAA |       GGA
      GTG |       GCG |       GAG |       GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000):   1  2  7  8

seq file is not paml/phylip format.  Trying nexus format.
ns = 8  	ls = 831
Reading sequences, sequential format..
Reading seq # 1: C1     
Reading seq # 2: C2     
Reading seq # 3: C3     
Reading seq # 4: C4     
Reading seq # 5: C5     
Reading seq # 6: C6     
Reading seq # 7: C7     
Reading seq # 8: C8     

Sites with gaps or missing data are removed.

    33 ambiguity characters in seq. 1
    33 ambiguity characters in seq. 2
    33 ambiguity characters in seq. 3
    33 ambiguity characters in seq. 4
    33 ambiguity characters in seq. 5
    33 ambiguity characters in seq. 6
    90 ambiguity characters in seq. 7
    33 ambiguity characters in seq. 8
30 sites are removed.   1  2  3  4  5  6  7  8  9 10 11 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277
Sequences read..
Counting site patterns..  0:00

         121 patterns at      247 /      247 sites (100.0%),  0:00
Counting codons..


      224 bytes for distance
   118096 bytes for conP
    10648 bytes for fhK
  5000000 bytes for space


Model 1: NearlyNeutral

TREE #  1
(1, 6, ((2, 3), ((4, 7), (5, 8))));   MP score: 127
   354288 bytes for conP, adjusted

    0.060115    0.039293    0.024179    0.014839    0.091505    0.059248    0.000685    0.007506    0.041500    0.083756    0.019426    0.045097    0.079790    0.300000    0.842478    0.405362

ntime & nrate & np:    13     2    16

Bounds (np=16):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000010   0.000001
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000   0.999990   1.000000

np =    16
lnL0 = -1922.120398

Iterating by ming2
Initial: fx=  1922.120398
x=  0.06011  0.03929  0.02418  0.01484  0.09150  0.05925  0.00069  0.00751  0.04150  0.08376  0.01943  0.04510  0.07979  0.30000  0.84248  0.40536

  1 h-m-p  0.0000 0.0017 1092.7392 YYYCC  1919.874968  4 0.0000    26 | 0/16
  2 h-m-p  0.0000 0.0002 316.4055 +CYC   1914.714726  2 0.0002    49 | 0/16
  3 h-m-p  0.0002 0.0019 249.6006 +YCYCCC  1886.295084  5 0.0014    77 | 0/16
  4 h-m-p  0.0000 0.0001 1691.5717 +YYYCCC  1874.687334  5 0.0001   104 | 0/16
  5 h-m-p  0.0000 0.0002 1838.9931 +CYCCC  1850.394451  4 0.0002   131 | 0/16
  6 h-m-p  0.0000 0.0002 256.4567 ++     1845.954957  m 0.0002   150 | 1/16
  7 h-m-p  0.0001 0.0003 325.5792 YCCCC  1844.193386  4 0.0001   176 | 1/16
  8 h-m-p  0.0004 0.0019  89.4546 YCYC   1843.648602  3 0.0002   199 | 1/16
  9 h-m-p  0.0007 0.0033  22.8267 YC     1843.556653  1 0.0003   219 | 1/16
 10 h-m-p  0.0003 0.0082  27.8891 YCCC   1843.413067  3 0.0005   243 | 1/16
 11 h-m-p  0.0009 0.0119  14.8027 CCC    1843.207764  2 0.0011   266 | 1/16
 12 h-m-p  0.0029 0.0145   5.1765 CYCCC  1842.183475  4 0.0045   292 | 1/16
 13 h-m-p  0.0005 0.0024  44.5655 CYCC   1841.499840  3 0.0005   316 | 1/16
 14 h-m-p  0.0010 0.0063  19.8701 YCC    1841.392375  2 0.0005   338 | 1/16
 15 h-m-p  0.0033 0.0229   3.0891 -YC    1841.390368  1 0.0003   359 | 1/16
 16 h-m-p  0.0034 0.4253   0.3139 +CC    1841.369182  1 0.0148   381 | 1/16
 17 h-m-p  0.0016 0.1075   2.8155 ++YCCC  1839.149683  3 0.0562   422 | 1/16
 18 h-m-p  1.5667 7.8334   0.0832 YCCCC  1837.460334  4 2.7723   448 | 1/16
 19 h-m-p  1.1750 5.8752   0.0666 CCC    1837.018585  2 1.1995   486 | 1/16
 20 h-m-p  1.6000 8.0000   0.0362 YCC    1836.911717  2 1.1884   523 | 1/16
 21 h-m-p  1.1243 8.0000   0.0382 YCC    1836.845836  2 1.7923   560 | 1/16
 22 h-m-p  1.6000 8.0000   0.0123 YC     1836.838014  1 0.9642   595 | 1/16
 23 h-m-p  1.6000 8.0000   0.0015 CC     1836.837280  1 1.3085   631 | 1/16
 24 h-m-p  1.6000 8.0000   0.0005 C      1836.837049  0 1.9363   665 | 1/16
 25 h-m-p  1.6000 8.0000   0.0002 C      1836.836987  0 1.5562   699 | 1/16
 26 h-m-p  1.1763 8.0000   0.0002 C      1836.836980  0 1.3483   733 | 1/16
 27 h-m-p  1.6000 8.0000   0.0001 Y      1836.836979  0 1.1889   767 | 1/16
 28 h-m-p  1.6000 8.0000   0.0000 C      1836.836979  0 1.2888   801 | 1/16
 29 h-m-p  1.6000 8.0000   0.0000 C      1836.836979  0 1.6074   835 | 1/16
 30 h-m-p  1.2331 8.0000   0.0000 Y      1836.836979  0 0.5755   869 | 1/16
 31 h-m-p  1.1275 8.0000   0.0000 Y      1836.836979  0 0.2819   903 | 1/16
 32 h-m-p  0.4221 8.0000   0.0000 ----C  1836.836979  0 0.0004   941
Out..
lnL  = -1836.836979
942 lfun, 3768 EigenQcodon, 24492 P(t)

Time used:  0:06


Model 2: PositiveSelection

TREE #  1
(1, 6, ((2, 3), ((4, 7), (5, 8))));   MP score: 127
    0.060115    0.039293    0.024179    0.014839    0.091505    0.059248    0.000685    0.007506    0.041500    0.083756    0.019426    0.045097    0.079790    1.688810    1.721302    0.311817    0.493629    1.300000

ntime & nrate & np:    13     3    18

Bounds (np=18):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100 -99.000000 -99.000000   0.000001   1.000000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000   1.000000 999.000000

np =    18
lnL0 = -1871.115588

Iterating by ming2
Initial: fx=  1871.115588
x=  0.06011  0.03929  0.02418  0.01484  0.09150  0.05925  0.00069  0.00751  0.04150  0.08376  0.01943  0.04510  0.07979  1.68881  1.72130  0.31182  0.49363  1.30000

  1 h-m-p  0.0000 0.0017 1212.8049 YYCCCCC  1869.002390  6 0.0000    33 | 0/18
  2 h-m-p  0.0000 0.0002 300.1820 YCCCC  1866.685507  4 0.0001    61 | 0/18
  3 h-m-p  0.0003 0.0020  82.0029 CCC    1865.562274  2 0.0004    86 | 0/18
  4 h-m-p  0.0002 0.0025 126.0757 +YCYCCC  1857.888012  5 0.0018   117 | 0/18
  5 h-m-p  0.0000 0.0001 4615.2744 ++     1844.332866  m 0.0001   138 | 0/18
  6 h-m-p -0.0000 -0.0000 349.1871 
h-m-p:     -1.76272420e-20     -8.81362099e-20      3.49187086e+02  1844.332866
..  | 0/18
  7 h-m-p  0.0000 0.0002 415.6718 +YCCC  1839.049950  3 0.0001   183 | 0/18
  8 h-m-p  0.0002 0.0008 207.4679 CCCC   1836.343344  3 0.0002   210 | 0/18
  9 h-m-p  0.0001 0.0003 300.4748 +YYCCC  1831.824694  4 0.0002   238 | 0/18
 10 h-m-p  0.0000 0.0000 169.4568 ++     1831.200766  m 0.0000   259 | 1/18
 11 h-m-p  0.0001 0.0024  65.1324 +YCCC  1830.701882  3 0.0003   286 | 1/18
 12 h-m-p  0.0005 0.0023  36.0190 YCCC   1830.547836  3 0.0003   312 | 1/18
 13 h-m-p  0.0003 0.0127  32.0349 +YCCC  1830.201507  3 0.0010   339 | 1/18
 14 h-m-p  0.0002 0.0030 187.4194 +CCCCC  1828.261837  4 0.0009   369 | 1/18
 15 h-m-p  0.0002 0.0011 284.6818 YCCC   1826.989248  3 0.0004   395 | 1/18
 16 h-m-p  0.0004 0.0019  88.4420 YCCC   1826.522418  3 0.0006   421 | 1/18
 17 h-m-p  0.0005 0.0054 110.2601 YCCC   1825.716765  3 0.0009   447 | 1/18
 18 h-m-p  0.0006 0.0079 163.4111 +CCC   1822.074112  2 0.0034   473 | 1/18
 19 h-m-p  0.0004 0.0020 1031.2322 +YCCCC  1813.594380  4 0.0012   502 | 1/18
 20 h-m-p  0.0003 0.0016 192.3216 YCC    1813.328823  2 0.0002   526 | 1/18
 21 h-m-p  0.0017 0.0178  23.2351 CCC    1813.263003  2 0.0006   551 | 1/18
 22 h-m-p  0.0037 1.3556   3.5375 ++CC   1812.863462  1 0.0597   576 | 0/18
 23 h-m-p  0.0049 0.1035  43.0051 CCC    1812.806021  2 0.0016   601 | 0/18
 24 h-m-p  0.0166 0.0832   2.1164 ++     1812.344595  m 0.0832   622 | 1/18
 25 h-m-p  0.1435 0.9851   1.2235 +CYCCC  1810.458486  4 0.6424   651 | 1/18
 26 h-m-p  0.3043 2.9937   2.5830 YYC    1809.548947  2 0.2625   674 | 1/18
 27 h-m-p  0.6746 8.0000   1.0051 YCCC   1809.186654  3 0.3288   700 | 1/18
 28 h-m-p  0.3139 6.4324   1.0529 +CCCC  1808.253229  3 1.3843   728 | 1/18
 29 h-m-p  1.6000 8.0000   0.4276 CCC    1807.872819  2 1.5825   753 | 1/18
 30 h-m-p  1.6000 8.0000   0.4048 CCC    1807.717474  2 1.7112   795 | 1/18
 31 h-m-p  1.6000 8.0000   0.0771 YC     1807.696723  1 0.9177   834 | 1/18
 32 h-m-p  1.2357 8.0000   0.0573 CC     1807.692517  1 1.0417   874 | 1/18
 33 h-m-p  1.6000 8.0000   0.0047 C      1807.692093  0 1.5862   912 | 1/18
 34 h-m-p  1.6000 8.0000   0.0025 C      1807.692075  0 1.3371   950 | 1/18
 35 h-m-p  1.6000 8.0000   0.0005 C      1807.692074  0 1.3469   988 | 1/18
 36 h-m-p  1.6000 8.0000   0.0001 C      1807.692074  0 1.7895  1026 | 1/18
 37 h-m-p  1.6000 8.0000   0.0000 C      1807.692074  0 1.9739  1064 | 1/18
 38 h-m-p  1.6000 8.0000   0.0000 C      1807.692074  0 1.8830  1102 | 1/18
 39 h-m-p  1.6000 8.0000   0.0000 ------C  1807.692074  0 0.0001  1146
Out..
lnL  = -1807.692074
1147 lfun, 6882 EigenQcodon, 44733 P(t)

BEBing (dim = 4).  This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
	log(fX) = -1816.119277  S = -1672.360973  -136.675160
Calculating f(w|X), posterior probabilities of site classes.

	did  10 / 121 patterns   0:16
	did  20 / 121 patterns   0:16
	did  30 / 121 patterns   0:17
	did  40 / 121 patterns   0:17
	did  50 / 121 patterns   0:17
	did  60 / 121 patterns   0:17
	did  70 / 121 patterns   0:17
	did  80 / 121 patterns   0:17
	did  90 / 121 patterns   0:17
	did 100 / 121 patterns   0:17
	did 110 / 121 patterns   0:17
	did 120 / 121 patterns   0:17
	did 121 / 121 patterns   0:17
Time used:  0:17


Model 7: beta

TREE #  1
(1, 6, ((2, 3), ((4, 7), (5, 8))));   MP score: 127
    0.060115    0.039293    0.024179    0.014839    0.091505    0.059248    0.000685    0.007506    0.041500    0.083756    0.019426    0.045097    0.079790    2.133144    0.633447    1.766224

ntime & nrate & np:    13     1    16

Bounds (np=16):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.005000   0.005000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000

np =    16
lnL0 = -1869.425793

Iterating by ming2
Initial: fx=  1869.425793
x=  0.06011  0.03929  0.02418  0.01484  0.09150  0.05925  0.00069  0.00751  0.04150  0.08376  0.01943  0.04510  0.07979  2.13314  0.63345  1.76622

  1 h-m-p  0.0000 0.0016 1144.3333 YYYCCCC  1867.267793  6 0.0000    30 | 0/16
  2 h-m-p  0.0000 0.0002 285.9688 YCCCC  1865.138022  4 0.0001    56 | 0/16
  3 h-m-p  0.0003 0.0020  59.3375 YC     1864.809272  1 0.0002    76 | 0/16
  4 h-m-p  0.0005 0.0045  25.3357 YC     1864.712516  1 0.0004    96 | 0/16
  5 h-m-p  0.0003 0.0079  27.6592 CCC    1864.655185  2 0.0003   119 | 0/16
  6 h-m-p  0.0002 0.0173  36.1163 ++YCC  1864.162074  2 0.0023   143 | 0/16
  7 h-m-p  0.0003 0.0048 248.1403 +YYC   1862.615691  2 0.0011   165 | 0/16
  8 h-m-p  0.0002 0.0009 409.7352 CCCC   1862.069633  3 0.0002   190 | 0/16
  9 h-m-p  0.0006 0.0030 106.6033 CCC    1861.940166  2 0.0002   213 | 0/16
 10 h-m-p  0.0008 0.0116  28.5180 CCC    1861.849935  2 0.0007   236 | 0/16
 11 h-m-p  0.0005 0.0217  36.5857 +CCC   1861.565765  2 0.0020   260 | 0/16
 12 h-m-p  0.0002 0.0045 348.1299 ++YYYYYCC  1853.962705  6 0.0034   288 | 0/16
 13 h-m-p  0.0000 0.0001 3013.0780 CCCCC  1853.479725  4 0.0000   315 | 0/16
 14 h-m-p  0.0049 0.0247  10.3378 YYYC   1853.280233  3 0.0047   337 | 0/16
 15 h-m-p  0.0001 0.0011 424.6025 +YCYYCYCYCC  1845.711128 10 0.0010   372 | 0/16
 16 h-m-p  0.0001 0.0007  79.6730 -CC    1845.707823  1 0.0000   394 | 0/16
 17 h-m-p  0.0016 0.3003   0.5292 ++CCC  1845.470420  2 0.0349   419 | 0/16
 18 h-m-p  0.0040 0.3666   4.6077 ++CYCCC  1841.207837  4 0.0574   463 | 0/16
 19 h-m-p  0.7520 4.2371   0.3517 CCCC   1839.331059  3 0.8986   488 | 0/16
 20 h-m-p  0.1874 0.9370   0.1822 +CCC   1837.539748  2 0.6729   528 | 0/16
 21 h-m-p  0.2051 1.0254   0.0640 ++     1836.982622  m 1.0254   563 | 1/16
 22 h-m-p  0.8992 8.0000   0.0723 YCYY   1836.910351  3 0.6741   603 | 0/16
 23 h-m-p  0.0001 0.0011 740.9254 YYYC   1836.899547  3 0.0000   640 | 0/16
 24 h-m-p  0.5010 5.4275   0.0244 YC     1836.889369  1 1.0066   660 | 0/16
 25 h-m-p  1.6000 8.0000   0.0005 C      1836.888886  0 1.4981   695 | 0/16
 26 h-m-p  1.6000 8.0000   0.0003 C      1836.888759  0 2.0891   730 | 0/16
 27 h-m-p  1.6000 8.0000   0.0003 C      1836.888743  0 1.3956   765 | 0/16
 28 h-m-p  1.6000 8.0000   0.0000 Y      1836.888740  0 2.6835   800 | 0/16
 29 h-m-p  1.6000 8.0000   0.0001 ++     1836.888729  m 8.0000   835 | 0/16
 30 h-m-p  0.8988 4.4941   0.0002 +Y     1836.888721  0 2.9630   871 | 0/16
 31 h-m-p  0.4534 2.2671   0.0002 +C     1836.888719  0 1.5790   907 | 0/16
 32 h-m-p  0.1173 0.5865   0.0002 ++     1836.888719  m 0.5865   942 | 1/16
 33 h-m-p  0.1331 8.0000   0.0007 C      1836.888718  0 0.1545   977 | 1/16
 34 h-m-p  1.6000 8.0000   0.0000 Y      1836.888718  0 1.0704  1011 | 1/16
 35 h-m-p  1.6000 8.0000   0.0000 C      1836.888718  0 0.6390  1045 | 1/16
 36 h-m-p  1.1842 8.0000   0.0000 -----Y  1836.888718  0 0.0003  1084
Out..
lnL  = -1836.888718
1085 lfun, 21700 EigenQcodon, 141050 P(t)

Time used:  0:51


Model 8: beta&w>1

TREE #  1
(1, 6, ((2, 3), ((4, 7), (5, 8))));   MP score: 127
    0.060115    0.039293    0.024179    0.014839    0.091505    0.059248    0.000685    0.007506    0.041500    0.083756    0.019426    0.045097    0.079790    1.681665    0.900000    0.705643    1.246019    1.300000

ntime & nrate & np:    13     2    18

Bounds (np=18):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000010   0.005000   0.005000   1.000000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000   0.999990  99.000000  99.000000 999.000000

np =    18
lnL0 = -1855.453021

Iterating by ming2
Initial: fx=  1855.453021
x=  0.06011  0.03929  0.02418  0.01484  0.09150  0.05925  0.00069  0.00751  0.04150  0.08376  0.01943  0.04510  0.07979  1.68166  0.90000  0.70564  1.24602  1.30000

  1 h-m-p  0.0000 0.0021 1179.0874 YYYCCCC  1853.261748  6 0.0000    32 | 0/18
  2 h-m-p  0.0000 0.0002 291.9229 YCCCC  1850.872829  4 0.0001    60 | 0/18
  3 h-m-p  0.0003 0.0020  75.7939 CYC    1849.979828  2 0.0003    84 | 0/18
  4 h-m-p  0.0003 0.0029  79.5933 YC     1848.555478  1 0.0008   106 | 0/18
  5 h-m-p  0.0003 0.0013 222.8503 CC     1847.227751  1 0.0003   129 | 0/18
  6 h-m-p  0.0003 0.0031 263.6116 +YYYC  1842.133311  3 0.0010   154 | 0/18
  7 h-m-p  0.0005 0.0024 274.3271 CCCC   1838.936059  3 0.0007   181 | 0/18
  8 h-m-p  0.0003 0.0016 281.6104 +CYCCC  1831.316171  4 0.0013   210 | 0/18
  9 h-m-p  0.0000 0.0000 3636.2030 ++     1829.579688  m 0.0000   231 | 1/18
 10 h-m-p  0.0002 0.0022 241.5681 +CCCC  1828.777756  3 0.0008   259 | 1/18
 11 h-m-p  0.0015 0.0074  95.5475 YCCC   1828.396601  3 0.0007   285 | 1/18
 12 h-m-p  0.0023 0.0115  15.1354 CCCCC  1826.799883  4 0.0032   314 | 1/18
 13 h-m-p  0.0006 0.0048  78.4007 YCCCC  1822.778982  4 0.0011   342 | 1/18
 14 h-m-p  0.0004 0.0019  85.9392 CCCCC  1821.534434  4 0.0004   371 | 1/18
 15 h-m-p  0.0018 0.0090  18.1477 CCC    1821.440692  2 0.0006   396 | 1/18
 16 h-m-p  0.0013 0.0645   8.7954 ++YCCC  1821.028715  3 0.0136   424 | 1/18
 17 h-m-p  0.0002 0.0031 657.8214 ++Y

a     0.000728     0.002912     0.003070     0.001831
f  1819.008299  1817.411653  1829.746178  1820.449548
	7.280777e-04 	1819.008299
	8.451565e-04 	1818.901071
	9.622352e-04 	1818.853967
	1.079314e-03 	1818.867385
	1.196393e-03 	1818.941908
	1.313472e-03 	1819.078291
	1.430550e-03 	1819.277460
	1.547629e-03 	1819.540505
	1.664708e-03 	1819.868675
	1.781787e-03 	1820.263372
	1.898865e-03 	1820.726133
	2.015944e-03 	1821.258596
	2.133023e-03 	1821.862418
	2.250102e-03 	1822.539029
	2.367181e-03 	1823.288847
	2.484259e-03 	1824.108085
	2.601338e-03 	1824.970905
	2.718417e-03 	1825.662595
	2.835496e-03 	1822.924205
	2.952574e-03 	1817.359646
	3.069653e-03 	1829.746178
Linesearch2 a4: multiple optima?
Y

a     0.001831     0.002912     0.003070     0.002393
f  1820.449548  1817.411653  1829.746178  1823.464464
	1.831011e-03 	1820.449548
	1.892943e-03 	1820.701063
	1.954875e-03 	1820.972059
	2.016807e-03 	1821.262783
	2.078739e-03 	1821.573481
	2.140671e-03 	1821.904383
	2.202603e-03 	1822.255689
	2.264535e-03 	1822.627526
	2.326468e-03 	1823.019878
	2.388400e-03 	1823.432430
	2.450332e-03 	1823.864205
	2.512264e-03 	1824.312646
	2.574196e-03 	1824.770990
	2.636128e-03 	1825.219554
	2.698060e-03 	1825.590900
	2.759992e-03 	1825.598455
	2.821925e-03 	1823.869658
	2.883857e-03 	1818.460633
	2.945789e-03 	1817.345049
	3.007721e-03 	1817.461618
	3.069653e-03 	1829.746178
Linesearch2 a4: multiple optima?
Y

a     0.002393     0.002912     0.003070     0.002696
f  1823.464464  1817.411653  1829.746178  1825.583807
	2.393088e-03 	1823.464464
	2.426917e-03 	1823.698810
	2.460745e-03 	1823.938547
	2.494573e-03 	1824.183116
	2.528401e-03 	1824.431570
	2.562230e-03 	1824.682265
	2.596058e-03 	1824.932253
	2.629886e-03 	1825.175995
	2.663714e-03 	1825.402507
	2.697542e-03 	1825.588579
	2.731371e-03 	1825.681693
	2.765199e-03 	1825.555689
	2.799027e-03 	1824.905662
	2.832855e-03 	1823.128984
	2.866684e-03 	1819.960814
	2.900512e-03 	1817.641209
	2.934340e-03 	1817.328907
	2.968168e-03 	1817.397402
	3.001997e-03 	1817.478024
	3.035825e-03 	1816.665036
	3.069653e-03 	1829.746178
Linesearch2 a4: multiple optima?
YCYYYC  1817.328092  8 0.0029   519 | 1/18
 18 h-m-p  0.0070 0.0351   2.5630 +YYY

a     0.017857     0.023309     0.028089     0.025150
f  1817.164789  1816.299114  1816.390283  1816.415090
	1.785699e-02 	1817.164789
	1.836860e-02 	1817.156228
	1.888022e-02 	1817.143052
	1.939184e-02 	1817.120225
	1.990346e-02 	1817.077053
	2.041508e-02 	1816.992049
	2.092670e-02 	1816.829829
	2.143832e-02 	1816.564914
	2.194993e-02 	1816.268953
	2.246155e-02 	1816.133613
	2.297317e-02 	1816.213945
	2.348479e-02 	1816.335465
	2.399641e-02 	1816.396645
	2.450803e-02 	1816.414390
	2.501965e-02 	1816.415720
	2.553127e-02 	1816.412412
	2.604288e-02 	1816.408040
	2.655450e-02 	1816.403472
	2.706612e-02 	1816.398883
	2.757774e-02 	1816.394345
Linesearch2 a4: multiple optima?
CYCYC  1816.133403  7 0.0225   570 | 1/18
 19 h-m-p  0.0859 1.7470   0.6709 Y

a     0.000000     0.085887     0.343549     0.064118
f  1816.133403  1815.990040  1819.049027  1816.259091
	0.000000e+00 	1816.133403
	1.717745e-02 	1816.818304
	3.435489e-02 	1816.647629
	5.153234e-02 	1816.420981
	6.870979e-02 	1816.201171
	8.588723e-02 	1815.990040
	1.030647e-01 	1815.787763
	1.202421e-01 	1815.595154
	1.374196e-01 	1815.415088
	1.545970e-01 	1815.254908
	1.717745e-01 	1815.131210
	1.889519e-01 	1815.079531
	2.061294e-01 	1815.161838
	2.233068e-01 	1815.443866
	2.404843e-01 	1815.938314
	2.576617e-01 	1816.578721
	2.748391e-01 	1817.258804
	2.920166e-01 	1817.885104
	3.091940e-01 	1818.401294
	3.263715e-01 	1818.787522
Linesearch2 a4: multiple optima?
YCCYCCCC  1815.079495  8 0.1885   624 | 0/18
 20 h-m-p  0.0000 0.0001 12104.4710 YCCC   1813.192303  3 0.0000   667 | 0/18
 21 h-m-p  0.3499 1.7494   0.1971 ++     1811.545579  m 1.7494   688 | 1/18
 22 h-m-p  0.2016 1.0080   1.1350 YCCYCYCC  1811.298358  7 0.0600   738 | 1/18
 23 h-m-p  0.2070 6.6864   0.3291 CC     1811.206476  1 0.2089   761 | 0/18
 24 h-m-p  0.0000 0.0000 280393.2415 YCCC   1811.138981  3 0.0000   804 | 0/18
 25 h-m-p  0.0998 0.5328   0.5610 ++     1810.804736  m 0.5328   825 | 1/18
 26 h-m-p  0.8362 6.3073   0.3575 CCC    1810.456139  2 0.9927   868 | 0/18
 27 h-m-p  0.0000 0.0000 49974.4883 -C     1810.451267  0 0.0000   907 | 0/18
 28 h-m-p  0.0432 8.0000   0.5500 ++YCCC  1809.568037  3 1.5137   935 | 0/18
 29 h-m-p  0.5181 2.5903   0.3047 +YC    1809.087350  1 1.6238   976 | 0/18
 30 h-m-p  0.2906 1.4531   0.0199 ++     1808.991361  m 1.4531  1015 | 0/18
 31 h-m-p -0.0000 -0.0000   0.0233 
h-m-p:     -0.00000000e+00     -0.00000000e+00      2.32865381e-02  1808.991361
..  | 0/18
 32 h-m-p  0.0000 0.0015  33.6910 +CYC   1808.963804  2 0.0001  1094 | 0/18
 33 h-m-p  0.0001 0.0011  30.0215 YC     1808.933502  1 0.0001  1116 | 0/18
 34 h-m-p  0.0008 0.0286   3.7627 YC     1808.931124  1 0.0003  1138 | 0/18
 35 h-m-p  0.0006 0.1000   2.2946 YC     1808.930531  1 0.0003  1160 | 0/18
 36 h-m-p  0.0006 0.0732   1.1327 +CYYCC  1808.789167  4 0.0038  1188 | 0/18
 37 h-m-p  0.0000 0.0001 677.6730 ----Y  1808.789165  0 0.0000  1213 | 0/18
 38 h-m-p  0.0001 0.0614   1.6200 C      1808.789074  0 0.0002  1234 | 0/18
 39 h-m-p  0.0008 0.1996   0.3211 Y      1808.789049  0 0.0005  1255 | 0/18
 40 h-m-p  0.0011 0.5389   0.6953 C      1808.788928  0 0.0015  1294 | 0/18
 41 h-m-p  0.0003 0.1240   3.0035 +C     1808.788494  0 0.0013  1334 | 0/18
 42 h-m-p  0.0010 0.1374   3.6702 C      1808.788083  0 0.0009  1355 | 0/18
 43 h-m-p  0.0007 0.1758   4.6865 C      1808.787614  0 0.0009  1376 | 0/18
 44 h-m-p  0.0008 0.0421   5.4759 +YC    1808.786368  1 0.0021  1399 | 0/18
 45 h-m-p  0.0007 0.0078  17.3778 CC     1808.784608  1 0.0010  1422 | 0/18
 46 h-m-p  0.0044 0.0267   3.8449 -C     1808.784498  0 0.0003  1444 | 0/18
 47 h-m-p  0.0023 0.1789   0.4827 Y      1808.784452  0 0.0011  1465 | 0/18
 48 h-m-p  0.0027 1.3365   0.2056 C      1808.784416  0 0.0024  1504 | 0/18
 49 h-m-p  0.0160 8.0000   0.4850 ++C    1808.775589  0 0.2540  1545 | 0/18
 50 h-m-p  1.6000 8.0000   0.0505 CC     1808.756435  1 1.9222  1586 | 0/18
 51 h-m-p  1.4134 8.0000   0.0687 ++     1808.424092  m 8.0000  1625 | 0/18
 52 h-m-p  0.0596 0.4511   9.2152 CCCC   1808.175052  3 0.0785  1670 | 0/18
 53 h-m-p  1.5809 8.0000   0.4578 YCCC   1808.025764  3 0.6772  1696 | 0/18
 54 h-m-p  0.6929 3.4647   0.1835 CYC    1807.795215  2 1.2537  1738 | 0/18
 55 h-m-p  1.6000 8.0000   0.0078 CCC    1807.706424  2 1.8114  1781 | 0/18
 56 h-m-p  0.2776 8.0000   0.0507 +CC    1807.698657  1 1.4943  1823 | 0/18
 57 h-m-p  1.6000 8.0000   0.0187 YC     1807.697464  1 1.1113  1863 | 0/18
 58 h-m-p  1.6000 8.0000   0.0021 C      1807.697128  0 1.4826  1902 | 0/18
 59 h-m-p  1.3025 8.0000   0.0024 ++     1807.696650  m 8.0000  1941 | 0/18
 60 h-m-p  1.6000 8.0000   0.0021 +C     1807.694763  0 6.0382  1981 | 0/18
 61 h-m-p  1.0132 5.0661   0.0062 +YC    1807.693104  1 2.6412  2022 | 0/18
 62 h-m-p  0.6403 3.2017   0.0053 +YC    1807.692794  1 1.8023  2063 | 0/18
 63 h-m-p  0.3539 1.7694   0.0017 ++     1807.692725  m 1.7694  2102 | 1/18
 64 h-m-p  1.1752 5.8759   0.0018 ----------------..  | 1/18
 65 h-m-p  0.0008 0.4127   0.1562 Y      1807.692720  0 0.0004  2193 | 1/18
 66 h-m-p  0.0127 6.3356   0.3421 ---C   1807.692719  0 0.0001  2234 | 1/18
 67 h-m-p  0.0006 0.3124   0.3563 Y      1807.692711  0 0.0005  2272 | 1/18
 68 h-m-p  0.0009 0.4639   0.2362 Y      1807.692708  0 0.0004  2310 | 1/18
 69 h-m-p  0.0068 3.4221   0.0427 -C     1807.692708  0 0.0004  2349 | 1/18
 70 h-m-p  0.0041 2.0439   0.0293 -C     1807.692707  0 0.0003  2388 | 1/18
 71 h-m-p  0.0160 8.0000   0.0083 -Y     1807.692707  0 0.0005  2427 | 1/18
 72 h-m-p  0.0160 8.0000   0.0058 -Y     1807.692707  0 0.0007  2466 | 1/18
 73 h-m-p  0.0160 8.0000   0.0039 -C     1807.692707  0 0.0010  2505 | 1/18
 74 h-m-p  0.0160 8.0000   0.0027 -C     1807.692707  0 0.0013  2544 | 1/18
 75 h-m-p  0.0160 8.0000   0.0059 -C     1807.692707  0 0.0009  2583 | 1/18
 76 h-m-p  0.0160 8.0000   0.0192 Y      1807.692707  0 0.0023  2621 | 1/18
 77 h-m-p  0.0160 8.0000   0.1279 C      1807.692706  0 0.0048  2659 | 1/18
 78 h-m-p  0.0079 3.9648   1.0302 -Y     1807.692704  0 0.0009  2698 | 1/18
 79 h-m-p  0.0160 8.0000   0.0595 -Y     1807.692704  0 0.0007  2720 | 1/18
 80 h-m-p  0.0247 8.0000   0.0017 +Y     1807.692704  0 0.0652  2759 | 1/18
 81 h-m-p  0.0160 8.0000   0.3073 -C     1807.692704  0 0.0010  2798 | 1/18
 82 h-m-p  0.3506 8.0000   0.0009 +C     1807.692703  0 1.4359  2837 | 1/18
 83 h-m-p  1.6000 8.0000   0.0001 C      1807.692703  0 1.6000  2875 | 1/18
 84 h-m-p  0.9704 8.0000   0.0001 +Y     1807.692703  0 2.4317  2914 | 1/18
 85 h-m-p  1.6000 8.0000   0.0001 Y      1807.692703  0 1.0223  2952 | 1/18
 86 h-m-p  1.6000 8.0000   0.0000 C      1807.692703  0 0.5235  2990 | 1/18
 87 h-m-p  1.0115 8.0000   0.0000 ------------C  1807.692703  0 0.0000  3040
Out..
lnL  = -1807.692703
3041 lfun, 66902 EigenQcodon, 434863 P(t)

BEBing (dim = 4).  This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
	log(fX) = -1816.765509  S = -1672.391440  -138.241395
Calculating f(w|X), posterior probabilities of site classes.

	did  10 / 121 patterns   2:36
	did  20 / 121 patterns   2:37
	did  30 / 121 patterns   2:37
	did  40 / 121 patterns   2:37
	did  50 / 121 patterns   2:37
	did  60 / 121 patterns   2:37
	did  70 / 121 patterns   2:38
	did  80 / 121 patterns   2:38
	did  90 / 121 patterns   2:38
	did 100 / 121 patterns   2:38
	did 110 / 121 patterns   2:38
	did 120 / 121 patterns   2:38
	did 121 / 121 patterns   2:38
Time used:  2:39
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=8, Len=277 

Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3                                MVCLKLPGGSSLAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGT
Aotus_nancymaae_Aotidae_Haplorrhini_XP_012296108.1_LOC105708938                        MVCLRLPGGSYVAALTVTLMVLSSPLALVGDTRPRFLELVKHECHFFNGT
Cebus_capucinus_imitator_Cebidae_Haplorrhini_XP_017378231.1_LOC108300090               MVCLRLPGGFCMAALTVTLMVLSSPLALAGDTRPRFLEQAKSECHFFNGT
Cercocebus_atys_Cercopithecidae_Haplorrhini_XP_011895433.1_LOC105576724                MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTRPRFLEQVKSECHFFNGT
Colobus_angolensis_palliatus_Cercopithecidae_Haplorrhini_XP_011784781.1_LOC105502761   MVCLKLPGGSYMAALTVTLMVLSSPLALAGDTQPRFLEQFKSECHFFNGT
Pan_paniscus_Hominidae_Haplorrhini_XP_003829806.1_                                     MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTRSRFLELVKSECHFFNGT
Papio_anubis_Cercopithecidae_Haplorrhini_XP_009198027.2_LOC101001669                   -----------MAALTVTLMVLSSPLALAGDTRPHFLEQGKSECHFFNGT
Piliocolobus_tephrosceles_Cercopithecidae_Haplorrhini_XP_023057332.1_LOC111535153      MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTRPRFLEYSTSECHFFNGT
                                                                                                  :************ **:.***:.:***  . ********

Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3                                ERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQK
Aotus_nancymaae_Aotidae_Haplorrhini_XP_012296108.1_LOC105708938                        ERVRYLDRYIHNQEEVVRFDSDVGEYRAVTELGRPDAEYWNSQKDYVEQK
Cebus_capucinus_imitator_Cebidae_Haplorrhini_XP_017378231.1_LOC108300090               ERVRYLQRYFYNQEEYVRFDSDVGEYRAVTELGRPSAEYWNSQKELLEQK
Cercocebus_atys_Cercopithecidae_Haplorrhini_XP_011895433.1_LOC105576724                ERVRFLERHFYNQEEFVRFDSDVGEYRAVSELGRPVAESWNSQKDLLEQK
Colobus_angolensis_palliatus_Cercopithecidae_Haplorrhini_XP_011784781.1_LOC105502761   ERVRYLQRYFYNQEEYVRYDSDVGEYRAVTELGRPDAKYWNSQKDILEQR
Pan_paniscus_Hominidae_Haplorrhini_XP_003829806.1_                                     ERVRFLERYFYNQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDYVEQK
Papio_anubis_Cercopithecidae_Haplorrhini_XP_009198027.2_LOC101001669                   ERVRFLERHFYNQEEYLRFDSDVGEYRAVSELGRPTAESWNSQKDYLEQK
Piliocolobus_tephrosceles_Cercopithecidae_Haplorrhini_XP_023057332.1_LOC111535153      ERVRYLDRYFYNQEETLRFDSDVGEYRAVTELGRPDAEYWNSQKDILEDQ
                                                                                       ****:*:*:::**** :*:**********:***** *: *****: :*::

Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3                                RGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSG
Aotus_nancymaae_Aotidae_Haplorrhini_XP_012296108.1_LOC105708938                        RGQVDNYCRHNYGVFESFTVQRRVQPKMTVYPAKTQPLQHHNLLVCSVSG
Cebus_capucinus_imitator_Cebidae_Haplorrhini_XP_017378231.1_LOC108300090               RGQVDNYCRHNYRVGESFTVQRRVQPKVTVYPAKTQPLQHHSLLVCSVSG
Cercocebus_atys_Cercopithecidae_Haplorrhini_XP_011895433.1_LOC105576724                RGQVDNYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHTLLVCSVSG
Colobus_angolensis_palliatus_Cercopithecidae_Haplorrhini_XP_011784781.1_LOC105502761   RARVDNYCRHNYGVGESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNG
Pan_paniscus_Hominidae_Haplorrhini_XP_003829806.1_                                     RGQVDNYCRHNYRVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVNG
Papio_anubis_Cercopithecidae_Haplorrhini_XP_009198027.2_LOC101001669                   RGQVDNYCRHNYGVGESFTVQRRVQPKVTVYPAKTQPLQHHTLLVCSVNG
Piliocolobus_tephrosceles_Cercopithecidae_Haplorrhini_XP_023057332.1_LOC111535153      RASVDNYCRYNYGVGESFTVQRRVQPKVTVYPAKTQPLQHHNLLVCSVNG
                                                                                       *. ******:** * *********:*::****:********.******.*

Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3                                FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY
Aotus_nancymaae_Aotidae_Haplorrhini_XP_012296108.1_LOC105708938                        FYPGSIEVRWFRNNQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
Cebus_capucinus_imitator_Cebidae_Haplorrhini_XP_017378231.1_LOC108300090               FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
Cercocebus_atys_Cercopithecidae_Haplorrhini_XP_011895433.1_LOC105576724                FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY
Colobus_angolensis_palliatus_Cercopithecidae_Haplorrhini_XP_011784781.1_LOC105502761   FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
Pan_paniscus_Hominidae_Haplorrhini_XP_003829806.1_                                     FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY
Papio_anubis_Cercopithecidae_Haplorrhini_XP_009198027.2_LOC101001669                   FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
Piliocolobus_tephrosceles_Cercopithecidae_Haplorrhini_XP_023057332.1_LOC111535153      FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
                                                                                       *************.******************************:*****

Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3                                TCQVEHPSVTSALTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
Aotus_nancymaae_Aotidae_Haplorrhini_XP_012296108.1_LOC105708938                        TCQVEHPSVTTPITVQWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
Cebus_capucinus_imitator_Cebidae_Haplorrhini_XP_017378231.1_LOC108300090               TCQVEHPSVMSPLTVQWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
Cercocebus_atys_Cercopithecidae_Haplorrhini_XP_011895433.1_LOC105576724                TCQVEHPSVTSPLTVQWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
Colobus_angolensis_palliatus_Cercopithecidae_Haplorrhini_XP_011784781.1_LOC105502761   TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
Pan_paniscus_Hominidae_Haplorrhini_XP_003829806.1_                                     TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
Papio_anubis_Cercopithecidae_Haplorrhini_XP_009198027.2_LOC101001669                   TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
Piliocolobus_tephrosceles_Cercopithecidae_Haplorrhini_XP_023057332.1_LOC111535153      TCQVEHPSVTSPLTVEWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
                                                                                       ********* :.:**:***:******************************

Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3                                RNQKGHSGLQPTGFLS-----------
Aotus_nancymaae_Aotidae_Haplorrhini_XP_012296108.1_LOC105708938                        RNQKGGSGLQPTGLLS-----------
Cebus_capucinus_imitator_Cebidae_Haplorrhini_XP_017378231.1_LOC108300090               RNQKGRSGLQPTGLLS-----------
Cercocebus_atys_Cercopithecidae_Haplorrhini_XP_011895433.1_LOC105576724                RNQKGHSGLQPTGLLS-----------
Colobus_angolensis_palliatus_Cercopithecidae_Haplorrhini_XP_011784781.1_LOC105502761   RNQKGHSGLHPTGLLS-----------
Pan_paniscus_Hominidae_Haplorrhini_XP_003829806.1_                                     RNQKGHSGLQPTGFLS-----------
Papio_anubis_Cercopithecidae_Haplorrhini_XP_009198027.2_LOC101001669                   RNQKGLLSooooooooooooooooooo
Piliocolobus_tephrosceles_Cercopithecidae_Haplorrhini_XP_023057332.1_LOC111535153      RNQKGHTGLQPTGLLS-----------
                                                                                       *****  .                   



>Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3
ATGGTGTGTCTGAAGCTCCCTGGAGGCTCCAGCTTGGCAGCGTTGACAGT
GACACTGATGGTGCTGAGCTCCCGACTGGCTTTCGCTGGGGACACCCGAC
CACGTTTCTTGGAGCTGCGTAAGTCTGAGTGTCATTTCTTCAATGGGACG
GAGCGGGTGCGGTACCTGGACAGATACTTCCATAACCAGGAGGAGTTCCT
GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
GGCCTGTCGCCGAGTCCTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAG
CGGGGCCGGGTGGACAATTACTGCAGACACAACTACGGGGTTGGTGAGAG
CTTCACAGTGCAGCGGCGAGTCCATCCTCAGGTGACTGTGTATCCTGCAA
AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAGTGGT
TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
GAAGGCTGGGGTGGTGTCCACGGGCCTGATCCAGAATGGAGACTGGACCT
TCCAGACCCTGGTGATGCTAGAAACAGTTCCTCGGAGTGGAGAGGTTTAC
ACTTGCCAAGTGGAGCACCCAAGCGTAACGAGCGCTCTCACAGTGGAATG
GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTGTTCATCTACTTC
AGGAATCAGAAAGGACACTCTGGACTTCAGCCAACAGGATTCCTGAGC--
-------------------------------
>Aotus_nancymaae_Aotidae_Haplorrhini_XP_012296108.1_LOC105708938
ATGGTGTGTCTGAGGCTCCCTGGAGGCTCCTACGTGGCAGCGCTGACAGT
GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGTTGGGGACACCCGAC
CACGTTTCTTGGAGCTGGTTAAGCATGAGTGTCATTTCTTCAACGGGACG
GAGCGGGTGCGGTACCTGGACAGATACATCCATAACCAGGAGGAGGTCGT
GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
GGCCTGACGCCGAGTACTGGAACAGCCAGAAGGACTACGTGGAGCAGAAG
CGGGGCCAGGTGGACAACTACTGCAGACACAACTACGGGGTTTTTGAGAG
CTTCACAGTGCAGCGGAGAGTCCAACCTAAGATGACTGTGTATCCTGCAA
AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAGTGGT
TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACAACCAGGAAGA
GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCT
TCCAGACCCTGGTGATGCTGGAAACCGTTCCTCAGAGTGGAGAGGTTTAC
ACCTGCCAAGTGGAGCACCCAAGTGTGACGACCCCTATCACAGTGCAATG
GAGAGCACAGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCAGGGCTGTTCATCTACTTC
AGGAATCAGAAAGGAGGCTCTGGACTTCAGCCAACAGGACTCCTGAGC--
-------------------------------
>Cebus_capucinus_imitator_Cebidae_Haplorrhini_XP_017378231.1_LOC108300090
ATGGTGTGTCTGAGGCTCCCTGGAGGCTTCTGCATGGCAGCGCTGACAGT
GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC
CACGTTTCTTGGAGCAGGCTAAGTCTGAGTGTCATTTCTTCAACGGGACG
GAGCGGGTGCGGTACCTGCAGAGATACTTCTATAACCAGGAGGAGTATGT
GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
GGCCTAGCGCAGAGTACTGGAACAGCCAGAAGGAACTCCTGGAGCAGAAG
CGGGGCCAGGTGGACAACTACTGCAGACACAACTACCGGGTTGGCGAGAG
CTTCACAGTGCAGCGGAGAGTCCAACCTAAGGTGACTGTGTATCCTGCAA
AGACCCAGCCCCTGCAGCACCACAGCCTCCTGGTCTGCTCTGTGAGTGGG
TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCT
TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCAGAGTGGAGAGGTTTAC
ACCTGCCAAGTGGAGCACCCAAGCGTGATGAGCCCTCTCACAGTGCAATG
GAGAGCACAGTCTGAATCTGCACAGAGTAAGATGCTGAGTGGAGTCGGGG
GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCAGGGCTGTTCATCTACTTC
AGGAATCAGAAAGGACGCTCTGGACTTCAGCCAACAGGACTCCTGAGC--
-------------------------------
>Cercocebus_atys_Cercopithecidae_Haplorrhini_XP_011895433.1_LOC105576724
ATGGTGTGTCTGAAGCTCCCTGGAGGCTCCTGCATGGCAGCTCTGACAGT
GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC
CACGTTTCTTGGAGCAGGTTAAGTCTGAGTGTCATTTCTTCAACGGGACG
GAGCGGGTGCGGTTCCTGGAGAGACACTTCTATAACCAGGAGGAGTTCGT
GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGTCGGAGCTGGGGC
GGCCTGTCGCCGAGTCCTGGAACAGCCAGAAGGACCTCCTGGAGCAGAAG
CGGGGCCAGGTGGACAACTACTGCAGATACAACTACGGGGTTGTGGAGAG
CTTCACAGTGCAGCGGCGAGTCCAACCTAAGGTGACTGTGTATCCTTCAA
AGACCCAGCCTCTGCAGCACCACACCCTCCTGGTCTGCTCTGTGAGTGGT
TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCT
TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCGGAGTGGAGAGGTTTAC
ACCTGCCAAGTGGAGCACCCAAGCGTGACGAGCCCTCTCACAGTGCAATG
GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTGTTCATCTACTTC
AGGAATCAGAAAGGACACTCTGGACTTCAGCCAACAGGACTCCTGAGC--
-------------------------------
>Colobus_angolensis_palliatus_Cercopithecidae_Haplorrhini_XP_011784781.1_LOC105502761
ATGGTGTGTCTGAAGCTCCCTGGAGGCTCCTATATGGCAGCTCTGACAGT
GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACTCAAC
CACGTTTCTTGGAGCAGTTTAAGTCTGAGTGTCACTTCTTCAACGGGACG
GAGCGGGTGCGGTACCTGCAGAGATACTTCTATAACCAGGAGGAGTACGT
GCGCTACGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
GGCCTGACGCCAAGTACTGGAACAGCCAGAAGGACATCCTGGAGCAGAGG
CGGGCCCGGGTGGACAACTACTGCAGACACAACTACGGGGTTGGTGAGAG
CTTCACAGTGCAGCGGCGAGTCCAACCTAAGGTGACTGTGTATCCTTCAA
AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAATGGT
TTCTACCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCT
TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCAGAGTGGAGAGGTTTAC
ACCTGCCAAGTGGAGCACCCAAGCGTGACGAGCCCTCTCACAGTGGAATG
GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCTGGGCTGTTCATCTACTTC
AGGAATCAGAAAGGACACTCTGGACTTCACCCAACAGGACTCCTGAGC--
-------------------------------
>Pan_paniscus_Hominidae_Haplorrhini_XP_003829806.1_
ATGGTGTGTTTGAAGCTCCCTGGAGGCTCCTGCATGGCAGCGCTGACAGT
GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAT
CACGTTTCTTGGAGCTGGTTAAGTCTGAGTGTCATTTCTTCAATGGGACG
GAGCGGGTGCGGTTCCTGGAGAGATACTTCTATAACCAGGAGGAGTACGT
GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
GGCCTGATGCCGAGTACTGGAACAGCCAGAAGGACTACGTGGAGCAGAAG
CGGGGCCAGGTGGACAATTACTGCAGACACAACTACAGGGTTGGTGAGAG
CTTCACAGTGCAGCGGCGAGTCCATCCTCAGGTGACTGTGTATCCTGCAA
AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAATGGT
TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAATGGCCAGGAAGA
GAAGGCTGGGGTGGTGTCCACGGGCCTGATCCAGAATGGAGACTGGACCT
TCCAGACCCTGGTGATGCTAGAAACAGTTCCTCGGAGTGGAGAGGTTTAC
ACCTGCCAAGTGGAGCACCCAAGCGTAACGAGCCCTCTCACAGTGGAATG
GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTGTTCATCTACTTC
AGGAATCAGAAAGGACACTCTGGACTTCAGCCAACAGGATTCCTGAGC--
-------------------------------
>Papio_anubis_Cercopithecidae_Haplorrhini_XP_009198027.2_LOC101001669
---------------------------------ATGGCAGCTCTGACAGT
GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC
CACATTTCTTGGAGCAGGGTAAGTCTGAGTGTCATTTCTTCAATGGGACG
GAGCGGGTGCGGTTCCTGGAGAGACACTTCTATAACCAGGAGGAGTACCT
GCGCTTCGACAGCGACGTAGGGGAGTACCGGGCGGTGTCGGAGCTGGGGC
GGCCTACCGCCGAGTCCTGGAACAGCCAGAAGGACTACCTGGAGCAGAAG
CGGGGCCAGGTGGACAACTACTGCAGACACAACTACGGGGTTGGTGAGAG
CTTCACAGTGCAGCGGCGAGTCCAACCTAAGGTGACTGTGTATCCTGCAA
AGACCCAGCCCCTGCAGCACCACACCCTCCTGGTCTGCTCTGTGAACGGT
TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAATGGCCAGGAAGA
GAAGGCTGGGGTGGTCTCCACAGGCCTGATCCAGAATGGAGACTGGACCT
TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCAGAGTGGAGAGGTTTAC
ACCTGCCAAGTGGAGCACCCAAGCGTGACCAGCCCTCTCACAGTGGAATG
GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
GTTTTGTGCTGGGCCTGCTCTTCCTTGGGGCTGGGCTGTTCATCTACTTC
AGGAATCAGAAAGGACTCCTGAGC--------------------------
-------------------------------
>Piliocolobus_tephrosceles_Cercopithecidae_Haplorrhini_XP_023057332.1_LOC111535153
ATGGTGTGTCTGAAGCTCCCTGGAGGCTCCTGCATGGCAGCTCTGACAGT
GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC
CACGTTTCTTGGAGTATTCTACATCTGAGTGTCACTTCTTCAACGGGACG
GAGCGGGTGCGGTACCTGGATAGATACTTCTACAACCAGGAGGAGACCCT
GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
GGCCTGACGCCGAGTACTGGAACAGCCAGAAGGACATCCTGGAAGACCAG
CGGGCCTCGGTGGACAATTACTGCAGATACAACTACGGGGTTGGTGAGAG
CTTCACAGTGCAGCGGCGAGTCCAACCTAAGGTGACTGTGTATCCTGCAA
AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAATGGT
TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCT
TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCAGAGTGGAGAGGTTTAC
ACCTGCCAAGTGGAGCACCCAAGCGTGACCAGCCCTCTCACAGTGGAATG
GAGAGCACAGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTGTTCATCTACTTC
AGGAATCAGAAAGGACACACTGGACTTCAGCCAACAGGACTCCTGAGC--
-------------------------------
>Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3
MVCLKLPGGSSLAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGT
ERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQK
RGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY
TCQVEHPSVTSALTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGHSGLQPTGFLS
>Aotus_nancymaae_Aotidae_Haplorrhini_XP_012296108.1_LOC105708938
MVCLRLPGGSYVAALTVTLMVLSSPLALVGDTRPRFLELVKHECHFFNGT
ERVRYLDRYIHNQEEVVRFDSDVGEYRAVTELGRPDAEYWNSQKDYVEQK
RGQVDNYCRHNYGVFESFTVQRRVQPKMTVYPAKTQPLQHHNLLVCSVSG
FYPGSIEVRWFRNNQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
TCQVEHPSVTTPITVQWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGGSGLQPTGLLS
>Cebus_capucinus_imitator_Cebidae_Haplorrhini_XP_017378231.1_LOC108300090
MVCLRLPGGFCMAALTVTLMVLSSPLALAGDTRPRFLEQAKSECHFFNGT
ERVRYLQRYFYNQEEYVRFDSDVGEYRAVTELGRPSAEYWNSQKELLEQK
RGQVDNYCRHNYRVGESFTVQRRVQPKVTVYPAKTQPLQHHSLLVCSVSG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
TCQVEHPSVMSPLTVQWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGRSGLQPTGLLS
>Cercocebus_atys_Cercopithecidae_Haplorrhini_XP_011895433.1_LOC105576724
MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTRPRFLEQVKSECHFFNGT
ERVRFLERHFYNQEEFVRFDSDVGEYRAVSELGRPVAESWNSQKDLLEQK
RGQVDNYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHTLLVCSVSG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY
TCQVEHPSVTSPLTVQWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGHSGLQPTGLLS
>Colobus_angolensis_palliatus_Cercopithecidae_Haplorrhini_XP_011784781.1_LOC105502761
MVCLKLPGGSYMAALTVTLMVLSSPLALAGDTQPRFLEQFKSECHFFNGT
ERVRYLQRYFYNQEEYVRYDSDVGEYRAVTELGRPDAKYWNSQKDILEQR
RARVDNYCRHNYGVGESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGHSGLHPTGLLS
>Pan_paniscus_Hominidae_Haplorrhini_XP_003829806.1_
MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTRSRFLELVKSECHFFNGT
ERVRFLERYFYNQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDYVEQK
RGQVDNYCRHNYRVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVNG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY
TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGHSGLQPTGFLS
>Papio_anubis_Cercopithecidae_Haplorrhini_XP_009198027.2_LOC101001669
-----------MAALTVTLMVLSSPLALAGDTRPHFLEQGKSECHFFNGT
ERVRFLERHFYNQEEYLRFDSDVGEYRAVSELGRPTAESWNSQKDYLEQK
RGQVDNYCRHNYGVGESFTVQRRVQPKVTVYPAKTQPLQHHTLLVCSVNG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGLLS--------
>Piliocolobus_tephrosceles_Cercopithecidae_Haplorrhini_XP_023057332.1_LOC111535153
MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTRPRFLEYSTSECHFFNGT
ERVRYLDRYFYNQEETLRFDSDVGEYRAVTELGRPDAEYWNSQKDILEDQ
RASVDNYCRYNYGVGESFTVQRRVQPKVTVYPAKTQPLQHHNLLVCSVNG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPQSGEVY
TCQVEHPSVTSPLTVEWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGHTGLQPTGLLS
#NEXUS

[ID: 3608949311]
begin trees;
   [Note: This tree contains information on the topology, 
          branch lengths (if present), and the probability
          of the partition indicated by the branch.]
   tree con_50_majrule = (Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3:0.028873,Pan_paniscus_Hominidae_Haplorrhini_XP_003829806.1_:0.013615,((Aotus_nancymaae_Aotidae_Haplorrhini_XP_012296108.1_LOC105708938:0.040243,Cebus_capucinus_imitator_Cebidae_Haplorrhini_XP_017378231.1_LOC108300090:0.024509)1.00:0.011195,((Cercocebus_atys_Cercopithecidae_Haplorrhini_XP_011895433.1_LOC105576724:0.015735,Papio_anubis_Cercopithecidae_Haplorrhini_XP_009198027.2_LOC101001669:0.037842)0.95:0.009387,(Colobus_angolensis_palliatus_Cercopithecidae_Haplorrhini_XP_011784781.1_LOC105502761:0.021023,Piliocolobus_tephrosceles_Cercopithecidae_Haplorrhini_XP_023057332.1_LOC111535153:0.034736)0.97:0.008054)0.66:0.003303)1.00:0.017335);

   [Note: This tree contains information only on the topology
          and branch lengths (mean of the posterior probability density).]
   tree con_50_majrule = (Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3:0.028873,Pan_paniscus_Hominidae_Haplorrhini_XP_003829806.1_:0.013615,((Aotus_nancymaae_Aotidae_Haplorrhini_XP_012296108.1_LOC105708938:0.040243,Cebus_capucinus_imitator_Cebidae_Haplorrhini_XP_017378231.1_LOC108300090:0.024509):0.011195,((Cercocebus_atys_Cercopithecidae_Haplorrhini_XP_011895433.1_LOC105576724:0.015735,Papio_anubis_Cercopithecidae_Haplorrhini_XP_009198027.2_LOC101001669:0.037842):0.009387,(Colobus_angolensis_palliatus_Cercopithecidae_Haplorrhini_XP_011784781.1_LOC105502761:0.021023,Piliocolobus_tephrosceles_Cercopithecidae_Haplorrhini_XP_023057332.1_LOC111535153:0.034736):0.008054):0.003303):0.017335);
end;
      Estimated marginal likelihoods for runs sampled in files
"/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -1980.50          -1997.15
2       -1980.38          -1998.75
--------------------------------------
TOTAL     -1980.44          -1998.24
--------------------------------------


Model parameter summaries over the runs sampled in files
"/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Summaries are based on a total of 15002 samples from 2 runs)
(Each run produced 10001 samples of which 7501 samples were included)

95% Cred. Interval
----------------------
Parameter          Mean        Variance       Lower         Upper         Median       PSRF *
---------------------------------------------------------------------------------------------
TL{all}           0.265317      0.000885      0.212000      0.329000      0.263000      1.000
r(A<->C){all}     0.101350      0.000840      0.051181      0.164004      0.098791      1.000
r(A<->G){all}     0.168862      0.001157      0.109084      0.242242      0.166530      1.000
r(A<->T){all}     0.210862      0.002079      0.129527      0.306510      0.208112      1.000
r(C<->G){all}     0.094341      0.000483      0.056313      0.141940      0.092704      1.000
r(C<->T){all}     0.340278      0.002551      0.245988      0.442625      0.338700      1.000
r(G<->T){all}     0.084306      0.000597      0.042649      0.137257      0.082479      1.002
pi(A){all}        0.216659      0.000197      0.189988      0.244904      0.216516      1.000
pi(C){all}        0.261869      0.000218      0.233643      0.291465      0.261522      1.000
pi(G){all}        0.316085      0.000245      0.286490      0.346889      0.315873      1.000
pi(T){all}        0.205388      0.000185      0.179485      0.232576      0.205199      1.000
alpha{1,2}       28.084679   2735.050281      0.173688    179.276444      0.846342      1.003
alpha{3}        100.482318   3261.914324      7.034359    194.807984     99.861952      1.000
pinvar{all}       0.694802      0.009037      0.471945      0.815786      0.712470      1.003
---------------------------------------------------------------------------------------------
* Convergence diagnostic (PSRF = Potential scale reduction factor [Gelman
and Rubin, 1992], uncorrected) should approach 1 as runs converge. The
values may be unreliable if you have a small number of samples. PSRF should
only be used as a rough guide to convergence since all the assumptions
that allow one to interpret it as a scale reduction factor are not met in
the phylogenetic context.
CODONML (in paml version 4.5, December 2011)  /home/jorge/Data/ADOPS/HLA/HLA-DRB3/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches
Codon frequency model: F3x4
Site-class models: 
ns =   8  ls = 247

Codon usage in sequences
--------------------------------------------------------------------------------------------------------------
Phe TTT  1  2  1  1  2  1 | Ser TCT  5  4  5  5  5  5 | Tyr TAT  2  2  4  3  2  3 | Cys TGT  1  1  1  1  1  1
    TTC 14 11 12 14 11 13 |     TCC  3  2  2  3  2  2 |     TAC  7  9  8  6 11  9 |     TGC  3  3  3  3  3  3
Leu TTA  0  0  0  0  0  0 |     TCA  0  0  0  1  1  1 | *** TAA  0  0  0  0  0  0 | *** TGA  0  0  0  0  0  0
    TTG  3  2  2  2  2  2 |     TCG  0  0  0  1  0  0 |     TAG  0  0  0  0  0  0 | Trp TGG  4  4  4  4  4  4
--------------------------------------------------------------------------------------------------------------
Leu CTT  1  1  1  1  1  1 | Pro CCT  4  5  5  6  5  5 | His CAT  3  3  1  1  0  2 | Arg CGT  2  1  1  1  1  1
    CTC  4  2  4  4  3  3 |     CCC  1  1  1  0  1  1 |     CAC  5  4  4  5  6  5 |     CGC  1  1  2  1  1  1
    CTA  1  0  0  0  0  1 |     CCA  3  4  4  4  4  3 | Gln CAA  1  3  3  3  3  1 |     CGA  3  1  1  2  1  2
    CTG 16 16 16 16 16 15 |     CCG  0  0  0  0  0  0 |     CAG 12 14 16 13 14 13 |     CGG 10  7  8  9  9  9
--------------------------------------------------------------------------------------------------------------
Ile ATT  1  1  1  1  1  1 | Thr ACT  2  1  1  1  2  1 | Asn AAT  4  2  2  2  3  6 | Ser AGT  3  4  4  3  2  2
    ATC  2  4  2  2  3  2 |     ACC  4  7  5  6  4  5 |     AAC  5  8  6  6  7  4 |     AGC  8  6  9  8  8  8
    ATA  0  0  0  0  0  0 |     ACA  5  5  6  6  6  5 | Lys AAA  1  1  1  1  1  1 | Arg AGA  3  4  4  3  3  3
Met ATG  3  4  5  4  4  4 |     ACG  4  3  2  2  3  4 |     AAG  6  7  7  7  7  6 |     AGG  2  2  2  2  3  3
--------------------------------------------------------------------------------------------------------------
Val GTT  3  5  3  4  3  4 | Ala GCT  4  2  4  4  5  3 | Asp GAT  0  0  0  0  0  1 | Gly GGT  2  1  0  1  2  2
    GTC  5  5  4  5  4  4 |     GCC  2  1  0  2  2  2 |     GAC  7  8  5  6  7  6 |     GGC  6  6  7  6  5  6
    GTA  1  0  0  0  0  1 |     GCA  4  5  6  3  3  4 | Glu GAA  5  4  5  4  5  5 |     GGA  5  5  5  5  5  5
    GTG 16 19 18 19 18 18 |     GCG  2  2  2  1  1  2 |     GAG 13 13 13 14 12 14 |     GGG  9  9  9  9  9  8
--------------------------------------------------------------------------------------------------------------

--------------------------------------------------------------
Phe TTT  1  1 | Ser TCT  4  5 | Tyr TAT  3  3 | Cys TGT  1  1
    TTC 13 12 |     TCC  3  2 |     TAC  7 10 |     TGC  3  3
Leu TTA  0  0 |     TCA  0  0 | *** TAA  0  0 | *** TGA  0  0
    TTG  2  2 |     TCG  1  1 |     TAG  0  0 | Trp TGG  4  4
--------------------------------------------------------------
Leu CTT  1  1 | Pro CCT  5  5 | His CAT  2  0 | Arg CGT  0  1
    CTC  4  3 |     CCC  1  1 |     CAC  5  5 |     CGC  1  1
    CTA  0  0 |     CCA  4  4 | Gln CAA  2  2 |     CGA  2  2
    CTG 18 17 |     CCG  0  0 |     CAG 14 13 |     CGG  8  7
--------------------------------------------------------------
Ile ATT  1  1 | Thr ACT  1  2 | Asn AAT  4  4 | Ser AGT  2  2
    ATC  2  3 |     ACC  8  7 |     AAC  5  6 |     AGC  9  8
    ATA  0  0 |     ACA  6  7 | Lys AAA  1  1 | Arg AGA  3  3
Met ATG  4  4 |     ACG  1  2 |     AAG  7  5 |     AGG  2  2
--------------------------------------------------------------
Val GTT  3  3 | Ala GCT  5  4 | Asp GAT  0  1 | Gly GGT  4  2
    GTC  5  4 |     GCC  1  3 |     GAC  6  8 |     GGC  5  5
    GTA  1  0 |     GCA  4  4 | Glu GAA  5  6 |     GGA  4  5
    GTG 15 17 |     GCG  1  1 |     GAG 14 12 |     GGG  9  9
--------------------------------------------------------------

Codon position x base (3x4) table for each sequence.

#1: Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3             
position  1:    T:0.17409    C:0.27126    A:0.21457    G:0.34008
position  2:    T:0.28745    C:0.17409    A:0.28745    G:0.25101
position  3:    T:0.15385    C:0.31174    A:0.12955    G:0.40486
Average         T:0.20513    C:0.25236    A:0.21053    G:0.33198

#2: Aotus_nancymaae_Aotidae_Haplorrhini_XP_012296108.1_LOC105708938             
position  1:    T:0.16194    C:0.25506    A:0.23887    G:0.34413
position  2:    T:0.29150    C:0.17004    A:0.31579    G:0.22267
position  3:    T:0.14170    C:0.31579    A:0.12955    G:0.41296
Average         T:0.19838    C:0.24696    A:0.22807    G:0.32659

#3: Cebus_capucinus_imitator_Cebidae_Haplorrhini_XP_017378231.1_LOC108300090             
position  1:    T:0.17004    C:0.27126    A:0.23077    G:0.32794
position  2:    T:0.27935    C:0.17409    A:0.30364    G:0.24291
position  3:    T:0.13765    C:0.29960    A:0.14170    G:0.42105
Average         T:0.19568    C:0.24831    A:0.22537    G:0.33063

#4: Cercocebus_atys_Cercopithecidae_Haplorrhini_XP_011895433.1_LOC105576724             
position  1:    T:0.17814    C:0.26721    A:0.21862    G:0.33603
position  2:    T:0.29555    C:0.18219    A:0.28745    G:0.23482
position  3:    T:0.14170    C:0.31174    A:0.12955    G:0.41700
Average         T:0.20513    C:0.25371    A:0.21188    G:0.32928

#5: Colobus_angolensis_palliatus_Cercopithecidae_Haplorrhini_XP_011784781.1_LOC105502761             
position  1:    T:0.17814    C:0.26316    A:0.23077    G:0.32794
position  2:    T:0.27530    C:0.17814    A:0.31579    G:0.23077
position  3:    T:0.14170    C:0.31579    A:0.12955    G:0.41296
Average         T:0.19838    C:0.25236    A:0.22537    G:0.32389

#6: Pan_paniscus_Hominidae_Haplorrhini_XP_003829806.1_             
position  1:    T:0.17814    C:0.25506    A:0.22267    G:0.34413
position  2:    T:0.28340    C:0.17409    A:0.30769    G:0.23482
position  3:    T:0.15789    C:0.29960    A:0.12955    G:0.41296
Average         T:0.20648    C:0.24291    A:0.21997    G:0.33063

#7: Papio_anubis_Cercopithecidae_Haplorrhini_XP_009198027.2_LOC101001669             
position  1:    T:0.17004    C:0.27126    A:0.22672    G:0.33198
position  2:    T:0.28340    C:0.18219    A:0.30364    G:0.23077
position  3:    T:0.14980    C:0.31579    A:0.12955    G:0.40486
Average         T:0.20108    C:0.25641    A:0.21997    G:0.32254

#8: Piliocolobus_tephrosceles_Cercopithecidae_Haplorrhini_XP_023057332.1_LOC111535153             
position  1:    T:0.17814    C:0.25101    A:0.23077    G:0.34008
position  2:    T:0.27530    C:0.19433    A:0.30769    G:0.22267
position  3:    T:0.14575    C:0.32794    A:0.13765    G:0.38866
Average         T:0.19973    C:0.25776    A:0.22537    G:0.31714

Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT      10 | Ser S TCT      38 | Tyr Y TAT      22 | Cys C TGT       8
      TTC     100 |       TCC      19 |       TAC      67 |       TGC      24
Leu L TTA       0 |       TCA       3 | *** * TAA       0 | *** * TGA       0
      TTG      17 |       TCG       3 |       TAG       0 | Trp W TGG      32
------------------------------------------------------------------------------
Leu L CTT       8 | Pro P CCT      40 | His H CAT      12 | Arg R CGT       8
      CTC      27 |       CCC       7 |       CAC      39 |       CGC       9
      CTA       2 |       CCA      30 | Gln Q CAA      18 |       CGA      14
      CTG     130 |       CCG       0 |       CAG     109 |       CGG      67
------------------------------------------------------------------------------
Ile I ATT       8 | Thr T ACT      11 | Asn N AAT      27 | Ser S AGT      22
      ATC      20 |       ACC      46 |       AAC      47 |       AGC      64
      ATA       0 |       ACA      46 | Lys K AAA       8 | Arg R AGA      26
Met M ATG      32 |       ACG      21 |       AAG      52 |       AGG      18
------------------------------------------------------------------------------
Val V GTT      28 | Ala A GCT      31 | Asp D GAT       2 | Gly G GGT      14
      GTC      36 |       GCC      13 |       GAC      53 |       GGC      46
      GTA       3 |       GCA      33 | Glu E GAA      39 |       GGA      39
      GTG     140 |       GCG      12 |       GAG     105 |       GGG      71
------------------------------------------------------------------------------


Codon position x base (3x4) table, overall

position  1:    T:0.17358    C:0.26316    A:0.22672    G:0.33654
position  2:    T:0.28391    C:0.17864    A:0.30364    G:0.23381
position  3:    T:0.14626    C:0.31225    A:0.13209    G:0.40941
Average         T:0.20125    C:0.25135    A:0.22082    G:0.32659


Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)

Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3                  
Aotus_nancymaae_Aotidae_Haplorrhini_XP_012296108.1_LOC105708938                   0.9509 (0.0596 0.0627)
Cebus_capucinus_imitator_Cebidae_Haplorrhini_XP_017378231.1_LOC108300090                   0.5963 (0.0481 0.0807) 1.3412 (0.0536 0.0399)
Cercocebus_atys_Cercopithecidae_Haplorrhini_XP_011895433.1_LOC105576724                   0.6919 (0.0388 0.0560) 1.5501 (0.0567 0.0366) 0.6819 (0.0348 0.0510)
Colobus_angolensis_palliatus_Cercopithecidae_Haplorrhini_XP_011784781.1_LOC105502761                   0.6761 (0.0462 0.0684) 1.3847 (0.0633 0.0457) 0.5762 (0.0366 0.0635) 1.1509 (0.0386 0.0335)
Pan_paniscus_Hominidae_Haplorrhini_XP_003829806.1_                   1.6694 (0.0368 0.0220) 0.7868 (0.0498 0.0633) 0.4176 (0.0366 0.0877) 0.6164 (0.0349 0.0566) 0.5033 (0.0348 0.0691)
Papio_anubis_Cercopithecidae_Haplorrhini_XP_009198027.2_LOC101001669                   0.5630 (0.0508 0.0902) 0.8547 (0.0679 0.0794) 0.4426 (0.0420 0.0948) 0.5069 (0.0336 0.0664) 0.6978 (0.0467 0.0670) 0.4734 (0.0373 0.0788)
Piliocolobus_tephrosceles_Cercopithecidae_Haplorrhini_XP_023057332.1_LOC111535153                   0.6686 (0.0525 0.0786) 0.9170 (0.0677 0.0739) 0.6488 (0.0508 0.0783) 1.2016 (0.0539 0.0449) 0.8187 (0.0395 0.0482) 0.6883 (0.0505 0.0733) 0.7434 (0.0571 0.0767)


Model 1: NearlyNeutral (2 categories)


TREE #  1:  (1, 6, ((2, 3), ((4, 7), (5, 8))));   MP score: 127
lnL(ntime: 13  np: 16):  -1836.836979      +0.000000
   9..1     9..6     9..10   10..11   11..2    11..3    10..12   12..13   13..4    13..7    12..14   14..5    14..8  
 0.069512 0.036420 0.039466 0.022508 0.103093 0.060314 0.004626 0.024189 0.040305 0.095015 0.023202 0.041966 0.095543 1.688810 0.686503 0.000001

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.65616

(1: 0.069512, 6: 0.036420, ((2: 0.103093, 3: 0.060314): 0.022508, ((4: 0.040305, 7: 0.095015): 0.024189, (5: 0.041966, 8: 0.095543): 0.023202): 0.004626): 0.039466);

(Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3: 0.069512, Pan_paniscus_Hominidae_Haplorrhini_XP_003829806.1_: 0.036420, ((Aotus_nancymaae_Aotidae_Haplorrhini_XP_012296108.1_LOC105708938: 0.103093, Cebus_capucinus_imitator_Cebidae_Haplorrhini_XP_017378231.1_LOC108300090: 0.060314): 0.022508, ((Cercocebus_atys_Cercopithecidae_Haplorrhini_XP_011895433.1_LOC105576724: 0.040305, Papio_anubis_Cercopithecidae_Haplorrhini_XP_009198027.2_LOC101001669: 0.095015): 0.024189, (Colobus_angolensis_palliatus_Cercopithecidae_Haplorrhini_XP_011784781.1_LOC105502761: 0.041966, Piliocolobus_tephrosceles_Cercopithecidae_Haplorrhini_XP_023057332.1_LOC111535153: 0.095543): 0.023202): 0.004626): 0.039466);

Detailed output identifying parameters

kappa (ts/tv) =  1.68881


dN/dS (w) for site classes (K=2)

p:   0.68650  0.31350
w:   0.00000  1.00000

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   9..1       0.070    577.0    164.0   0.3135   0.0156   0.0498    9.0    8.2
   9..6       0.036    577.0    164.0   0.3135   0.0082   0.0261    4.7    4.3
   9..10      0.039    577.0    164.0   0.3135   0.0089   0.0283    5.1    4.6
  10..11      0.023    577.0    164.0   0.3135   0.0051   0.0161    2.9    2.6
  11..2       0.103    577.0    164.0   0.3135   0.0231   0.0738   13.4   12.1
  11..3       0.060    577.0    164.0   0.3135   0.0135   0.0432    7.8    7.1
  10..12      0.005    577.0    164.0   0.3135   0.0010   0.0033    0.6    0.5
  12..13      0.024    577.0    164.0   0.3135   0.0054   0.0173    3.1    2.8
  13..4       0.040    577.0    164.0   0.3135   0.0090   0.0289    5.2    4.7
  13..7       0.095    577.0    164.0   0.3135   0.0213   0.0680   12.3   11.2
  12..14      0.023    577.0    164.0   0.3135   0.0052   0.0166    3.0    2.7
  14..5       0.042    577.0    164.0   0.3135   0.0094   0.0301    5.4    4.9
  14..8       0.096    577.0    164.0   0.3135   0.0214   0.0684   12.4   11.2


Time used:  0:06


Model 2: PositiveSelection (3 categories)


TREE #  1:  (1, 6, ((2, 3), ((4, 7), (5, 8))));   MP score: 127
lnL(ntime: 13  np: 18):  -1807.692074      +0.000000
   9..1     9..6     9..10   10..11   11..2    11..3    10..12   12..13   13..4    13..7    12..14   14..5    14..8  
 0.078080 0.042365 0.045430 0.024979 0.122577 0.067286 0.005544 0.028131 0.043531 0.110891 0.025014 0.047514 0.111508 2.133144 0.643271 0.278778 0.000001 8.181557

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.75285

(1: 0.078080, 6: 0.042365, ((2: 0.122577, 3: 0.067286): 0.024979, ((4: 0.043531, 7: 0.110891): 0.028131, (5: 0.047514, 8: 0.111508): 0.025014): 0.005544): 0.045430);

(Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3: 0.078080, Pan_paniscus_Hominidae_Haplorrhini_XP_003829806.1_: 0.042365, ((Aotus_nancymaae_Aotidae_Haplorrhini_XP_012296108.1_LOC105708938: 0.122577, Cebus_capucinus_imitator_Cebidae_Haplorrhini_XP_017378231.1_LOC108300090: 0.067286): 0.024979, ((Cercocebus_atys_Cercopithecidae_Haplorrhini_XP_011895433.1_LOC105576724: 0.043531, Papio_anubis_Cercopithecidae_Haplorrhini_XP_009198027.2_LOC101001669: 0.110891): 0.028131, (Colobus_angolensis_palliatus_Cercopithecidae_Haplorrhini_XP_011784781.1_LOC105502761: 0.047514, Piliocolobus_tephrosceles_Cercopithecidae_Haplorrhini_XP_023057332.1_LOC111535153: 0.111508): 0.025014): 0.005544): 0.045430);

Detailed output identifying parameters

kappa (ts/tv) =  2.13314


dN/dS (w) for site classes (K=3)

p:   0.64327  0.27878  0.07795
w:   0.00000  1.00000  8.18156

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   9..1       0.078    572.1    168.9   0.9165   0.0255   0.0278   14.6    4.7
   9..6       0.042    572.1    168.9   0.9165   0.0138   0.0151    7.9    2.5
   9..10      0.045    572.1    168.9   0.9165   0.0148   0.0162    8.5    2.7
  10..11      0.025    572.1    168.9   0.9165   0.0082   0.0089    4.7    1.5
  11..2       0.123    572.1    168.9   0.9165   0.0400   0.0437   22.9    7.4
  11..3       0.067    572.1    168.9   0.9165   0.0220   0.0240   12.6    4.0
  10..12      0.006    572.1    168.9   0.9165   0.0018   0.0020    1.0    0.3
  12..13      0.028    572.1    168.9   0.9165   0.0092   0.0100    5.3    1.7
  13..4       0.044    572.1    168.9   0.9165   0.0142   0.0155    8.1    2.6
  13..7       0.111    572.1    168.9   0.9165   0.0362   0.0395   20.7    6.7
  12..14      0.025    572.1    168.9   0.9165   0.0082   0.0089    4.7    1.5
  14..5       0.048    572.1    168.9   0.9165   0.0155   0.0169    8.9    2.9
  14..8       0.112    572.1    168.9   0.9165   0.0364   0.0397   20.8    6.7


Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3)

            Pr(w>1)     post mean +- SE for w

    28 L      0.954*        7.852
    29 R      1.000**       8.181
    31 S      0.803         6.768
    46 D      0.973*        7.987
    50 H      0.682         5.897
    55 F      1.000**       8.179
    56 L      0.549         4.940
    75 V      0.999**       8.175
    85 L      1.000**       8.181
    92 R      0.931         7.686
   104 G      0.953*        7.841
   122 A      0.773         6.548
   138 S      0.925         7.641
   205 E      0.585         5.201
   245 H      0.720         6.169
   246 S      0.963*        7.915


Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3)

            Pr(w>1)     post mean +- SE for w

    28 L      0.957*        7.475 +- 2.185
    29 R      1.000**       7.800 +- 1.733
    31 S      0.823         6.506 +- 3.010
    46 D      0.974*        7.601 +- 2.024
    50 H      0.717         5.702 +- 3.311
    55 F      1.000**       7.799 +- 1.736
    56 L      0.609         4.832 +- 3.349
    75 V      0.999**       7.794 +- 1.744
    85 L      1.000**       7.800 +- 1.733
    92 R      0.935         7.304 +- 2.363
   104 G      0.957*        7.489 +- 2.189
   122 A      0.796         6.305 +- 3.109
   138 S      0.931         7.297 +- 2.396
   205 E      0.635         5.080 +- 3.402
   245 H      0.747         5.870 +- 3.203
   246 S      0.966*        7.559 +- 2.107



The grid (see ternary graph for p0-p1)

w0:   0.050  0.150  0.250  0.350  0.450  0.550  0.650  0.750  0.850  0.950
w2:   1.500  2.500  3.500  4.500  5.500  6.500  7.500  8.500  9.500 10.500


Posterior on the grid

w0:   0.922  0.074  0.003  0.000  0.000  0.000  0.000  0.000  0.000  0.000
w2:   0.000  0.000  0.003  0.050  0.129  0.157  0.182  0.194  0.166  0.117

Posterior for p0-p1 (see the ternary graph)

 0.000
 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.003
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.003 0.079 0.024
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.076 0.443 0.012
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.028 0.154 0.108 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.003 0.040 0.024 0.003 0.000

sum of density on p0-p1 =   1.000000

Time used:  0:17


Model 7: beta (10 categories)


TREE #  1:  (1, 6, ((2, 3), ((4, 7), (5, 8))));   MP score: 127
lnL(ntime: 13  np: 16):  -1836.888718      +0.000000
   9..1     9..6     9..10   10..11   11..2    11..3    10..12   12..13   13..4    13..7    12..14   14..5    14..8  
 0.068745 0.036008 0.039032 0.022255 0.101992 0.059661 0.004571 0.023910 0.039859 0.093972 0.022946 0.041503 0.094520 1.681665 0.005000 0.011678

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.64897

(1: 0.068745, 6: 0.036008, ((2: 0.101992, 3: 0.059661): 0.022255, ((4: 0.039859, 7: 0.093972): 0.023910, (5: 0.041503, 8: 0.094520): 0.022946): 0.004571): 0.039032);

(Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3: 0.068745, Pan_paniscus_Hominidae_Haplorrhini_XP_003829806.1_: 0.036008, ((Aotus_nancymaae_Aotidae_Haplorrhini_XP_012296108.1_LOC105708938: 0.101992, Cebus_capucinus_imitator_Cebidae_Haplorrhini_XP_017378231.1_LOC108300090: 0.059661): 0.022255, ((Cercocebus_atys_Cercopithecidae_Haplorrhini_XP_011895433.1_LOC105576724: 0.039859, Papio_anubis_Cercopithecidae_Haplorrhini_XP_009198027.2_LOC101001669: 0.093972): 0.023910, (Colobus_angolensis_palliatus_Cercopithecidae_Haplorrhini_XP_011784781.1_LOC105502761: 0.041503, Piliocolobus_tephrosceles_Cercopithecidae_Haplorrhini_XP_023057332.1_LOC111535153: 0.094520): 0.022946): 0.004571): 0.039032);

Detailed output identifying parameters

kappa (ts/tv) =  1.68166

Parameters in M7 (beta):
 p=  0.00500  q=  0.01168


dN/dS (w) for site classes (K=10)

p:   0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000
w:   0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  1.00000  1.00000  1.00000

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   9..1       0.069    577.0    164.0   0.3000   0.0151   0.0504    8.7    8.3
   9..6       0.036    577.0    164.0   0.3000   0.0079   0.0264    4.6    4.3
   9..10      0.039    577.0    164.0   0.3000   0.0086   0.0286    5.0    4.7
  10..11      0.022    577.0    164.0   0.3000   0.0049   0.0163    2.8    2.7
  11..2       0.102    577.0    164.0   0.3000   0.0224   0.0747   12.9   12.3
  11..3       0.060    577.0    164.0   0.3000   0.0131   0.0437    7.6    7.2
  10..12      0.005    577.0    164.0   0.3000   0.0010   0.0033    0.6    0.5
  12..13      0.024    577.0    164.0   0.3000   0.0053   0.0175    3.0    2.9
  13..4       0.040    577.0    164.0   0.3000   0.0088   0.0292    5.1    4.8
  13..7       0.094    577.0    164.0   0.3000   0.0207   0.0689   11.9   11.3
  12..14      0.023    577.0    164.0   0.3000   0.0050   0.0168    2.9    2.8
  14..5       0.042    577.0    164.0   0.3000   0.0091   0.0304    5.3    5.0
  14..8       0.095    577.0    164.0   0.3000   0.0208   0.0693   12.0   11.4


Time used:  0:51


Model 8: beta&w>1 (11 categories)


TREE #  1:  (1, 6, ((2, 3), ((4, 7), (5, 8))));   MP score: 127
lnL(ntime: 13  np: 18):  -1807.692703      +0.000000
   9..1     9..6     9..10   10..11   11..2    11..3    10..12   12..13   13..4    13..7    12..14   14..5    14..8  
 0.078047 0.042329 0.045398 0.024948 0.122503 0.067274 0.005540 0.028109 0.043506 0.110830 0.025011 0.047484 0.111432 2.132411 0.921670 0.005000 0.011779 8.141492

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.75241

(1: 0.078047, 6: 0.042329, ((2: 0.122503, 3: 0.067274): 0.024948, ((4: 0.043506, 7: 0.110830): 0.028109, (5: 0.047484, 8: 0.111432): 0.025011): 0.005540): 0.045398);

(Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3: 0.078047, Pan_paniscus_Hominidae_Haplorrhini_XP_003829806.1_: 0.042329, ((Aotus_nancymaae_Aotidae_Haplorrhini_XP_012296108.1_LOC105708938: 0.122503, Cebus_capucinus_imitator_Cebidae_Haplorrhini_XP_017378231.1_LOC108300090: 0.067274): 0.024948, ((Cercocebus_atys_Cercopithecidae_Haplorrhini_XP_011895433.1_LOC105576724: 0.043506, Papio_anubis_Cercopithecidae_Haplorrhini_XP_009198027.2_LOC101001669: 0.110830): 0.028109, (Colobus_angolensis_palliatus_Cercopithecidae_Haplorrhini_XP_011784781.1_LOC105502761: 0.047484, Piliocolobus_tephrosceles_Cercopithecidae_Haplorrhini_XP_023057332.1_LOC111535153: 0.111432): 0.025011): 0.005540): 0.045398);

Detailed output identifying parameters

kappa (ts/tv) =  2.13241

Parameters in M8 (beta&w>1):
  p0=  0.92167  p=  0.00500 q=  0.01178
 (p1=  0.07833) w=  8.14149


dN/dS (w) for site classes (K=11)

p:   0.09217  0.09217  0.09217  0.09217  0.09217  0.09217  0.09217  0.09217  0.09217  0.09217  0.07833
w:   0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  1.00000  1.00000  1.00000  8.14149

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   9..1       0.078    572.1    168.9   0.9142   0.0255   0.0279   14.6    4.7
   9..6       0.042    572.1    168.9   0.9142   0.0138   0.0151    7.9    2.6
   9..10      0.045    572.1    168.9   0.9142   0.0148   0.0162    8.5    2.7
  10..11      0.025    572.1    168.9   0.9142   0.0081   0.0089    4.7    1.5
  11..2       0.123    572.1    168.9   0.9142   0.0400   0.0437   22.9    7.4
  11..3       0.067    572.1    168.9   0.9142   0.0220   0.0240   12.6    4.1
  10..12      0.006    572.1    168.9   0.9142   0.0018   0.0020    1.0    0.3
  12..13      0.028    572.1    168.9   0.9142   0.0092   0.0100    5.2    1.7
  13..4       0.044    572.1    168.9   0.9142   0.0142   0.0155    8.1    2.6
  13..7       0.111    572.1    168.9   0.9142   0.0362   0.0396   20.7    6.7
  12..14      0.025    572.1    168.9   0.9142   0.0082   0.0089    4.7    1.5
  14..5       0.047    572.1    168.9   0.9142   0.0155   0.0170    8.9    2.9
  14..8       0.111    572.1    168.9   0.9142   0.0364   0.0398   20.8    6.7


Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3)

            Pr(w>1)     post mean +- SE for w

    28 L      0.955*        7.817
    29 R      1.000**       8.141
    31 S      0.805         6.746
    46 D      0.973*        7.950
    50 H      0.684         5.888
    55 F      1.000**       8.139
    56 L      0.553         4.948
    75 V      0.999**       8.135
    85 L      1.000**       8.141
    92 R      0.932         7.654
   104 G      0.953*        7.805
   122 A      0.774         6.530
   138 S      0.925         7.608
   205 E      0.588         5.202
   245 H      0.723         6.162
   246 S      0.963*        7.878


Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3)

            Pr(w>1)     post mean +- SE for w

    14 R      0.607         3.608 +- 2.669
    18 A      0.521         3.120 +- 2.659
    22 R      0.648         3.846 +- 2.652
    23 P      0.604         3.590 +- 2.670
    24 R      0.529         3.168 +- 2.663
    28 L      0.992**       5.888 +- 1.485
    29 R      1.000**       5.940 +- 1.431
    31 S      0.939         5.562 +- 1.817
    44 Y      0.749         4.364 +- 2.329
    46 D      0.996**       5.914 +- 1.457
    50 H      0.903         5.322 +- 1.965
    55 F      1.000**       5.940 +- 1.431
    56 L      0.898         5.246 +- 1.910
    75 V      1.000**       5.939 +- 1.432
    78 S      0.781         4.551 +- 2.275
    85 L      1.000**       5.940 +- 1.431
    86 L      0.735         4.283 +- 2.352
    88 Q      0.590         3.478 +- 2.465
    89 K      0.523         3.121 +- 2.458
    92 R      0.988*        5.861 +- 1.508
    99 H      0.630         3.693 +- 2.452
   102 G      0.549         3.261 +- 2.470
   104 G      0.989*        5.872 +- 1.515
   122 A      0.930         5.502 +- 1.859
   131 N      0.645         3.773 +- 2.441
   138 S      0.983*        5.833 +- 1.552
   153 G      0.668         3.903 +- 2.424
   184 R      0.678         3.966 +- 2.425
   201 A      0.569         3.394 +- 2.672
   205 E      0.872         5.120 +- 2.066
   209 R      0.725         4.225 +- 2.361
   245 H      0.940         5.531 +- 1.756
   246 S      0.990*        5.879 +- 1.512
   247 G      0.704         4.159 +- 2.574



The grid 

p0:   0.050  0.150  0.250  0.350  0.450  0.550  0.650  0.750  0.850  0.950
p :   0.100  0.300  0.500  0.700  0.900  1.100  1.300  1.500  1.700  1.900
q :   0.100  0.300  0.500  0.700  0.900  1.100  1.300  1.500  1.700  1.900
ws:   1.500  2.500  3.500  4.500  5.500  6.500  7.500  8.500  9.500 10.500


Posterior on the grid

p0:   0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.009  0.866  0.124
p :   0.541  0.338  0.092  0.021  0.005  0.001  0.000  0.000  0.000  0.000
q :   0.001  0.084  0.110  0.114  0.104  0.104  0.110  0.117  0.124  0.131
ws:   0.000  0.000  0.012  0.236  0.397  0.188  0.067  0.042  0.034  0.023

Time used:  2:39
Model 8: beta&w>1	-1807.692703
Model 7: beta	-1836.888718
Model 1: NearlyNeutral	-1836.836979
Model 2: PositiveSelection	-1807.692074


Model 2 vs 1	58.28980999999976

Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3)

            Pr(w>1)     post mean +- SE for w

    28 L      0.954*        7.852
    29 R      1.000**       8.181
    31 S      0.803         6.768
    46 D      0.973*        7.987
    50 H      0.682         5.897
    55 F      1.000**       8.179
    56 L      0.549         4.940
    75 V      0.999**       8.175
    85 L      1.000**       8.181
    92 R      0.931         7.686
   104 G      0.953*        7.841
   122 A      0.773         6.548
   138 S      0.925         7.641
   205 E      0.585         5.201
   245 H      0.720         6.169
   246 S      0.963*        7.915

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3)

            Pr(w>1)     post mean +- SE for w

    28 L      0.957*        7.475 +- 2.185
    29 R      1.000**       7.800 +- 1.733
    31 S      0.823         6.506 +- 3.010
    46 D      0.974*        7.601 +- 2.024
    50 H      0.717         5.702 +- 3.311
    55 F      1.000**       7.799 +- 1.736
    56 L      0.609         4.832 +- 3.349
    75 V      0.999**       7.794 +- 1.744
    85 L      1.000**       7.800 +- 1.733
    92 R      0.935         7.304 +- 2.363
   104 G      0.957*        7.489 +- 2.189
   122 A      0.796         6.305 +- 3.109
   138 S      0.931         7.297 +- 2.396
   205 E      0.635         5.080 +- 3.402
   245 H      0.747         5.870 +- 3.203
   246 S      0.966*        7.559 +- 2.107


Model 8 vs 7	58.39202999999998

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3)

            Pr(w>1)     post mean +- SE for w

    28 L      0.955*        7.817
    29 R      1.000**       8.141
    31 S      0.805         6.746
    46 D      0.973*        7.950
    50 H      0.684         5.888
    55 F      1.000**       8.139
    56 L      0.553         4.948
    75 V      0.999**       8.135
    85 L      1.000**       8.141
    92 R      0.932         7.654
   104 G      0.953*        7.805
   122 A      0.774         6.530
   138 S      0.925         7.608
   205 E      0.588         5.202
   245 H      0.723         6.162
   246 S      0.963*        7.878

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_072049.2_HLA-DRB3)

            Pr(w>1)     post mean +- SE for w

    14 R      0.607         3.608 +- 2.669
    18 A      0.521         3.120 +- 2.659
    22 R      0.648         3.846 +- 2.652
    23 P      0.604         3.590 +- 2.670
    24 R      0.529         3.168 +- 2.663
    28 L      0.992**       5.888 +- 1.485
    29 R      1.000**       5.940 +- 1.431
    31 S      0.939         5.562 +- 1.817
    44 Y      0.749         4.364 +- 2.329
    46 D      0.996**       5.914 +- 1.457
    50 H      0.903         5.322 +- 1.965
    55 F      1.000**       5.940 +- 1.431
    56 L      0.898         5.246 +- 1.910
    75 V      1.000**       5.939 +- 1.432
    78 S      0.781         4.551 +- 2.275
    85 L      1.000**       5.940 +- 1.431
    86 L      0.735         4.283 +- 2.352
    88 Q      0.590         3.478 +- 2.465
    89 K      0.523         3.121 +- 2.458
    92 R      0.988*        5.861 +- 1.508
    99 H      0.630         3.693 +- 2.452
   102 G      0.549         3.261 +- 2.470
   104 G      0.989*        5.872 +- 1.515
   122 A      0.930         5.502 +- 1.859
   131 N      0.645         3.773 +- 2.441
   138 S      0.983*        5.833 +- 1.552
   153 G      0.668         3.903 +- 2.424
   184 R      0.678         3.966 +- 2.425
   201 A      0.569         3.394 +- 2.672
   205 E      0.872         5.120 +- 2.066
   209 R      0.725         4.225 +- 2.361
   245 H      0.940         5.531 +- 1.756
   246 S      0.990*        5.879 +- 1.512
   247 G      0.704         4.159 +- 2.574