--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Tue Feb 20 05:37:29 WET 2018
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/HIV1_N3/VPR_1_1/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/HIV1_N3/VPR_1_1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/HIV1_N3/VPR_1_1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/HIV1_N3/VPR_1_1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -4003.61         -4047.12
2      -4001.34         -4050.38
--------------------------------------
TOTAL    -4001.93         -4049.72
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/HIV1_N3/VPR_1_1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/HIV1_N3/VPR_1_1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/HIV1_N3/VPR_1_1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         5.865040    0.211270    4.962854    6.756617    5.830887    947.84   1096.40    1.000
r(A<->C){all}   0.114304    0.000235    0.085566    0.144827    0.113617    557.13    626.24    1.002
r(A<->G){all}   0.300026    0.001134    0.233756    0.366132    0.298924    404.95    442.59    1.001
r(A<->T){all}   0.053112    0.000100    0.034361    0.073159    0.052303    645.33    649.90    1.000
r(C<->G){all}   0.046719    0.000118    0.026891    0.069306    0.046225    710.10    752.29    1.000
r(C<->T){all}   0.428444    0.001519    0.359555    0.511255    0.428039    375.55    437.02    1.001
r(G<->T){all}   0.057396    0.000135    0.036125    0.079828    0.056519    398.38    533.67    1.002
pi(A){all}      0.331899    0.000414    0.291064    0.369460    0.331336    556.62    610.04    1.000
pi(C){all}      0.197563    0.000320    0.164793    0.234862    0.196956    491.56    498.28    1.000
pi(G){all}      0.267157    0.000360    0.229984    0.305116    0.267103    571.45    684.29    1.000
pi(T){all}      0.203382    0.000337    0.167928    0.239469    0.203000    459.31    512.97    1.000
alpha{1,2}      0.358685    0.002266    0.270807    0.452940    0.353829   1048.70   1089.74    1.000
alpha{3}        1.574862    0.132919    0.964004    2.340947    1.530524   1207.09   1288.66    1.000
pinvar{all}     0.117496    0.001674    0.036017    0.197684    0.117234   1227.46   1260.50    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-3676.405965
Model 2: PositiveSelection	-3654.007077
Model 0: one-ratio	-3926.31723
Model 3: discrete	-3652.360501
Model 7: beta	-3671.484472
Model 8: beta&w>1	-3648.066749


Model 0 vs 1	499.82253000000037

Model 2 vs 1	44.79777599999943

Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: G.GH.03.03GH175G.AB287004_)

            Pr(w>1)     post mean +- SE for w

    33 P      1.000**       2.979
    37 G      0.995**       2.969
    80 I      1.000**       2.979
    87 P      0.932         2.844

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: G.GH.03.03GH175G.AB287004_)

            Pr(w>1)     post mean +- SE for w

    33 P      1.000**       2.989 +- 0.508
    37 G      0.992**       2.971 +- 0.535
    80 I      1.000**       2.990 +- 0.507
    87 P      0.905         2.780 +- 0.750


Model 8 vs 7	46.83544600000005

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: G.GH.03.03GH175G.AB287004_)

            Pr(w>1)     post mean +- SE for w

    33 P      1.000**       2.644
    37 G      0.998**       2.641
    80 I      1.000**       2.644
    87 P      0.973*        2.597

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: G.GH.03.03GH175G.AB287004_)

            Pr(w>1)     post mean +- SE for w

    33 P      1.000**       2.595 +- 0.309
    37 G      0.996**       2.588 +- 0.322
    80 I      1.000**       2.595 +- 0.309
    87 P      0.959*        2.520 +- 0.439

>C1
MEQAPENQGPQREPYNEWALELLEELKNEAVRHFPRPWLHGLGQYIYNTY
GDTWEGVEAIIRMLQQLLFIHYRIGCQHSRIGIIPQRRVRDGPSRPoo
>C2
MEQPPEDQGPQREPYNEWALEILEELKQEAVRHFPRPWLHSLGQYIYETY
GDTWAGVEALLRILQQLLFIHYRIGCQHSRIGILQQRRARNGTSRSoo
>C3
MEQAPEDQGPQREPHNEWTLELLEELKTEAVRHFPRPWLHGLGQYIYNTY
GDTWEGVEAIIRTLQQLLFVHFRIGCQHSRIGIIPGRRGRNGAGRSoo
>C4
MEQAPEDQGPQREPYNEWMLELLEDLKQEAVRHFPRPWLHGLGQHIYETY
GDTWEGVEAIVRMLQHLLFVHFRIGCQHSRIGIIRGRRRVRDGAGRSo
>C5
MEQAPEDQGPQREPYNEWTLELLGELKNEAVRHFPGPWLHGLGQYIYATY
GDTWAGVIAIIRILQQLLFTHFRIGCQHSRIGILQRRRARNGASRSoo
>C6
MEQPPEDQGPQREPYNGWTLELLEELKQEAVRHFPRPWLHSLGQHIYATY
GDTWTGVEAMIRILQQLLFVHFRIGCQHSRIGILRQRRARNGANRSoo
>C7
MEQAPEDQGPQREPYNEWTLELLEELKSEAVRHFPRIWLHSLGQYIYETY
GDTWAGVEAIIRILQQLLFIHFRIGCQHSRIGVIRQRRARNGASRSoo
>C8
MEQTPEDQGPQREPYNEWALELLEELKQEAVRHFPRPWLHSLGQHIYNTY
GDTWAGVEAIIRILQQLLFIHFRIGCQHSRIGILRQRRTRNGASRSoo
>C9
MEQAPEDQGPQREPYNEWTLELLEELKSEAVRHFPRVWLHSLGQYIYETY
GDTWTGVEAIIRILQQLLFIHFRIGCHHSRIGIMRQRRTRNGASRSoo
>C10
MEQAPEDQGPQREPYNEWTLELLEELKNEAVRHFPRMWLHGLGQYIYETY
GDTWEGVEAIIRILQQLLFTHFRIGCQHSRIGIIRQRRARNGASRSoo
>C11
MEQAPEDQGPQREPYNDWTLELLEELKSEAVRHFPRIWLHSLGQYIYETY
GDTWTGVEALVRILQQLLFIHFRIGCQHSRIGIIQRRRPRNGARRSoo
>C12
MEQAPGDQGPQREPYNEWTLELLEELKNEAVRHFPRVWLHGLGQHIYETY
GDTWAGVEAIIRILQQLLFIHFRIGCRHSRIGITPQRRTRNGSSRSoo
>C13
MEQSPEDQGPQREPFNEWALELLEELKNEAVRHFPRPWLHGLGQYIYDTY
GDTWEGVEAIIRILQQLLFIHFRIGCQHSRIGIIPGRRGRNGAGRSoo
>C14
MEQAPENQGPQREPYHEWTLELLEELKNEAVRHFPRDWLHSLGQYIYETY
GDTWAGVEALIRILQQLLFIHFRIGCQHSRIGIIRQRRARNGSSRSoo
>C15
MEQAPEDQGPQREPSNEWTLELLEERKHEGVRNFPMLWLNGLGEYRYNTY
GDTGAGVEALLRILQQILFIHFRIGCQHSRIGITPQRRARNGSSRSoo
>C16
MEQAPEDQGPQREPYNEWTLELLEELKQEAVRHFPRPWLHGLGQHIYETY
GDTWTGVEVIIRILQQLLFIHFRIGCRHSRIGIMRQRRARNGASRSoo
>C17
MEQAPEDQGPQREPYNEWTLELLEELKQEAVRHFPRPWLHSMGQYIYETY
GDTWTGVEMIIRILQQLLFIHFRIGCQHSRIGILRQRRARNGANRSoo
>C18
MEQPPEDQGPQREPYNEWTLEILEELKQEAVRHFPRPWLHGIGQYVYETY
GDTWTGVEVIIRILQQLLFIHFRIGCQHSRIGIMRQRRARNGANRSoo
>C19
MEQPPEDQGPQREPFNEWTLELLEELKQEAVRHFPRPWLHGLGQYVYDTY
GDTWAGVEAIIRILQQLLFIHFRIGCHHSRIGIVIQRRARNGASRSoo
>C20
MEQAPEDQGPQREPYNEWTLELLEELKNEAVRHFPRVWLHGLGQHIYETY
GDTWTGVEALVRSLQQLLFIHFRIGCRHSRIGIAIGRRTRARNGASRP
>C21
MEQAPEDQRPQREPHWTLELLEELKNEAVRHFPRPWLHGLGQYIYDNYGD
TWEGAVAIIRILQQLLFVHFRIGCQHSRIGITPGRRGRNGAGRSoooo
>C22
MEQAPEDQGPPREPHNEWTLELLEELKNEAVRHFPRPWLHGLGQYIYNNY
GDTWEGVEAIIRILQQLLFVHFRIGCQHSRIGITPGRRGRNGGGRSoo
>C23
MEQAPEDQGPQREPYNEWTLELLEELKNEAVRHFPITWLHSLGQYIYTTY
GDTWAGVEAIIRILQQLLFIHFRIGCQHSRIGIIRGRRGRNGSGRSoo
>C24
MEQAPEDQGPQREPYNEWTLELLEELKNEAVRHFPRIWLHGLGQHIYETY
GDTWTGVEALIRILQQLLFIHFRIGCRHSRIGITPQRRARNGARRSoo
>C25
MEQAPEDQGPQREPYNEWTLELLEELKSEAVRHFPRTWLHSLGQHIYETY
GDTWTGVMALIRMLNQLLFIHFRIGCRHSRIGIMQHRRPRNGASRSoo
>C26
MEQAPEDQGPQREPYNEWTLELLEELKNEAVRHFPRTWLHGLGQHIYNTY
GDTWEGVEDIIRILQQLLFIHFRIGCHHSRIGITRQRRARNGASRSoo
>C27
MEQPPEDQGPQREPYTEWALEILEELKQEAVRHFPRPWLHSLGQYIYETY
GDTWAGVEALTRILQQLLFIHFRIGCRHSRIGVWRQRRVRNGASRSoo
>C28
MEQAPEDQGPQREPYNEWTLELLEELKNEAVRHFPRPWLHGLGQHIYETY
GDTWAGVEAIIRILQQLMFIHFRIGCQHSRIGILQRRTRNGANRSooo
>C29
MEQAPEDQGPQREPYNEWTLELLEELRSEAVRHFPRVWLHGLGQHIYETY
GDTWAGVELIIRILQQPLFIHFRIGCRHSRIGISPQRRARNGSSRSoo
>C30
MEQTPEDQGPQREPHNEWTLELLEELKNEAVRHFPRPWLHSLGQHIYDTY
GDTWEGVEAIIRILQQLIFVHFRIGCQHSRIGIIPGRRGRNGAGRSoo
>C31
MERAPEDQGPQREPNNEWTLELLEELKNEAVRHFPRPWLHGLGQYIYSNY
GDTWEGVQAMIRILQQLLFVHFRIGCQHSRIGITPGRRGRNGAGRSoo
>C32
MEQAPEDQGPQREPYNEWTLELLEELKREAVRHFPRPWLHSLGQHIYETY
GDTWTGVEAIIRILQQLLFIHFRIGCQHSRIGITPRRRPRNGSSRSoo
>C33
MEQPPEDQGPQREPYNVWTLELLEDLKQEAVRHFPRPWLHGLGQYIYETY
GDTWTGVENMIRMLQQLLFIHFRIGCQHSRIGIMRQRRARNGASRPoo
>C34
MEQTPEDQGPQREPYNEWTLEILEELKQEAVRHFPRPWLHNLGQHIYETY
GDTWAGVESLLRILQQLLFIHFRIGCQHSRIGILRQRRGRNGASRSoo
>C35
MEQAPENQGPQREQWALELLEELKNEAVRHFPRPWLLSLGQYIYETYGDT
WAGVEAITRILQQLLFIHFRIGCQHSRIGIIPQRRSRNGASRSooooo
>C36
MEQAPEDQGPQREPYNEWTLELLEELKQEAVRHFPRPWLHNLGQYIYETY
GDTWMGVEALIRTLQQLLFIHFRIGCHHSRIGIMRQRRARNGTSRSoo
>C37
MEQAPEDQGPQREPHNEWTLELLEELKEEAVKHFPRPWLHSLGQHIYNTY
GDTWEGVEAIIRILQQLLFIHFRIGCHHSRIGILRQARLRHGSNRPoo
>C38
MERPPEDHGPQREPYNEWTLELLEELKQEAVRHFPRPWLHGLGQYVYENY
GDTWTGVETIIRILQQLLFIHFRIGCQHSRIGIMRQRRARNGASRSoo
>C39
MERAPEDQGPQREPYNEWTLELLEELKREAVRHFPRPWLHSLGQYIYETY
GDTWAGVEAIIRILQQLLFIHFRIGCRHSRIGIMRQRRTRNGASRSoo
>C40
MEQAPGNQGPQREPYNEWTLELLEELMNEAVRHFPREWLHSLGQYIYDTY
GDTWAGVEALIRILQQLLFIHFRIGCRHSRIGIIRQRRTSNGASGSoo
>C41
MEQAPEDQGPQREPYNEWTLELLEELKNEAVRHFPRPWLHGLGQYIYNTY
GDTWEGVEAITRILQQLLFIHFRIGCQHSRIGILPGRRGRNGAGRSoo
>C42
MEQAPEDQGPQREPYNEWTLELLEELKSEAVRHFPRVWLHGLGQHIYETY
GDTWAGVEAIIRILQQLLFIHSRIGCHHSRIGVIRQRRARIGDRRSYo
>C43
MEQLPEDQGPQREPYNEWALEILEELKQEAVRHFPRPWLHILGQYIYDTY
GDTWTGVEALIRTLQQLLFMHFRIGCQHSRIGATPQRRARNGANRSoo
>C44
MEQAPEDQGPQREPYNEWALELLEELKSEAVRHFPRPWLHGLGQHIYETY
GDTWAGVEAIIRILQQLLFIHFRIGCRHSRIGITRRARNGASRSoooo
>C45
MEQAPEDQGPQREPYNEWTLELLEELKSEAVKHFPRPWLHGLGQHIYETY
GDTWAGVEAIIRILQQLLFIHFRIGCQHSRIGITRRRTRNGTSRSooo
>C46
MEQAPEDQGPQREPYNEWTLELLEELKNEAVRHFPRVWLHGLGQHIYETY
GDTWAGVEAIIRTLQQLLFIHFRIGCRHSRIGITPQRRTRNGASRSoo
>C47
MEQAPEDQGPQREPHNEWTLELLEELKSEAVRHFPRVWLHGLGQLIYETY
GDTWAGVEALVRTLQQLLFIHFRIGCQHSRIGITQRRRARNGASRSoo
>C48
MEQAPEDQGPQREPYNEWTLELLEELKREAVRHFPRIWLHSLGQYIYETY
GDTWTGVEALIIHLQQLLFVHFRIGCQHSRIGILQRRRARNGASRPoo
>C49
MEQPPENQGPQREPYNEWTLEVLEELKQEAVRHFPRPWLHDLGQYIYETY
GDTWTGVEAIIRILQQLLFIHFRIGCQHSRIGILRQRRARNGASRSoo
>C50
MEQAPEDQGPQREPSNEWTLELLEELKSEAVRHFPRTWLHSLGQHIYETY
GDTWAGVEAITRILQRLLFIHFRIGCQHSRIGVVRQRRARNGSSRSoo

PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 50 SEQUENCES  [PROTEIN]
	Multi Core Mode: 8 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 50 SEQUENCES  [PROTEIN]
	Multi Core Mode: 8 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 50 SEQUENCES  [PROTEIN]
	Multi Core Mode: 8 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 50 SEQUENCES  [PROTEIN]
	Multi Core Mode: 8 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 50 SEQUENCES  [PROTEIN]
	Multi Core Mode: 8 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 50 SEQUENCES  [PROTEIN]
	Multi Core Mode: 8 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 50 SEQUENCES  [PROTEIN]
	Multi Core Mode: 8 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 50 SEQUENCES  [PROTEIN]
	Multi Core Mode: 8 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 50 SEQUENCES  [PROTEIN]
	Multi Core Mode: 8 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 50 SEQUENCES  [PROTEIN]
	Multi Core Mode: 8 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 50 SEQUENCES  [PROTEIN]
	Multi Core Mode: 8 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [251400]

Library Relaxation: Multi_proc [8]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 50 SEQUENCES  [PROTEIN]
	Multi Core Mode: 8 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [251400]

Library Relaxation: Multi_proc [8]
 
		[Relax Library][TOT=    6][  0 %][ELAPSED TIME:    0 sec.]
		[Relax Library][TOT=    6][ 33 %][ELAPSED TIME:    0 sec.]
		[Relax Library][TOT=    6][ 50 %][ELAPSED TIME:    0 sec.]
		[Relax Library][TOT=    6][ 66 %][ELAPSED TIME:    0 sec.]
		[Relax Library][TOT=    6][ 83 %][ELAPSED TIME:    0 sec.]
		[Relax Library][TOT=    6][100 %][ELAPSED TIME:    0 sec.]
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 50 SEQUENCES  [PROTEIN]
	Multi Core Mode: 8 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [251400]

Library Relaxation: Multi_proc [8]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 50 SEQUENCES  [PROTEIN]
	Multi Core Mode: 8 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [251400]

Library Relaxation: Multi_proc [8]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 50 SEQUENCES  [PROTEIN]
	Multi Core Mode: 8 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [251400]

Library Relaxation: Multi_proc [8]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 50 SEQUENCES  [PROTEIN]
	Multi Core Mode: 8 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [251400]

Library Relaxation: Multi_proc [8]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 50 SEQUENCES  [PROTEIN]
	Multi Core Mode: 8 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [251400]

Library Relaxation: Multi_proc [8]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 50 SEQUENCES  [PROTEIN]
	Multi Core Mode: 8 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [251400]

Library Relaxation: Multi_proc [8]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 50 SEQUENCES  [PROTEIN]
	Multi Core Mode: 8 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [251400]

Library Relaxation: Multi_proc [8]
 
Relaxation Summary: [251400]--->[250205]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 31.740 Mb, Max= 38.751 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MEQAPENQGPQREWALELLEELKNEAVRHFPRPWLHGLGQYIYNTYGDTW
C2              MEQPPEDQGPQREWALEILEELKQEAVRHFPRPWLHSLGQYIYETYGDTW
C3              MEQAPEDQGPQREWTLELLEELKTEAVRHFPRPWLHGLGQYIYNTYGDTW
C4              MEQAPEDQGPQREWMLELLEDLKQEAVRHFPRPWLHGLGQHIYETYGDTW
C5              MEQAPEDQGPQREWTLELLGELKNEAVRHFPGPWLHGLGQYIYATYGDTW
C6              MEQPPEDQGPQREWTLELLEELKQEAVRHFPRPWLHSLGQHIYATYGDTW
C7              MEQAPEDQGPQREWTLELLEELKSEAVRHFPRIWLHSLGQYIYETYGDTW
C8              MEQTPEDQGPQREWALELLEELKQEAVRHFPRPWLHSLGQHIYNTYGDTW
C9              MEQAPEDQGPQREWTLELLEELKSEAVRHFPRVWLHSLGQYIYETYGDTW
C10             MEQAPEDQGPQREWTLELLEELKNEAVRHFPRMWLHGLGQYIYETYGDTW
C11             MEQAPEDQGPQREWTLELLEELKSEAVRHFPRIWLHSLGQYIYETYGDTW
C12             MEQAPGDQGPQREWTLELLEELKNEAVRHFPRVWLHGLGQHIYETYGDTW
C13             MEQSPEDQGPQREWALELLEELKNEAVRHFPRPWLHGLGQYIYDTYGDTW
C14             MEQAPENQGPQREWTLELLEELKNEAVRHFPRDWLHSLGQYIYETYGDTW
C15             MEQAPEDQGPQREWTLELLEERKHEGVRNFPMLWLNGLGEYRYNTYGDTG
C16             MEQAPEDQGPQREWTLELLEELKQEAVRHFPRPWLHGLGQHIYETYGDTW
C17             MEQAPEDQGPQREWTLELLEELKQEAVRHFPRPWLHSMGQYIYETYGDTW
C18             MEQPPEDQGPQREWTLEILEELKQEAVRHFPRPWLHGIGQYVYETYGDTW
C19             MEQPPEDQGPQREWTLELLEELKQEAVRHFPRPWLHGLGQYVYDTYGDTW
C20             MEQAPEDQGPQREWTLELLEELKNEAVRHFPRVWLHGLGQHIYETYGDTW
C21             MEQAPEDQRPQREWTLELLEELKNEAVRHFPRPWLHGLGQYIYDNYGDTW
C22             MEQAPEDQGPPREWTLELLEELKNEAVRHFPRPWLHGLGQYIYNNYGDTW
C23             MEQAPEDQGPQREWTLELLEELKNEAVRHFPITWLHSLGQYIYTTYGDTW
C24             MEQAPEDQGPQREWTLELLEELKNEAVRHFPRIWLHGLGQHIYETYGDTW
C25             MEQAPEDQGPQREWTLELLEELKSEAVRHFPRTWLHSLGQHIYETYGDTW
C26             MEQAPEDQGPQREWTLELLEELKNEAVRHFPRTWLHGLGQHIYNTYGDTW
C27             MEQPPEDQGPQREWALEILEELKQEAVRHFPRPWLHSLGQYIYETYGDTW
C28             MEQAPEDQGPQREWTLELLEELKNEAVRHFPRPWLHGLGQHIYETYGDTW
C29             MEQAPEDQGPQREWTLELLEELRSEAVRHFPRVWLHGLGQHIYETYGDTW
C30             MEQTPEDQGPQREWTLELLEELKNEAVRHFPRPWLHSLGQHIYDTYGDTW
C31             MERAPEDQGPQREWTLELLEELKNEAVRHFPRPWLHGLGQYIYSNYGDTW
C32             MEQAPEDQGPQREWTLELLEELKREAVRHFPRPWLHSLGQHIYETYGDTW
C33             MEQPPEDQGPQREWTLELLEDLKQEAVRHFPRPWLHGLGQYIYETYGDTW
C34             MEQTPEDQGPQREWTLEILEELKQEAVRHFPRPWLHNLGQHIYETYGDTW
C35             MEQAPENQGPQREWALELLEELKNEAVRHFPRPWLLSLGQYIYETYGDTW
C36             MEQAPEDQGPQREWTLELLEELKQEAVRHFPRPWLHNLGQYIYETYGDTW
C37             MEQAPEDQGPQREWTLELLEELKEEAVKHFPRPWLHSLGQHIYNTYGDTW
C38             MERPPEDHGPQREWTLELLEELKQEAVRHFPRPWLHGLGQYVYENYGDTW
C39             MERAPEDQGPQREWTLELLEELKREAVRHFPRPWLHSLGQYIYETYGDTW
C40             MEQAPGNQGPQREWTLELLEELMNEAVRHFPREWLHSLGQYIYDTYGDTW
C41             MEQAPEDQGPQREWTLELLEELKNEAVRHFPRPWLHGLGQYIYNTYGDTW
C42             MEQAPEDQGPQREWTLELLEELKSEAVRHFPRVWLHGLGQHIYETYGDTW
C43             MEQLPEDQGPQREWALEILEELKQEAVRHFPRPWLHILGQYIYDTYGDTW
C44             MEQAPEDQGPQREWALELLEELKSEAVRHFPRPWLHGLGQHIYETYGDTW
C45             MEQAPEDQGPQREWTLELLEELKSEAVKHFPRPWLHGLGQHIYETYGDTW
C46             MEQAPEDQGPQREWTLELLEELKNEAVRHFPRVWLHGLGQHIYETYGDTW
C47             MEQAPEDQGPQREWTLELLEELKSEAVRHFPRVWLHGLGQLIYETYGDTW
C48             MEQAPEDQGPQREWTLELLEELKREAVRHFPRIWLHSLGQYIYETYGDTW
C49             MEQPPENQGPQREWTLEVLEELKQEAVRHFPRPWLHDLGQYIYETYGDTW
C50             MEQAPEDQGPQREWTLELLEELKSEAVRHFPRTWLHSLGQHIYETYGDTW
                **: * :: * *** **:* :   *.*::**  **  :*:  * .**** 

C1              EGVEAIIRMLQQLLFIHYRIGCQHSRIGIIRRVRDGPSRP
C2              AGVEALLRILQQLLFIHYRIGCQHSRIGILRRARNGTSRS
C3              EGVEAIIRTLQQLLFVHFRIGCQHSRIGIIRRGRNGAGRS
C4              EGVEAIVRMLQHLLFVHFRIGCQHSRIGIIRRVRDGAGRS
C5              AGVIAIIRILQQLLFTHFRIGCQHSRIGILRRARNGASRS
C6              TGVEAMIRILQQLLFVHFRIGCQHSRIGILRRARNGANRS
C7              AGVEAIIRILQQLLFIHFRIGCQHSRIGVIRRARNGASRS
C8              AGVEAIIRILQQLLFIHFRIGCQHSRIGILRRTRNGASRS
C9              TGVEAIIRILQQLLFIHFRIGCHHSRIGIMRRTRNGASRS
C10             EGVEAIIRILQQLLFTHFRIGCQHSRIGIIRRARNGASRS
C11             TGVEALVRILQQLLFIHFRIGCQHSRIGIIRRPRNGARRS
C12             AGVEAIIRILQQLLFIHFRIGCRHSRIGITRRTRNGSSRS
C13             EGVEAIIRILQQLLFIHFRIGCQHSRIGIIRRGRNGAGRS
C14             AGVEALIRILQQLLFIHFRIGCQHSRIGIIRRARNGSSRS
C15             AGVEALLRILQQILFIHFRIGCQHSRIGITRRARNGSSRS
C16             TGVEVIIRILQQLLFIHFRIGCRHSRIGIMRRARNGASRS
C17             TGVEMIIRILQQLLFIHFRIGCQHSRIGILRRARNGANRS
C18             TGVEVIIRILQQLLFIHFRIGCQHSRIGIMRRARNGANRS
C19             AGVEAIIRILQQLLFIHFRIGCHHSRIGIVRRARNGASRS
C20             TGVEALVRSLQQLLFIHFRIGCRHSRIGIATRARNGASRP
C21             EGAVAIIRILQQLLFVHFRIGCQHSRIGITRRGRNGAGRS
C22             EGVEAIIRILQQLLFVHFRIGCQHSRIGITRRGRNGGGRS
C23             AGVEAIIRILQQLLFIHFRIGCQHSRIGIIRRGRNGSGRS
C24             TGVEALIRILQQLLFIHFRIGCRHSRIGITRRARNGARRS
C25             TGVMALIRMLNQLLFIHFRIGCRHSRIGIMRRPRNGASRS
C26             EGVEDIIRILQQLLFIHFRIGCHHSRIGITRRARNGASRS
C27             AGVEALTRILQQLLFIHFRIGCRHSRIGVWRRVRNGASRS
C28             AGVEAIIRILQQLMFIHFRIGCQHSRIGILRRTRNGANRS
C29             AGVELIIRILQQPLFIHFRIGCRHSRIGISRRARNGSSRS
C30             EGVEAIIRILQQLIFVHFRIGCQHSRIGIIRRGRNGAGRS
C31             EGVQAMIRILQQLLFVHFRIGCQHSRIGITRRGRNGAGRS
C32             TGVEAIIRILQQLLFIHFRIGCQHSRIGITRRPRNGSSRS
C33             TGVENMIRMLQQLLFIHFRIGCQHSRIGIMRRARNGASRP
C34             AGVESLLRILQQLLFIHFRIGCQHSRIGILRRGRNGASRS
C35             AGVEAITRILQQLLFIHFRIGCQHSRIGIIRRSRNGASRS
C36             MGVEALIRTLQQLLFIHFRIGCHHSRIGIMRRARNGTSRS
C37             EGVEAIIRILQQLLFIHFRIGCHHSRIGILARLRHGSNRP
C38             TGVETIIRILQQLLFIHFRIGCQHSRIGIMRRARNGASRS
C39             AGVEAIIRILQQLLFIHFRIGCRHSRIGIMRRTRNGASRS
C40             AGVEALIRILQQLLFIHFRIGCRHSRIGIIRRTSNGASGS
C41             EGVEAITRILQQLLFIHFRIGCQHSRIGILRRGRNGAGRS
C42             AGVEAIIRILQQLLFIHSRIGCHHSRIGVIRRARIGDRRS
C43             TGVEALIRTLQQLLFMHFRIGCQHSRIGATRRARNGANRS
C44             AGVEAIIRILQQLLFIHFRIGCRHSRIGITRRARNGASRS
C45             AGVEAIIRILQQLLFIHFRIGCQHSRIGITRRTRNGTSRS
C46             AGVEAIIRTLQQLLFIHFRIGCRHSRIGITRRTRNGASRS
C47             AGVEALVRTLQQLLFIHFRIGCQHSRIGITRRARNGASRS
C48             TGVEALIIHLQQLLFVHFRIGCQHSRIGILRRARNGASRP
C49             TGVEAIIRILQQLLFIHFRIGCQHSRIGILRRARNGASRS
C50             AGVEAITRILQRLLFIHFRIGCQHSRIGVVRRARNGSSRS
                 *.  :   *:: :* * ****:*****   *   *   .




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:98 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# SEQ_INDEX C11 10
# SEQ_INDEX C12 11
# SEQ_INDEX C13 12
# SEQ_INDEX C14 13
# SEQ_INDEX C15 14
# SEQ_INDEX C16 15
# SEQ_INDEX C17 16
# SEQ_INDEX C18 17
# SEQ_INDEX C19 18
# SEQ_INDEX C20 19
# SEQ_INDEX C21 20
# SEQ_INDEX C22 21
# SEQ_INDEX C23 22
# SEQ_INDEX C24 23
# SEQ_INDEX C25 24
# SEQ_INDEX C26 25
# SEQ_INDEX C27 26
# SEQ_INDEX C28 27
# SEQ_INDEX C29 28
# SEQ_INDEX C30 29
# SEQ_INDEX C31 30
# SEQ_INDEX C32 31
# SEQ_INDEX C33 32
# SEQ_INDEX C34 33
# SEQ_INDEX C35 34
# SEQ_INDEX C36 35
# SEQ_INDEX C37 36
# SEQ_INDEX C38 37
# SEQ_INDEX C39 38
# SEQ_INDEX C40 39
# SEQ_INDEX C41 40
# SEQ_INDEX C42 41
# SEQ_INDEX C43 42
# SEQ_INDEX C44 43
# SEQ_INDEX C45 44
# SEQ_INDEX C46 45
# SEQ_INDEX C47 46
# SEQ_INDEX C48 47
# SEQ_INDEX C49 48
# SEQ_INDEX C50 49
# PW_SEQ_DISTANCES 
BOT	    0    1	 83.67  C1	  C2	 83.67
TOP	    1    0	 83.67  C2	  C1	 83.67
BOT	    0    2	 86.73  C1	  C3	 86.73
TOP	    2    0	 86.73  C3	  C1	 86.73
BOT	    0    3	 84.54  C1	  C4	 84.54
TOP	    3    0	 84.54  C4	  C1	 84.54
BOT	    0    4	 82.65  C1	  C5	 82.65
TOP	    4    0	 82.65  C5	  C1	 82.65
BOT	    0    5	 79.59  C1	  C6	 79.59
TOP	    5    0	 79.59  C6	  C1	 79.59
BOT	    0    6	 84.69  C1	  C7	 84.69
TOP	    6    0	 84.69  C7	  C1	 84.69
BOT	    0    7	 85.71  C1	  C8	 85.71
TOP	    7    0	 85.71  C8	  C1	 85.71
BOT	    0    8	 83.67  C1	  C9	 83.67
TOP	    8    0	 83.67  C9	  C1	 83.67
BOT	    0    9	 87.76  C1	 C10	 87.76
TOP	    9    0	 87.76 C10	  C1	 87.76
BOT	    0   10	 80.61  C1	 C11	 80.61
TOP	   10    0	 80.61 C11	  C1	 80.61
BOT	    0   11	 84.69  C1	 C12	 84.69
TOP	   11    0	 84.69 C12	  C1	 84.69
BOT	    0   12	 87.76  C1	 C13	 87.76
TOP	   12    0	 87.76 C13	  C1	 87.76
BOT	    0   13	 85.71  C1	 C14	 85.71
TOP	   13    0	 85.71 C14	  C1	 85.71
BOT	    0   14	 75.51  C1	 C15	 75.51
TOP	   14    0	 75.51 C15	  C1	 75.51
BOT	    0   15	 83.67  C1	 C16	 83.67
TOP	   15    0	 83.67 C16	  C1	 83.67
BOT	    0   16	 82.65  C1	 C17	 82.65
TOP	   16    0	 82.65 C17	  C1	 82.65
BOT	    0   17	 80.61  C1	 C18	 80.61
TOP	   17    0	 80.61 C18	  C1	 80.61
BOT	    0   18	 82.65  C1	 C19	 82.65
TOP	   18    0	 82.65 C19	  C1	 82.65
BOT	    0   19	 81.25  C1	 C20	 81.25
TOP	   19    0	 81.25 C20	  C1	 81.25
BOT	    0   20	 81.25  C1	 C21	 81.25
TOP	   20    0	 81.25 C21	  C1	 81.25
BOT	    0   21	 84.69  C1	 C22	 84.69
TOP	   21    0	 84.69 C22	  C1	 84.69
BOT	    0   22	 83.67  C1	 C23	 83.67
TOP	   22    0	 83.67 C23	  C1	 83.67
BOT	    0   23	 83.67  C1	 C24	 83.67
TOP	   23    0	 83.67 C24	  C1	 83.67
BOT	    0   24	 79.59  C1	 C25	 79.59
TOP	   24    0	 79.59 C25	  C1	 79.59
BOT	    0   25	 85.71  C1	 C26	 85.71
TOP	   25    0	 85.71 C26	  C1	 85.71
BOT	    0   26	 80.61  C1	 C27	 80.61
TOP	   26    0	 80.61 C27	  C1	 80.61
BOT	    0   27	 85.57  C1	 C28	 85.57
TOP	   27    0	 85.57 C28	  C1	 85.57
BOT	    0   28	 81.63  C1	 C29	 81.63
TOP	   28    0	 81.63 C29	  C1	 81.63
BOT	    0   29	 82.65  C1	 C30	 82.65
TOP	   29    0	 82.65 C30	  C1	 82.65
BOT	    0   30	 81.63  C1	 C31	 81.63
TOP	   30    0	 81.63 C31	  C1	 81.63
BOT	    0   31	 84.69  C1	 C32	 84.69
TOP	   31    0	 84.69 C32	  C1	 84.69
BOT	    0   32	 83.67  C1	 C33	 83.67
TOP	   32    0	 83.67 C33	  C1	 83.67
BOT	    0   33	 79.59  C1	 C34	 79.59
TOP	   33    0	 79.59 C34	  C1	 79.59
BOT	    0   34	 87.37  C1	 C35	 87.37
TOP	   34    0	 87.37 C35	  C1	 87.37
BOT	    0   35	 83.67  C1	 C36	 83.67
TOP	   35    0	 83.67 C36	  C1	 83.67
BOT	    0   36	 82.65  C1	 C37	 82.65
TOP	   36    0	 82.65 C37	  C1	 82.65
BOT	    0   37	 80.61  C1	 C38	 80.61
TOP	   37    0	 80.61 C38	  C1	 80.61
BOT	    0   38	 83.67  C1	 C39	 83.67
TOP	   38    0	 83.67 C39	  C1	 83.67
BOT	    0   39	 81.63  C1	 C40	 81.63
TOP	   39    0	 81.63 C40	  C1	 81.63
BOT	    0   40	 87.76  C1	 C41	 87.76
TOP	   40    0	 87.76 C41	  C1	 87.76
BOT	    0   41	 81.63  C1	 C42	 81.63
TOP	   41    0	 81.63 C42	  C1	 81.63
BOT	    0   42	 81.63  C1	 C43	 81.63
TOP	   42    0	 81.63 C43	  C1	 81.63
BOT	    0   43	 86.46  C1	 C44	 86.46
TOP	   43    0	 86.46 C44	  C1	 86.46
BOT	    0   44	 84.54  C1	 C45	 84.54
TOP	   44    0	 84.54 C45	  C1	 84.54
BOT	    0   45	 85.71  C1	 C46	 85.71
TOP	   45    0	 85.71 C46	  C1	 85.71
BOT	    0   46	 80.61  C1	 C47	 80.61
TOP	   46    0	 80.61 C47	  C1	 80.61
BOT	    0   47	 81.63  C1	 C48	 81.63
TOP	   47    0	 81.63 C48	  C1	 81.63
BOT	    0   48	 84.69  C1	 C49	 84.69
TOP	   48    0	 84.69 C49	  C1	 84.69
BOT	    0   49	 79.59  C1	 C50	 79.59
TOP	   49    0	 79.59 C50	  C1	 79.59
BOT	    1    2	 80.61  C2	  C3	 80.61
TOP	    2    1	 80.61  C3	  C2	 80.61
BOT	    1    3	 79.38  C2	  C4	 79.38
TOP	    3    1	 79.38  C4	  C2	 79.38
BOT	    1    4	 84.69  C2	  C5	 84.69
TOP	    4    1	 84.69  C5	  C2	 84.69
BOT	    1    5	 86.73  C2	  C6	 86.73
TOP	    5    1	 86.73  C6	  C2	 86.73
BOT	    1    6	 87.76  C2	  C7	 87.76
TOP	    6    1	 87.76  C7	  C2	 87.76
BOT	    1    7	 89.80  C2	  C8	 89.80
TOP	    7    1	 89.80  C8	  C2	 89.80
BOT	    1    8	 85.71  C2	  C9	 85.71
TOP	    8    1	 85.71  C9	  C2	 85.71
BOT	    1    9	 85.71  C2	 C10	 85.71
TOP	    9    1	 85.71 C10	  C2	 85.71
BOT	    1   10	 85.71  C2	 C11	 85.71
TOP	   10    1	 85.71 C11	  C2	 85.71
BOT	    1   11	 83.67  C2	 C12	 83.67
TOP	   11    1	 83.67 C12	  C2	 83.67
BOT	    1   12	 83.67  C2	 C13	 83.67
TOP	   12    1	 83.67 C13	  C2	 83.67
BOT	    1   13	 87.76  C2	 C14	 87.76
TOP	   13    1	 87.76 C14	  C2	 87.76
BOT	    1   14	 78.57  C2	 C15	 78.57
TOP	   14    1	 78.57 C15	  C2	 78.57
BOT	    1   15	 85.71  C2	 C16	 85.71
TOP	   15    1	 85.71 C16	  C2	 85.71
BOT	    1   16	 87.76  C2	 C17	 87.76
TOP	   16    1	 87.76 C17	  C2	 87.76
BOT	    1   17	 86.73  C2	 C18	 86.73
TOP	   17    1	 86.73 C18	  C2	 86.73
BOT	    1   18	 86.73  C2	 C19	 86.73
TOP	   18    1	 86.73 C19	  C2	 86.73
BOT	    1   19	 81.25  C2	 C20	 81.25
TOP	   19    1	 81.25 C20	  C2	 81.25
BOT	    1   20	 77.08  C2	 C21	 77.08
TOP	   20    1	 77.08 C21	  C2	 77.08
BOT	    1   21	 79.59  C2	 C22	 79.59
TOP	   21    1	 79.59 C22	  C2	 79.59
BOT	    1   22	 83.67  C2	 C23	 83.67
TOP	   22    1	 83.67 C23	  C2	 83.67
BOT	    1   23	 84.69  C2	 C24	 84.69
TOP	   23    1	 84.69 C24	  C2	 84.69
BOT	    1   24	 82.65  C2	 C25	 82.65
TOP	   24    1	 82.65 C25	  C2	 82.65
BOT	    1   25	 82.65  C2	 C26	 82.65
TOP	   25    1	 82.65 C26	  C2	 82.65
BOT	    1   26	 90.82  C2	 C27	 90.82
TOP	   26    1	 90.82 C27	  C2	 90.82
BOT	    1   27	 86.60  C2	 C28	 86.60
TOP	   27    1	 86.60 C28	  C2	 86.60
BOT	    1   28	 82.65  C2	 C29	 82.65
TOP	   28    1	 82.65 C29	  C2	 82.65
BOT	    1   29	 80.61  C2	 C30	 80.61
TOP	   29    1	 80.61 C30	  C2	 80.61
BOT	    1   30	 78.57  C2	 C31	 78.57
TOP	   30    1	 78.57 C31	  C2	 78.57
BOT	    1   31	 85.71  C2	 C32	 85.71
TOP	   31    1	 85.71 C32	  C2	 85.71
BOT	    1   32	 84.69  C2	 C33	 84.69
TOP	   32    1	 84.69 C33	  C2	 84.69
BOT	    1   33	 90.82  C2	 C34	 90.82
TOP	   33    1	 90.82 C34	  C2	 90.82
BOT	    1   34	 86.32  C2	 C35	 86.32
TOP	   34    1	 86.32 C35	  C2	 86.32
BOT	    1   35	 88.78  C2	 C36	 88.78
TOP	   35    1	 88.78 C36	  C2	 88.78
BOT	    1   36	 79.59  C2	 C37	 79.59
TOP	   36    1	 79.59 C37	  C2	 79.59
BOT	    1   37	 84.69  C2	 C38	 84.69
TOP	   37    1	 84.69 C38	  C2	 84.69
BOT	    1   38	 86.73  C2	 C39	 86.73
TOP	   38    1	 86.73 C39	  C2	 86.73
BOT	    1   39	 81.63  C2	 C40	 81.63
TOP	   39    1	 81.63 C40	  C2	 81.63
BOT	    1   40	 84.69  C2	 C41	 84.69
TOP	   40    1	 84.69 C41	  C2	 84.69
BOT	    1   41	 81.63  C2	 C42	 81.63
TOP	   41    1	 81.63 C42	  C2	 81.63
BOT	    1   42	 86.73  C2	 C43	 86.73
TOP	   42    1	 86.73 C43	  C2	 86.73
BOT	    1   43	 88.54  C2	 C44	 88.54
TOP	   43    1	 88.54 C44	  C2	 88.54
BOT	    1   44	 86.60  C2	 C45	 86.60
TOP	   44    1	 86.60 C45	  C2	 86.60
BOT	    1   45	 83.67  C2	 C46	 83.67
TOP	   45    1	 83.67 C46	  C2	 83.67
BOT	    1   46	 85.71  C2	 C47	 85.71
TOP	   46    1	 85.71 C47	  C2	 85.71
BOT	    1   47	 85.71  C2	 C48	 85.71
TOP	   47    1	 85.71 C48	  C2	 85.71
BOT	    1   48	 89.80  C2	 C49	 89.80
TOP	   48    1	 89.80 C49	  C2	 89.80
BOT	    1   49	 84.69  C2	 C50	 84.69
TOP	   49    1	 84.69 C50	  C2	 84.69
BOT	    2    3	 86.60  C3	  C4	 86.60
TOP	    3    2	 86.60  C4	  C3	 86.60
BOT	    2    4	 85.71  C3	  C5	 85.71
TOP	    4    2	 85.71  C5	  C3	 85.71
BOT	    2    5	 84.69  C3	  C6	 84.69
TOP	    5    2	 84.69  C6	  C3	 84.69
BOT	    2    6	 86.73  C3	  C7	 86.73
TOP	    6    2	 86.73  C7	  C3	 86.73
BOT	    2    7	 85.71  C3	  C8	 85.71
TOP	    7    2	 85.71  C8	  C3	 85.71
BOT	    2    8	 85.71  C3	  C9	 85.71
TOP	    8    2	 85.71  C9	  C3	 85.71
BOT	    2    9	 89.80  C3	 C10	 89.80
TOP	    9    2	 89.80 C10	  C3	 89.80
BOT	    2   10	 84.69  C3	 C11	 84.69
TOP	   10    2	 84.69 C11	  C3	 84.69
BOT	    2   11	 84.69  C3	 C12	 84.69
TOP	   11    2	 84.69 C12	  C3	 84.69
BOT	    2   12	 92.86  C3	 C13	 92.86
TOP	   12    2	 92.86 C13	  C3	 92.86
BOT	    2   13	 83.67  C3	 C14	 83.67
TOP	   13    2	 83.67 C14	  C3	 83.67
BOT	    2   14	 77.55  C3	 C15	 77.55
TOP	   14    2	 77.55 C15	  C3	 77.55
BOT	    2   15	 85.71  C3	 C16	 85.71
TOP	   15    2	 85.71 C16	  C3	 85.71
BOT	    2   16	 85.71  C3	 C17	 85.71
TOP	   16    2	 85.71 C17	  C3	 85.71
BOT	    2   17	 83.67  C3	 C18	 83.67
TOP	   17    2	 83.67 C18	  C3	 83.67
BOT	    2   18	 85.71  C3	 C19	 85.71
TOP	   18    2	 85.71 C19	  C3	 85.71
BOT	    2   19	 81.25  C3	 C20	 81.25
TOP	   19    2	 81.25 C20	  C3	 81.25
BOT	    2   20	 91.67  C3	 C21	 91.67
TOP	   20    2	 91.67 C21	  C3	 91.67
BOT	    2   21	 93.88  C3	 C22	 93.88
TOP	   21    2	 93.88 C22	  C3	 93.88
BOT	    2   22	 88.78  C3	 C23	 88.78
TOP	   22    2	 88.78 C23	  C3	 88.78
BOT	    2   23	 85.71  C3	 C24	 85.71
TOP	   23    2	 85.71 C24	  C3	 85.71
BOT	    2   24	 81.63  C3	 C25	 81.63
TOP	   24    2	 81.63 C25	  C3	 81.63
BOT	    2   25	 86.73  C3	 C26	 86.73
TOP	   25    2	 86.73 C26	  C3	 86.73
BOT	    2   26	 79.59  C3	 C27	 79.59
TOP	   26    2	 79.59 C27	  C3	 79.59
BOT	    2   27	 87.63  C3	 C28	 87.63
TOP	   27    2	 87.63 C28	  C3	 87.63
BOT	    2   28	 82.65  C3	 C29	 82.65
TOP	   28    2	 82.65 C29	  C3	 82.65
BOT	    2   29	 92.86  C3	 C30	 92.86
TOP	   29    2	 92.86 C30	  C3	 92.86
BOT	    2   30	 90.82  C3	 C31	 90.82
TOP	   30    2	 90.82 C31	  C3	 90.82
BOT	    2   31	 86.73  C3	 C32	 86.73
TOP	   31    2	 86.73 C32	  C3	 86.73
BOT	    2   32	 82.65  C3	 C33	 82.65
TOP	   32    2	 82.65 C33	  C3	 82.65
BOT	    2   33	 82.65  C3	 C34	 82.65
TOP	   33    2	 82.65 C34	  C3	 82.65
BOT	    2   34	 85.26  C3	 C35	 85.26
TOP	   34    2	 85.26 C35	  C3	 85.26
BOT	    2   35	 85.71  C3	 C36	 85.71
TOP	   35    2	 85.71 C36	  C3	 85.71
BOT	    2   36	 83.67  C3	 C37	 83.67
TOP	   36    2	 83.67 C37	  C3	 83.67
BOT	    2   37	 82.65  C3	 C38	 82.65
TOP	   37    2	 82.65 C38	  C3	 82.65
BOT	    2   38	 85.71  C3	 C39	 85.71
TOP	   38    2	 85.71 C39	  C3	 85.71
BOT	    2   39	 80.61  C3	 C40	 80.61
TOP	   39    2	 80.61 C40	  C3	 80.61
BOT	    2   40	 93.88  C3	 C41	 93.88
TOP	   40    2	 93.88 C41	  C3	 93.88
BOT	    2   41	 81.63  C3	 C42	 81.63
TOP	   41    2	 81.63 C42	  C3	 81.63
BOT	    2   42	 84.69  C3	 C43	 84.69
TOP	   42    2	 84.69 C43	  C3	 84.69
BOT	    2   43	 87.50  C3	 C44	 87.50
TOP	   43    2	 87.50 C44	  C3	 87.50
BOT	    2   44	 86.60  C3	 C45	 86.60
TOP	   44    2	 86.60 C45	  C3	 86.60
BOT	    2   45	 87.76  C3	 C46	 87.76
TOP	   45    2	 87.76 C46	  C3	 87.76
BOT	    2   46	 86.73  C3	 C47	 86.73
TOP	   46    2	 86.73 C47	  C3	 86.73
BOT	    2   47	 84.69  C3	 C48	 84.69
TOP	   47    2	 84.69 C48	  C3	 84.69
BOT	    2   48	 84.69  C3	 C49	 84.69
TOP	   48    2	 84.69 C49	  C3	 84.69
BOT	    2   49	 81.63  C3	 C50	 81.63
TOP	   49    2	 81.63 C50	  C3	 81.63
BOT	    3    4	 81.44  C4	  C5	 81.44
TOP	    4    3	 81.44  C5	  C4	 81.44
BOT	    3    5	 82.47  C4	  C6	 82.47
TOP	    5    3	 82.47  C6	  C4	 82.47
BOT	    3    6	 82.47  C4	  C7	 82.47
TOP	    6    3	 82.47  C7	  C4	 82.47
BOT	    3    7	 83.51  C4	  C8	 83.51
TOP	    7    3	 83.51  C8	  C4	 83.51
BOT	    3    8	 81.44  C4	  C9	 81.44
TOP	    8    3	 81.44  C9	  C4	 81.44
BOT	    3    9	 85.57  C4	 C10	 85.57
TOP	    9    3	 85.57 C10	  C4	 85.57
BOT	    3   10	 83.51  C4	 C11	 83.51
TOP	   10    3	 83.51 C11	  C4	 83.51
BOT	    3   11	 81.44  C4	 C12	 81.44
TOP	   11    3	 81.44 C12	  C4	 81.44
BOT	    3   12	 84.54  C4	 C13	 84.54
TOP	   12    3	 84.54 C13	  C4	 84.54
BOT	    3   13	 79.38  C4	 C14	 79.38
TOP	   13    3	 79.38 C14	  C4	 79.38
BOT	    3   14	 70.10  C4	 C15	 70.10
TOP	   14    3	 70.10 C15	  C4	 70.10
BOT	    3   15	 84.54  C4	 C16	 84.54
TOP	   15    3	 84.54 C16	  C4	 84.54
BOT	    3   16	 82.47  C4	 C17	 82.47
TOP	   16    3	 82.47 C17	  C4	 82.47
BOT	    3   17	 80.41  C4	 C18	 80.41
TOP	   17    3	 80.41 C18	  C4	 80.41
BOT	    3   18	 80.41  C4	 C19	 80.41
TOP	   18    3	 80.41 C19	  C4	 80.41
BOT	    3   19	 81.44  C4	 C20	 81.44
TOP	   19    3	 81.44 C20	  C4	 81.44
BOT	    3   20	 81.05  C4	 C21	 81.05
TOP	   20    3	 81.05 C21	  C4	 81.05
BOT	    3   21	 82.47  C4	 C22	 82.47
TOP	   21    3	 82.47 C22	  C4	 82.47
BOT	    3   22	 81.44  C4	 C23	 81.44
TOP	   22    3	 81.44 C23	  C4	 81.44
BOT	    3   23	 82.47  C4	 C24	 82.47
TOP	   23    3	 82.47 C24	  C4	 82.47
BOT	    3   24	 80.41  C4	 C25	 80.41
TOP	   24    3	 80.41 C25	  C4	 80.41
BOT	    3   25	 82.47  C4	 C26	 82.47
TOP	   25    3	 82.47 C26	  C4	 82.47
BOT	    3   26	 79.38  C4	 C27	 79.38
TOP	   26    3	 79.38 C27	  C4	 79.38
BOT	    3   27	 85.42  C4	 C28	 85.42
TOP	   27    3	 85.42 C28	  C4	 85.42
BOT	    3   28	 79.38  C4	 C29	 79.38
TOP	   28    3	 79.38 C29	  C4	 79.38
BOT	    3   29	 84.54  C4	 C30	 84.54
TOP	   29    3	 84.54 C30	  C4	 84.54
BOT	    3   30	 81.44  C4	 C31	 81.44
TOP	   30    3	 81.44 C31	  C4	 81.44
BOT	    3   31	 84.54  C4	 C32	 84.54
TOP	   31    3	 84.54 C32	  C4	 84.54
BOT	    3   32	 82.47  C4	 C33	 82.47
TOP	   32    3	 82.47 C33	  C4	 82.47
BOT	    3   33	 81.44  C4	 C34	 81.44
TOP	   33    3	 81.44 C34	  C4	 81.44
BOT	    3   34	 80.85  C4	 C35	 80.85
TOP	   34    3	 80.85 C35	  C4	 80.85
BOT	    3   35	 81.44  C4	 C36	 81.44
TOP	   35    3	 81.44 C36	  C4	 81.44
BOT	    3   36	 78.35  C4	 C37	 78.35
TOP	   36    3	 78.35 C37	  C4	 78.35
BOT	    3   37	 79.38  C4	 C38	 79.38
TOP	   37    3	 79.38 C38	  C4	 79.38
BOT	    3   38	 81.44  C4	 C39	 81.44
TOP	   38    3	 81.44 C39	  C4	 81.44
BOT	    3   39	 75.26  C4	 C40	 75.26
TOP	   39    3	 75.26 C40	  C4	 75.26
BOT	    3   40	 85.57  C4	 C41	 85.57
TOP	   40    3	 85.57 C41	  C4	 85.57
BOT	    3   41	 80.41  C4	 C42	 80.41
TOP	   41    3	 80.41 C42	  C4	 80.41
BOT	    3   42	 79.38  C4	 C43	 79.38
TOP	   42    3	 79.38 C43	  C4	 79.38
BOT	    3   43	 86.32  C4	 C44	 86.32
TOP	   43    3	 86.32 C44	  C4	 86.32
BOT	    3   44	 84.38  C4	 C45	 84.38
TOP	   44    3	 84.38 C45	  C4	 84.38
BOT	    3   45	 83.51  C4	 C46	 83.51
TOP	   45    3	 83.51 C46	  C4	 83.51
BOT	    3   46	 83.51  C4	 C47	 83.51
TOP	   46    3	 83.51 C47	  C4	 83.51
BOT	    3   47	 81.44  C4	 C48	 81.44
TOP	   47    3	 81.44 C48	  C4	 81.44
BOT	    3   48	 81.44  C4	 C49	 81.44
TOP	   48    3	 81.44 C49	  C4	 81.44
BOT	    3   49	 80.41  C4	 C50	 80.41
TOP	   49    3	 80.41 C50	  C4	 80.41
BOT	    4    5	 85.71  C5	  C6	 85.71
TOP	    5    4	 85.71  C6	  C5	 85.71
BOT	    4    6	 87.76  C5	  C7	 87.76
TOP	    6    4	 87.76  C7	  C5	 87.76
BOT	    4    7	 86.73  C5	  C8	 86.73
TOP	    7    4	 86.73  C8	  C5	 86.73
BOT	    4    8	 85.71  C5	  C9	 85.71
TOP	    8    4	 85.71  C9	  C5	 85.71
BOT	    4    9	 90.82  C5	 C10	 90.82
TOP	    9    4	 90.82 C10	  C5	 90.82
BOT	    4   10	 84.69  C5	 C11	 84.69
TOP	   10    4	 84.69 C11	  C5	 84.69
BOT	    4   11	 85.71  C5	 C12	 85.71
TOP	   11    4	 85.71 C12	  C5	 85.71
BOT	    4   12	 85.71  C5	 C13	 85.71
TOP	   12    4	 85.71 C13	  C5	 85.71
BOT	    4   13	 85.71  C5	 C14	 85.71
TOP	   13    4	 85.71 C14	  C5	 85.71
BOT	    4   14	 77.55  C5	 C15	 77.55
TOP	   14    4	 77.55 C15	  C5	 77.55
BOT	    4   15	 86.73  C5	 C16	 86.73
TOP	   15    4	 86.73 C16	  C5	 86.73
BOT	    4   16	 86.73  C5	 C17	 86.73
TOP	   16    4	 86.73 C17	  C5	 86.73
BOT	    4   17	 83.67  C5	 C18	 83.67
TOP	   17    4	 83.67 C18	  C5	 83.67
BOT	    4   18	 86.73  C5	 C19	 86.73
TOP	   18    4	 86.73 C19	  C5	 86.73
BOT	    4   19	 83.33  C5	 C20	 83.33
TOP	   19    4	 83.33 C20	  C5	 83.33
BOT	    4   20	 84.38  C5	 C21	 84.38
TOP	   20    4	 84.38 C21	  C5	 84.38
BOT	    4   21	 84.69  C5	 C22	 84.69
TOP	   21    4	 84.69 C22	  C5	 84.69
BOT	    4   22	 86.73  C5	 C23	 86.73
TOP	   22    4	 86.73 C23	  C5	 86.73
BOT	    4   23	 85.71  C5	 C24	 85.71
TOP	   23    4	 85.71 C24	  C5	 85.71
BOT	    4   24	 82.65  C5	 C25	 82.65
TOP	   24    4	 82.65 C25	  C5	 82.65
BOT	    4   25	 86.73  C5	 C26	 86.73
TOP	   25    4	 86.73 C26	  C5	 86.73
BOT	    4   26	 80.61  C5	 C27	 80.61
TOP	   26    4	 80.61 C27	  C5	 80.61
BOT	    4   27	 89.69  C5	 C28	 89.69
TOP	   27    4	 89.69 C28	  C5	 89.69
BOT	    4   28	 83.67  C5	 C29	 83.67
TOP	   28    4	 83.67 C29	  C5	 83.67
BOT	    4   29	 83.67  C5	 C30	 83.67
TOP	   29    4	 83.67 C30	  C5	 83.67
BOT	    4   30	 84.69  C5	 C31	 84.69
TOP	   30    4	 84.69 C31	  C5	 84.69
BOT	    4   31	 86.73  C5	 C32	 86.73
TOP	   31    4	 86.73 C32	  C5	 86.73
BOT	    4   32	 82.65  C5	 C33	 82.65
TOP	   32    4	 82.65 C33	  C5	 82.65
BOT	    4   33	 83.67  C5	 C34	 83.67
TOP	   33    4	 83.67 C34	  C5	 83.67
BOT	    4   34	 84.21  C5	 C35	 84.21
TOP	   34    4	 84.21 C35	  C5	 84.21
BOT	    4   35	 84.69  C5	 C36	 84.69
TOP	   35    4	 84.69 C36	  C5	 84.69
BOT	    4   36	 79.59  C5	 C37	 79.59
TOP	   36    4	 79.59 C37	  C5	 79.59
BOT	    4   37	 83.67  C5	 C38	 83.67
TOP	   37    4	 83.67 C38	  C5	 83.67
BOT	    4   38	 86.73  C5	 C39	 86.73
TOP	   38    4	 86.73 C39	  C5	 86.73
BOT	    4   39	 81.63  C5	 C40	 81.63
TOP	   39    4	 81.63 C40	  C5	 81.63
BOT	    4   40	 88.78  C5	 C41	 88.78
TOP	   40    4	 88.78 C41	  C5	 88.78
BOT	    4   41	 81.63  C5	 C42	 81.63
TOP	   41    4	 81.63 C42	  C5	 81.63
BOT	    4   42	 81.63  C5	 C43	 81.63
TOP	   42    4	 81.63 C43	  C5	 81.63
BOT	    4   43	 89.58  C5	 C44	 89.58
TOP	   43    4	 89.58 C44	  C5	 89.58
BOT	    4   44	 87.63  C5	 C45	 87.63
TOP	   44    4	 87.63 C45	  C5	 87.63
BOT	    4   45	 86.73  C5	 C46	 86.73
TOP	   45    4	 86.73 C46	  C5	 86.73
BOT	    4   46	 86.73  C5	 C47	 86.73
TOP	   46    4	 86.73 C47	  C5	 86.73
BOT	    4   47	 86.73  C5	 C48	 86.73
TOP	   47    4	 86.73 C48	  C5	 86.73
BOT	    4   48	 86.73  C5	 C49	 86.73
TOP	   48    4	 86.73 C49	  C5	 86.73
BOT	    4   49	 82.65  C5	 C50	 82.65
TOP	   49    4	 82.65 C50	  C5	 82.65
BOT	    5    6	 87.76  C6	  C7	 87.76
TOP	    6    5	 87.76  C7	  C6	 87.76
BOT	    5    7	 90.82  C6	  C8	 90.82
TOP	    7    5	 90.82  C8	  C6	 90.82
BOT	    5    8	 87.76  C6	  C9	 87.76
TOP	    8    5	 87.76  C9	  C6	 87.76
BOT	    5    9	 87.76  C6	 C10	 87.76
TOP	    9    5	 87.76 C10	  C6	 87.76
BOT	    5   10	 85.71  C6	 C11	 85.71
TOP	   10    5	 85.71 C11	  C6	 85.71
BOT	    5   11	 83.67  C6	 C12	 83.67
TOP	   11    5	 83.67 C12	  C6	 83.67
BOT	    5   12	 83.67  C6	 C13	 83.67
TOP	   12    5	 83.67 C13	  C6	 83.67
BOT	    5   13	 85.71  C6	 C14	 85.71
TOP	   13    5	 85.71 C14	  C6	 85.71
BOT	    5   14	 74.49  C6	 C15	 74.49
TOP	   14    5	 74.49 C15	  C6	 74.49
BOT	    5   15	 89.80  C6	 C16	 89.80
TOP	   15    5	 89.80 C16	  C6	 89.80
BOT	    5   16	 91.84  C6	 C17	 91.84
TOP	   16    5	 91.84 C17	  C6	 91.84
BOT	    5   17	 88.78  C6	 C18	 88.78
TOP	   17    5	 88.78 C18	  C6	 88.78
BOT	    5   18	 86.73  C6	 C19	 86.73
TOP	   18    5	 86.73 C19	  C6	 86.73
BOT	    5   19	 83.33  C6	 C20	 83.33
TOP	   19    5	 83.33 C20	  C6	 83.33
BOT	    5   20	 82.29  C6	 C21	 82.29
TOP	   20    5	 82.29 C21	  C6	 82.29
BOT	    5   21	 82.65  C6	 C22	 82.65
TOP	   21    5	 82.65 C22	  C6	 82.65
BOT	    5   22	 84.69  C6	 C23	 84.69
TOP	   22    5	 84.69 C23	  C6	 84.69
BOT	    5   23	 87.76  C6	 C24	 87.76
TOP	   23    5	 87.76 C24	  C6	 87.76
BOT	    5   24	 83.67  C6	 C25	 83.67
TOP	   24    5	 83.67 C25	  C6	 83.67
BOT	    5   25	 86.73  C6	 C26	 86.73
TOP	   25    5	 86.73 C26	  C6	 86.73
BOT	    5   26	 84.69  C6	 C27	 84.69
TOP	   26    5	 84.69 C27	  C6	 84.69
BOT	    5   27	 89.69  C6	 C28	 89.69
TOP	   27    5	 89.69 C28	  C6	 89.69
BOT	    5   28	 82.65  C6	 C29	 82.65
TOP	   28    5	 82.65 C29	  C6	 82.65
BOT	    5   29	 86.73  C6	 C30	 86.73
TOP	   29    5	 86.73 C30	  C6	 86.73
BOT	    5   30	 83.67  C6	 C31	 83.67
TOP	   30    5	 83.67 C31	  C6	 83.67
BOT	    5   31	 87.76  C6	 C32	 87.76
TOP	   31    5	 87.76 C32	  C6	 87.76
BOT	    5   32	 88.78  C6	 C33	 88.78
TOP	   32    5	 88.78 C33	  C6	 88.78
BOT	    5   33	 87.76  C6	 C34	 87.76
TOP	   33    5	 87.76 C34	  C6	 87.76
BOT	    5   34	 83.16  C6	 C35	 83.16
TOP	   34    5	 83.16 C35	  C6	 83.16
BOT	    5   35	 86.73  C6	 C36	 86.73
TOP	   35    5	 86.73 C36	  C6	 86.73
BOT	    5   36	 84.69  C6	 C37	 84.69
TOP	   36    5	 84.69 C37	  C6	 84.69
BOT	    5   37	 86.73  C6	 C38	 86.73
TOP	   37    5	 86.73 C38	  C6	 86.73
BOT	    5   38	 86.73  C6	 C39	 86.73
TOP	   38    5	 86.73 C39	  C6	 86.73
BOT	    5   39	 81.63  C6	 C40	 81.63
TOP	   39    5	 81.63 C40	  C6	 81.63
BOT	    5   40	 85.71  C6	 C41	 85.71
TOP	   40    5	 85.71 C41	  C6	 85.71
BOT	    5   41	 82.65  C6	 C42	 82.65
TOP	   41    5	 82.65 C42	  C6	 82.65
BOT	    5   42	 86.73  C6	 C43	 86.73
TOP	   42    5	 86.73 C43	  C6	 86.73
BOT	    5   43	 87.50  C6	 C44	 87.50
TOP	   43    5	 87.50 C44	  C6	 87.50
BOT	    5   44	 86.60  C6	 C45	 86.60
TOP	   44    5	 86.60 C45	  C6	 86.60
BOT	    5   45	 84.69  C6	 C46	 84.69
TOP	   45    5	 84.69 C46	  C6	 84.69
BOT	    5   46	 82.65  C6	 C47	 82.65
TOP	   46    5	 82.65 C47	  C6	 82.65
BOT	    5   47	 86.73  C6	 C48	 86.73
TOP	   47    5	 86.73 C48	  C6	 86.73
BOT	    5   48	 90.82  C6	 C49	 90.82
TOP	   48    5	 90.82 C49	  C6	 90.82
BOT	    5   49	 84.69  C6	 C50	 84.69
TOP	   49    5	 84.69 C50	  C6	 84.69
BOT	    6    7	 90.82  C7	  C8	 90.82
TOP	    7    6	 90.82  C8	  C7	 90.82
BOT	    6    8	 93.88  C7	  C9	 93.88
TOP	    8    6	 93.88  C9	  C7	 93.88
BOT	    6    9	 93.88  C7	 C10	 93.88
TOP	    9    6	 93.88 C10	  C7	 93.88
BOT	    6   10	 90.82  C7	 C11	 90.82
TOP	   10    6	 90.82 C11	  C7	 90.82
BOT	    6   11	 88.78  C7	 C12	 88.78
TOP	   11    6	 88.78 C12	  C7	 88.78
BOT	    6   12	 86.73  C7	 C13	 86.73
TOP	   12    6	 86.73 C13	  C7	 86.73
BOT	    6   13	 92.86  C7	 C14	 92.86
TOP	   13    6	 92.86 C14	  C7	 92.86
BOT	    6   14	 79.59  C7	 C15	 79.59
TOP	   14    6	 79.59 C15	  C7	 79.59
BOT	    6   15	 90.82  C7	 C16	 90.82
TOP	   15    6	 90.82 C16	  C7	 90.82
BOT	    6   16	 91.84  C7	 C17	 91.84
TOP	   16    6	 91.84 C17	  C7	 91.84
BOT	    6   17	 87.76  C7	 C18	 87.76
TOP	   17    6	 87.76 C18	  C7	 87.76
BOT	    6   18	 88.78  C7	 C19	 88.78
TOP	   18    6	 88.78 C19	  C7	 88.78
BOT	    6   19	 85.42  C7	 C20	 85.42
TOP	   19    6	 85.42 C20	  C7	 85.42
BOT	    6   20	 82.29  C7	 C21	 82.29
TOP	   20    6	 82.29 C21	  C7	 82.29
BOT	    6   21	 83.67  C7	 C22	 83.67
TOP	   21    6	 83.67 C22	  C7	 83.67
BOT	    6   22	 90.82  C7	 C23	 90.82
TOP	   22    6	 90.82 C23	  C7	 90.82
BOT	    6   23	 89.80  C7	 C24	 89.80
TOP	   23    6	 89.80 C24	  C7	 89.80
BOT	    6   24	 86.73  C7	 C25	 86.73
TOP	   24    6	 86.73 C25	  C7	 86.73
BOT	    6   25	 89.80  C7	 C26	 89.80
TOP	   25    6	 89.80 C26	  C7	 89.80
BOT	    6   26	 88.78  C7	 C27	 88.78
TOP	   26    6	 88.78 C27	  C7	 88.78
BOT	    6   27	 90.72  C7	 C28	 90.72
TOP	   27    6	 90.72 C28	  C7	 90.72
BOT	    6   28	 88.78  C7	 C29	 88.78
TOP	   28    6	 88.78 C29	  C7	 88.78
BOT	    6   29	 85.71  C7	 C30	 85.71
TOP	   29    6	 85.71 C30	  C7	 85.71
BOT	    6   30	 82.65  C7	 C31	 82.65
TOP	   30    6	 82.65 C31	  C7	 82.65
BOT	    6   31	 89.80  C7	 C32	 89.80
TOP	   31    6	 89.80 C32	  C7	 89.80
BOT	    6   32	 86.73  C7	 C33	 86.73
TOP	   32    6	 86.73 C33	  C7	 86.73
BOT	    6   33	 87.76  C7	 C34	 87.76
TOP	   33    6	 87.76 C34	  C7	 87.76
BOT	    6   34	 89.47  C7	 C35	 89.47
TOP	   34    6	 89.47 C35	  C7	 89.47
BOT	    6   35	 89.80  C7	 C36	 89.80
TOP	   35    6	 89.80 C36	  C7	 89.80
BOT	    6   36	 83.67  C7	 C37	 83.67
TOP	   36    6	 83.67 C37	  C7	 83.67
BOT	    6   37	 87.76  C7	 C38	 87.76
TOP	   37    6	 87.76 C38	  C7	 87.76
BOT	    6   38	 92.86  C7	 C39	 92.86
TOP	   38    6	 92.86 C39	  C7	 92.86
BOT	    6   39	 87.76  C7	 C40	 87.76
TOP	   39    6	 87.76 C40	  C7	 87.76
BOT	    6   40	 87.76  C7	 C41	 87.76
TOP	   40    6	 87.76 C41	  C7	 87.76
BOT	    6   41	 90.82  C7	 C42	 90.82
TOP	   41    6	 90.82 C42	  C7	 90.82
BOT	    6   42	 84.69  C7	 C43	 84.69
TOP	   42    6	 84.69 C43	  C7	 84.69
BOT	    6   43	 92.71  C7	 C44	 92.71
TOP	   43    6	 92.71 C44	  C7	 92.71
BOT	    6   44	 91.75  C7	 C45	 91.75
TOP	   44    6	 91.75 C45	  C7	 91.75
BOT	    6   45	 89.80  C7	 C46	 89.80
TOP	   45    6	 89.80 C46	  C7	 89.80
BOT	    6   46	 88.78  C7	 C47	 88.78
TOP	   46    6	 88.78 C47	  C7	 88.78
BOT	    6   47	 88.78  C7	 C48	 88.78
TOP	   47    6	 88.78 C48	  C7	 88.78
BOT	    6   48	 90.82  C7	 C49	 90.82
TOP	   48    6	 90.82 C49	  C7	 90.82
BOT	    6   49	 92.86  C7	 C50	 92.86
TOP	   49    6	 92.86 C50	  C7	 92.86
BOT	    7    8	 90.82  C8	  C9	 90.82
TOP	    8    7	 90.82  C9	  C8	 90.82
BOT	    7    9	 88.78  C8	 C10	 88.78
TOP	    9    7	 88.78 C10	  C8	 88.78
BOT	    7   10	 84.69  C8	 C11	 84.69
TOP	   10    7	 84.69 C11	  C8	 84.69
BOT	    7   11	 88.78  C8	 C12	 88.78
TOP	   11    7	 88.78 C12	  C8	 88.78
BOT	    7   12	 87.76  C8	 C13	 87.76
TOP	   12    7	 87.76 C13	  C8	 87.76
BOT	    7   13	 87.76  C8	 C14	 87.76
TOP	   13    7	 87.76 C14	  C8	 87.76
BOT	    7   14	 77.55  C8	 C15	 77.55
TOP	   14    7	 77.55 C15	  C8	 77.55
BOT	    7   15	 90.82  C8	 C16	 90.82
TOP	   15    7	 90.82 C16	  C8	 90.82
BOT	    7   16	 90.82  C8	 C17	 90.82
TOP	   16    7	 90.82 C17	  C8	 90.82
BOT	    7   17	 86.73  C8	 C18	 86.73
TOP	   17    7	 86.73 C18	  C8	 86.73
BOT	    7   18	 88.78  C8	 C19	 88.78
TOP	   18    7	 88.78 C19	  C8	 88.78
BOT	    7   19	 83.33  C8	 C20	 83.33
TOP	   19    7	 83.33 C20	  C8	 83.33
BOT	    7   20	 81.25  C8	 C21	 81.25
TOP	   20    7	 81.25 C21	  C8	 81.25
BOT	    7   21	 83.67  C8	 C22	 83.67
TOP	   21    7	 83.67 C22	  C8	 83.67
BOT	    7   22	 87.76  C8	 C23	 87.76
TOP	   22    7	 87.76 C23	  C8	 87.76
BOT	    7   23	 86.73  C8	 C24	 86.73
TOP	   23    7	 86.73 C24	  C8	 86.73
BOT	    7   24	 84.69  C8	 C25	 84.69
TOP	   24    7	 84.69 C25	  C8	 84.69
BOT	    7   25	 89.80  C8	 C26	 89.80
TOP	   25    7	 89.80 C26	  C8	 89.80
BOT	    7   26	 88.78  C8	 C27	 88.78
TOP	   26    7	 88.78 C27	  C8	 88.78
BOT	    7   27	 92.78  C8	 C28	 92.78
TOP	   27    7	 92.78 C28	  C8	 92.78
BOT	    7   28	 85.71  C8	 C29	 85.71
TOP	   28    7	 85.71 C29	  C8	 85.71
BOT	    7   29	 87.76  C8	 C30	 87.76
TOP	   29    7	 87.76 C30	  C8	 87.76
BOT	    7   30	 81.63  C8	 C31	 81.63
TOP	   30    7	 81.63 C31	  C8	 81.63
BOT	    7   31	 89.80  C8	 C32	 89.80
TOP	   31    7	 89.80 C32	  C8	 89.80
BOT	    7   32	 85.71  C8	 C33	 85.71
TOP	   32    7	 85.71 C33	  C8	 85.71
BOT	    7   33	 91.84  C8	 C34	 91.84
TOP	   33    7	 91.84 C34	  C8	 91.84
BOT	    7   34	 88.42  C8	 C35	 88.42
TOP	   34    7	 88.42 C35	  C8	 88.42
BOT	    7   35	 87.76  C8	 C36	 87.76
TOP	   35    7	 87.76 C36	  C8	 87.76
BOT	    7   36	 86.73  C8	 C37	 86.73
TOP	   36    7	 86.73 C37	  C8	 86.73
BOT	    7   37	 86.73  C8	 C38	 86.73
TOP	   37    7	 86.73 C38	  C8	 86.73
BOT	    7   38	 91.84  C8	 C39	 91.84
TOP	   38    7	 91.84 C39	  C8	 91.84
BOT	    7   39	 85.71  C8	 C40	 85.71
TOP	   39    7	 85.71 C40	  C8	 85.71
BOT	    7   40	 88.78  C8	 C41	 88.78
TOP	   40    7	 88.78 C41	  C8	 88.78
BOT	    7   41	 84.69  C8	 C42	 84.69
TOP	   41    7	 84.69 C42	  C8	 84.69
BOT	    7   42	 85.71  C8	 C43	 85.71
TOP	   42    7	 85.71 C43	  C8	 85.71
BOT	    7   43	 92.71  C8	 C44	 92.71
TOP	   43    7	 92.71 C44	  C8	 92.71
BOT	    7   44	 91.75  C8	 C45	 91.75
TOP	   44    7	 91.75 C45	  C8	 91.75
BOT	    7   45	 89.80  C8	 C46	 89.80
TOP	   45    7	 89.80 C46	  C8	 89.80
BOT	    7   46	 84.69  C8	 C47	 84.69
TOP	   46    7	 84.69 C47	  C8	 84.69
BOT	    7   47	 84.69  C8	 C48	 84.69
TOP	   47    7	 84.69 C48	  C8	 84.69
BOT	    7   48	 90.82  C8	 C49	 90.82
TOP	   48    7	 90.82 C49	  C8	 90.82
BOT	    7   49	 87.76  C8	 C50	 87.76
TOP	   49    7	 87.76 C50	  C8	 87.76
BOT	    8    9	 91.84  C9	 C10	 91.84
TOP	    9    8	 91.84 C10	  C9	 91.84
BOT	    8   10	 89.80  C9	 C11	 89.80
TOP	   10    8	 89.80 C11	  C9	 89.80
BOT	    8   11	 90.82  C9	 C12	 90.82
TOP	   11    8	 90.82 C12	  C9	 90.82
BOT	    8   12	 85.71  C9	 C13	 85.71
TOP	   12    8	 85.71 C13	  C9	 85.71
BOT	    8   13	 89.80  C9	 C14	 89.80
TOP	   13    8	 89.80 C14	  C9	 89.80
BOT	    8   14	 77.55  C9	 C15	 77.55
TOP	   14    8	 77.55 C15	  C9	 77.55
BOT	    8   15	 92.86  C9	 C16	 92.86
TOP	   15    8	 92.86 C16	  C9	 92.86
BOT	    8   16	 91.84  C9	 C17	 91.84
TOP	   16    8	 91.84 C17	  C9	 91.84
BOT	    8   17	 88.78  C9	 C18	 88.78
TOP	   17    8	 88.78 C18	  C9	 88.78
BOT	    8   18	 88.78  C9	 C19	 88.78
TOP	   18    8	 88.78 C19	  C9	 88.78
BOT	    8   19	 87.50  C9	 C20	 87.50
TOP	   19    8	 87.50 C20	  C9	 87.50
BOT	    8   20	 82.29  C9	 C21	 82.29
TOP	   20    8	 82.29 C21	  C9	 82.29
BOT	    8   21	 83.67  C9	 C22	 83.67
TOP	   21    8	 83.67 C22	  C9	 83.67
BOT	    8   22	 88.78  C9	 C23	 88.78
TOP	   22    8	 88.78 C23	  C9	 88.78
BOT	    8   23	 89.80  C9	 C24	 89.80
TOP	   23    8	 89.80 C24	  C9	 89.80
BOT	    8   24	 89.80  C9	 C25	 89.80
TOP	   24    8	 89.80 C25	  C9	 89.80
BOT	    8   25	 90.82  C9	 C26	 90.82
TOP	   25    8	 90.82 C26	  C9	 90.82
BOT	    8   26	 86.73  C9	 C27	 86.73
TOP	   26    8	 86.73 C27	  C9	 86.73
BOT	    8   27	 90.72  C9	 C28	 90.72
TOP	   27    8	 90.72 C28	  C9	 90.72
BOT	    8   28	 88.78  C9	 C29	 88.78
TOP	   28    8	 88.78 C29	  C9	 88.78
BOT	    8   29	 84.69  C9	 C30	 84.69
TOP	   29    8	 84.69 C30	  C9	 84.69
BOT	    8   30	 82.65  C9	 C31	 82.65
TOP	   30    8	 82.65 C31	  C9	 82.65
BOT	    8   31	 90.82  C9	 C32	 90.82
TOP	   31    8	 90.82 C32	  C9	 90.82
BOT	    8   32	 87.76  C9	 C33	 87.76
TOP	   32    8	 87.76 C33	  C9	 87.76
BOT	    8   33	 86.73  C9	 C34	 86.73
TOP	   33    8	 86.73 C34	  C9	 86.73
BOT	    8   34	 87.37  C9	 C35	 87.37
TOP	   34    8	 87.37 C35	  C9	 87.37
BOT	    8   35	 91.84  C9	 C36	 91.84
TOP	   35    8	 91.84 C36	  C9	 91.84
BOT	    8   36	 85.71  C9	 C37	 85.71
TOP	   36    8	 85.71 C37	  C9	 85.71
BOT	    8   37	 88.78  C9	 C38	 88.78
TOP	   37    8	 88.78 C38	  C9	 88.78
BOT	    8   38	 94.90  C9	 C39	 94.90
TOP	   38    8	 94.90 C39	  C9	 94.90
BOT	    8   39	 87.76  C9	 C40	 87.76
TOP	   39    8	 87.76 C40	  C9	 87.76
BOT	    8   40	 87.76  C9	 C41	 87.76
TOP	   40    8	 87.76 C41	  C9	 87.76
BOT	    8   41	 88.78  C9	 C42	 88.78
TOP	   41    8	 88.78 C42	  C9	 88.78
BOT	    8   42	 83.67  C9	 C43	 83.67
TOP	   42    8	 83.67 C43	  C9	 83.67
BOT	    8   43	 91.67  C9	 C44	 91.67
TOP	   43    8	 91.67 C44	  C9	 91.67
BOT	    8   44	 91.75  C9	 C45	 91.75
TOP	   44    8	 91.75 C45	  C9	 91.75
BOT	    8   45	 91.84  C9	 C46	 91.84
TOP	   45    8	 91.84 C46	  C9	 91.84
BOT	    8   46	 87.76  C9	 C47	 87.76
TOP	   46    8	 87.76 C47	  C9	 87.76
BOT	    8   47	 87.76  C9	 C48	 87.76
TOP	   47    8	 87.76 C48	  C9	 87.76
BOT	    8   48	 90.82  C9	 C49	 90.82
TOP	   48    8	 90.82 C49	  C9	 90.82
BOT	    8   49	 88.78  C9	 C50	 88.78
TOP	   49    8	 88.78 C50	  C9	 88.78
BOT	    9   10	 87.76 C10	 C11	 87.76
TOP	   10    9	 87.76 C11	 C10	 87.76
BOT	    9   11	 89.80 C10	 C12	 89.80
TOP	   11    9	 89.80 C12	 C10	 89.80
BOT	    9   12	 89.80 C10	 C13	 89.80
TOP	   12    9	 89.80 C13	 C10	 89.80
BOT	    9   13	 91.84 C10	 C14	 91.84
TOP	   13    9	 91.84 C14	 C10	 91.84
BOT	    9   14	 79.59 C10	 C15	 79.59
TOP	   14    9	 79.59 C15	 C10	 79.59
BOT	    9   15	 91.84 C10	 C16	 91.84
TOP	   15    9	 91.84 C16	 C10	 91.84
BOT	    9   16	 90.82 C10	 C17	 90.82
TOP	   16    9	 90.82 C17	 C10	 90.82
BOT	    9   17	 88.78 C10	 C18	 88.78
TOP	   17    9	 88.78 C18	 C10	 88.78
BOT	    9   18	 88.78 C10	 C19	 88.78
TOP	   18    9	 88.78 C19	 C10	 88.78
BOT	    9   19	 87.50 C10	 C20	 87.50
TOP	   19    9	 87.50 C20	 C10	 87.50
BOT	    9   20	 86.46 C10	 C21	 86.46
TOP	   20    9	 86.46 C21	 C10	 86.46
BOT	    9   21	 87.76 C10	 C22	 87.76
TOP	   21    9	 87.76 C22	 C10	 87.76
BOT	    9   22	 89.80 C10	 C23	 89.80
TOP	   22    9	 89.80 C23	 C10	 89.80
BOT	    9   23	 90.82 C10	 C24	 90.82
TOP	   23    9	 90.82 C24	 C10	 90.82
BOT	    9   24	 84.69 C10	 C25	 84.69
TOP	   24    9	 84.69 C25	 C10	 84.69
BOT	    9   25	 92.86 C10	 C26	 92.86
TOP	   25    9	 92.86 C26	 C10	 92.86
BOT	    9   26	 84.69 C10	 C27	 84.69
TOP	   26    9	 84.69 C27	 C10	 84.69
BOT	    9   27	 91.75 C10	 C28	 91.75
TOP	   27    9	 91.75 C28	 C10	 91.75
BOT	    9   28	 87.76 C10	 C29	 87.76
TOP	   28    9	 87.76 C29	 C10	 87.76
BOT	    9   29	 87.76 C10	 C30	 87.76
TOP	   29    9	 87.76 C30	 C10	 87.76
BOT	    9   30	 86.73 C10	 C31	 86.73
TOP	   30    9	 86.73 C31	 C10	 86.73
BOT	    9   31	 88.78 C10	 C32	 88.78
TOP	   31    9	 88.78 C32	 C10	 88.78
BOT	    9   32	 87.76 C10	 C33	 87.76
TOP	   32    9	 87.76 C33	 C10	 87.76
BOT	    9   33	 86.73 C10	 C34	 86.73
TOP	   33    9	 86.73 C34	 C10	 86.73
BOT	    9   34	 88.42 C10	 C35	 88.42
TOP	   34    9	 88.42 C35	 C10	 88.42
BOT	    9   35	 89.80 C10	 C36	 89.80
TOP	   35    9	 89.80 C36	 C10	 89.80
BOT	    9   36	 83.67 C10	 C37	 83.67
TOP	   36    9	 83.67 C37	 C10	 83.67
BOT	    9   37	 88.78 C10	 C38	 88.78
TOP	   37    9	 88.78 C38	 C10	 88.78
BOT	    9   38	 90.82 C10	 C39	 90.82
TOP	   38    9	 90.82 C39	 C10	 90.82
BOT	    9   39	 86.73 C10	 C40	 86.73
TOP	   39    9	 86.73 C40	 C10	 86.73
BOT	    9   40	 90.82 C10	 C41	 90.82
TOP	   40    9	 90.82 C41	 C10	 90.82
BOT	    9   41	 87.76 C10	 C42	 87.76
TOP	   41    9	 87.76 C42	 C10	 87.76
BOT	    9   42	 84.69 C10	 C43	 84.69
TOP	   42    9	 84.69 C43	 C10	 84.69
BOT	    9   43	 91.67 C10	 C44	 91.67
TOP	   43    9	 91.67 C44	 C10	 91.67
BOT	    9   44	 90.72 C10	 C45	 90.72
TOP	   44    9	 90.72 C45	 C10	 90.72
BOT	    9   45	 90.82 C10	 C46	 90.82
TOP	   45    9	 90.82 C46	 C10	 90.82
BOT	    9   46	 87.76 C10	 C47	 87.76
TOP	   46    9	 87.76 C47	 C10	 87.76
BOT	    9   47	 87.76 C10	 C48	 87.76
TOP	   47    9	 87.76 C48	 C10	 87.76
BOT	    9   48	 90.82 C10	 C49	 90.82
TOP	   48    9	 90.82 C49	 C10	 90.82
BOT	    9   49	 87.76 C10	 C50	 87.76
TOP	   49    9	 87.76 C50	 C10	 87.76
BOT	   10   11	 83.67 C11	 C12	 83.67
TOP	   11   10	 83.67 C12	 C11	 83.67
BOT	   10   12	 84.69 C11	 C13	 84.69
TOP	   12   10	 84.69 C13	 C11	 84.69
BOT	   10   13	 87.76 C11	 C14	 87.76
TOP	   13   10	 87.76 C14	 C11	 87.76
BOT	   10   14	 76.53 C11	 C15	 76.53
TOP	   14   10	 76.53 C15	 C11	 76.53
BOT	   10   15	 85.71 C11	 C16	 85.71
TOP	   15   10	 85.71 C16	 C11	 85.71
BOT	   10   16	 87.76 C11	 C17	 87.76
TOP	   16   10	 87.76 C17	 C11	 87.76
BOT	   10   17	 83.67 C11	 C18	 83.67
TOP	   17   10	 83.67 C18	 C11	 83.67
BOT	   10   18	 82.65 C11	 C19	 82.65
TOP	   18   10	 82.65 C19	 C11	 82.65
BOT	   10   19	 86.46 C11	 C20	 86.46
TOP	   19   10	 86.46 C20	 C11	 86.46
BOT	   10   20	 81.25 C11	 C21	 81.25
TOP	   20   10	 81.25 C21	 C11	 81.25
BOT	   10   21	 81.63 C11	 C22	 81.63
TOP	   21   10	 81.63 C22	 C11	 81.63
BOT	   10   22	 86.73 C11	 C23	 86.73
TOP	   22   10	 86.73 C23	 C11	 86.73
BOT	   10   23	 89.80 C11	 C24	 89.80
TOP	   23   10	 89.80 C24	 C11	 89.80
BOT	   10   24	 88.78 C11	 C25	 88.78
TOP	   24   10	 88.78 C25	 C11	 88.78
BOT	   10   25	 83.67 C11	 C26	 83.67
TOP	   25   10	 83.67 C26	 C11	 83.67
BOT	   10   26	 83.67 C11	 C27	 83.67
TOP	   26   10	 83.67 C27	 C11	 83.67
BOT	   10   27	 86.60 C11	 C28	 86.60
TOP	   27   10	 86.60 C28	 C11	 86.60
BOT	   10   28	 82.65 C11	 C29	 82.65
TOP	   28   10	 82.65 C29	 C11	 82.65
BOT	   10   29	 83.67 C11	 C30	 83.67
TOP	   29   10	 83.67 C30	 C11	 83.67
BOT	   10   30	 81.63 C11	 C31	 81.63
TOP	   30   10	 81.63 C31	 C11	 81.63
BOT	   10   31	 89.80 C11	 C32	 89.80
TOP	   31   10	 89.80 C32	 C11	 89.80
BOT	   10   32	 83.67 C11	 C33	 83.67
TOP	   32   10	 83.67 C33	 C11	 83.67
BOT	   10   33	 84.69 C11	 C34	 84.69
TOP	   33   10	 84.69 C34	 C11	 84.69
BOT	   10   34	 86.32 C11	 C35	 86.32
TOP	   34   10	 86.32 C35	 C11	 86.32
BOT	   10   35	 85.71 C11	 C36	 85.71
TOP	   35   10	 85.71 C36	 C11	 85.71
BOT	   10   36	 79.59 C11	 C37	 79.59
TOP	   36   10	 79.59 C37	 C11	 79.59
BOT	   10   37	 82.65 C11	 C38	 82.65
TOP	   37   10	 82.65 C38	 C11	 82.65
BOT	   10   38	 86.73 C11	 C39	 86.73
TOP	   38   10	 86.73 C39	 C11	 86.73
BOT	   10   39	 83.67 C11	 C40	 83.67
TOP	   39   10	 83.67 C40	 C11	 83.67
BOT	   10   40	 86.73 C11	 C41	 86.73
TOP	   40   10	 86.73 C41	 C11	 86.73
BOT	   10   41	 83.67 C11	 C42	 83.67
TOP	   41   10	 83.67 C42	 C11	 83.67
BOT	   10   42	 82.65 C11	 C43	 82.65
TOP	   42   10	 82.65 C43	 C11	 82.65
BOT	   10   43	 87.50 C11	 C44	 87.50
TOP	   43   10	 87.50 C44	 C11	 87.50
BOT	   10   44	 86.60 C11	 C45	 86.60
TOP	   44   10	 86.60 C45	 C11	 86.60
BOT	   10   45	 84.69 C11	 C46	 84.69
TOP	   45   10	 84.69 C46	 C11	 84.69
BOT	   10   46	 89.80 C11	 C47	 89.80
TOP	   46   10	 89.80 C47	 C11	 89.80
BOT	   10   47	 89.80 C11	 C48	 89.80
TOP	   47   10	 89.80 C48	 C11	 89.80
BOT	   10   48	 85.71 C11	 C49	 85.71
TOP	   48   10	 85.71 C49	 C11	 85.71
BOT	   10   49	 84.69 C11	 C50	 84.69
TOP	   49   10	 84.69 C50	 C11	 84.69
BOT	   11   12	 85.71 C12	 C13	 85.71
TOP	   12   11	 85.71 C13	 C12	 85.71
BOT	   11   13	 88.78 C12	 C14	 88.78
TOP	   13   11	 88.78 C14	 C12	 88.78
BOT	   11   14	 80.61 C12	 C15	 80.61
TOP	   14   11	 80.61 C15	 C12	 80.61
BOT	   11   15	 90.82 C12	 C16	 90.82
TOP	   15   11	 90.82 C16	 C12	 90.82
BOT	   11   16	 85.71 C12	 C17	 85.71
TOP	   16   11	 85.71 C17	 C12	 85.71
BOT	   11   17	 83.67 C12	 C18	 83.67
TOP	   17   11	 83.67 C18	 C12	 83.67
BOT	   11   18	 86.73 C12	 C19	 86.73
TOP	   18   11	 86.73 C19	 C12	 86.73
BOT	   11   19	 87.50 C12	 C20	 87.50
TOP	   19   11	 87.50 C20	 C12	 87.50
BOT	   11   20	 83.33 C12	 C21	 83.33
TOP	   20   11	 83.33 C21	 C12	 83.33
BOT	   11   21	 85.71 C12	 C22	 85.71
TOP	   21   11	 85.71 C22	 C12	 85.71
BOT	   11   22	 87.76 C12	 C23	 87.76
TOP	   22   11	 87.76 C23	 C12	 87.76
BOT	   11   23	 92.86 C12	 C24	 92.86
TOP	   23   11	 92.86 C24	 C12	 92.86
BOT	   11   24	 85.71 C12	 C25	 85.71
TOP	   24   11	 85.71 C25	 C12	 85.71
BOT	   11   25	 90.82 C12	 C26	 90.82
TOP	   25   11	 90.82 C26	 C12	 90.82
BOT	   11   26	 83.67 C12	 C27	 83.67
TOP	   26   11	 83.67 C27	 C12	 83.67
BOT	   11   27	 92.78 C12	 C28	 92.78
TOP	   27   11	 92.78 C28	 C12	 92.78
BOT	   11   28	 92.86 C12	 C29	 92.86
TOP	   28   11	 92.86 C29	 C12	 92.86
BOT	   11   29	 84.69 C12	 C30	 84.69
TOP	   29   11	 84.69 C30	 C12	 84.69
BOT	   11   30	 83.67 C12	 C31	 83.67
TOP	   30   11	 83.67 C31	 C12	 83.67
BOT	   11   31	 91.84 C12	 C32	 91.84
TOP	   31   11	 91.84 C32	 C12	 91.84
BOT	   11   32	 82.65 C12	 C33	 82.65
TOP	   32   11	 82.65 C33	 C12	 82.65
BOT	   11   33	 85.71 C12	 C34	 85.71
TOP	   33   11	 85.71 C34	 C12	 85.71
BOT	   11   34	 86.32 C12	 C35	 86.32
TOP	   34   11	 86.32 C35	 C12	 86.32
BOT	   11   35	 86.73 C12	 C36	 86.73
TOP	   35   11	 86.73 C36	 C12	 86.73
BOT	   11   36	 83.67 C12	 C37	 83.67
TOP	   36   11	 83.67 C37	 C12	 83.67
BOT	   11   37	 83.67 C12	 C38	 83.67
TOP	   37   11	 83.67 C38	 C12	 83.67
BOT	   11   38	 90.82 C12	 C39	 90.82
TOP	   38   11	 90.82 C39	 C12	 90.82
BOT	   11   39	 87.76 C12	 C40	 87.76
TOP	   39   11	 87.76 C40	 C12	 87.76
BOT	   11   40	 87.76 C12	 C41	 87.76
TOP	   40   11	 87.76 C41	 C12	 87.76
BOT	   11   41	 87.76 C12	 C42	 87.76
TOP	   41   11	 87.76 C42	 C12	 87.76
BOT	   11   42	 81.63 C12	 C43	 81.63
TOP	   42   11	 81.63 C43	 C12	 81.63
BOT	   11   43	 93.75 C12	 C44	 93.75
TOP	   43   11	 93.75 C44	 C12	 93.75
BOT	   11   44	 92.78 C12	 C45	 92.78
TOP	   44   11	 92.78 C45	 C12	 92.78
BOT	   11   45	 96.94 C12	 C46	 96.94
TOP	   45   11	 96.94 C46	 C12	 96.94
BOT	   11   46	 87.76 C12	 C47	 87.76
TOP	   46   11	 87.76 C47	 C12	 87.76
BOT	   11   47	 82.65 C12	 C48	 82.65
TOP	   47   11	 82.65 C48	 C12	 82.65
BOT	   11   48	 85.71 C12	 C49	 85.71
TOP	   48   11	 85.71 C49	 C12	 85.71
BOT	   11   49	 87.76 C12	 C50	 87.76
TOP	   49   11	 87.76 C50	 C12	 87.76
BOT	   12   13	 84.69 C13	 C14	 84.69
TOP	   13   12	 84.69 C14	 C13	 84.69
BOT	   12   14	 76.53 C13	 C15	 76.53
TOP	   14   12	 76.53 C15	 C13	 76.53
BOT	   12   15	 85.71 C13	 C16	 85.71
TOP	   15   12	 85.71 C16	 C13	 85.71
BOT	   12   16	 85.71 C13	 C17	 85.71
TOP	   16   12	 85.71 C17	 C13	 85.71
BOT	   12   17	 84.69 C13	 C18	 84.69
TOP	   17   12	 84.69 C18	 C13	 84.69
BOT	   12   18	 88.78 C13	 C19	 88.78
TOP	   18   12	 88.78 C19	 C13	 88.78
BOT	   12   19	 81.25 C13	 C20	 81.25
TOP	   19   12	 81.25 C20	 C13	 81.25
BOT	   12   20	 90.62 C13	 C21	 90.62
TOP	   20   12	 90.62 C21	 C13	 90.62
BOT	   12   21	 90.82 C13	 C22	 90.82
TOP	   21   12	 90.82 C22	 C13	 90.82
BOT	   12   22	 89.80 C13	 C23	 89.80
TOP	   22   12	 89.80 C23	 C13	 89.80
BOT	   12   23	 86.73 C13	 C24	 86.73
TOP	   23   12	 86.73 C24	 C13	 86.73
BOT	   12   24	 80.61 C13	 C25	 80.61
TOP	   24   12	 80.61 C25	 C13	 80.61
BOT	   12   25	 86.73 C13	 C26	 86.73
TOP	   25   12	 86.73 C26	 C13	 86.73
BOT	   12   26	 82.65 C13	 C27	 82.65
TOP	   26   12	 82.65 C27	 C13	 82.65
BOT	   12   27	 88.66 C13	 C28	 88.66
TOP	   27   12	 88.66 C28	 C13	 88.66
BOT	   12   28	 82.65 C13	 C29	 82.65
TOP	   28   12	 82.65 C29	 C13	 82.65
BOT	   12   29	 92.86 C13	 C30	 92.86
TOP	   29   12	 92.86 C30	 C13	 92.86
BOT	   12   30	 89.80 C13	 C31	 89.80
TOP	   30   12	 89.80 C31	 C13	 89.80
BOT	   12   31	 86.73 C13	 C32	 86.73
TOP	   31   12	 86.73 C32	 C13	 86.73
BOT	   12   32	 82.65 C13	 C33	 82.65
TOP	   32   12	 82.65 C33	 C13	 82.65
BOT	   12   33	 83.67 C13	 C34	 83.67
TOP	   33   12	 83.67 C34	 C13	 83.67
BOT	   12   34	 88.42 C13	 C35	 88.42
TOP	   34   12	 88.42 C35	 C13	 88.42
BOT	   12   35	 83.67 C13	 C36	 83.67
TOP	   35   12	 83.67 C36	 C13	 83.67
BOT	   12   36	 81.63 C13	 C37	 81.63
TOP	   36   12	 81.63 C37	 C13	 81.63
BOT	   12   37	 83.67 C13	 C38	 83.67
TOP	   37   12	 83.67 C38	 C13	 83.67
BOT	   12   38	 85.71 C13	 C39	 85.71
TOP	   38   12	 85.71 C39	 C13	 85.71
BOT	   12   39	 82.65 C13	 C40	 82.65
TOP	   39   12	 82.65 C40	 C13	 82.65
BOT	   12   40	 93.88 C13	 C41	 93.88
TOP	   40   12	 93.88 C41	 C13	 93.88
BOT	   12   41	 81.63 C13	 C42	 81.63
TOP	   41   12	 81.63 C42	 C13	 81.63
BOT	   12   42	 85.71 C13	 C43	 85.71
TOP	   42   12	 85.71 C43	 C13	 85.71
BOT	   12   43	 89.58 C13	 C44	 89.58
TOP	   43   12	 89.58 C44	 C13	 89.58
BOT	   12   44	 86.60 C13	 C45	 86.60
TOP	   44   12	 86.60 C45	 C13	 86.60
BOT	   12   45	 86.73 C13	 C46	 86.73
TOP	   45   12	 86.73 C46	 C13	 86.73
BOT	   12   46	 83.67 C13	 C47	 83.67
TOP	   46   12	 83.67 C47	 C13	 83.67
BOT	   12   47	 81.63 C13	 C48	 81.63
TOP	   47   12	 81.63 C48	 C13	 81.63
BOT	   12   48	 85.71 C13	 C49	 85.71
TOP	   48   12	 85.71 C49	 C13	 85.71
BOT	   12   49	 81.63 C13	 C50	 81.63
TOP	   49   12	 81.63 C50	 C13	 81.63
BOT	   13   14	 80.61 C14	 C15	 80.61
TOP	   14   13	 80.61 C15	 C14	 80.61
BOT	   13   15	 87.76 C14	 C16	 87.76
TOP	   15   13	 87.76 C16	 C14	 87.76
BOT	   13   16	 88.78 C14	 C17	 88.78
TOP	   16   13	 88.78 C17	 C14	 88.78
BOT	   13   17	 84.69 C14	 C18	 84.69
TOP	   17   13	 84.69 C18	 C14	 84.69
BOT	   13   18	 85.71 C14	 C19	 85.71
TOP	   18   13	 85.71 C19	 C14	 85.71
BOT	   13   19	 85.42 C14	 C20	 85.42
TOP	   19   13	 85.42 C20	 C14	 85.42
BOT	   13   20	 81.25 C14	 C21	 81.25
TOP	   20   13	 81.25 C21	 C14	 81.25
BOT	   13   21	 82.65 C14	 C22	 82.65
TOP	   21   13	 82.65 C22	 C14	 82.65
BOT	   13   22	 90.82 C14	 C23	 90.82
TOP	   22   13	 90.82 C23	 C14	 90.82
BOT	   13   23	 88.78 C14	 C24	 88.78
TOP	   23   13	 88.78 C24	 C14	 88.78
BOT	   13   24	 84.69 C14	 C25	 84.69
TOP	   24   13	 84.69 C25	 C14	 84.69
BOT	   13   25	 87.76 C14	 C26	 87.76
TOP	   25   13	 87.76 C26	 C14	 87.76
BOT	   13   26	 86.73 C14	 C27	 86.73
TOP	   26   13	 86.73 C27	 C14	 86.73
BOT	   13   27	 88.66 C14	 C28	 88.66
TOP	   27   13	 88.66 C28	 C14	 88.66
BOT	   13   28	 86.73 C14	 C29	 86.73
TOP	   28   13	 86.73 C29	 C14	 86.73
BOT	   13   29	 83.67 C14	 C30	 83.67
TOP	   29   13	 83.67 C30	 C14	 83.67
BOT	   13   30	 81.63 C14	 C31	 81.63
TOP	   30   13	 81.63 C31	 C14	 81.63
BOT	   13   31	 88.78 C14	 C32	 88.78
TOP	   31   13	 88.78 C32	 C14	 88.78
BOT	   13   32	 84.69 C14	 C33	 84.69
TOP	   32   13	 84.69 C33	 C14	 84.69
BOT	   13   33	 86.73 C14	 C34	 86.73
TOP	   33   13	 86.73 C34	 C14	 86.73
BOT	   13   34	 90.53 C14	 C35	 90.53
TOP	   34   13	 90.53 C35	 C14	 90.53
BOT	   13   35	 89.80 C14	 C36	 89.80
TOP	   35   13	 89.80 C36	 C14	 89.80
BOT	   13   36	 82.65 C14	 C37	 82.65
TOP	   36   13	 82.65 C37	 C14	 82.65
BOT	   13   37	 84.69 C14	 C38	 84.69
TOP	   37   13	 84.69 C38	 C14	 84.69
BOT	   13   38	 89.80 C14	 C39	 89.80
TOP	   38   13	 89.80 C39	 C14	 89.80
BOT	   13   39	 89.80 C14	 C40	 89.80
TOP	   39   13	 89.80 C40	 C14	 89.80
BOT	   13   40	 85.71 C14	 C41	 85.71
TOP	   40   13	 85.71 C41	 C14	 85.71
BOT	   13   41	 85.71 C14	 C42	 85.71
TOP	   41   13	 85.71 C42	 C14	 85.71
BOT	   13   42	 82.65 C14	 C43	 82.65
TOP	   42   13	 82.65 C43	 C14	 82.65
BOT	   13   43	 88.54 C14	 C44	 88.54
TOP	   43   13	 88.54 C44	 C14	 88.54
BOT	   13   44	 88.66 C14	 C45	 88.66
TOP	   44   13	 88.66 C45	 C14	 88.66
BOT	   13   45	 87.76 C14	 C46	 87.76
TOP	   45   13	 87.76 C46	 C14	 87.76
BOT	   13   46	 86.73 C14	 C47	 86.73
TOP	   46   13	 86.73 C47	 C14	 86.73
BOT	   13   47	 86.73 C14	 C48	 86.73
TOP	   47   13	 86.73 C48	 C14	 86.73
BOT	   13   48	 89.80 C14	 C49	 89.80
TOP	   48   13	 89.80 C49	 C14	 89.80
BOT	   13   49	 88.78 C14	 C50	 88.78
TOP	   49   13	 88.78 C50	 C14	 88.78
BOT	   14   15	 77.55 C15	 C16	 77.55
TOP	   15   14	 77.55 C16	 C15	 77.55
BOT	   14   16	 76.53 C15	 C17	 76.53
TOP	   16   14	 76.53 C17	 C15	 76.53
BOT	   14   17	 75.51 C15	 C18	 75.51
TOP	   17   14	 75.51 C18	 C15	 75.51
BOT	   14   18	 79.59 C15	 C19	 79.59
TOP	   18   14	 79.59 C19	 C15	 79.59
BOT	   14   19	 75.00 C15	 C20	 75.00
TOP	   19   14	 75.00 C20	 C15	 75.00
BOT	   14   20	 73.96 C15	 C21	 73.96
TOP	   20   14	 73.96 C21	 C15	 73.96
BOT	   14   21	 77.55 C15	 C22	 77.55
TOP	   21   14	 77.55 C22	 C15	 77.55
BOT	   14   22	 78.57 C15	 C23	 78.57
TOP	   22   14	 78.57 C23	 C15	 78.57
BOT	   14   23	 80.61 C15	 C24	 80.61
TOP	   23   14	 80.61 C24	 C15	 80.61
BOT	   14   24	 73.47 C15	 C25	 73.47
TOP	   24   14	 73.47 C25	 C15	 73.47
BOT	   14   25	 79.59 C15	 C26	 79.59
TOP	   25   14	 79.59 C26	 C15	 79.59
BOT	   14   26	 74.49 C15	 C27	 74.49
TOP	   26   14	 74.49 C27	 C15	 74.49
BOT	   14   27	 78.35 C15	 C28	 78.35
TOP	   27   14	 78.35 C28	 C15	 78.35
BOT	   14   28	 79.59 C15	 C29	 79.59
TOP	   28   14	 79.59 C29	 C15	 79.59
BOT	   14   29	 73.47 C15	 C30	 73.47
TOP	   29   14	 73.47 C30	 C15	 73.47
BOT	   14   30	 75.51 C15	 C31	 75.51
TOP	   30   14	 75.51 C31	 C15	 75.51
BOT	   14   31	 79.59 C15	 C32	 79.59
TOP	   31   14	 79.59 C32	 C15	 79.59
BOT	   14   32	 74.49 C15	 C33	 74.49
TOP	   32   14	 74.49 C33	 C15	 74.49
BOT	   14   33	 77.55 C15	 C34	 77.55
TOP	   33   14	 77.55 C34	 C15	 77.55
BOT	   14   34	 77.89 C15	 C35	 77.89
TOP	   34   14	 77.89 C35	 C15	 77.89
BOT	   14   35	 78.57 C15	 C36	 78.57
TOP	   35   14	 78.57 C36	 C15	 78.57
BOT	   14   36	 73.47 C15	 C37	 73.47
TOP	   36   14	 73.47 C37	 C15	 73.47
BOT	   14   37	 75.51 C15	 C38	 75.51
TOP	   37   14	 75.51 C38	 C15	 75.51
BOT	   14   38	 77.55 C15	 C39	 77.55
TOP	   38   14	 77.55 C39	 C15	 77.55
BOT	   14   39	 74.49 C15	 C40	 74.49
TOP	   39   14	 74.49 C40	 C15	 74.49
BOT	   14   40	 79.59 C15	 C41	 79.59
TOP	   40   14	 79.59 C41	 C15	 79.59
BOT	   14   41	 74.49 C15	 C42	 74.49
TOP	   41   14	 74.49 C42	 C15	 74.49
BOT	   14   42	 75.51 C15	 C43	 75.51
TOP	   42   14	 75.51 C43	 C15	 75.51
BOT	   14   43	 80.21 C15	 C44	 80.21
TOP	   43   14	 80.21 C44	 C15	 80.21
BOT	   14   44	 79.38 C15	 C45	 79.38
TOP	   44   14	 79.38 C45	 C15	 79.38
BOT	   14   45	 79.59 C15	 C46	 79.59
TOP	   45   14	 79.59 C46	 C15	 79.59
BOT	   14   46	 80.61 C15	 C47	 80.61
TOP	   46   14	 80.61 C47	 C15	 80.61
BOT	   14   47	 75.51 C15	 C48	 75.51
TOP	   47   14	 75.51 C48	 C15	 75.51
BOT	   14   48	 76.53 C15	 C49	 76.53
TOP	   48   14	 76.53 C49	 C15	 76.53
BOT	   14   49	 79.59 C15	 C50	 79.59
TOP	   49   14	 79.59 C50	 C15	 79.59
BOT	   15   16	 92.86 C16	 C17	 92.86
TOP	   16   15	 92.86 C17	 C16	 92.86
BOT	   15   17	 92.86 C16	 C18	 92.86
TOP	   17   15	 92.86 C18	 C16	 92.86
BOT	   15   18	 89.80 C16	 C19	 89.80
TOP	   18   15	 89.80 C19	 C16	 89.80
BOT	   15   19	 89.58 C16	 C20	 89.58
TOP	   19   15	 89.58 C20	 C16	 89.58
BOT	   15   20	 82.29 C16	 C21	 82.29
TOP	   20   15	 82.29 C21	 C16	 82.29
BOT	   15   21	 83.67 C16	 C22	 83.67
TOP	   21   15	 83.67 C22	 C16	 83.67
BOT	   15   22	 85.71 C16	 C23	 85.71
TOP	   22   15	 85.71 C23	 C16	 85.71
BOT	   15   23	 92.86 C16	 C24	 92.86
TOP	   23   15	 92.86 C24	 C16	 92.86
BOT	   15   24	 88.78 C16	 C25	 88.78
TOP	   24   15	 88.78 C25	 C16	 88.78
BOT	   15   25	 92.86 C16	 C26	 92.86
TOP	   25   15	 92.86 C26	 C16	 92.86
BOT	   15   26	 86.73 C16	 C27	 86.73
TOP	   26   15	 86.73 C27	 C16	 86.73
BOT	   15   27	 91.75 C16	 C28	 91.75
TOP	   27   15	 91.75 C28	 C16	 91.75
BOT	   15   28	 90.82 C16	 C29	 90.82
TOP	   28   15	 90.82 C29	 C16	 90.82
BOT	   15   29	 84.69 C16	 C30	 84.69
TOP	   29   15	 84.69 C30	 C16	 84.69
BOT	   15   30	 82.65 C16	 C31	 82.65
TOP	   30   15	 82.65 C31	 C16	 82.65
BOT	   15   31	 90.82 C16	 C32	 90.82
TOP	   31   15	 90.82 C32	 C16	 90.82
BOT	   15   32	 90.82 C16	 C33	 90.82
TOP	   32   15	 90.82 C33	 C16	 90.82
BOT	   15   33	 89.80 C16	 C34	 89.80
TOP	   33   15	 89.80 C34	 C16	 89.80
BOT	   15   34	 85.26 C16	 C35	 85.26
TOP	   34   15	 85.26 C35	 C16	 85.26
BOT	   15   35	 91.84 C16	 C36	 91.84
TOP	   35   15	 91.84 C36	 C16	 91.84
BOT	   15   36	 84.69 C16	 C37	 84.69
TOP	   36   15	 84.69 C37	 C16	 84.69
BOT	   15   37	 91.84 C16	 C38	 91.84
TOP	   37   15	 91.84 C38	 C16	 91.84
BOT	   15   38	 92.86 C16	 C39	 92.86
TOP	   38   15	 92.86 C39	 C16	 92.86
BOT	   15   39	 84.69 C16	 C40	 84.69
TOP	   39   15	 84.69 C40	 C16	 84.69
BOT	   15   40	 87.76 C16	 C41	 87.76
TOP	   40   15	 87.76 C41	 C16	 87.76
BOT	   15   41	 87.76 C16	 C42	 87.76
TOP	   41   15	 87.76 C42	 C16	 87.76
BOT	   15   42	 84.69 C16	 C43	 84.69
TOP	   42   15	 84.69 C43	 C16	 84.69
BOT	   15   43	 94.79 C16	 C44	 94.79
TOP	   43   15	 94.79 C44	 C16	 94.79
BOT	   15   44	 91.75 C16	 C45	 91.75
TOP	   44   15	 91.75 C45	 C16	 91.75
BOT	   15   45	 91.84 C16	 C46	 91.84
TOP	   45   15	 91.84 C46	 C16	 91.84
BOT	   15   46	 86.73 C16	 C47	 86.73
TOP	   46   15	 86.73 C47	 C16	 86.73
BOT	   15   47	 85.71 C16	 C48	 85.71
TOP	   47   15	 85.71 C48	 C16	 85.71
BOT	   15   48	 91.84 C16	 C49	 91.84
TOP	   48   15	 91.84 C49	 C16	 91.84
BOT	   15   49	 87.76 C16	 C50	 87.76
TOP	   49   15	 87.76 C50	 C16	 87.76
BOT	   16   17	 92.86 C17	 C18	 92.86
TOP	   17   16	 92.86 C18	 C17	 92.86
BOT	   16   18	 87.76 C17	 C19	 87.76
TOP	   18   16	 87.76 C19	 C17	 87.76
BOT	   16   19	 84.38 C17	 C20	 84.38
TOP	   19   16	 84.38 C20	 C17	 84.38
BOT	   16   20	 82.29 C17	 C21	 82.29
TOP	   20   16	 82.29 C21	 C17	 82.29
BOT	   16   21	 83.67 C17	 C22	 83.67
TOP	   21   16	 83.67 C22	 C17	 83.67
BOT	   16   22	 87.76 C17	 C23	 87.76
TOP	   22   16	 87.76 C23	 C17	 87.76
BOT	   16   23	 88.78 C17	 C24	 88.78
TOP	   23   16	 88.78 C24	 C17	 88.78
BOT	   16   24	 84.69 C17	 C25	 84.69
TOP	   24   16	 84.69 C25	 C17	 84.69
BOT	   16   25	 88.78 C17	 C26	 88.78
TOP	   25   16	 88.78 C26	 C17	 88.78
BOT	   16   26	 85.71 C17	 C27	 85.71
TOP	   26   16	 85.71 C27	 C17	 85.71
BOT	   16   27	 91.75 C17	 C28	 91.75
TOP	   27   16	 91.75 C28	 C17	 91.75
BOT	   16   28	 85.71 C17	 C29	 85.71
TOP	   28   16	 85.71 C29	 C17	 85.71
BOT	   16   29	 84.69 C17	 C30	 84.69
TOP	   29   16	 84.69 C30	 C17	 84.69
BOT	   16   30	 82.65 C17	 C31	 82.65
TOP	   30   16	 82.65 C31	 C17	 82.65
BOT	   16   31	 89.80 C17	 C32	 89.80
TOP	   31   16	 89.80 C32	 C17	 89.80
BOT	   16   32	 88.78 C17	 C33	 88.78
TOP	   32   16	 88.78 C33	 C17	 88.78
BOT	   16   33	 88.78 C17	 C34	 88.78
TOP	   33   16	 88.78 C34	 C17	 88.78
BOT	   16   34	 86.32 C17	 C35	 86.32
TOP	   34   16	 86.32 C35	 C17	 86.32
BOT	   16   35	 89.80 C17	 C36	 89.80
TOP	   35   16	 89.80 C36	 C17	 89.80
BOT	   16   36	 85.71 C17	 C37	 85.71
TOP	   36   16	 85.71 C37	 C17	 85.71
BOT	   16   37	 89.80 C17	 C38	 89.80
TOP	   37   16	 89.80 C38	 C17	 89.80
BOT	   16   38	 90.82 C17	 C39	 90.82
TOP	   38   16	 90.82 C39	 C17	 90.82
BOT	   16   39	 83.67 C17	 C40	 83.67
TOP	   39   16	 83.67 C40	 C17	 83.67
BOT	   16   40	 88.78 C17	 C41	 88.78
TOP	   40   16	 88.78 C41	 C17	 88.78
BOT	   16   41	 84.69 C17	 C42	 84.69
TOP	   41   16	 84.69 C42	 C17	 84.69
BOT	   16   42	 86.73 C17	 C43	 86.73
TOP	   42   16	 86.73 C43	 C17	 86.73
BOT	   16   43	 89.58 C17	 C44	 89.58
TOP	   43   16	 89.58 C44	 C17	 89.58
BOT	   16   44	 88.66 C17	 C45	 88.66
TOP	   44   16	 88.66 C45	 C17	 88.66
BOT	   16   45	 86.73 C17	 C46	 86.73
TOP	   45   16	 86.73 C46	 C17	 86.73
BOT	   16   46	 84.69 C17	 C47	 84.69
TOP	   46   16	 84.69 C47	 C17	 84.69
BOT	   16   47	 87.76 C17	 C48	 87.76
TOP	   47   16	 87.76 C48	 C17	 87.76
BOT	   16   48	 92.86 C17	 C49	 92.86
TOP	   48   16	 92.86 C49	 C17	 92.86
BOT	   16   49	 86.73 C17	 C50	 86.73
TOP	   49   16	 86.73 C50	 C17	 86.73
BOT	   17   18	 89.80 C18	 C19	 89.80
TOP	   18   17	 89.80 C19	 C18	 89.80
BOT	   17   19	 82.29 C18	 C20	 82.29
TOP	   19   17	 82.29 C20	 C18	 82.29
BOT	   17   20	 80.21 C18	 C21	 80.21
TOP	   20   17	 80.21 C21	 C18	 80.21
BOT	   17   21	 81.63 C18	 C22	 81.63
TOP	   21   17	 81.63 C22	 C18	 81.63
BOT	   17   22	 83.67 C18	 C23	 83.67
TOP	   22   17	 83.67 C23	 C18	 83.67
BOT	   17   23	 86.73 C18	 C24	 86.73
TOP	   23   17	 86.73 C24	 C18	 86.73
BOT	   17   24	 81.63 C18	 C25	 81.63
TOP	   24   17	 81.63 C25	 C18	 81.63
BOT	   17   25	 86.73 C18	 C26	 86.73
TOP	   25   17	 86.73 C26	 C18	 86.73
BOT	   17   26	 85.71 C18	 C27	 85.71
TOP	   26   17	 85.71 C27	 C18	 85.71
BOT	   17   27	 88.66 C18	 C28	 88.66
TOP	   27   17	 88.66 C28	 C18	 88.66
BOT	   17   28	 83.67 C18	 C29	 83.67
TOP	   28   17	 83.67 C29	 C18	 83.67
BOT	   17   29	 81.63 C18	 C30	 81.63
TOP	   29   17	 81.63 C30	 C18	 81.63
BOT	   17   30	 80.61 C18	 C31	 80.61
TOP	   30   17	 80.61 C31	 C18	 80.61
BOT	   17   31	 85.71 C18	 C32	 85.71
TOP	   31   17	 85.71 C32	 C18	 85.71
BOT	   17   32	 89.80 C18	 C33	 89.80
TOP	   32   17	 89.80 C33	 C18	 89.80
BOT	   17   33	 87.76 C18	 C34	 87.76
TOP	   33   17	 87.76 C34	 C18	 87.76
BOT	   17   34	 82.11 C18	 C35	 82.11
TOP	   34   17	 82.11 C35	 C18	 82.11
BOT	   17   35	 87.76 C18	 C36	 87.76
TOP	   35   17	 87.76 C36	 C18	 87.76
BOT	   17   36	 80.61 C18	 C37	 80.61
TOP	   36   17	 80.61 C37	 C18	 80.61
BOT	   17   37	 92.86 C18	 C38	 92.86
TOP	   37   17	 92.86 C38	 C18	 92.86
BOT	   17   38	 87.76 C18	 C39	 87.76
TOP	   38   17	 87.76 C39	 C18	 87.76
BOT	   17   39	 79.59 C18	 C40	 79.59
TOP	   39   17	 79.59 C40	 C18	 79.59
BOT	   17   40	 85.71 C18	 C41	 85.71
TOP	   40   17	 85.71 C41	 C18	 85.71
BOT	   17   41	 82.65 C18	 C42	 82.65
TOP	   41   17	 82.65 C42	 C18	 82.65
BOT	   17   42	 86.73 C18	 C43	 86.73
TOP	   42   17	 86.73 C43	 C18	 86.73
BOT	   17   43	 87.50 C18	 C44	 87.50
TOP	   43   17	 87.50 C44	 C18	 87.50
BOT	   17   44	 86.60 C18	 C45	 86.60
TOP	   44   17	 86.60 C45	 C18	 86.60
BOT	   17   45	 84.69 C18	 C46	 84.69
TOP	   45   17	 84.69 C46	 C18	 84.69
BOT	   17   46	 82.65 C18	 C47	 82.65
TOP	   46   17	 82.65 C47	 C18	 82.65
BOT	   17   47	 82.65 C18	 C48	 82.65
TOP	   47   17	 82.65 C48	 C18	 82.65
BOT	   17   48	 91.84 C18	 C49	 91.84
TOP	   48   17	 91.84 C49	 C18	 91.84
BOT	   17   49	 82.65 C18	 C50	 82.65
TOP	   49   17	 82.65 C50	 C18	 82.65
BOT	   18   19	 82.29 C19	 C20	 82.29
TOP	   19   18	 82.29 C20	 C19	 82.29
BOT	   18   20	 83.33 C19	 C21	 83.33
TOP	   20   18	 83.33 C21	 C19	 83.33
BOT	   18   21	 83.67 C19	 C22	 83.67
TOP	   21   18	 83.67 C22	 C19	 83.67
BOT	   18   22	 84.69 C19	 C23	 84.69
TOP	   22   18	 84.69 C23	 C19	 84.69
BOT	   18   23	 86.73 C19	 C24	 86.73
TOP	   23   18	 86.73 C24	 C19	 86.73
BOT	   18   24	 81.63 C19	 C25	 81.63
TOP	   24   18	 81.63 C25	 C19	 81.63
BOT	   18   25	 88.78 C19	 C26	 88.78
TOP	   25   18	 88.78 C26	 C19	 88.78
BOT	   18   26	 85.71 C19	 C27	 85.71
TOP	   26   18	 85.71 C27	 C19	 85.71
BOT	   18   27	 88.66 C19	 C28	 88.66
TOP	   27   18	 88.66 C28	 C19	 88.66
BOT	   18   28	 85.71 C19	 C29	 85.71
TOP	   28   18	 85.71 C29	 C19	 85.71
BOT	   18   29	 84.69 C19	 C30	 84.69
TOP	   29   18	 84.69 C30	 C19	 84.69
BOT	   18   30	 82.65 C19	 C31	 82.65
TOP	   30   18	 82.65 C31	 C19	 82.65
BOT	   18   31	 85.71 C19	 C32	 85.71
TOP	   31   18	 85.71 C32	 C19	 85.71
BOT	   18   32	 86.73 C19	 C33	 86.73
TOP	   32   18	 86.73 C33	 C19	 86.73
BOT	   18   33	 85.71 C19	 C34	 85.71
TOP	   33   18	 85.71 C34	 C19	 85.71
BOT	   18   34	 85.26 C19	 C35	 85.26
TOP	   34   18	 85.26 C35	 C19	 85.26
BOT	   18   35	 88.78 C19	 C36	 88.78
TOP	   35   18	 88.78 C36	 C19	 88.78
BOT	   18   36	 82.65 C19	 C37	 82.65
TOP	   36   18	 82.65 C37	 C19	 82.65
BOT	   18   37	 89.80 C19	 C38	 89.80
TOP	   37   18	 89.80 C38	 C19	 89.80
BOT	   18   38	 88.78 C19	 C39	 88.78
TOP	   38   18	 88.78 C39	 C19	 88.78
BOT	   18   39	 83.67 C19	 C40	 83.67
TOP	   39   18	 83.67 C40	 C19	 83.67
BOT	   18   40	 86.73 C19	 C41	 86.73
TOP	   40   18	 86.73 C41	 C19	 86.73
BOT	   18   41	 84.69 C19	 C42	 84.69
TOP	   41   18	 84.69 C42	 C19	 84.69
BOT	   18   42	 84.69 C19	 C43	 84.69
TOP	   42   18	 84.69 C43	 C19	 84.69
BOT	   18   43	 90.62 C19	 C44	 90.62
TOP	   43   18	 90.62 C44	 C19	 90.62
BOT	   18   44	 87.63 C19	 C45	 87.63
TOP	   44   18	 87.63 C45	 C19	 87.63
BOT	   18   45	 87.76 C19	 C46	 87.76
TOP	   45   18	 87.76 C46	 C19	 87.76
BOT	   18   46	 85.71 C19	 C47	 85.71
TOP	   46   18	 85.71 C47	 C19	 85.71
BOT	   18   47	 82.65 C19	 C48	 82.65
TOP	   47   18	 82.65 C48	 C19	 82.65
BOT	   18   48	 89.80 C19	 C49	 89.80
TOP	   48   18	 89.80 C49	 C19	 89.80
BOT	   18   49	 85.71 C19	 C50	 85.71
TOP	   49   18	 85.71 C50	 C19	 85.71
BOT	   19   20	 77.66 C20	 C21	 77.66
TOP	   20   19	 77.66 C21	 C20	 77.66
BOT	   19   21	 79.17 C20	 C22	 79.17
TOP	   21   19	 79.17 C22	 C20	 79.17
BOT	   19   22	 82.29 C20	 C23	 82.29
TOP	   22   19	 82.29 C23	 C20	 82.29
BOT	   19   23	 90.62 C20	 C24	 90.62
TOP	   23   19	 90.62 C24	 C20	 90.62
BOT	   19   24	 86.46 C20	 C25	 86.46
TOP	   24   19	 86.46 C25	 C20	 86.46
BOT	   19   25	 87.50 C20	 C26	 87.50
TOP	   25   19	 87.50 C26	 C20	 87.50
BOT	   19   26	 82.29 C20	 C27	 82.29
TOP	   26   19	 82.29 C27	 C20	 82.29
BOT	   19   27	 86.32 C20	 C28	 86.32
TOP	   27   19	 86.32 C28	 C20	 86.32
BOT	   19   28	 85.42 C20	 C29	 85.42
TOP	   28   19	 85.42 C29	 C20	 85.42
BOT	   19   29	 80.21 C20	 C30	 80.21
TOP	   29   19	 80.21 C30	 C20	 80.21
BOT	   19   30	 79.17 C20	 C31	 79.17
TOP	   30   19	 79.17 C31	 C20	 79.17
BOT	   19   31	 86.46 C20	 C32	 86.46
TOP	   31   19	 86.46 C32	 C20	 86.46
BOT	   19   32	 85.42 C20	 C33	 85.42
TOP	   32   19	 85.42 C33	 C20	 85.42
BOT	   19   33	 84.38 C20	 C34	 84.38
TOP	   33   19	 84.38 C34	 C20	 84.38
BOT	   19   34	 80.65 C20	 C35	 80.65
TOP	   34   19	 80.65 C35	 C20	 80.65
BOT	   19   35	 86.46 C20	 C36	 86.46
TOP	   35   19	 86.46 C36	 C20	 86.46
BOT	   19   36	 81.25 C20	 C37	 81.25
TOP	   36   19	 81.25 C37	 C20	 81.25
BOT	   19   37	 82.29 C20	 C38	 82.29
TOP	   37   19	 82.29 C38	 C20	 82.29
BOT	   19   38	 85.42 C20	 C39	 85.42
TOP	   38   19	 85.42 C39	 C20	 85.42
BOT	   19   39	 82.29 C20	 C40	 82.29
TOP	   39   19	 82.29 C40	 C20	 82.29
BOT	   19   40	 84.38 C20	 C41	 84.38
TOP	   40   19	 84.38 C41	 C20	 84.38
BOT	   19   41	 84.38 C20	 C42	 84.38
TOP	   41   19	 84.38 C42	 C20	 84.38
BOT	   19   42	 80.21 C20	 C43	 80.21
TOP	   42   19	 80.21 C43	 C20	 80.21
BOT	   19   43	 89.36 C20	 C44	 89.36
TOP	   43   19	 89.36 C44	 C20	 89.36
BOT	   19   44	 86.32 C20	 C45	 86.32
TOP	   44   19	 86.32 C45	 C20	 86.32
BOT	   19   45	 89.58 C20	 C46	 89.58
TOP	   45   19	 89.58 C46	 C20	 89.58
BOT	   19   46	 89.58 C20	 C47	 89.58
TOP	   46   19	 89.58 C47	 C20	 89.58
BOT	   19   47	 87.50 C20	 C48	 87.50
TOP	   47   19	 87.50 C48	 C20	 87.50
BOT	   19   48	 84.38 C20	 C49	 84.38
TOP	   48   19	 84.38 C49	 C20	 84.38
BOT	   19   49	 83.33 C20	 C50	 83.33
TOP	   49   19	 83.33 C50	 C20	 83.33
BOT	   20   21	 93.75 C21	 C22	 93.75
TOP	   21   20	 93.75 C22	 C21	 93.75
BOT	   20   22	 85.42 C21	 C23	 85.42
TOP	   22   20	 85.42 C23	 C21	 85.42
BOT	   20   23	 84.38 C21	 C24	 84.38
TOP	   23   20	 84.38 C24	 C21	 84.38
BOT	   20   24	 78.12 C21	 C25	 78.12
TOP	   24   20	 78.12 C25	 C21	 78.12
BOT	   20   25	 84.38 C21	 C26	 84.38
TOP	   25   20	 84.38 C26	 C21	 84.38
BOT	   20   26	 77.08 C21	 C27	 77.08
TOP	   26   20	 77.08 C27	 C21	 77.08
BOT	   20   27	 85.42 C21	 C28	 85.42
TOP	   27   20	 85.42 C28	 C21	 85.42
BOT	   20   28	 79.17 C21	 C29	 79.17
TOP	   28   20	 79.17 C29	 C21	 79.17
BOT	   20   29	 90.62 C21	 C30	 90.62
TOP	   29   20	 90.62 C30	 C21	 90.62
BOT	   20   30	 92.71 C21	 C31	 92.71
TOP	   30   20	 92.71 C31	 C21	 92.71
BOT	   20   31	 84.38 C21	 C32	 84.38
TOP	   31   20	 84.38 C32	 C21	 84.38
BOT	   20   32	 79.17 C21	 C33	 79.17
TOP	   32   20	 79.17 C33	 C21	 79.17
BOT	   20   33	 79.17 C21	 C34	 79.17
TOP	   33   20	 79.17 C34	 C21	 79.17
BOT	   20   34	 83.33 C21	 C35	 83.33
TOP	   34   20	 83.33 C35	 C21	 83.33
BOT	   20   35	 80.21 C21	 C36	 80.21
TOP	   35   20	 80.21 C36	 C21	 80.21
BOT	   20   36	 79.17 C21	 C37	 79.17
TOP	   36   20	 79.17 C37	 C21	 79.17
BOT	   20   37	 81.25 C21	 C38	 81.25
TOP	   37   20	 81.25 C38	 C21	 81.25
BOT	   20   38	 82.29 C21	 C39	 82.29
TOP	   38   20	 82.29 C39	 C21	 82.29
BOT	   20   39	 78.12 C21	 C40	 78.12
TOP	   39   20	 78.12 C40	 C21	 78.12
BOT	   20   40	 90.62 C21	 C41	 90.62
TOP	   40   20	 90.62 C41	 C21	 90.62
BOT	   20   41	 77.08 C21	 C42	 77.08
TOP	   41   20	 77.08 C42	 C21	 77.08
BOT	   20   42	 81.25 C21	 C43	 81.25
TOP	   42   20	 81.25 C43	 C21	 81.25
BOT	   20   43	 85.42 C21	 C44	 85.42
TOP	   43   20	 85.42 C44	 C21	 85.42
BOT	   20   44	 84.38 C21	 C45	 84.38
TOP	   44   20	 84.38 C45	 C21	 84.38
BOT	   20   45	 84.38 C21	 C46	 84.38
TOP	   45   20	 84.38 C46	 C21	 84.38
BOT	   20   46	 82.29 C21	 C47	 82.29
TOP	   46   20	 82.29 C47	 C21	 82.29
BOT	   20   47	 80.21 C21	 C48	 80.21
TOP	   47   20	 80.21 C48	 C21	 80.21
BOT	   20   48	 81.25 C21	 C49	 81.25
TOP	   48   20	 81.25 C49	 C21	 81.25
BOT	   20   49	 78.12 C21	 C50	 78.12
TOP	   49   20	 78.12 C50	 C21	 78.12
BOT	   21   22	 87.76 C22	 C23	 87.76
TOP	   22   21	 87.76 C23	 C22	 87.76
BOT	   21   23	 85.71 C22	 C24	 85.71
TOP	   23   21	 85.71 C24	 C22	 85.71
BOT	   21   24	 78.57 C22	 C25	 78.57
TOP	   24   21	 78.57 C25	 C22	 78.57
BOT	   21   25	 86.73 C22	 C26	 86.73
TOP	   25   21	 86.73 C26	 C22	 86.73
BOT	   21   26	 77.55 C22	 C27	 77.55
TOP	   26   21	 77.55 C27	 C22	 77.55
BOT	   21   27	 86.60 C22	 C28	 86.60
TOP	   27   21	 86.60 C28	 C22	 86.60
BOT	   21   28	 81.63 C22	 C29	 81.63
TOP	   28   21	 81.63 C29	 C22	 81.63
BOT	   21   29	 90.82 C22	 C30	 90.82
TOP	   29   21	 90.82 C30	 C22	 90.82
BOT	   21   30	 92.86 C22	 C31	 92.86
TOP	   30   21	 92.86 C31	 C22	 92.86
BOT	   21   31	 86.73 C22	 C32	 86.73
TOP	   31   21	 86.73 C32	 C22	 86.73
BOT	   21   32	 79.59 C22	 C33	 79.59
TOP	   32   21	 79.59 C33	 C22	 79.59
BOT	   21   33	 80.61 C22	 C34	 80.61
TOP	   33   21	 80.61 C34	 C22	 80.61
BOT	   21   34	 83.16 C22	 C35	 83.16
TOP	   34   21	 83.16 C35	 C22	 83.16
BOT	   21   35	 82.65 C22	 C36	 82.65
TOP	   35   21	 82.65 C36	 C22	 82.65
BOT	   21   36	 82.65 C22	 C37	 82.65
TOP	   36   21	 82.65 C37	 C22	 82.65
BOT	   21   37	 82.65 C22	 C38	 82.65
TOP	   37   21	 82.65 C38	 C22	 82.65
BOT	   21   38	 83.67 C22	 C39	 83.67
TOP	   38   21	 83.67 C39	 C22	 83.67
BOT	   21   39	 78.57 C22	 C40	 78.57
TOP	   39   21	 78.57 C40	 C22	 78.57
BOT	   21   40	 92.86 C22	 C41	 92.86
TOP	   40   21	 92.86 C41	 C22	 92.86
BOT	   21   41	 79.59 C22	 C42	 79.59
TOP	   41   21	 79.59 C42	 C22	 79.59
BOT	   21   42	 81.63 C22	 C43	 81.63
TOP	   42   21	 81.63 C43	 C22	 81.63
BOT	   21   43	 86.46 C22	 C44	 86.46
TOP	   43   21	 86.46 C44	 C22	 86.46
BOT	   21   44	 86.60 C22	 C45	 86.60
TOP	   44   21	 86.60 C45	 C22	 86.60
BOT	   21   45	 85.71 C22	 C46	 85.71
TOP	   45   21	 85.71 C46	 C22	 85.71
BOT	   21   46	 83.67 C22	 C47	 83.67
TOP	   46   21	 83.67 C47	 C22	 83.67
BOT	   21   47	 81.63 C22	 C48	 81.63
TOP	   47   21	 81.63 C48	 C22	 81.63
BOT	   21   48	 82.65 C22	 C49	 82.65
TOP	   48   21	 82.65 C49	 C22	 82.65
BOT	   21   49	 80.61 C22	 C50	 80.61
TOP	   49   21	 80.61 C50	 C22	 80.61
BOT	   22   23	 85.71 C23	 C24	 85.71
TOP	   23   22	 85.71 C24	 C23	 85.71
BOT	   22   24	 83.67 C23	 C25	 83.67
TOP	   24   22	 83.67 C25	 C23	 83.67
BOT	   22   25	 87.76 C23	 C26	 87.76
TOP	   25   22	 87.76 C26	 C23	 87.76
BOT	   22   26	 82.65 C23	 C27	 82.65
TOP	   26   22	 82.65 C27	 C23	 82.65
BOT	   22   27	 88.66 C23	 C28	 88.66
TOP	   27   22	 88.66 C28	 C23	 88.66
BOT	   22   28	 84.69 C23	 C29	 84.69
TOP	   28   22	 84.69 C29	 C23	 84.69
BOT	   22   29	 88.78 C23	 C30	 88.78
TOP	   29   22	 88.78 C30	 C23	 88.78
BOT	   22   30	 85.71 C23	 C31	 85.71
TOP	   30   22	 85.71 C31	 C23	 85.71
BOT	   22   31	 88.78 C23	 C32	 88.78
TOP	   31   22	 88.78 C32	 C23	 88.78
BOT	   22   32	 81.63 C23	 C33	 81.63
TOP	   32   22	 81.63 C33	 C23	 81.63
BOT	   22   33	 84.69 C23	 C34	 84.69
TOP	   33   22	 84.69 C34	 C23	 84.69
BOT	   22   34	 86.32 C23	 C35	 86.32
TOP	   34   22	 86.32 C35	 C23	 86.32
BOT	   22   35	 85.71 C23	 C36	 85.71
TOP	   35   22	 85.71 C36	 C23	 85.71
BOT	   22   36	 83.67 C23	 C37	 83.67
TOP	   36   22	 83.67 C37	 C23	 83.67
BOT	   22   37	 82.65 C23	 C38	 82.65
TOP	   37   22	 82.65 C38	 C23	 82.65
BOT	   22   38	 88.78 C23	 C39	 88.78
TOP	   38   22	 88.78 C39	 C23	 88.78
BOT	   22   39	 85.71 C23	 C40	 85.71
TOP	   39   22	 85.71 C40	 C23	 85.71
BOT	   22   40	 90.82 C23	 C41	 90.82
TOP	   40   22	 90.82 C41	 C23	 90.82
BOT	   22   41	 84.69 C23	 C42	 84.69
TOP	   41   22	 84.69 C42	 C23	 84.69
BOT	   22   42	 80.61 C23	 C43	 80.61
TOP	   42   22	 80.61 C43	 C23	 80.61
BOT	   22   43	 87.50 C23	 C44	 87.50
TOP	   43   22	 87.50 C44	 C23	 87.50
BOT	   22   44	 88.66 C23	 C45	 88.66
TOP	   44   22	 88.66 C45	 C23	 88.66
BOT	   22   45	 86.73 C23	 C46	 86.73
TOP	   45   22	 86.73 C46	 C23	 86.73
BOT	   22   46	 83.67 C23	 C47	 83.67
TOP	   46   22	 83.67 C47	 C23	 83.67
BOT	   22   47	 83.67 C23	 C48	 83.67
TOP	   47   22	 83.67 C48	 C23	 83.67
BOT	   22   48	 85.71 C23	 C49	 85.71
TOP	   48   22	 85.71 C49	 C23	 85.71
BOT	   22   49	 87.76 C23	 C50	 87.76
TOP	   49   22	 87.76 C50	 C23	 87.76
BOT	   23   24	 88.78 C24	 C25	 88.78
TOP	   24   23	 88.78 C25	 C24	 88.78
BOT	   23   25	 91.84 C24	 C26	 91.84
TOP	   25   23	 91.84 C26	 C24	 91.84
BOT	   23   26	 84.69 C24	 C27	 84.69
TOP	   26   23	 84.69 C27	 C24	 84.69
BOT	   23   27	 91.75 C24	 C28	 91.75
TOP	   27   23	 91.75 C28	 C24	 91.75
BOT	   23   28	 89.80 C24	 C29	 89.80
TOP	   28   23	 89.80 C29	 C24	 89.80
BOT	   23   29	 85.71 C24	 C30	 85.71
TOP	   29   23	 85.71 C30	 C24	 85.71
BOT	   23   30	 85.71 C24	 C31	 85.71
TOP	   30   23	 85.71 C31	 C24	 85.71
BOT	   23   31	 90.82 C24	 C32	 90.82
TOP	   31   23	 90.82 C32	 C24	 90.82
BOT	   23   32	 85.71 C24	 C33	 85.71
TOP	   32   23	 85.71 C33	 C24	 85.71
BOT	   23   33	 86.73 C24	 C34	 86.73
TOP	   33   23	 86.73 C34	 C24	 86.73
BOT	   23   34	 85.26 C24	 C35	 85.26
TOP	   34   23	 85.26 C35	 C24	 85.26
BOT	   23   35	 88.78 C24	 C36	 88.78
TOP	   35   23	 88.78 C36	 C24	 88.78
BOT	   23   36	 82.65 C24	 C37	 82.65
TOP	   36   23	 82.65 C37	 C24	 82.65
BOT	   23   37	 85.71 C24	 C38	 85.71
TOP	   37   23	 85.71 C38	 C24	 85.71
BOT	   23   38	 88.78 C24	 C39	 88.78
TOP	   38   23	 88.78 C39	 C24	 88.78
BOT	   23   39	 85.71 C24	 C40	 85.71
TOP	   39   23	 85.71 C40	 C24	 85.71
BOT	   23   40	 88.78 C24	 C41	 88.78
TOP	   40   23	 88.78 C41	 C24	 88.78
BOT	   23   41	 87.76 C24	 C42	 87.76
TOP	   41   23	 87.76 C42	 C24	 87.76
BOT	   23   42	 86.73 C24	 C43	 86.73
TOP	   42   23	 86.73 C43	 C24	 86.73
BOT	   23   43	 93.75 C24	 C44	 93.75
TOP	   43   23	 93.75 C44	 C24	 93.75
BOT	   23   44	 89.69 C24	 C45	 89.69
TOP	   44   23	 89.69 C45	 C24	 89.69
BOT	   23   45	 93.88 C24	 C46	 93.88
TOP	   45   23	 93.88 C46	 C24	 93.88
BOT	   23   46	 88.78 C24	 C47	 88.78
TOP	   46   23	 88.78 C47	 C24	 88.78
BOT	   23   47	 87.76 C24	 C48	 87.76
TOP	   47   23	 87.76 C48	 C24	 87.76
BOT	   23   48	 87.76 C24	 C49	 87.76
TOP	   48   23	 87.76 C49	 C24	 87.76
BOT	   23   49	 85.71 C24	 C50	 85.71
TOP	   49   23	 85.71 C50	 C24	 85.71
BOT	   24   25	 85.71 C25	 C26	 85.71
TOP	   25   24	 85.71 C26	 C25	 85.71
BOT	   24   26	 82.65 C25	 C27	 82.65
TOP	   26   24	 82.65 C27	 C25	 82.65
BOT	   24   27	 85.57 C25	 C28	 85.57
TOP	   27   24	 85.57 C28	 C25	 85.57
BOT	   24   28	 84.69 C25	 C29	 84.69
TOP	   28   24	 84.69 C29	 C25	 84.69
BOT	   24   29	 81.63 C25	 C30	 81.63
TOP	   29   24	 81.63 C30	 C25	 81.63
BOT	   24   30	 79.59 C25	 C31	 79.59
TOP	   30   24	 79.59 C31	 C25	 79.59
BOT	   24   31	 88.78 C25	 C32	 88.78
TOP	   31   24	 88.78 C32	 C25	 88.78
BOT	   24   32	 83.67 C25	 C33	 83.67
TOP	   32   24	 83.67 C33	 C25	 83.67
BOT	   24   33	 83.67 C25	 C34	 83.67
TOP	   33   24	 83.67 C34	 C25	 83.67
BOT	   24   34	 81.05 C25	 C35	 81.05
TOP	   34   24	 81.05 C35	 C25	 81.05
BOT	   24   35	 86.73 C25	 C36	 86.73
TOP	   35   24	 86.73 C36	 C25	 86.73
BOT	   24   36	 79.59 C25	 C37	 79.59
TOP	   36   24	 79.59 C37	 C25	 79.59
BOT	   24   37	 81.63 C25	 C38	 81.63
TOP	   37   24	 81.63 C38	 C25	 81.63
BOT	   24   38	 87.76 C25	 C39	 87.76
TOP	   38   24	 87.76 C39	 C25	 87.76
BOT	   24   39	 82.65 C25	 C40	 82.65
TOP	   39   24	 82.65 C40	 C25	 82.65
BOT	   24   40	 82.65 C25	 C41	 82.65
TOP	   40   24	 82.65 C41	 C25	 82.65
BOT	   24   41	 81.63 C25	 C42	 81.63
TOP	   41   24	 81.63 C42	 C25	 81.63
BOT	   24   42	 80.61 C25	 C43	 80.61
TOP	   42   24	 80.61 C43	 C25	 80.61
BOT	   24   43	 89.58 C25	 C44	 89.58
TOP	   43   24	 89.58 C44	 C25	 89.58
BOT	   24   44	 86.60 C25	 C45	 86.60
TOP	   44   24	 86.60 C45	 C25	 86.60
BOT	   24   45	 87.76 C25	 C46	 87.76
TOP	   45   24	 87.76 C46	 C25	 87.76
BOT	   24   46	 86.73 C25	 C47	 86.73
TOP	   46   24	 86.73 C47	 C25	 86.73
BOT	   24   47	 86.73 C25	 C48	 86.73
TOP	   47   24	 86.73 C48	 C25	 86.73
BOT	   24   48	 83.67 C25	 C49	 83.67
TOP	   48   24	 83.67 C49	 C25	 83.67
BOT	   24   49	 84.69 C25	 C50	 84.69
TOP	   49   24	 84.69 C50	 C25	 84.69
BOT	   25   26	 82.65 C26	 C27	 82.65
TOP	   26   25	 82.65 C27	 C26	 82.65
BOT	   25   27	 90.72 C26	 C28	 90.72
TOP	   27   25	 90.72 C28	 C26	 90.72
BOT	   25   28	 88.78 C26	 C29	 88.78
TOP	   28   25	 88.78 C29	 C26	 88.78
BOT	   25   29	 85.71 C26	 C30	 85.71
TOP	   29   25	 85.71 C30	 C26	 85.71
BOT	   25   30	 84.69 C26	 C31	 84.69
TOP	   30   25	 84.69 C31	 C26	 84.69
BOT	   25   31	 88.78 C26	 C32	 88.78
TOP	   31   25	 88.78 C32	 C26	 88.78
BOT	   25   32	 85.71 C26	 C33	 85.71
TOP	   32   25	 85.71 C33	 C26	 85.71
BOT	   25   33	 86.73 C26	 C34	 86.73
TOP	   33   25	 86.73 C34	 C26	 86.73
BOT	   25   34	 84.21 C26	 C35	 84.21
TOP	   34   25	 84.21 C35	 C26	 84.21
BOT	   25   35	 88.78 C26	 C36	 88.78
TOP	   35   25	 88.78 C36	 C26	 88.78
BOT	   25   36	 86.73 C26	 C37	 86.73
TOP	   36   25	 86.73 C37	 C26	 86.73
BOT	   25   37	 86.73 C26	 C38	 86.73
TOP	   37   25	 86.73 C38	 C26	 86.73
BOT	   25   38	 88.78 C26	 C39	 88.78
TOP	   38   25	 88.78 C39	 C26	 88.78
BOT	   25   39	 84.69 C26	 C40	 84.69
TOP	   39   25	 84.69 C40	 C26	 84.69
BOT	   25   40	 89.80 C26	 C41	 89.80
TOP	   40   25	 89.80 C41	 C26	 89.80
BOT	   25   41	 87.76 C26	 C42	 87.76
TOP	   41   25	 87.76 C42	 C26	 87.76
BOT	   25   42	 82.65 C26	 C43	 82.65
TOP	   42   25	 82.65 C43	 C26	 82.65
BOT	   25   43	 92.71 C26	 C44	 92.71
TOP	   43   25	 92.71 C44	 C26	 92.71
BOT	   25   44	 90.72 C26	 C45	 90.72
TOP	   44   25	 90.72 C45	 C26	 90.72
BOT	   25   45	 91.84 C26	 C46	 91.84
TOP	   45   25	 91.84 C46	 C26	 91.84
BOT	   25   46	 86.73 C26	 C47	 86.73
TOP	   46   25	 86.73 C47	 C26	 86.73
BOT	   25   47	 83.67 C26	 C48	 83.67
TOP	   47   25	 83.67 C48	 C26	 83.67
BOT	   25   48	 87.76 C26	 C49	 87.76
TOP	   48   25	 87.76 C49	 C26	 87.76
BOT	   25   49	 87.76 C26	 C50	 87.76
TOP	   49   25	 87.76 C50	 C26	 87.76
BOT	   26   27	 84.54 C27	 C28	 84.54
TOP	   27   26	 84.54 C28	 C27	 84.54
BOT	   26   28	 81.63 C27	 C29	 81.63
TOP	   28   26	 81.63 C29	 C27	 81.63
BOT	   26   29	 79.59 C27	 C30	 79.59
TOP	   29   26	 79.59 C30	 C27	 79.59
BOT	   26   30	 77.55 C27	 C31	 77.55
TOP	   30   26	 77.55 C31	 C27	 77.55
BOT	   26   31	 83.67 C27	 C32	 83.67
TOP	   31   26	 83.67 C32	 C27	 83.67
BOT	   26   32	 83.67 C27	 C33	 83.67
TOP	   32   26	 83.67 C33	 C27	 83.67
BOT	   26   33	 88.78 C27	 C34	 88.78
TOP	   33   26	 88.78 C34	 C27	 88.78
BOT	   26   34	 87.37 C27	 C35	 87.37
TOP	   34   26	 87.37 C35	 C27	 87.37
BOT	   26   35	 86.73 C27	 C36	 86.73
TOP	   35   26	 86.73 C36	 C27	 86.73
BOT	   26   36	 78.57 C27	 C37	 78.57
TOP	   36   26	 78.57 C37	 C27	 78.57
BOT	   26   37	 83.67 C27	 C38	 83.67
TOP	   37   26	 83.67 C38	 C27	 83.67
BOT	   26   38	 88.78 C27	 C39	 88.78
TOP	   38   26	 88.78 C39	 C27	 88.78
BOT	   26   39	 83.67 C27	 C40	 83.67
TOP	   39   26	 83.67 C40	 C27	 83.67
BOT	   26   40	 83.67 C27	 C41	 83.67
TOP	   40   26	 83.67 C41	 C27	 83.67
BOT	   26   41	 81.63 C27	 C42	 81.63
TOP	   41   26	 81.63 C42	 C27	 81.63
BOT	   26   42	 85.71 C27	 C43	 85.71
TOP	   42   26	 85.71 C43	 C27	 85.71
BOT	   26   43	 88.54 C27	 C44	 88.54
TOP	   43   26	 88.54 C44	 C27	 88.54
BOT	   26   44	 84.54 C27	 C45	 84.54
TOP	   44   26	 84.54 C45	 C27	 84.54
BOT	   26   45	 84.69 C27	 C46	 84.69
TOP	   45   26	 84.69 C46	 C27	 84.69
BOT	   26   46	 82.65 C27	 C47	 82.65
TOP	   46   26	 82.65 C47	 C27	 82.65
BOT	   26   47	 81.63 C27	 C48	 81.63
TOP	   47   26	 81.63 C48	 C27	 81.63
BOT	   26   48	 87.76 C27	 C49	 87.76
TOP	   48   26	 87.76 C49	 C27	 87.76
BOT	   26   49	 85.71 C27	 C50	 85.71
TOP	   49   26	 85.71 C50	 C27	 85.71
BOT	   27   28	 88.66 C28	 C29	 88.66
TOP	   28   27	 88.66 C29	 C28	 88.66
BOT	   27   29	 88.66 C28	 C30	 88.66
TOP	   29   27	 88.66 C30	 C28	 88.66
BOT	   27   30	 85.57 C28	 C31	 85.57
TOP	   30   27	 85.57 C31	 C28	 85.57
BOT	   27   31	 90.72 C28	 C32	 90.72
TOP	   31   27	 90.72 C32	 C28	 90.72
BOT	   27   32	 85.57 C28	 C33	 85.57
TOP	   32   27	 85.57 C33	 C28	 85.57
BOT	   27   33	 89.69 C28	 C34	 89.69
TOP	   33   27	 89.69 C34	 C28	 89.69
BOT	   27   34	 88.42 C28	 C35	 88.42
TOP	   34   27	 88.42 C35	 C28	 88.42
BOT	   27   35	 87.63 C28	 C36	 87.63
TOP	   35   27	 87.63 C36	 C28	 87.63
BOT	   27   36	 86.60 C28	 C37	 86.60
TOP	   36   27	 86.60 C37	 C28	 86.60
BOT	   27   37	 86.60 C28	 C38	 86.60
TOP	   37   27	 86.60 C38	 C28	 86.60
BOT	   27   38	 91.75 C28	 C39	 91.75
TOP	   38   27	 91.75 C39	 C28	 91.75
BOT	   27   39	 85.57 C28	 C40	 85.57
TOP	   39   27	 85.57 C40	 C28	 85.57
BOT	   27   40	 91.75 C28	 C41	 91.75
TOP	   40   27	 91.75 C41	 C28	 91.75
BOT	   27   41	 87.63 C28	 C42	 87.63
TOP	   41   27	 87.63 C42	 C28	 87.63
BOT	   27   42	 84.54 C28	 C43	 84.54
TOP	   42   27	 84.54 C43	 C28	 84.54
BOT	   27   43	 92.78 C28	 C44	 92.78
TOP	   43   27	 92.78 C44	 C28	 92.78
BOT	   27   44	 93.81 C28	 C45	 93.81
TOP	   44   27	 93.81 C45	 C28	 93.81
BOT	   27   45	 93.81 C28	 C46	 93.81
TOP	   45   27	 93.81 C46	 C28	 93.81
BOT	   27   46	 87.63 C28	 C47	 87.63
TOP	   46   27	 87.63 C47	 C28	 87.63
BOT	   27   47	 85.57 C28	 C48	 85.57
TOP	   47   27	 85.57 C48	 C28	 85.57
BOT	   27   48	 89.69 C28	 C49	 89.69
TOP	   48   27	 89.69 C49	 C28	 89.69
BOT	   27   49	 87.63 C28	 C50	 87.63
TOP	   49   27	 87.63 C50	 C28	 87.63
BOT	   28   29	 81.63 C29	 C30	 81.63
TOP	   29   28	 81.63 C30	 C29	 81.63
BOT	   28   30	 79.59 C29	 C31	 79.59
TOP	   30   28	 79.59 C31	 C29	 79.59
BOT	   28   31	 88.78 C29	 C32	 88.78
TOP	   31   28	 88.78 C32	 C29	 88.78
BOT	   28   32	 82.65 C29	 C33	 82.65
TOP	   32   28	 82.65 C33	 C29	 82.65
BOT	   28   33	 84.69 C29	 C34	 84.69
TOP	   33   28	 84.69 C34	 C29	 84.69
BOT	   28   34	 83.16 C29	 C35	 83.16
TOP	   34   28	 83.16 C35	 C29	 83.16
BOT	   28   35	 85.71 C29	 C36	 85.71
TOP	   35   28	 85.71 C36	 C29	 85.71
BOT	   28   36	 81.63 C29	 C37	 81.63
TOP	   36   28	 81.63 C37	 C29	 81.63
BOT	   28   37	 83.67 C29	 C38	 83.67
TOP	   37   28	 83.67 C38	 C29	 83.67
BOT	   28   38	 87.76 C29	 C39	 87.76
TOP	   38   28	 87.76 C39	 C29	 87.76
BOT	   28   39	 82.65 C29	 C40	 82.65
TOP	   39   28	 82.65 C40	 C29	 82.65
BOT	   28   40	 84.69 C29	 C41	 84.69
TOP	   40   28	 84.69 C41	 C29	 84.69
BOT	   28   41	 87.76 C29	 C42	 87.76
TOP	   41   28	 87.76 C42	 C29	 87.76
BOT	   28   42	 79.59 C29	 C43	 79.59
TOP	   42   28	 79.59 C43	 C29	 79.59
BOT	   28   43	 92.71 C29	 C44	 92.71
TOP	   43   28	 92.71 C44	 C29	 92.71
BOT	   28   44	 89.69 C29	 C45	 89.69
TOP	   44   28	 89.69 C45	 C29	 89.69
BOT	   28   45	 91.84 C29	 C46	 91.84
TOP	   45   28	 91.84 C46	 C29	 91.84
BOT	   28   46	 86.73 C29	 C47	 86.73
TOP	   46   28	 86.73 C47	 C29	 86.73
BOT	   28   47	 81.63 C29	 C48	 81.63
TOP	   47   28	 81.63 C48	 C29	 81.63
BOT	   28   48	 84.69 C29	 C49	 84.69
TOP	   48   28	 84.69 C49	 C29	 84.69
BOT	   28   49	 87.76 C29	 C50	 87.76
TOP	   49   28	 87.76 C50	 C29	 87.76
BOT	   29   30	 88.78 C30	 C31	 88.78
TOP	   30   29	 88.78 C31	 C30	 88.78
BOT	   29   31	 87.76 C30	 C32	 87.76
TOP	   31   29	 87.76 C32	 C30	 87.76
BOT	   29   32	 79.59 C30	 C33	 79.59
TOP	   32   29	 79.59 C33	 C30	 79.59
BOT	   29   33	 84.69 C30	 C34	 84.69
TOP	   33   29	 84.69 C34	 C30	 84.69
BOT	   29   34	 85.26 C30	 C35	 85.26
TOP	   34   29	 85.26 C35	 C30	 85.26
BOT	   29   35	 81.63 C30	 C36	 81.63
TOP	   35   29	 81.63 C36	 C30	 81.63
BOT	   29   36	 83.67 C30	 C37	 83.67
TOP	   36   29	 83.67 C37	 C30	 83.67
BOT	   29   37	 80.61 C30	 C38	 80.61
TOP	   37   29	 80.61 C38	 C30	 80.61
BOT	   29   38	 84.69 C30	 C39	 84.69
TOP	   38   29	 84.69 C39	 C30	 84.69
BOT	   29   39	 81.63 C30	 C40	 81.63
TOP	   39   29	 81.63 C40	 C30	 81.63
BOT	   29   40	 90.82 C30	 C41	 90.82
TOP	   40   29	 90.82 C41	 C30	 90.82
BOT	   29   41	 80.61 C30	 C42	 80.61
TOP	   41   29	 80.61 C42	 C30	 80.61
BOT	   29   42	 82.65 C30	 C43	 82.65
TOP	   42   29	 82.65 C43	 C30	 82.65
BOT	   29   43	 86.46 C30	 C44	 86.46
TOP	   43   29	 86.46 C44	 C30	 86.46
BOT	   29   44	 85.57 C30	 C45	 85.57
TOP	   44   29	 85.57 C45	 C30	 85.57
BOT	   29   45	 85.71 C30	 C46	 85.71
TOP	   45   29	 85.71 C46	 C30	 85.71
BOT	   29   46	 82.65 C30	 C47	 82.65
TOP	   46   29	 82.65 C47	 C30	 82.65
BOT	   29   47	 82.65 C30	 C48	 82.65
TOP	   47   29	 82.65 C48	 C30	 82.65
BOT	   29   48	 83.67 C30	 C49	 83.67
TOP	   48   29	 83.67 C49	 C30	 83.67
BOT	   29   49	 82.65 C30	 C50	 82.65
TOP	   49   29	 82.65 C50	 C30	 82.65
BOT	   30   31	 84.69 C31	 C32	 84.69
TOP	   31   30	 84.69 C32	 C31	 84.69
BOT	   30   32	 80.61 C31	 C33	 80.61
TOP	   32   30	 80.61 C33	 C31	 80.61
BOT	   30   33	 80.61 C31	 C34	 80.61
TOP	   33   30	 80.61 C34	 C31	 80.61
BOT	   30   34	 82.11 C31	 C35	 82.11
TOP	   34   30	 82.11 C35	 C31	 82.11
BOT	   30   35	 81.63 C31	 C36	 81.63
TOP	   35   30	 81.63 C36	 C31	 81.63
BOT	   30   36	 78.57 C31	 C37	 78.57
TOP	   36   30	 78.57 C37	 C31	 78.57
BOT	   30   37	 83.67 C31	 C38	 83.67
TOP	   37   30	 83.67 C38	 C31	 83.67
BOT	   30   38	 84.69 C31	 C39	 84.69
TOP	   38   30	 84.69 C39	 C31	 84.69
BOT	   30   39	 78.57 C31	 C40	 78.57
TOP	   39   30	 78.57 C40	 C31	 78.57
BOT	   30   40	 90.82 C31	 C41	 90.82
TOP	   40   30	 90.82 C41	 C31	 90.82
BOT	   30   41	 77.55 C31	 C42	 77.55
TOP	   41   30	 77.55 C42	 C31	 77.55
BOT	   30   42	 81.63 C31	 C43	 81.63
TOP	   42   30	 81.63 C43	 C31	 81.63
BOT	   30   43	 85.42 C31	 C44	 85.42
TOP	   43   30	 85.42 C44	 C31	 85.42
BOT	   30   44	 84.54 C31	 C45	 84.54
TOP	   44   30	 84.54 C45	 C31	 84.54
BOT	   30   45	 84.69 C31	 C46	 84.69
TOP	   45   30	 84.69 C46	 C31	 84.69
BOT	   30   46	 82.65 C31	 C47	 82.65
TOP	   46   30	 82.65 C47	 C31	 82.65
BOT	   30   47	 81.63 C31	 C48	 81.63
TOP	   47   30	 81.63 C48	 C31	 81.63
BOT	   30   48	 81.63 C31	 C49	 81.63
TOP	   48   30	 81.63 C49	 C31	 81.63
BOT	   30   49	 78.57 C31	 C50	 78.57
TOP	   49   30	 78.57 C50	 C31	 78.57
BOT	   31   32	 84.69 C32	 C33	 84.69
TOP	   32   31	 84.69 C33	 C32	 84.69
BOT	   31   33	 86.73 C32	 C34	 86.73
TOP	   33   31	 86.73 C34	 C32	 86.73
BOT	   31   34	 87.37 C32	 C35	 87.37
TOP	   34   31	 87.37 C35	 C32	 87.37
BOT	   31   35	 87.76 C32	 C36	 87.76
TOP	   35   31	 87.76 C36	 C32	 87.76
BOT	   31   36	 85.71 C32	 C37	 85.71
TOP	   36   31	 85.71 C37	 C32	 85.71
BOT	   31   37	 85.71 C32	 C38	 85.71
TOP	   37   31	 85.71 C38	 C32	 85.71
BOT	   31   38	 90.82 C32	 C39	 90.82
TOP	   38   31	 90.82 C39	 C32	 90.82
BOT	   31   39	 82.65 C32	 C40	 82.65
TOP	   39   31	 82.65 C40	 C32	 82.65
BOT	   31   40	 88.78 C32	 C41	 88.78
TOP	   40   31	 88.78 C41	 C32	 88.78
BOT	   31   41	 84.69 C32	 C42	 84.69
TOP	   41   31	 84.69 C42	 C32	 84.69
BOT	   31   42	 84.69 C32	 C43	 84.69
TOP	   42   31	 84.69 C43	 C32	 84.69
BOT	   31   43	 92.71 C32	 C44	 92.71
TOP	   43   31	 92.71 C44	 C32	 92.71
BOT	   31   44	 92.78 C32	 C45	 92.78
TOP	   44   31	 92.78 C45	 C32	 92.78
BOT	   31   45	 90.82 C32	 C46	 90.82
TOP	   45   31	 90.82 C46	 C32	 90.82
BOT	   31   46	 87.76 C32	 C47	 87.76
TOP	   46   31	 87.76 C47	 C32	 87.76
BOT	   31   47	 88.78 C32	 C48	 88.78
TOP	   47   31	 88.78 C48	 C32	 88.78
BOT	   31   48	 88.78 C32	 C49	 88.78
TOP	   48   31	 88.78 C49	 C32	 88.78
BOT	   31   49	 88.78 C32	 C50	 88.78
TOP	   49   31	 88.78 C50	 C32	 88.78
BOT	   32   33	 85.71 C33	 C34	 85.71
TOP	   33   32	 85.71 C34	 C33	 85.71
BOT	   32   34	 82.11 C33	 C35	 82.11
TOP	   34   32	 82.11 C35	 C33	 82.11
BOT	   32   35	 88.78 C33	 C36	 88.78
TOP	   35   32	 88.78 C36	 C33	 88.78
BOT	   32   36	 79.59 C33	 C37	 79.59
TOP	   36   32	 79.59 C37	 C33	 79.59
BOT	   32   37	 89.80 C33	 C38	 89.80
TOP	   37   32	 89.80 C38	 C33	 89.80
BOT	   32   38	 86.73 C33	 C39	 86.73
TOP	   38   32	 86.73 C39	 C33	 86.73
BOT	   32   39	 79.59 C33	 C40	 79.59
TOP	   39   32	 79.59 C40	 C33	 79.59
BOT	   32   40	 83.67 C33	 C41	 83.67
TOP	   40   32	 83.67 C41	 C33	 83.67
BOT	   32   41	 80.61 C33	 C42	 80.61
TOP	   41   32	 80.61 C42	 C33	 80.61
BOT	   32   42	 83.67 C33	 C43	 83.67
TOP	   42   32	 83.67 C43	 C33	 83.67
BOT	   32   43	 86.46 C33	 C44	 86.46
TOP	   43   32	 86.46 C44	 C33	 86.46
BOT	   32   44	 85.57 C33	 C45	 85.57
TOP	   44   32	 85.57 C45	 C33	 85.57
BOT	   32   45	 84.69 C33	 C46	 84.69
TOP	   45   32	 84.69 C46	 C33	 84.69
BOT	   32   46	 83.67 C33	 C47	 83.67
TOP	   46   32	 83.67 C47	 C33	 83.67
BOT	   32   47	 85.71 C33	 C48	 85.71
TOP	   47   32	 85.71 C48	 C33	 85.71
BOT	   32   48	 89.80 C33	 C49	 89.80
TOP	   48   32	 89.80 C49	 C33	 89.80
BOT	   32   49	 81.63 C33	 C50	 81.63
TOP	   49   32	 81.63 C50	 C33	 81.63
BOT	   33   34	 84.21 C34	 C35	 84.21
TOP	   34   33	 84.21 C35	 C34	 84.21
BOT	   33   35	 88.78 C34	 C36	 88.78
TOP	   35   33	 88.78 C36	 C34	 88.78
BOT	   33   36	 81.63 C34	 C37	 81.63
TOP	   36   33	 81.63 C37	 C34	 81.63
BOT	   33   37	 85.71 C34	 C38	 85.71
TOP	   37   33	 85.71 C38	 C34	 85.71
BOT	   33   38	 87.76 C34	 C39	 87.76
TOP	   38   33	 87.76 C39	 C34	 87.76
BOT	   33   39	 82.65 C34	 C40	 82.65
TOP	   39   33	 82.65 C40	 C34	 82.65
BOT	   33   40	 86.73 C34	 C41	 86.73
TOP	   40   33	 86.73 C41	 C34	 86.73
BOT	   33   41	 82.65 C34	 C42	 82.65
TOP	   41   33	 82.65 C42	 C34	 82.65
BOT	   33   42	 84.69 C34	 C43	 84.69
TOP	   42   33	 84.69 C43	 C34	 84.69
BOT	   33   43	 88.54 C34	 C44	 88.54
TOP	   43   33	 88.54 C44	 C34	 88.54
BOT	   33   44	 88.66 C34	 C45	 88.66
TOP	   44   33	 88.66 C45	 C34	 88.66
BOT	   33   45	 86.73 C34	 C46	 86.73
TOP	   45   33	 86.73 C46	 C34	 86.73
BOT	   33   46	 85.71 C34	 C47	 85.71
TOP	   46   33	 85.71 C47	 C34	 85.71
BOT	   33   47	 83.67 C34	 C48	 83.67
TOP	   47   33	 83.67 C48	 C34	 83.67
BOT	   33   48	 89.80 C34	 C49	 89.80
TOP	   48   33	 89.80 C49	 C34	 89.80
BOT	   33   49	 85.71 C34	 C50	 85.71
TOP	   49   33	 85.71 C50	 C34	 85.71
BOT	   34   35	 84.21 C35	 C36	 84.21
TOP	   35   34	 84.21 C36	 C35	 84.21
BOT	   34   36	 80.00 C35	 C37	 80.00
TOP	   36   34	 80.00 C37	 C35	 80.00
BOT	   34   37	 82.11 C35	 C38	 82.11
TOP	   37   34	 82.11 C38	 C35	 82.11
BOT	   34   38	 88.42 C35	 C39	 88.42
TOP	   38   34	 88.42 C39	 C35	 88.42
BOT	   34   39	 85.26 C35	 C40	 85.26
TOP	   39   34	 85.26 C40	 C35	 85.26
BOT	   34   40	 88.42 C35	 C41	 88.42
TOP	   40   34	 88.42 C41	 C35	 88.42
BOT	   34   41	 81.05 C35	 C42	 81.05
TOP	   41   34	 81.05 C42	 C35	 81.05
BOT	   34   42	 82.11 C35	 C43	 82.11
TOP	   42   34	 82.11 C43	 C35	 82.11
BOT	   34   43	 89.47 C35	 C44	 89.47
TOP	   43   34	 89.47 C44	 C35	 89.47
BOT	   34   44	 86.32 C35	 C45	 86.32
TOP	   44   34	 86.32 C45	 C35	 86.32
BOT	   34   45	 87.37 C35	 C46	 87.37
TOP	   45   34	 87.37 C46	 C35	 87.37
BOT	   34   46	 84.21 C35	 C47	 84.21
TOP	   46   34	 84.21 C47	 C35	 84.21
BOT	   34   47	 82.11 C35	 C48	 82.11
TOP	   47   34	 82.11 C48	 C35	 82.11
BOT	   34   48	 87.37 C35	 C49	 87.37
TOP	   48   34	 87.37 C49	 C35	 87.37
BOT	   34   49	 86.32 C35	 C50	 86.32
TOP	   49   34	 86.32 C50	 C35	 86.32
BOT	   35   36	 83.67 C36	 C37	 83.67
TOP	   36   35	 83.67 C37	 C36	 83.67
BOT	   35   37	 87.76 C36	 C38	 87.76
TOP	   37   35	 87.76 C38	 C36	 87.76
BOT	   35   38	 90.82 C36	 C39	 90.82
TOP	   38   35	 90.82 C39	 C36	 90.82
BOT	   35   39	 84.69 C36	 C40	 84.69
TOP	   39   35	 84.69 C40	 C36	 84.69
BOT	   35   40	 85.71 C36	 C41	 85.71
TOP	   40   35	 85.71 C41	 C36	 85.71
BOT	   35   41	 85.71 C36	 C42	 85.71
TOP	   41   35	 85.71 C42	 C36	 85.71
BOT	   35   42	 86.73 C36	 C43	 86.73
TOP	   42   35	 86.73 C43	 C36	 86.73
BOT	   35   43	 89.58 C36	 C44	 89.58
TOP	   43   35	 89.58 C44	 C36	 89.58
BOT	   35   44	 89.69 C36	 C45	 89.69
TOP	   44   35	 89.69 C45	 C36	 89.69
BOT	   35   45	 88.78 C36	 C46	 88.78
TOP	   45   35	 88.78 C46	 C36	 88.78
BOT	   35   46	 87.76 C36	 C47	 87.76
TOP	   46   35	 87.76 C47	 C36	 87.76
BOT	   35   47	 86.73 C36	 C48	 86.73
TOP	   47   35	 86.73 C48	 C36	 86.73
BOT	   35   48	 89.80 C36	 C49	 89.80
TOP	   48   35	 89.80 C49	 C36	 89.80
BOT	   35   49	 85.71 C36	 C50	 85.71
TOP	   49   35	 85.71 C50	 C36	 85.71
BOT	   36   37	 78.57 C37	 C38	 78.57
TOP	   37   36	 78.57 C38	 C37	 78.57
BOT	   36   38	 84.69 C37	 C39	 84.69
TOP	   38   36	 84.69 C39	 C37	 84.69
BOT	   36   39	 78.57 C37	 C40	 78.57
TOP	   39   36	 78.57 C40	 C37	 78.57
BOT	   36   40	 84.69 C37	 C41	 84.69
TOP	   40   36	 84.69 C41	 C37	 84.69
BOT	   36   41	 82.65 C37	 C42	 82.65
TOP	   41   36	 82.65 C42	 C37	 82.65
BOT	   36   42	 77.55 C37	 C43	 77.55
TOP	   42   36	 77.55 C43	 C37	 77.55
BOT	   36   43	 84.38 C37	 C44	 84.38
TOP	   43   36	 84.38 C44	 C37	 84.38
BOT	   36   44	 86.60 C37	 C45	 86.60
TOP	   44   36	 86.60 C45	 C37	 86.60
BOT	   36   45	 82.65 C37	 C46	 82.65
TOP	   45   36	 82.65 C46	 C37	 82.65
BOT	   36   46	 79.59 C37	 C47	 79.59
TOP	   46   36	 79.59 C47	 C37	 79.59
BOT	   36   47	 80.61 C37	 C48	 80.61
TOP	   47   36	 80.61 C48	 C37	 80.61
BOT	   36   48	 82.65 C37	 C49	 82.65
TOP	   48   36	 82.65 C49	 C37	 82.65
BOT	   36   49	 83.67 C37	 C50	 83.67
TOP	   49   36	 83.67 C50	 C37	 83.67
BOT	   37   38	 89.80 C38	 C39	 89.80
TOP	   38   37	 89.80 C39	 C38	 89.80
BOT	   37   39	 79.59 C38	 C40	 79.59
TOP	   39   37	 79.59 C40	 C38	 79.59
BOT	   37   40	 84.69 C38	 C41	 84.69
TOP	   40   37	 84.69 C41	 C38	 84.69
BOT	   37   41	 81.63 C38	 C42	 81.63
TOP	   41   37	 81.63 C42	 C38	 81.63
BOT	   37   42	 82.65 C38	 C43	 82.65
TOP	   42   37	 82.65 C43	 C38	 82.65
BOT	   37   43	 87.50 C38	 C44	 87.50
TOP	   43   37	 87.50 C44	 C38	 87.50
BOT	   37   44	 86.60 C38	 C45	 86.60
TOP	   44   37	 86.60 C45	 C38	 86.60
BOT	   37   45	 84.69 C38	 C46	 84.69
TOP	   45   37	 84.69 C46	 C38	 84.69
BOT	   37   46	 82.65 C38	 C47	 82.65
TOP	   46   37	 82.65 C47	 C38	 82.65
BOT	   37   47	 82.65 C38	 C48	 82.65
TOP	   47   37	 82.65 C48	 C38	 82.65
BOT	   37   48	 90.82 C38	 C49	 90.82
TOP	   48   37	 90.82 C49	 C38	 90.82
BOT	   37   49	 82.65 C38	 C50	 82.65
TOP	   49   37	 82.65 C50	 C38	 82.65
BOT	   38   39	 88.78 C39	 C40	 88.78
TOP	   39   38	 88.78 C40	 C39	 88.78
BOT	   38   40	 87.76 C39	 C41	 87.76
TOP	   40   38	 87.76 C41	 C39	 87.76
BOT	   38   41	 85.71 C39	 C42	 85.71
TOP	   41   38	 85.71 C42	 C39	 85.71
BOT	   38   42	 82.65 C39	 C43	 82.65
TOP	   42   38	 82.65 C43	 C39	 82.65
BOT	   38   43	 92.71 C39	 C44	 92.71
TOP	   43   38	 92.71 C44	 C39	 92.71
BOT	   38   44	 91.75 C39	 C45	 91.75
TOP	   44   38	 91.75 C45	 C39	 91.75
BOT	   38   45	 91.84 C39	 C46	 91.84
TOP	   45   38	 91.84 C46	 C39	 91.84
BOT	   38   46	 85.71 C39	 C47	 85.71
TOP	   46   38	 85.71 C47	 C39	 85.71
BOT	   38   47	 86.73 C39	 C48	 86.73
TOP	   47   38	 86.73 C48	 C39	 86.73
BOT	   38   48	 89.80 C39	 C49	 89.80
TOP	   48   38	 89.80 C49	 C39	 89.80
BOT	   38   49	 87.76 C39	 C50	 87.76
TOP	   49   38	 87.76 C50	 C39	 87.76
BOT	   39   40	 82.65 C40	 C41	 82.65
TOP	   40   39	 82.65 C41	 C40	 82.65
BOT	   39   41	 80.61 C40	 C42	 80.61
TOP	   41   39	 80.61 C42	 C40	 80.61
BOT	   39   42	 79.59 C40	 C43	 79.59
TOP	   42   39	 79.59 C43	 C40	 79.59
BOT	   39   43	 85.42 C40	 C44	 85.42
TOP	   43   39	 85.42 C44	 C40	 85.42
BOT	   39   44	 84.54 C40	 C45	 84.54
TOP	   44   39	 84.54 C45	 C40	 84.54
BOT	   39   45	 86.73 C40	 C46	 86.73
TOP	   45   39	 86.73 C46	 C40	 86.73
BOT	   39   46	 81.63 C40	 C47	 81.63
TOP	   46   39	 81.63 C47	 C40	 81.63
BOT	   39   47	 81.63 C40	 C48	 81.63
TOP	   47   39	 81.63 C48	 C40	 81.63
BOT	   39   48	 84.69 C40	 C49	 84.69
TOP	   48   39	 84.69 C49	 C40	 84.69
BOT	   39   49	 81.63 C40	 C50	 81.63
TOP	   49   39	 81.63 C50	 C40	 81.63
BOT	   40   41	 82.65 C41	 C42	 82.65
TOP	   41   40	 82.65 C42	 C41	 82.65
BOT	   40   42	 83.67 C41	 C43	 83.67
TOP	   42   40	 83.67 C43	 C41	 83.67
BOT	   40   43	 89.58 C41	 C44	 89.58
TOP	   43   40	 89.58 C44	 C41	 89.58
BOT	   40   44	 88.66 C41	 C45	 88.66
TOP	   44   40	 88.66 C45	 C41	 88.66
BOT	   40   45	 88.78 C41	 C46	 88.78
TOP	   45   40	 88.78 C46	 C41	 88.78
BOT	   40   46	 85.71 C41	 C47	 85.71
TOP	   46   40	 85.71 C47	 C41	 85.71
BOT	   40   47	 84.69 C41	 C48	 84.69
TOP	   47   40	 84.69 C48	 C41	 84.69
BOT	   40   48	 87.76 C41	 C49	 87.76
TOP	   48   40	 87.76 C49	 C41	 87.76
BOT	   40   49	 84.69 C41	 C50	 84.69
TOP	   49   40	 84.69 C50	 C41	 84.69
BOT	   41   42	 78.57 C42	 C43	 78.57
TOP	   42   41	 78.57 C43	 C42	 78.57
BOT	   41   43	 89.58 C42	 C44	 89.58
TOP	   43   41	 89.58 C44	 C42	 89.58
BOT	   41   44	 88.66 C42	 C45	 88.66
TOP	   44   41	 88.66 C45	 C42	 88.66
BOT	   41   45	 87.76 C42	 C46	 87.76
TOP	   45   41	 87.76 C46	 C42	 87.76
BOT	   41   46	 84.69 C42	 C47	 84.69
TOP	   46   41	 84.69 C47	 C42	 84.69
BOT	   41   47	 79.59 C42	 C48	 79.59
TOP	   47   41	 79.59 C48	 C42	 79.59
BOT	   41   48	 83.67 C42	 C49	 83.67
TOP	   48   41	 83.67 C49	 C42	 83.67
BOT	   41   49	 87.76 C42	 C50	 87.76
TOP	   49   41	 87.76 C50	 C42	 87.76
BOT	   42   43	 86.46 C43	 C44	 86.46
TOP	   43   42	 86.46 C44	 C43	 86.46
BOT	   42   44	 82.47 C43	 C45	 82.47
TOP	   44   42	 82.47 C45	 C43	 82.47
BOT	   42   45	 84.69 C43	 C46	 84.69
TOP	   45   42	 84.69 C46	 C43	 84.69
BOT	   42   46	 83.67 C43	 C47	 83.67
TOP	   46   42	 83.67 C47	 C43	 83.67
BOT	   42   47	 83.67 C43	 C48	 83.67
TOP	   47   42	 83.67 C48	 C43	 83.67
BOT	   42   48	 86.73 C43	 C49	 86.73
TOP	   48   42	 86.73 C49	 C43	 86.73
BOT	   42   49	 79.59 C43	 C50	 79.59
TOP	   49   42	 79.59 C50	 C43	 79.59
BOT	   43   44	 94.85 C44	 C45	 94.85
TOP	   44   43	 94.85 C45	 C44	 94.85
BOT	   43   45	 94.79 C44	 C46	 94.79
TOP	   45   43	 94.79 C46	 C44	 94.79
BOT	   43   46	 91.67 C44	 C47	 91.67
TOP	   46   43	 91.67 C47	 C44	 91.67
BOT	   43   47	 86.46 C44	 C48	 86.46
TOP	   47   43	 86.46 C48	 C44	 86.46
BOT	   43   48	 89.58 C44	 C49	 89.58
TOP	   48   43	 89.58 C49	 C44	 89.58
BOT	   43   49	 89.58 C44	 C50	 89.58
TOP	   49   43	 89.58 C50	 C44	 89.58
BOT	   44   45	 92.78 C45	 C46	 92.78
TOP	   45   44	 92.78 C46	 C45	 92.78
BOT	   44   46	 89.69 C45	 C47	 89.69
TOP	   46   44	 89.69 C47	 C45	 89.69
BOT	   44   47	 84.54 C45	 C48	 84.54
TOP	   47   44	 84.54 C48	 C45	 84.54
BOT	   44   48	 88.66 C45	 C49	 88.66
TOP	   48   44	 88.66 C49	 C45	 88.66
BOT	   44   49	 89.69 C45	 C50	 89.69
TOP	   49   44	 89.69 C50	 C45	 89.69
BOT	   45   46	 90.82 C46	 C47	 90.82
TOP	   46   45	 90.82 C47	 C46	 90.82
BOT	   45   47	 84.69 C46	 C48	 84.69
TOP	   47   45	 84.69 C48	 C46	 84.69
BOT	   45   48	 86.73 C46	 C49	 86.73
TOP	   48   45	 86.73 C49	 C46	 86.73
BOT	   45   49	 86.73 C46	 C50	 86.73
TOP	   49   45	 86.73 C50	 C46	 86.73
BOT	   46   47	 87.76 C47	 C48	 87.76
TOP	   47   46	 87.76 C48	 C47	 87.76
BOT	   46   48	 84.69 C47	 C49	 84.69
TOP	   48   46	 84.69 C49	 C47	 84.69
BOT	   46   49	 86.73 C47	 C50	 86.73
TOP	   49   46	 86.73 C50	 C47	 86.73
BOT	   47   48	 86.73 C48	 C49	 86.73
TOP	   48   47	 86.73 C49	 C48	 86.73
BOT	   47   49	 82.65 C48	 C50	 82.65
TOP	   49   47	 82.65 C50	 C48	 82.65
BOT	   48   49	 85.71 C49	 C50	 85.71
TOP	   49   48	 85.71 C50	 C49	 85.71
AVG	 0	  C1	   *	 83.20
AVG	 1	  C2	   *	 84.65
AVG	 2	  C3	   *	 85.62
AVG	 3	  C4	   *	 81.79
AVG	 4	  C5	   *	 84.97
AVG	 5	  C6	   *	 85.61
AVG	 6	  C7	   *	 88.43
AVG	 7	  C8	   *	 87.47
AVG	 8	  C9	   *	 88.18
AVG	 9	 C10	   *	 88.60
AVG	 10	 C11	   *	 85.14
AVG	 11	 C12	   *	 87.00
AVG	 12	 C13	   *	 85.79
AVG	 13	 C14	   *	 86.66
AVG	 14	 C15	   *	 77.18
AVG	 15	 C16	   *	 88.39
AVG	 16	 C17	   *	 87.39
AVG	 17	 C18	   *	 85.19
AVG	 18	 C19	   *	 86.05
AVG	 19	 C20	   *	 84.09
AVG	 20	 C21	   *	 82.64
AVG	 21	 C22	   *	 84.09
AVG	 22	 C23	   *	 85.97
AVG	 23	 C24	   *	 87.68
AVG	 24	 C25	   *	 83.84
AVG	 25	 C26	   *	 87.33
AVG	 26	 C27	   *	 83.76
AVG	 27	 C28	   *	 88.50
AVG	 28	 C29	   *	 85.05
AVG	 29	 C30	   *	 84.62
AVG	 30	 C31	   *	 83.09
AVG	 31	 C32	   *	 87.64
AVG	 32	 C33	   *	 84.34
AVG	 33	 C34	   *	 85.51
AVG	 34	 C35	   *	 85.06
AVG	 35	 C36	   *	 86.70
AVG	 36	 C37	   *	 82.15
AVG	 37	 C38	   *	 84.71
AVG	 38	 C39	   *	 87.87
AVG	 39	 C40	   *	 82.88
AVG	 40	 C41	   *	 87.25
AVG	 41	 C42	   *	 83.69
AVG	 42	 C43	   *	 83.11
AVG	 43	 C44	   *	 89.32
AVG	 44	 C45	   *	 88.05
AVG	 45	 C46	   *	 87.83
AVG	 46	 C47	   *	 85.54
AVG	 47	 C48	   *	 84.38
AVG	 48	 C49	   *	 87.05
AVG	 49	 C50	   *	 84.97
TOT	 TOT	   *	 85.52
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGAACAAGCCCCAGAAAACCAAGGGCCACAGAGAGAACCCTACAATGA
C2              ATGGAACAACCCCCAGAAGATCAAGGGCCGCAGAGGGAGCCATACAATGA
C3              ATGGAACAAGCCCCAGAAGATCAGGGGCCACAGAGAGAACCCCACAATGA
C4              ATGGAACAAGCCCCAGAAGACCAGGGGCCACAGAGGGAGCCATACAATGA
C5              ATGGAACAAGCCCCAGAAGACCAAGGGCCGCAAAGGGAGCCATATAATGA
C6              ATGGAACAACCCCCAGAAGACCAGGGGCCGCAGAGGGAACCATACAATGG
C7              ATGGAACAAGCCCCAGAAGACCAAGGGCCACAGAGGGAGCCATACAATGA
C8              ATGGAACAAACCCCAGAAGACCAGGGGCCACAGAGGGAGCCATACAATGA
C9              ATGGAACAAGCCCCAGAAGACCAAGGGCCACAGAGGGAGCCATACAATGA
C10             ATGGAACAAGCCCCGGAAGACCAAGGGCCACAGAGGGAACCATACAATGA
C11             ATGGAACAAGCCCCAGAAGACCAAGGGCCACAGAGGGAGCCATACAATGA
C12             ATGGAACAAGCCCCGGGAGATCAAGGGCCACAGAGGGAGCCATACAATGA
C13             ATGGAACAAAGCCCAGAAGACCAGGGGCCACAGAGAGAACCCTTCAATGA
C14             ATGGAACAAGCCCCAGAAAACCAAGGGCCGCAGAGAGAGCCATACCATGA
C15             ATGGAACAAGCCCCAGAAGACCAAGGGCCACAGAGGGAGCCGTCCAATGA
C16             ATGGAACAAGCCCCAGAAGATCAGGGACCACAGAGGGAGCCATATAATGA
C17             ATGGAACAAGCCCCAGAAGATCAGGGGCCGCAGAGGGAACCATACAATGA
C18             ATGGAACAACCCCCAGAAGACCAGGGGCCGCAGAGGGAACCATACAATGA
C19             ATGGAACAACCCCCAGAAGATCAGGGGCCGCAGAGGGAACCATTTAATGA
C20             ATGGAACAAGCCCCAGAAGATCAAGGGCCACAAAGGGAACCATACAATGA
C21             ATGGAACAAGCCCCAGAAGATCAGAGGCCACAGAGAGAGCCCCAC-----
C22             ATGGAACAAGCCCCAGAAGATCAGGGGCCACCCAGAGAACCCCACAATGA
C23             ATGGAACAAGCCCCAGAAGACCAAGGACCACAGAGGGAGCCATACAATGA
C24             ATGGAACAAGCCCCAGAAGACCAAGGGCCACAGAGGGAGCCATACAATGA
C25             ATGGAGCAAGCCCCGGAAGACCAAGGGCCACAGAGGGAGCCATACAATGA
C26             ATGGAACAAGCCCCAGAAGACCAGGGACCACAGAGGGAGCCATACAATGA
C27             ATGGAACAACCCCCAGAAGATCAGGGGCCGCAGAGGGAACCATACACTGA
C28             ATGGAACAAGCCCCAGAAGACCAAGGGCCACAGAGGGAGCCATACAATGA
C29             ATGGAACAAGCCCCAGAAGACCAAGGGCCACAGAGGGAGCCATACAATGA
C30             ATGGAACAAACCCCAGAAGATCAGGGGCCACAGAGAGAACCCCACAATGA
C31             ATGGAACGAGCCCCAGAAGACCAGGGGCCACAGAGAGAACCCAACAATGA
C32             ATGGAACAAGCCCCAGAGGACCAAGGGCCACAGAGGGAGCCATACAATGA
C33             ATGGAACAACCCCCAGAAGATCAGGGGCCACAGAGGGAACCATACAATGT
C34             ATGGAACAAACCCCAGAAGATCAGGGGCCGCAGAGGGAACCATACAATGA
C35             ATGGAACAAGCCCCGGAAAACCAAGGACCACAGAGAGAG---------CA
C36             ATGGAACAAGCCCCAGAAGACCAGGGGCCGCAGAGGGAACCATACAATGA
C37             ATGGAACAAGCCCCAGAAGACCAGGGACCGCAGAGGGAGCCACACAATGA
C38             ATGGAACGACCCCCAGAAGATCATGGGCCGCAGAGGGAACCATACAATGA
C39             ATGGAACGAGCCCCAGAAGACCAAGGGCCACAGAGAGAGCCATACAATGA
C40             ATGGAACAAGCCCCAGGGAACCAAGGGCCACAGAGGGAACCATACAATGA
C41             ATGGAACAAGCCCCAGAAGACCAGGGGCCACAAAGAGAACCATACAATGA
C42             ATGGAACAAGCCCCAGAAGACCAAGGGCCCCAGAGGGAGCCATACAATGA
C43             ATGGAACAACTCCCAGAAGACCAGGGGCCGCAGAGGGAACCATACAATGA
C44             ATGGAACAAGCCCCAGAAGACCAAGGGCCACAGAGGGAACCATACAATGA
C45             ATGGAACAAGCCCCAGAAGACCAAGGGCCACAGAGAGAGCCATACAATGA
C46             ATGGAACAAGCCCCAGAAGACCAAGGGCCACAGAGGGAGCCATACAATGA
C47             ATGGAACAAGCCCCAGAGGACCAAGGACCACAGAGGGAGCCACACAATGA
C48             ATGGAACAAGCCCCAGAAGACCAAGGGCCACAGAGGGAGCCATACAATGA
C49             ATGGAACAACCCCCAGAAAATCAGGGGCCGCAGAGGGAACCATACAATGA
C50             ATGGAACAAGCCCCAGAAGACCAAGGGCCACAGAGGGAGCCATCTAATGA
                *****.*.*  ***.*...* ** .*.** *. **.**.           

C1              ATGGGCATTGGAACTGTTAGAAGAGCTTAAAAATGAAGCTGTTAGACATT
C2              ATGGGCACTAGAGATTCTAGAGGAACTCAAGCAGGAAGCTGTCAGGCACT
C3              GTGGACATTAGAACTTTTAGAGGAGCTTAAAACTGAGGCTGTTAGACATT
C4              ATGGATGTTAGAACTGTTGGAAGATCTTAAGCAGGAAGCTGTTAGACATT
C5              ATGGACACTAGAGCTTTTAGGGGAGCTTAAGAATGAAGCTGTTAGGCATT
C6              ATGGACACTAGAGCTTTTAGAGGAACTCAAGCAGGAAGCTGTCAGACACT
C7              GTGGACACTAGAACTTTTAGAGGAGCTTAAGAGTGAAGCTGTTAGACATT
C8              GTGGGCACTAGAGCTTTTAGAAGAACTTAAGCAGGAAGCTGTCAGACACT
C9              ATGGACATTAGAGCTTTTAGAGGAGCTTAAGAGTGAAGCTGTTAGACACT
C10             ATGGACACTAGAGCTTTTAGAGGAGCTCAAGAATGAAGCTGTTAGACATT
C11             CTGGACACTAGAGCTTTTAGAGGAGCTTAAGAGTGAAGCTGTCAGACATT
C12             ATGGACACTAGAACTTTTAGAGGAGCTTAAAAATGAAGCTGTTAGACATT
C13             ATGGGCATTAGAGCTGTTAGAGGAGCTTAAAAATGAAGCTGTTAGACATT
C14             ATGGACACTAGAACTTCTAGAGGAACTTAAGAATGAAGCTGTTAGACATT
C15             ATGGACACTAGAACTGTTAGAAGAGCGTAAGCATGAAGGAGTTAGGAATT
C16             ATGGACACTAGAACTTTTAGAGGAGCTCAAGCAGGAAGCTGTCAGACACT
C17             ATGGACACTAGAGCTTTTAGAAGAGCTCAAGCAGGAAGCTGTCAGACACT
C18             ATGGACATTAGAGATACTAGAGGAACTCAAGCAGGAAGCTGTCAGACACT
C19             ATGGACACTAGAGCTTCTAGAGGAACTCAAACAGGAAGCTGTCAGACACT
C20             GTGGACACTAGAGCTTTTAGAGGAGCTTAAGAATGAAGCTGTTAGACACT
C21             -TGGACATTAGAACTGTTAGAAGAGCTTAAGAATGAAGCTGTTAGACACT
C22             ATGGACATTAGAACTGTTAGAGGAGCTTAAAAATGAAGCTGTTAGACATT
C23             ATGGACACTAGAGCTTTTAGAGGAGCTTAAGAATGAAGCTGTTAGACATT
C24             ATGGACACTAGAGCTTTTAGAGGAGCTTAAGAATGAAGCAGTTAGACACT
C25             ATGGACACTAGAGCTTTTAGAGGAGCTTAAGAGTGAAGCTGTTAGACACT
C26             ATGGACACTAGAGCTTTTAGAGGAGCTTAAGAATGAAGCTGTTAGACATT
C27             ATGGGCATTAGAGATTCTAGAAGAACTCAAGCAGGAAGCTGTCAGACACT
C28             ATGGACACTAGAGCTTTTGGAGGAACTTAAGAATGAGGCTGTTAGACATT
C29             ATGGACACTAGAGCTTTTAGAAGAGCTTAGGAGTGAAGCTGTTAGGCATT
C30             ATGGACATTAGAACTATTAGAGGAGCTTAAAAATGAAGCTGTTAGACATT
C31             ATGGACATTAGAGCTGTTAGAGGAACTTAAAAATGAAGCTGTTAGACACT
C32             ATGGACACTAGAGCTTTTAGAAGAACTTAAAAGAGAAGCTGTCAGACATT
C33             ATGGACACTAGAGCTTCTAGAGGACCTCAAGCAAGAAGCTGTCAGACATT
C34             ATGGACATTAGAGATTCTAGAGGAACTCAAGCAGGAAGCGGTCAGACACT
C35             ATGGGCACTAGAGCTTCTAGAGGAACTTAAGAATGAAGCTGTTAGGCATT
C36             GTGGACACTAGAGCTTTTAGAGGAACTTAAGCAGGAAGCTGTCAGACACT
C37             ATGGACACTAGAGCTTTTGGAGGAGCTCAAGGAGGAAGCTGTTAAACATT
C38             ATGGACACTAGAGCTCCTAGAGGAACTCAAGCAGGAAGCGGTCAGACACT
C39             ATGGACACTAGAACTTTTAGAGGAGCTTAAGAGGGAAGCTGTTAGACATT
C40             GTGGACACTAGAGCTTTTAGAGGAGCTTATGAATGAAGCTGTTAGACATT
C41             ATGGACATTAGAACTGTTAGAGGAGCTTAAAAATGAAGCAGTTAGGCATT
C42             ATGGACACTAGAGCTTTTAGAGGAACTAAAGAGTGAAGCTGTTAGACATT
C43             ATGGGCACTAGAAATTCTAGAGGAACTCAAGCAGGAAGCTGTCAGACACT
C44             ATGGGCACTAGAGCTTTTAGAAGAGCTTAAGAGTGAAGCTGTTAGACATT
C45             ATGGACACTAGAGCTTTTAGAAGAACTTAAGAGTGAAGCCGTTAAGCATT
C46             ATGGACACTAGAGCTTTTAGAAGAGCTTAAGAATGAAGCTGTTAGACATT
C47             GTGGACACTAGAACTTTTAGAGGAGCTTAAGAGTGAAGCTGTTAGACATT
C48             ATGGACACTAGAGCTTTTGGAGGAGCTTAAGAGAGAAGCTGTTAGACATT
C49             ATGGACATTAGAGGTTTTAGAGGAACTTAAGCAAGAGGCTGTCAGACACT
C50             ATGGACATTAGAGCTTTTAGAGGAGCTTAAGAGTGAAGCTGTTAGACATT
                 ***. . *.**. *  *.*..** *  * .   **.*  ** *...* *

C1              TTCCTAGGCCCTGGCTTCATGGCTTAGGACAGTATATCTATAACACTTAT
C2              TTCCTAGACCATGGCTCCATAGCTTAGGGCAGTATATCTATGAAACTTAT
C3              TTCCTAGGCCCTGGCTCCATGGCTTAGGACAGTACATCTATAACACTTAT
C4              TTCCTAGGCCTTGGCTCCATGGATTAGGACAACATATCTATGAAACCTAT
C5              TCCCTGGGCCATGGCTTCATGGCTTAGGGCAGTATATCTATGCAACTTAT
C6              TTCCTAGACCATGGCTCCATAGCTTAGGACAACATATCTATGCAACCTAT
C7              TTCCTAGGATATGGCTACATAGCCTAGGACAGTATATCTATGAAACTTAT
C8              TTCCTAGACCATGGCTCCATAGCTTAGGACAACATATCTATAACACCTAT
C9              TCCCTAGGGTATGGCTTCATAGCCTAGGACAATATATTTATGAAACCTAT
C10             TCCCTAGGATGTGGCTCCATGGATTAGGACAATATATCTATGAAACTTAT
C11             TTCCTAGAATATGGCTCCATAGCTTAGGGCAGTATATCTATGAAACTTAT
C12             TTCCTAGGGTATGGCTTCACGGCTTAGGGCAACACATCTATGAAACTTAT
C13             TTCCTAGGCCTTGGCTCCATGGCTTAGGACAGTACATCTATGACACTTAT
C14             TTCCTAGGGATTGGCTCCATAGCTTAGGACAATATATCTATGAAACTTAT
C15             TTCCTATGCTGTGGCTCAATGGATTAGGAGAATATCGCTATAACACATAT
C16             TTCCTAGACCTTGGCTTCATGGCTTAGGACAACATATCTATGAAACCTAT
C17             TTCCTAGACCATGGCTCCATAGTATGGGACAATATATCTATGAAACCTAT
C18             TTCCTAGACCATGGCTTCATGGCATAGGACAGTATGTCTATGAAACCTAT
C19             TTCCTAGACCATGGCTTCATGGCTTAGGACAATATGTCTATGACACCTAT
C20             TTCCTAGGGTTTGGCTCCACGGCTTAGGGCAACATATCTATGAAACTTAT
C21             TTCCTAGGCCCTGGCTTCATGGCTTAGGACAGTACATCTATGACAATTAC
C22             TTCCTAGGCCCTGGCTCCATGGCTTAGGACAGTACATCTATAACAATTAT
C23             TTCCTATAACATGGCTCCATAGCTTAGGGCAATATATCTATACAACTTAT
C24             TTCCTAGGATTTGGCTCCACGGCTTAGGGCAGCATATCTATGAAACTTAT
C25             TTCCTAGGACATGGCTCCATAGCTTAGGGCAACATATCTATGAAACTTAT
C26             TTCCTAGGACTTGGCTTCATGGCTTAGGACAACATATCTATAACACCTAT
C27             TTCCTAGACCATGGCTCCATAGCTTAGGACAGTATATCTATGAAACCTAT
C28             TTCCTAGGCCATGGCTCCATGGCTTAGGACAACATATCTATGAAACTTAT
C29             TTCCTAGGGTATGGCTACATGGTCTAGGGCAGCATATCTATGAAACTTAT
C30             TTCCTAGGCCCTGGCTCCATAGCTTAGGACAGCACATCTATGACACTTAT
C31             TTCCTAGGCCCTGGCTCCATGGCTTAGGACAATACATCTATTCCAATTAT
C32             TTCCTAGACCATGGCTTCATAGCTTAGGACAGCATATCTATGAAACTTAT
C33             TTCCTAGACCATGGCTTCATGGCTTAGGACAATATATCTATGAAACCTAT
C34             TTCCTAGACCGTGGCTCCATAACTTAGGACAGCATATATATGAAACCTAT
C35             TTCCTAGACCATGGCTCCTTAGCTTAGGCCAATACATCTATGAAACTTAT
C36             TTCCTAGACCATGGCTCCATAACTTAGGACAATATATCTATGAAACCTAT
C37             TTCCTAGGCCATGGCTTCATAGCCTAGGACAACATATTTATAACACATAT
C38             TTCCTAGACCATGGCTTCATGGCTTAGGACAATATGTCTATGAAAATTAT
C39             TTCCTAGGCCATGGCTCCATAGCTTAGGCCAATATATCTATGAAACATAT
C40             TTCCTAGGGAATGGCTCCATAGCTTAGGGCAATATATCTATGACACTTAT
C41             TTCCTAGGCCCTGGCTCCATGGCTTAGGACAGTACATCTATAACACTTAT
C42             TTCCTAGGGTATGGCTCCATGGCTTAGGACAACATATCTATGAAACTTAT
C43             TTCCTAGACCATGGCTCCATATCTTAGGACAGTATATCTATGATACCTAT
C44             TTCCTAGGCCATGGCTCCATGGCTTGGGCCAACATATCTATGAAACTTAT
C45             TTCCTAGGCCTTGGCTTCATGGATTAGGGCAACATATCTATGAAACTTAT
C46             TCCCTAGGGTGTGGCTCCATGGCTTAGGGCAACATATCTATGAAACTTAT
C47             TTCCTAGGGTATGGCTCCATGGGTTGGGACAACTTATCTATGAAACATAT
C48             TTCCCAGGATATGGCTCCATAGCTTAGGGCAATATATCTATGAAACTTAT
C49             TTCCTAGACCATGGCTCCATGACTTAGGACAGTATATCTATGAAACCTAT
C50             TTCCTAGGACCTGGCTCCATAGCCTAGGACAACATATTTATGAAACCTAT
                * ** . .   ***** .: .   *.**  *. :    *** . *. ** 

C1              GGGGATACTTGGGAAGGAGTTGAAGCTATAATAAGAATGCTACAACAACT
C2              GGGGATACTTGGGCAGGAGTCGAAGCTCTGCTAAGAATACTGCAACAACT
C3              GGGGATACTTGGGAAGGGGTTGAAGCTATAATAAGAACATTGCAACAACT
C4              GGGGATACTTGGGAAGGAGTTGAAGCTATAGTAAGAATGTTGCAACATTT
C5              GGAGATACTTGGGCAGGAGTGATAGCCATAATAAGAATCCTGCAACAACT
C6              GGGGATACTTGGACAGGAGTTGAAGCTATGATAAGAATTCTGCAACAACT
C7              GGGGATACTTGGGCAGGAGTGGAAGCCATAATAAGAATACTGCAACAACT
C8              GGAGATACTTGGGCAGGAGTCGAAGCTATAATAAGAATACTGCAACAGTT
C9              GGGGATACCTGGACAGGAGTTGAAGCTATAATAAGAATCCTTCAACAGCT
C10             GGGGATACTTGGGAAGGAGTGGAAGCCATAATAAGAATACTACAACAACT
C11             GGGGATACGTGGACAGGGGTGGAAGCCCTAGTAAGGATTCTGCAACAACT
C12             GGGGACACTTGGGCAGGAGTGGAAGCCATAATAAGAATCCTGCAACAACT
C13             GGGGATACTTGGGAAGGGGTCGAAGCTATAATAAGAATTTTGCAGCAACT
C14             GGGGATACCTGGGCAGGAGTGGAAGCCCTAATAAGAATTCTGCAACAACT
C15             GGGGATACTGGGGCAGGGGTTGAAGCTTTACTAAGAATCCTGCAACAAAT
C16             GGAGATACTTGGACGGGAGTGGAAGTTATAATAAGAATTCTGCAACAACT
C17             GGGGATACTTGGACGGGAGTCGAAATGATAATAAGAATTCTGCAGCAATT
C18             GGGGACACTTGGACGGGAGTTGAAGTGATAATAAGAATTCTGCAACAATT
C19             GGGGATACTTGGGCAGGAGTTGAAGCTATAATAAGAATACTGCAACAATT
C20             GGAGATACTTGGACAGGAGTGGAAGCCCTAGTAAGAAGTCTGCAACAACT
C21             GGGGATACTTGGGAAGGGGCTGTAGCTATAATAAGAATATTGCAACAACT
C22             GGGGATACTTGGGAAGGGGTTGAAGCTATAATAAGAATTTTGCAACAACT
C23             GGAGATACTTGGGCAGGAGTGGAAGCCATAATAAGAATTCTGCAACAACT
C24             GGGGATACTTGGACAGGAGTGGAAGCCTTAATAAGAATTCTGCAACAACT
C25             GGGGATACTTGGACAGGAGTGATGGCCTTAATAAGAATGCTGAATCAACT
C26             GGGGATACTTGGGAGGGAGTTGAAGATATAATAAGGATCTTGCAACAACT
C27             GGGGATACTTGGGCAGGAGTTGAAGCGCTAACAAGAATACTGCAACAACT
C28             GGGGATACTTGGGCAGGAGTGGAAGCTATAATAAGAATTCTGCAACAACT
C29             GGGGATACTTGGGCAGGAGTGGAACTCATAATAAGAATCCTGCAACAACC
C30             GGAGATACTTGGGAAGGGGTTGAAGCTATAATCAGAATTTTGCAACAACT
C31             GGGGATACTTGGGAAGGGGTTCAAGCTATGATAAGGATTTTGCAACAACT
C32             GGGGATACTTGGACAGGAGTGGAAGCCATAATAAGAATACTGCAACAACT
C33             GGAGATACTTGGACAGGAGTTGAAAATATGATAAGAATGCTGCAACAATT
C34             GGGGATACTTGGGCAGGAGTCGAAAGTCTACTAAGAATATTGCAACAACT
C35             GGGGACACTTGGGCAGGAGTGGAAGCCATAACAAGAATTCTGCAACAACT
C36             GGAGATACCTGGATGGGAGTCGAAGCTCTGATAAGAACTCTGCAACAACT
C37             GGGGATACTTGGGAAGGAGTTGAGGCTATAATAAGGATATTACAACAACT
C38             GGGGATACTTGGACAGGAGTCGAAACTATAATAAGAATACTGCAACAATT
C39             GGGGATACTTGGGCAGGAGTGGAAGCCATAATAAGAATACTGCAACAACT
C40             GGGGATACTTGGGCAGGAGTGGAAGCCCTAATAAGAATTCTACAACAACT
C41             GGGGACACTTGGGAAGGGGTTGAAGCTATAACAAGAATTTTGCAACAACT
C42             GGGGATACTTGGGCAGGAGTGGAAGCCATAATAAGAATTCTGCAGCAACT
C43             GGAGATACTTGGACAGGAGTTGAAGCTCTAATAAGAACATTACAACAGCT
C44             GGAGATACTTGGGCAGGAGTGGAAGCCATAATAAGAATTCTGCAACAACT
C45             GGGGATACTTGGGCAGGAGTAGAAGCCATAATAAGAATTCTGCAACAACT
C46             GGGGATACTTGGGCAGGAGTGGAAGCCATAATAAGAACTCTGCAACAACT
C47             GGGGATACTTGGGCAGGAGTAGAAGCCTTAGTAAGAACTCTGCAACAACT
C48             GGAGATACTTGGACAGGAGTGGAAGCTCTCATAATACATCTGCAACAACT
C49             GGGGATACTTGGACAGGAGTCGAAGCAATAATAAGAATACTGCAACAACT
C50             GGGGATACCTGGGCAGGAGTTGAAGCTATAACAAGAATTCTGCAACGATT
                **.** **  **. .**.*   :.    *   .* ..   * .* *.   

C1              ACTGTTTATCCATTACAGAATCGGGTGCCAACATAGCAGAATAGGCATTA
C2              ACTGTTTATTCATTACAGAATTGGGTGCCAGCATAGCAGAATAGGAATTT
C3              ACTGTTTGTTCATTTCAGAATTGGGTGTCAACATAGCAGAATAGGCATTA
C4              ATTGTTTGTGCATTTCAGAATTGGGTGTCAACATAGCAGAATAGGCATTA
C5              GCTGTTTACTCATTTCAGAATTGGGTGTCAACATAGCAGAATAGGCATCC
C6              GCTGTTTGTTCATTTCAGAATTGGGTGCCAACACAGCAGAATAGGCATTT
C7              GCTGTTTATCCATTTCAGAATTGGGTGTCAACATAGCAGAATAGGAGTTA
C8              ACTGTTTATTCATTTCAGAATTGGGTGTCAACATAGCAGAATAGGCATCC
C9              ACTGTTTATCCATTTCAGAATTGGGTGTCACCATAGCAGAATAGGCATTA
C10             GCTGTTTACTCATTTTAGAATTGGCTGTCAACATAGCAGAATAGGCATTA
C11             GCTGTTTATTCATTTCAGAATTGGGTGTCAACATAGCAGAATAGGCATTA
C12             GCTGTTTATCCATTTCAGAATTGGGTGTCGACATAGCAGAATAGGCATTA
C13             ACTGTTTATTCATTTCAGAATTGGGTGTCAACATAGCAGAATAGGCATTA
C14             GCTGTTTATTCATTTCAGAATTGGATGTCAACATAGCAGAATAGGCATTA
C15             ACTGTTCATTCATTTCAGAATTGGGTGTCAACATAGCAGAATAGGCATCA
C16             ACTGTTTATCCATTTCAGAATTGGGTGCCGGCATAGCCGAATAGGCATTA
C17             ACTGTTTATTCATTTCAGAATTGGGTGCCAGCATAGCAGAATAGGCATTT
C18             ACTGTTTATTCATTTCAGAATTGGGTGCCAACATAGCAGAATAGGCATTA
C19             ACTGTTTATTCATTTCAGAATTGGGTGCCATCATAGTAGAATAGGCATTG
C20             GCTGTTTATTCATTTCAGAATTGGGTGTCGTCATAGCAGAATAGGCATTG
C21             ACTGTTTGTTCATTTCAGGATTGGGTGTCAACATAGCAGGATAGGCATTA
C22             ACTGTTTGTTCATTTCAGAATTGGGTGTCAACATAGCAGAATAGGCATTA
C23             GTTGTTTATTCATTTCAGAATTGGGTGCCAACATAGCAGAATAGGCATTA
C24             GCTGTTTATTCATTTCAGAATTGGGTGTCGACATAGCAGAATAGGCATTA
C25             GCTGTTTATTCATTTCAGAATTGGGTGTCGACACAGCAGAATAGGCATTA
C26             ACTGTTTATCCATTTCAGAATTGGGTGCCACCATAGCAGAATAGGCATTA
C27             ACTGTTTATTCATTTCAGAATTGGGTGTCGTCATAGCAGAATAGGAGTTT
C28             GATGTTTATTCATTTCAGAATTGGATGTCAACATAGCAGAATAGGTATTC
C29             GCTATTTATCCATTTCAGAATTGGGTGTCGACATAGCAGAATAGGCATTT
C30             AATATTTGTTCATTTCAGAATTGGGTGTCAACATAGCAGAATAGGCATTA
C31             ACTGTTTGTTCATTTCAGAATTGGGTGTCAACATAGCAGAATAGGCATTA
C32             GCTGTTTATTCATTTCAGAATTGGGTGCCAACATAGCAGAATAGGCATTA
C33             ATTGTTTATTCATTTCAGGATTGGGTGCCAGCATAGCAGAATAGGCATTA
C34             ACTGTTCATTCATTTCAGAATTGGGTGTCAGCATAGCCGAATAGGAATAT
C35             GCTGTTTATTCATTTCAGAATTGGATGTCAACATAGCAGAATAGGCATTA
C36             ATTGTTTATTCATTTCAGAATTGGGTGCCATCACAGCAGAATAGGCATTA
C37             GCTGTTTATCCATTTCAGAATTGGGTGCCATCATAGCAGAATAGGCATCC
C38             ACTGTTTATTCATTTCAGAATTGGGTGCCAGCATAGCAGAATAGGCATTA
C39             GTTATTTATTCATTTCAGAATTGGGTGTCGCCATAGCAGAATAGGCATTA
C40             GCTGTTTATTCATTTCAGAATTGGGTGTCGACATAGCAGAATAGGCATTA
C41             ACTGTTTATTCATTTCAGAATTGGGTGTCAGCATAGCAGAATAGGCATTT
C42             GCTGTTTATTCATTCCAGAATTGGATGTCATCATAGCAGAATAGGCGTTA
C43             ACTGTTTATGCATTTCAGAATTGGGTGCCAGCATAGCAGAATAGGAGCCA
C44             GTTGTTTATTCATTTCAGAATTGGGTGTCGACATAGCAGAATAGGCATTA
C45             GCTGTTTATTCATTTCAGAATTGGGTGTCAACATAGCAGGATAGGCATTA
C46             ACTGTTTATTCATTTCAGAATTGGGTGTCGACATAGCAGAATAGGCATTA
C47             GCTGTTTATTCATTTCAGAATTGGGTGTCAACATAGCAGAATAGGCATTA
C48             GCTGTTTGTTCATTTCAGAATTGGGTGTCAACATAGCAGAATAGGCATTT
C49             ACTGTTTATTCATTTCAGAATTGGGTGCCAACATAGCAGAATAGGAATTT
C50             ACTGTTTATTCATTTCAGAATTGGGTGTCAACATAGCAGAATAGGTGTTG
                . *.** .  ****  **.** ** ** *. ** ** .*.***** .   

C1              TC------CCACAGAGAAGAGTAAGGGATGGACCCAGTAGACCC------
C2              TA------CAACAGAGAAGAGCAAGAAATGGAACCAGTAGATCC------
C3              TA------CCAGGGAGAAGAGGCAGGAATGGAGCCGGTAGATCC------
C4              TT---CGAGGGAGGAGAAGAGTCAGGGATGGAGCCGGTAGATCC------
C5              TG------CAACGGAGGAGAGCAAGAAATGGAGCCAGTAGATCC------
C6              TG------CGACAGAGAAGAGCAAGAAATGGAGCCAATAGATCC------
C7              TT------CGACAGAGGAGAGCAAGAAATGGAGCCAGTAGATCC------
C8              TG------CGACAGAGGAGAACAAGAAATGGAGCCAGTAGATCA------
C9              TG------CGACAGAGAAGAACAAGAAATGGAGCCAGTAGATCC------
C10             TT------CGACAGAGGAGAGCGAGAAATGGAGCCAGTAGATCC------
C11             TT------CAACGGAGGAGACCAAGAAATGGAGCCCGTAGATCC------
C12             CT------CCACAGAGGAGAACAAGAAATGGATCCAGTAGATCC------
C13             TA------CCAGGGAGAAGAGGCAGGAATGGAGCCGGTAGATCC------
C14             TT------CGACAAAGGAGAGCAAGGAATGGATCCAGTAGATCC------
C15             CT------CCACAGAGAAGAGCAAGAAATGGATCCAGTAGATCC------
C16             TG------AGACAGAGAAGAGCAAGAAATGGAGCCAGTAGATCC------
C17             TG------CGACAGAGAAGAGCAAGAAATGGAGCCAATAGATCC------
C18             TG------CGACAGAGAAGAGCAAGAAATGGAGCCAATAGATCC------
C19             TG------ATACAGAGAAGAGCAAGAAATGGAGCCAGTAGATCC------
C20             CTATTGGTCGACGGACGAGAGCAAGAAATGGAGCCAGTAGACCC------
C21             CA------CCAGGGAGAAGAGGCAGGAATGGAGCTGGTAGATCC------
C22             CG------CCAGGGAGAAGAGGCAGGAATGGAGGTGGTAGATCC------
C23             TT------CGAGGGAGAAGAGGCAGGAATGGATCCGGTAGATCC------
C24             CT------CCACAGAGGAGAGCAAGAAATGGAGCCCGTAGATCC------
C25             TG------CAACACAGGAGACCAAGAAATGGAGCCAGTAGATCC------
C26             CT------CGACAGAGAAGAGCAAGGAATGGAGCCAGTAGATCC------
C27             GG------AGACAGAGAAGAGTGAGAAATGGAGCCAGTAGATCC------
C28             TA---------CAGAGGAGAACAAGGAATGGAGCCAATAGATCC------
C29             CT------CCACAGAGGAGAGCAAGAAATGGATCCAGTAGATCC------
C30             TA------CCAGGGAGAAGAGGCAGGAATGGAGCCGGTAGATCC------
C31             CG------CCAGGGAGAAGAGGCAGGAATGGAGCTGGTAGATCC------
C32             CT------CCACGGAGGAGACCAAGAAATGGATCCAGTAGATCC------
C33             TG------AGACAGAGAAGAGCAAGAAATGGAGCCAGTAGACCC------
C34             TG------CGGCAGAGGAGAGGAAGAAATGGAGCCAGTAGATCC------
C35             TT------CCACAGAGGAGATCAAGAAATGGAGCCAGTAGATCC------
C36             TG------CGACAGAGAAGAGCAAGAAATGGAACCAGTAGATCC------
C37             TT------CGACAGGCAAGGTTAAGACATGGATCCAATAGACCC------
C38             TG------AGACAAAGAAGAGCAAGAAATGGAGCCAGTAGATCC------
C39             TG------CGGCAGAGGAGAACAAGAAATGGAGCCAGTAGATCC------
C40             TT------CGACAGAGGCGAACAAGCAATGGAGCCAGTGGATCC------
C41             TG------CCAGGGAGAAGAGGCAGGAATGGAGCCGGTAGATCC------
C42             TT------CGACAGAGGAGAGCAAGAATTGGAGACAGAAGATCCTAC---
C43             CG------CCACAAAGAAGAGCAAGAAATGGAGCCAATAGATCC------
C44             CT------------CGGAGAGCAAGAAATGGAGCCAGTAGATCC------
C45             CG------CGA---CGGAGGACAAGAAATGGAACCAGTAGATCC------
C46             CT------CCACAGAGGAGAACAAGAAATGGAGCCAGTAGATCC------
C47             CT------CAACGGAGGAGAGCAAGAAATGGAGCCAGTAGATCC------
C48             TA------CAACGGAGGAGAGCAAGAAATGGAGCCAGTAGACCC------
C49             TA------CGACAGAGAAGAGCAAGAAATGGAGCCAGTAGATCC------
C50             TT------CGACAGAGAAGAGCAAGAAATGGATCCAGTAGATCC------
                                ..*.   **  :****    .:.** *.      

C1              ---------
C2              ---------
C3              ---------
C4              ---------
C5              ---------
C6              ---------
C7              ---------
C8              ---------
C9              ---------
C10             ---------
C11             ---------
C12             ---------
C13             ---------
C14             ---------
C15             ---------
C16             ---------
C17             ---------
C18             ---------
C19             ---------
C20             ---------
C21             ---------
C22             ---------
C23             ---------
C24             ---------
C25             ---------
C26             ---------
C27             ---------
C28             ---------
C29             ---------
C30             ---------
C31             ---------
C32             ---------
C33             ---------
C34             ---------
C35             ---------
C36             ---------
C37             ---------
C38             ---------
C39             ---------
C40             ---------
C41             ---------
C42             ---------
C43             ---------
C44             ---------
C45             ---------
C46             ---------
C47             ---------
C48             ---------
C49             ---------
C50             ---------
                         



>C1
ATGGAACAAGCCCCAGAAAACCAAGGGCCACAGAGAGAACCCTACAATGA
ATGGGCATTGGAACTGTTAGAAGAGCTTAAAAATGAAGCTGTTAGACATT
TTCCTAGGCCCTGGCTTCATGGCTTAGGACAGTATATCTATAACACTTAT
GGGGATACTTGGGAAGGAGTTGAAGCTATAATAAGAATGCTACAACAACT
ACTGTTTATCCATTACAGAATCGGGTGCCAACATAGCAGAATAGGCATTA
TC------CCACAGAGAAGAGTAAGGGATGGACCCAGTAGACCC------
---------
>C2
ATGGAACAACCCCCAGAAGATCAAGGGCCGCAGAGGGAGCCATACAATGA
ATGGGCACTAGAGATTCTAGAGGAACTCAAGCAGGAAGCTGTCAGGCACT
TTCCTAGACCATGGCTCCATAGCTTAGGGCAGTATATCTATGAAACTTAT
GGGGATACTTGGGCAGGAGTCGAAGCTCTGCTAAGAATACTGCAACAACT
ACTGTTTATTCATTACAGAATTGGGTGCCAGCATAGCAGAATAGGAATTT
TA------CAACAGAGAAGAGCAAGAAATGGAACCAGTAGATCC------
---------
>C3
ATGGAACAAGCCCCAGAAGATCAGGGGCCACAGAGAGAACCCCACAATGA
GTGGACATTAGAACTTTTAGAGGAGCTTAAAACTGAGGCTGTTAGACATT
TTCCTAGGCCCTGGCTCCATGGCTTAGGACAGTACATCTATAACACTTAT
GGGGATACTTGGGAAGGGGTTGAAGCTATAATAAGAACATTGCAACAACT
ACTGTTTGTTCATTTCAGAATTGGGTGTCAACATAGCAGAATAGGCATTA
TA------CCAGGGAGAAGAGGCAGGAATGGAGCCGGTAGATCC------
---------
>C4
ATGGAACAAGCCCCAGAAGACCAGGGGCCACAGAGGGAGCCATACAATGA
ATGGATGTTAGAACTGTTGGAAGATCTTAAGCAGGAAGCTGTTAGACATT
TTCCTAGGCCTTGGCTCCATGGATTAGGACAACATATCTATGAAACCTAT
GGGGATACTTGGGAAGGAGTTGAAGCTATAGTAAGAATGTTGCAACATTT
ATTGTTTGTGCATTTCAGAATTGGGTGTCAACATAGCAGAATAGGCATTA
TT---CGAGGGAGGAGAAGAGTCAGGGATGGAGCCGGTAGATCC------
---------
>C5
ATGGAACAAGCCCCAGAAGACCAAGGGCCGCAAAGGGAGCCATATAATGA
ATGGACACTAGAGCTTTTAGGGGAGCTTAAGAATGAAGCTGTTAGGCATT
TCCCTGGGCCATGGCTTCATGGCTTAGGGCAGTATATCTATGCAACTTAT
GGAGATACTTGGGCAGGAGTGATAGCCATAATAAGAATCCTGCAACAACT
GCTGTTTACTCATTTCAGAATTGGGTGTCAACATAGCAGAATAGGCATCC
TG------CAACGGAGGAGAGCAAGAAATGGAGCCAGTAGATCC------
---------
>C6
ATGGAACAACCCCCAGAAGACCAGGGGCCGCAGAGGGAACCATACAATGG
ATGGACACTAGAGCTTTTAGAGGAACTCAAGCAGGAAGCTGTCAGACACT
TTCCTAGACCATGGCTCCATAGCTTAGGACAACATATCTATGCAACCTAT
GGGGATACTTGGACAGGAGTTGAAGCTATGATAAGAATTCTGCAACAACT
GCTGTTTGTTCATTTCAGAATTGGGTGCCAACACAGCAGAATAGGCATTT
TG------CGACAGAGAAGAGCAAGAAATGGAGCCAATAGATCC------
---------
>C7
ATGGAACAAGCCCCAGAAGACCAAGGGCCACAGAGGGAGCCATACAATGA
GTGGACACTAGAACTTTTAGAGGAGCTTAAGAGTGAAGCTGTTAGACATT
TTCCTAGGATATGGCTACATAGCCTAGGACAGTATATCTATGAAACTTAT
GGGGATACTTGGGCAGGAGTGGAAGCCATAATAAGAATACTGCAACAACT
GCTGTTTATCCATTTCAGAATTGGGTGTCAACATAGCAGAATAGGAGTTA
TT------CGACAGAGGAGAGCAAGAAATGGAGCCAGTAGATCC------
---------
>C8
ATGGAACAAACCCCAGAAGACCAGGGGCCACAGAGGGAGCCATACAATGA
GTGGGCACTAGAGCTTTTAGAAGAACTTAAGCAGGAAGCTGTCAGACACT
TTCCTAGACCATGGCTCCATAGCTTAGGACAACATATCTATAACACCTAT
GGAGATACTTGGGCAGGAGTCGAAGCTATAATAAGAATACTGCAACAGTT
ACTGTTTATTCATTTCAGAATTGGGTGTCAACATAGCAGAATAGGCATCC
TG------CGACAGAGGAGAACAAGAAATGGAGCCAGTAGATCA------
---------
>C9
ATGGAACAAGCCCCAGAAGACCAAGGGCCACAGAGGGAGCCATACAATGA
ATGGACATTAGAGCTTTTAGAGGAGCTTAAGAGTGAAGCTGTTAGACACT
TCCCTAGGGTATGGCTTCATAGCCTAGGACAATATATTTATGAAACCTAT
GGGGATACCTGGACAGGAGTTGAAGCTATAATAAGAATCCTTCAACAGCT
ACTGTTTATCCATTTCAGAATTGGGTGTCACCATAGCAGAATAGGCATTA
TG------CGACAGAGAAGAACAAGAAATGGAGCCAGTAGATCC------
---------
>C10
ATGGAACAAGCCCCGGAAGACCAAGGGCCACAGAGGGAACCATACAATGA
ATGGACACTAGAGCTTTTAGAGGAGCTCAAGAATGAAGCTGTTAGACATT
TCCCTAGGATGTGGCTCCATGGATTAGGACAATATATCTATGAAACTTAT
GGGGATACTTGGGAAGGAGTGGAAGCCATAATAAGAATACTACAACAACT
GCTGTTTACTCATTTTAGAATTGGCTGTCAACATAGCAGAATAGGCATTA
TT------CGACAGAGGAGAGCGAGAAATGGAGCCAGTAGATCC------
---------
>C11
ATGGAACAAGCCCCAGAAGACCAAGGGCCACAGAGGGAGCCATACAATGA
CTGGACACTAGAGCTTTTAGAGGAGCTTAAGAGTGAAGCTGTCAGACATT
TTCCTAGAATATGGCTCCATAGCTTAGGGCAGTATATCTATGAAACTTAT
GGGGATACGTGGACAGGGGTGGAAGCCCTAGTAAGGATTCTGCAACAACT
GCTGTTTATTCATTTCAGAATTGGGTGTCAACATAGCAGAATAGGCATTA
TT------CAACGGAGGAGACCAAGAAATGGAGCCCGTAGATCC------
---------
>C12
ATGGAACAAGCCCCGGGAGATCAAGGGCCACAGAGGGAGCCATACAATGA
ATGGACACTAGAACTTTTAGAGGAGCTTAAAAATGAAGCTGTTAGACATT
TTCCTAGGGTATGGCTTCACGGCTTAGGGCAACACATCTATGAAACTTAT
GGGGACACTTGGGCAGGAGTGGAAGCCATAATAAGAATCCTGCAACAACT
GCTGTTTATCCATTTCAGAATTGGGTGTCGACATAGCAGAATAGGCATTA
CT------CCACAGAGGAGAACAAGAAATGGATCCAGTAGATCC------
---------
>C13
ATGGAACAAAGCCCAGAAGACCAGGGGCCACAGAGAGAACCCTTCAATGA
ATGGGCATTAGAGCTGTTAGAGGAGCTTAAAAATGAAGCTGTTAGACATT
TTCCTAGGCCTTGGCTCCATGGCTTAGGACAGTACATCTATGACACTTAT
GGGGATACTTGGGAAGGGGTCGAAGCTATAATAAGAATTTTGCAGCAACT
ACTGTTTATTCATTTCAGAATTGGGTGTCAACATAGCAGAATAGGCATTA
TA------CCAGGGAGAAGAGGCAGGAATGGAGCCGGTAGATCC------
---------
>C14
ATGGAACAAGCCCCAGAAAACCAAGGGCCGCAGAGAGAGCCATACCATGA
ATGGACACTAGAACTTCTAGAGGAACTTAAGAATGAAGCTGTTAGACATT
TTCCTAGGGATTGGCTCCATAGCTTAGGACAATATATCTATGAAACTTAT
GGGGATACCTGGGCAGGAGTGGAAGCCCTAATAAGAATTCTGCAACAACT
GCTGTTTATTCATTTCAGAATTGGATGTCAACATAGCAGAATAGGCATTA
TT------CGACAAAGGAGAGCAAGGAATGGATCCAGTAGATCC------
---------
>C15
ATGGAACAAGCCCCAGAAGACCAAGGGCCACAGAGGGAGCCGTCCAATGA
ATGGACACTAGAACTGTTAGAAGAGCGTAAGCATGAAGGAGTTAGGAATT
TTCCTATGCTGTGGCTCAATGGATTAGGAGAATATCGCTATAACACATAT
GGGGATACTGGGGCAGGGGTTGAAGCTTTACTAAGAATCCTGCAACAAAT
ACTGTTCATTCATTTCAGAATTGGGTGTCAACATAGCAGAATAGGCATCA
CT------CCACAGAGAAGAGCAAGAAATGGATCCAGTAGATCC------
---------
>C16
ATGGAACAAGCCCCAGAAGATCAGGGACCACAGAGGGAGCCATATAATGA
ATGGACACTAGAACTTTTAGAGGAGCTCAAGCAGGAAGCTGTCAGACACT
TTCCTAGACCTTGGCTTCATGGCTTAGGACAACATATCTATGAAACCTAT
GGAGATACTTGGACGGGAGTGGAAGTTATAATAAGAATTCTGCAACAACT
ACTGTTTATCCATTTCAGAATTGGGTGCCGGCATAGCCGAATAGGCATTA
TG------AGACAGAGAAGAGCAAGAAATGGAGCCAGTAGATCC------
---------
>C17
ATGGAACAAGCCCCAGAAGATCAGGGGCCGCAGAGGGAACCATACAATGA
ATGGACACTAGAGCTTTTAGAAGAGCTCAAGCAGGAAGCTGTCAGACACT
TTCCTAGACCATGGCTCCATAGTATGGGACAATATATCTATGAAACCTAT
GGGGATACTTGGACGGGAGTCGAAATGATAATAAGAATTCTGCAGCAATT
ACTGTTTATTCATTTCAGAATTGGGTGCCAGCATAGCAGAATAGGCATTT
TG------CGACAGAGAAGAGCAAGAAATGGAGCCAATAGATCC------
---------
>C18
ATGGAACAACCCCCAGAAGACCAGGGGCCGCAGAGGGAACCATACAATGA
ATGGACATTAGAGATACTAGAGGAACTCAAGCAGGAAGCTGTCAGACACT
TTCCTAGACCATGGCTTCATGGCATAGGACAGTATGTCTATGAAACCTAT
GGGGACACTTGGACGGGAGTTGAAGTGATAATAAGAATTCTGCAACAATT
ACTGTTTATTCATTTCAGAATTGGGTGCCAACATAGCAGAATAGGCATTA
TG------CGACAGAGAAGAGCAAGAAATGGAGCCAATAGATCC------
---------
>C19
ATGGAACAACCCCCAGAAGATCAGGGGCCGCAGAGGGAACCATTTAATGA
ATGGACACTAGAGCTTCTAGAGGAACTCAAACAGGAAGCTGTCAGACACT
TTCCTAGACCATGGCTTCATGGCTTAGGACAATATGTCTATGACACCTAT
GGGGATACTTGGGCAGGAGTTGAAGCTATAATAAGAATACTGCAACAATT
ACTGTTTATTCATTTCAGAATTGGGTGCCATCATAGTAGAATAGGCATTG
TG------ATACAGAGAAGAGCAAGAAATGGAGCCAGTAGATCC------
---------
>C20
ATGGAACAAGCCCCAGAAGATCAAGGGCCACAAAGGGAACCATACAATGA
GTGGACACTAGAGCTTTTAGAGGAGCTTAAGAATGAAGCTGTTAGACACT
TTCCTAGGGTTTGGCTCCACGGCTTAGGGCAACATATCTATGAAACTTAT
GGAGATACTTGGACAGGAGTGGAAGCCCTAGTAAGAAGTCTGCAACAACT
GCTGTTTATTCATTTCAGAATTGGGTGTCGTCATAGCAGAATAGGCATTG
CTATTGGTCGACGGACGAGAGCAAGAAATGGAGCCAGTAGACCC------
---------
>C21
ATGGAACAAGCCCCAGAAGATCAGAGGCCACAGAGAGAGCCCCAC-----
-TGGACATTAGAACTGTTAGAAGAGCTTAAGAATGAAGCTGTTAGACACT
TTCCTAGGCCCTGGCTTCATGGCTTAGGACAGTACATCTATGACAATTAC
GGGGATACTTGGGAAGGGGCTGTAGCTATAATAAGAATATTGCAACAACT
ACTGTTTGTTCATTTCAGGATTGGGTGTCAACATAGCAGGATAGGCATTA
CA------CCAGGGAGAAGAGGCAGGAATGGAGCTGGTAGATCC------
---------
>C22
ATGGAACAAGCCCCAGAAGATCAGGGGCCACCCAGAGAACCCCACAATGA
ATGGACATTAGAACTGTTAGAGGAGCTTAAAAATGAAGCTGTTAGACATT
TTCCTAGGCCCTGGCTCCATGGCTTAGGACAGTACATCTATAACAATTAT
GGGGATACTTGGGAAGGGGTTGAAGCTATAATAAGAATTTTGCAACAACT
ACTGTTTGTTCATTTCAGAATTGGGTGTCAACATAGCAGAATAGGCATTA
CG------CCAGGGAGAAGAGGCAGGAATGGAGGTGGTAGATCC------
---------
>C23
ATGGAACAAGCCCCAGAAGACCAAGGACCACAGAGGGAGCCATACAATGA
ATGGACACTAGAGCTTTTAGAGGAGCTTAAGAATGAAGCTGTTAGACATT
TTCCTATAACATGGCTCCATAGCTTAGGGCAATATATCTATACAACTTAT
GGAGATACTTGGGCAGGAGTGGAAGCCATAATAAGAATTCTGCAACAACT
GTTGTTTATTCATTTCAGAATTGGGTGCCAACATAGCAGAATAGGCATTA
TT------CGAGGGAGAAGAGGCAGGAATGGATCCGGTAGATCC------
---------
>C24
ATGGAACAAGCCCCAGAAGACCAAGGGCCACAGAGGGAGCCATACAATGA
ATGGACACTAGAGCTTTTAGAGGAGCTTAAGAATGAAGCAGTTAGACACT
TTCCTAGGATTTGGCTCCACGGCTTAGGGCAGCATATCTATGAAACTTAT
GGGGATACTTGGACAGGAGTGGAAGCCTTAATAAGAATTCTGCAACAACT
GCTGTTTATTCATTTCAGAATTGGGTGTCGACATAGCAGAATAGGCATTA
CT------CCACAGAGGAGAGCAAGAAATGGAGCCCGTAGATCC------
---------
>C25
ATGGAGCAAGCCCCGGAAGACCAAGGGCCACAGAGGGAGCCATACAATGA
ATGGACACTAGAGCTTTTAGAGGAGCTTAAGAGTGAAGCTGTTAGACACT
TTCCTAGGACATGGCTCCATAGCTTAGGGCAACATATCTATGAAACTTAT
GGGGATACTTGGACAGGAGTGATGGCCTTAATAAGAATGCTGAATCAACT
GCTGTTTATTCATTTCAGAATTGGGTGTCGACACAGCAGAATAGGCATTA
TG------CAACACAGGAGACCAAGAAATGGAGCCAGTAGATCC------
---------
>C26
ATGGAACAAGCCCCAGAAGACCAGGGACCACAGAGGGAGCCATACAATGA
ATGGACACTAGAGCTTTTAGAGGAGCTTAAGAATGAAGCTGTTAGACATT
TTCCTAGGACTTGGCTTCATGGCTTAGGACAACATATCTATAACACCTAT
GGGGATACTTGGGAGGGAGTTGAAGATATAATAAGGATCTTGCAACAACT
ACTGTTTATCCATTTCAGAATTGGGTGCCACCATAGCAGAATAGGCATTA
CT------CGACAGAGAAGAGCAAGGAATGGAGCCAGTAGATCC------
---------
>C27
ATGGAACAACCCCCAGAAGATCAGGGGCCGCAGAGGGAACCATACACTGA
ATGGGCATTAGAGATTCTAGAAGAACTCAAGCAGGAAGCTGTCAGACACT
TTCCTAGACCATGGCTCCATAGCTTAGGACAGTATATCTATGAAACCTAT
GGGGATACTTGGGCAGGAGTTGAAGCGCTAACAAGAATACTGCAACAACT
ACTGTTTATTCATTTCAGAATTGGGTGTCGTCATAGCAGAATAGGAGTTT
GG------AGACAGAGAAGAGTGAGAAATGGAGCCAGTAGATCC------
---------
>C28
ATGGAACAAGCCCCAGAAGACCAAGGGCCACAGAGGGAGCCATACAATGA
ATGGACACTAGAGCTTTTGGAGGAACTTAAGAATGAGGCTGTTAGACATT
TTCCTAGGCCATGGCTCCATGGCTTAGGACAACATATCTATGAAACTTAT
GGGGATACTTGGGCAGGAGTGGAAGCTATAATAAGAATTCTGCAACAACT
GATGTTTATTCATTTCAGAATTGGATGTCAACATAGCAGAATAGGTATTC
TA---------CAGAGGAGAACAAGGAATGGAGCCAATAGATCC------
---------
>C29
ATGGAACAAGCCCCAGAAGACCAAGGGCCACAGAGGGAGCCATACAATGA
ATGGACACTAGAGCTTTTAGAAGAGCTTAGGAGTGAAGCTGTTAGGCATT
TTCCTAGGGTATGGCTACATGGTCTAGGGCAGCATATCTATGAAACTTAT
GGGGATACTTGGGCAGGAGTGGAACTCATAATAAGAATCCTGCAACAACC
GCTATTTATCCATTTCAGAATTGGGTGTCGACATAGCAGAATAGGCATTT
CT------CCACAGAGGAGAGCAAGAAATGGATCCAGTAGATCC------
---------
>C30
ATGGAACAAACCCCAGAAGATCAGGGGCCACAGAGAGAACCCCACAATGA
ATGGACATTAGAACTATTAGAGGAGCTTAAAAATGAAGCTGTTAGACATT
TTCCTAGGCCCTGGCTCCATAGCTTAGGACAGCACATCTATGACACTTAT
GGAGATACTTGGGAAGGGGTTGAAGCTATAATCAGAATTTTGCAACAACT
AATATTTGTTCATTTCAGAATTGGGTGTCAACATAGCAGAATAGGCATTA
TA------CCAGGGAGAAGAGGCAGGAATGGAGCCGGTAGATCC------
---------
>C31
ATGGAACGAGCCCCAGAAGACCAGGGGCCACAGAGAGAACCCAACAATGA
ATGGACATTAGAGCTGTTAGAGGAACTTAAAAATGAAGCTGTTAGACACT
TTCCTAGGCCCTGGCTCCATGGCTTAGGACAATACATCTATTCCAATTAT
GGGGATACTTGGGAAGGGGTTCAAGCTATGATAAGGATTTTGCAACAACT
ACTGTTTGTTCATTTCAGAATTGGGTGTCAACATAGCAGAATAGGCATTA
CG------CCAGGGAGAAGAGGCAGGAATGGAGCTGGTAGATCC------
---------
>C32
ATGGAACAAGCCCCAGAGGACCAAGGGCCACAGAGGGAGCCATACAATGA
ATGGACACTAGAGCTTTTAGAAGAACTTAAAAGAGAAGCTGTCAGACATT
TTCCTAGACCATGGCTTCATAGCTTAGGACAGCATATCTATGAAACTTAT
GGGGATACTTGGACAGGAGTGGAAGCCATAATAAGAATACTGCAACAACT
GCTGTTTATTCATTTCAGAATTGGGTGCCAACATAGCAGAATAGGCATTA
CT------CCACGGAGGAGACCAAGAAATGGATCCAGTAGATCC------
---------
>C33
ATGGAACAACCCCCAGAAGATCAGGGGCCACAGAGGGAACCATACAATGT
ATGGACACTAGAGCTTCTAGAGGACCTCAAGCAAGAAGCTGTCAGACATT
TTCCTAGACCATGGCTTCATGGCTTAGGACAATATATCTATGAAACCTAT
GGAGATACTTGGACAGGAGTTGAAAATATGATAAGAATGCTGCAACAATT
ATTGTTTATTCATTTCAGGATTGGGTGCCAGCATAGCAGAATAGGCATTA
TG------AGACAGAGAAGAGCAAGAAATGGAGCCAGTAGACCC------
---------
>C34
ATGGAACAAACCCCAGAAGATCAGGGGCCGCAGAGGGAACCATACAATGA
ATGGACATTAGAGATTCTAGAGGAACTCAAGCAGGAAGCGGTCAGACACT
TTCCTAGACCGTGGCTCCATAACTTAGGACAGCATATATATGAAACCTAT
GGGGATACTTGGGCAGGAGTCGAAAGTCTACTAAGAATATTGCAACAACT
ACTGTTCATTCATTTCAGAATTGGGTGTCAGCATAGCCGAATAGGAATAT
TG------CGGCAGAGGAGAGGAAGAAATGGAGCCAGTAGATCC------
---------
>C35
ATGGAACAAGCCCCGGAAAACCAAGGACCACAGAGAGAG---------CA
ATGGGCACTAGAGCTTCTAGAGGAACTTAAGAATGAAGCTGTTAGGCATT
TTCCTAGACCATGGCTCCTTAGCTTAGGCCAATACATCTATGAAACTTAT
GGGGACACTTGGGCAGGAGTGGAAGCCATAACAAGAATTCTGCAACAACT
GCTGTTTATTCATTTCAGAATTGGATGTCAACATAGCAGAATAGGCATTA
TT------CCACAGAGGAGATCAAGAAATGGAGCCAGTAGATCC------
---------
>C36
ATGGAACAAGCCCCAGAAGACCAGGGGCCGCAGAGGGAACCATACAATGA
GTGGACACTAGAGCTTTTAGAGGAACTTAAGCAGGAAGCTGTCAGACACT
TTCCTAGACCATGGCTCCATAACTTAGGACAATATATCTATGAAACCTAT
GGAGATACCTGGATGGGAGTCGAAGCTCTGATAAGAACTCTGCAACAACT
ATTGTTTATTCATTTCAGAATTGGGTGCCATCACAGCAGAATAGGCATTA
TG------CGACAGAGAAGAGCAAGAAATGGAACCAGTAGATCC------
---------
>C37
ATGGAACAAGCCCCAGAAGACCAGGGACCGCAGAGGGAGCCACACAATGA
ATGGACACTAGAGCTTTTGGAGGAGCTCAAGGAGGAAGCTGTTAAACATT
TTCCTAGGCCATGGCTTCATAGCCTAGGACAACATATTTATAACACATAT
GGGGATACTTGGGAAGGAGTTGAGGCTATAATAAGGATATTACAACAACT
GCTGTTTATCCATTTCAGAATTGGGTGCCATCATAGCAGAATAGGCATCC
TT------CGACAGGCAAGGTTAAGACATGGATCCAATAGACCC------
---------
>C38
ATGGAACGACCCCCAGAAGATCATGGGCCGCAGAGGGAACCATACAATGA
ATGGACACTAGAGCTCCTAGAGGAACTCAAGCAGGAAGCGGTCAGACACT
TTCCTAGACCATGGCTTCATGGCTTAGGACAATATGTCTATGAAAATTAT
GGGGATACTTGGACAGGAGTCGAAACTATAATAAGAATACTGCAACAATT
ACTGTTTATTCATTTCAGAATTGGGTGCCAGCATAGCAGAATAGGCATTA
TG------AGACAAAGAAGAGCAAGAAATGGAGCCAGTAGATCC------
---------
>C39
ATGGAACGAGCCCCAGAAGACCAAGGGCCACAGAGAGAGCCATACAATGA
ATGGACACTAGAACTTTTAGAGGAGCTTAAGAGGGAAGCTGTTAGACATT
TTCCTAGGCCATGGCTCCATAGCTTAGGCCAATATATCTATGAAACATAT
GGGGATACTTGGGCAGGAGTGGAAGCCATAATAAGAATACTGCAACAACT
GTTATTTATTCATTTCAGAATTGGGTGTCGCCATAGCAGAATAGGCATTA
TG------CGGCAGAGGAGAACAAGAAATGGAGCCAGTAGATCC------
---------
>C40
ATGGAACAAGCCCCAGGGAACCAAGGGCCACAGAGGGAACCATACAATGA
GTGGACACTAGAGCTTTTAGAGGAGCTTATGAATGAAGCTGTTAGACATT
TTCCTAGGGAATGGCTCCATAGCTTAGGGCAATATATCTATGACACTTAT
GGGGATACTTGGGCAGGAGTGGAAGCCCTAATAAGAATTCTACAACAACT
GCTGTTTATTCATTTCAGAATTGGGTGTCGACATAGCAGAATAGGCATTA
TT------CGACAGAGGCGAACAAGCAATGGAGCCAGTGGATCC------
---------
>C41
ATGGAACAAGCCCCAGAAGACCAGGGGCCACAAAGAGAACCATACAATGA
ATGGACATTAGAACTGTTAGAGGAGCTTAAAAATGAAGCAGTTAGGCATT
TTCCTAGGCCCTGGCTCCATGGCTTAGGACAGTACATCTATAACACTTAT
GGGGACACTTGGGAAGGGGTTGAAGCTATAACAAGAATTTTGCAACAACT
ACTGTTTATTCATTTCAGAATTGGGTGTCAGCATAGCAGAATAGGCATTT
TG------CCAGGGAGAAGAGGCAGGAATGGAGCCGGTAGATCC------
---------
>C42
ATGGAACAAGCCCCAGAAGACCAAGGGCCCCAGAGGGAGCCATACAATGA
ATGGACACTAGAGCTTTTAGAGGAACTAAAGAGTGAAGCTGTTAGACATT
TTCCTAGGGTATGGCTCCATGGCTTAGGACAACATATCTATGAAACTTAT
GGGGATACTTGGGCAGGAGTGGAAGCCATAATAAGAATTCTGCAGCAACT
GCTGTTTATTCATTCCAGAATTGGATGTCATCATAGCAGAATAGGCGTTA
TT------CGACAGAGGAGAGCAAGAATTGGAGACAGAAGATCCTAC---
---------
>C43
ATGGAACAACTCCCAGAAGACCAGGGGCCGCAGAGGGAACCATACAATGA
ATGGGCACTAGAAATTCTAGAGGAACTCAAGCAGGAAGCTGTCAGACACT
TTCCTAGACCATGGCTCCATATCTTAGGACAGTATATCTATGATACCTAT
GGAGATACTTGGACAGGAGTTGAAGCTCTAATAAGAACATTACAACAGCT
ACTGTTTATGCATTTCAGAATTGGGTGCCAGCATAGCAGAATAGGAGCCA
CG------CCACAAAGAAGAGCAAGAAATGGAGCCAATAGATCC------
---------
>C44
ATGGAACAAGCCCCAGAAGACCAAGGGCCACAGAGGGAACCATACAATGA
ATGGGCACTAGAGCTTTTAGAAGAGCTTAAGAGTGAAGCTGTTAGACATT
TTCCTAGGCCATGGCTCCATGGCTTGGGCCAACATATCTATGAAACTTAT
GGAGATACTTGGGCAGGAGTGGAAGCCATAATAAGAATTCTGCAACAACT
GTTGTTTATTCATTTCAGAATTGGGTGTCGACATAGCAGAATAGGCATTA
CT------------CGGAGAGCAAGAAATGGAGCCAGTAGATCC------
---------
>C45
ATGGAACAAGCCCCAGAAGACCAAGGGCCACAGAGAGAGCCATACAATGA
ATGGACACTAGAGCTTTTAGAAGAACTTAAGAGTGAAGCCGTTAAGCATT
TTCCTAGGCCTTGGCTTCATGGATTAGGGCAACATATCTATGAAACTTAT
GGGGATACTTGGGCAGGAGTAGAAGCCATAATAAGAATTCTGCAACAACT
GCTGTTTATTCATTTCAGAATTGGGTGTCAACATAGCAGGATAGGCATTA
CG------CGA---CGGAGGACAAGAAATGGAACCAGTAGATCC------
---------
>C46
ATGGAACAAGCCCCAGAAGACCAAGGGCCACAGAGGGAGCCATACAATGA
ATGGACACTAGAGCTTTTAGAAGAGCTTAAGAATGAAGCTGTTAGACATT
TCCCTAGGGTGTGGCTCCATGGCTTAGGGCAACATATCTATGAAACTTAT
GGGGATACTTGGGCAGGAGTGGAAGCCATAATAAGAACTCTGCAACAACT
ACTGTTTATTCATTTCAGAATTGGGTGTCGACATAGCAGAATAGGCATTA
CT------CCACAGAGGAGAACAAGAAATGGAGCCAGTAGATCC------
---------
>C47
ATGGAACAAGCCCCAGAGGACCAAGGACCACAGAGGGAGCCACACAATGA
GTGGACACTAGAACTTTTAGAGGAGCTTAAGAGTGAAGCTGTTAGACATT
TTCCTAGGGTATGGCTCCATGGGTTGGGACAACTTATCTATGAAACATAT
GGGGATACTTGGGCAGGAGTAGAAGCCTTAGTAAGAACTCTGCAACAACT
GCTGTTTATTCATTTCAGAATTGGGTGTCAACATAGCAGAATAGGCATTA
CT------CAACGGAGGAGAGCAAGAAATGGAGCCAGTAGATCC------
---------
>C48
ATGGAACAAGCCCCAGAAGACCAAGGGCCACAGAGGGAGCCATACAATGA
ATGGACACTAGAGCTTTTGGAGGAGCTTAAGAGAGAAGCTGTTAGACATT
TTCCCAGGATATGGCTCCATAGCTTAGGGCAATATATCTATGAAACTTAT
GGAGATACTTGGACAGGAGTGGAAGCTCTCATAATACATCTGCAACAACT
GCTGTTTGTTCATTTCAGAATTGGGTGTCAACATAGCAGAATAGGCATTT
TA------CAACGGAGGAGAGCAAGAAATGGAGCCAGTAGACCC------
---------
>C49
ATGGAACAACCCCCAGAAAATCAGGGGCCGCAGAGGGAACCATACAATGA
ATGGACATTAGAGGTTTTAGAGGAACTTAAGCAAGAGGCTGTCAGACACT
TTCCTAGACCATGGCTCCATGACTTAGGACAGTATATCTATGAAACCTAT
GGGGATACTTGGACAGGAGTCGAAGCAATAATAAGAATACTGCAACAACT
ACTGTTTATTCATTTCAGAATTGGGTGCCAACATAGCAGAATAGGAATTT
TA------CGACAGAGAAGAGCAAGAAATGGAGCCAGTAGATCC------
---------
>C50
ATGGAACAAGCCCCAGAAGACCAAGGGCCACAGAGGGAGCCATCTAATGA
ATGGACATTAGAGCTTTTAGAGGAGCTTAAGAGTGAAGCTGTTAGACATT
TTCCTAGGACCTGGCTCCATAGCCTAGGACAACATATTTATGAAACCTAT
GGGGATACCTGGGCAGGAGTTGAAGCTATAACAAGAATTCTGCAACGATT
ACTGTTTATTCATTTCAGAATTGGGTGTCAACATAGCAGAATAGGTGTTG
TT------CGACAGAGAAGAGCAAGAAATGGATCCAGTAGATCC------
---------
>C1
MEQAPENQGPQREPYNEWALELLEELKNEAVRHFPRPWLHGLGQYIYNTY
GDTWEGVEAIIRMLQQLLFIHYRIGCQHSRIGIIooPQRRVRDGPSRPo
>C2
MEQPPEDQGPQREPYNEWALEILEELKQEAVRHFPRPWLHSLGQYIYETY
GDTWAGVEALLRILQQLLFIHYRIGCQHSRIGILooQQRRARNGTSRSo
>C3
MEQAPEDQGPQREPHNEWTLELLEELKTEAVRHFPRPWLHGLGQYIYNTY
GDTWEGVEAIIRTLQQLLFVHFRIGCQHSRIGIIooPGRRGRNGAGRSo
>C4
MEQAPEDQGPQREPYNEWMLELLEDLKQEAVRHFPRPWLHGLGQHIYETY
GDTWEGVEAIVRMLQHLLFVHFRIGCQHSRIGIIoRGRRRVRDGAGRSo
>C5
MEQAPEDQGPQREPYNEWTLELLGELKNEAVRHFPGPWLHGLGQYIYATY
GDTWAGVIAIIRILQQLLFTHFRIGCQHSRIGILooQRRRARNGASRSo
>C6
MEQPPEDQGPQREPYNGWTLELLEELKQEAVRHFPRPWLHSLGQHIYATY
GDTWTGVEAMIRILQQLLFVHFRIGCQHSRIGILooRQRRARNGANRSo
>C7
MEQAPEDQGPQREPYNEWTLELLEELKSEAVRHFPRIWLHSLGQYIYETY
GDTWAGVEAIIRILQQLLFIHFRIGCQHSRIGVIooRQRRARNGASRSo
>C8
MEQTPEDQGPQREPYNEWALELLEELKQEAVRHFPRPWLHSLGQHIYNTY
GDTWAGVEAIIRILQQLLFIHFRIGCQHSRIGILooRQRRTRNGASRSo
>C9
MEQAPEDQGPQREPYNEWTLELLEELKSEAVRHFPRVWLHSLGQYIYETY
GDTWTGVEAIIRILQQLLFIHFRIGCHHSRIGIMooRQRRTRNGASRSo
>C10
MEQAPEDQGPQREPYNEWTLELLEELKNEAVRHFPRMWLHGLGQYIYETY
GDTWEGVEAIIRILQQLLFTHFRIGCQHSRIGIIooRQRRARNGASRSo
>C11
MEQAPEDQGPQREPYNDWTLELLEELKSEAVRHFPRIWLHSLGQYIYETY
GDTWTGVEALVRILQQLLFIHFRIGCQHSRIGIIooQRRRPRNGARRSo
>C12
MEQAPGDQGPQREPYNEWTLELLEELKNEAVRHFPRVWLHGLGQHIYETY
GDTWAGVEAIIRILQQLLFIHFRIGCRHSRIGITooPQRRTRNGSSRSo
>C13
MEQSPEDQGPQREPFNEWALELLEELKNEAVRHFPRPWLHGLGQYIYDTY
GDTWEGVEAIIRILQQLLFIHFRIGCQHSRIGIIooPGRRGRNGAGRSo
>C14
MEQAPENQGPQREPYHEWTLELLEELKNEAVRHFPRDWLHSLGQYIYETY
GDTWAGVEALIRILQQLLFIHFRIGCQHSRIGIIooRQRRARNGSSRSo
>C15
MEQAPEDQGPQREPSNEWTLELLEERKHEGVRNFPMLWLNGLGEYRYNTY
GDTGAGVEALLRILQQILFIHFRIGCQHSRIGITooPQRRARNGSSRSo
>C16
MEQAPEDQGPQREPYNEWTLELLEELKQEAVRHFPRPWLHGLGQHIYETY
GDTWTGVEVIIRILQQLLFIHFRIGCRHSRIGIMooRQRRARNGASRSo
>C17
MEQAPEDQGPQREPYNEWTLELLEELKQEAVRHFPRPWLHSMGQYIYETY
GDTWTGVEMIIRILQQLLFIHFRIGCQHSRIGILooRQRRARNGANRSo
>C18
MEQPPEDQGPQREPYNEWTLEILEELKQEAVRHFPRPWLHGIGQYVYETY
GDTWTGVEVIIRILQQLLFIHFRIGCQHSRIGIMooRQRRARNGANRSo
>C19
MEQPPEDQGPQREPFNEWTLELLEELKQEAVRHFPRPWLHGLGQYVYDTY
GDTWAGVEAIIRILQQLLFIHFRIGCHHSRIGIVooIQRRARNGASRSo
>C20
MEQAPEDQGPQREPYNEWTLELLEELKNEAVRHFPRVWLHGLGQHIYETY
GDTWTGVEALVRSLQQLLFIHFRIGCRHSRIGIAIGRRTRARNGASRPo
>C21
MEQAPEDQRPQREPHooWTLELLEELKNEAVRHFPRPWLHGLGQYIYDNY
GDTWEGAVAIIRILQQLLFVHFRIGCQHSRIGITooPGRRGRNGAGRSo
>C22
MEQAPEDQGPPREPHNEWTLELLEELKNEAVRHFPRPWLHGLGQYIYNNY
GDTWEGVEAIIRILQQLLFVHFRIGCQHSRIGITooPGRRGRNGGGRSo
>C23
MEQAPEDQGPQREPYNEWTLELLEELKNEAVRHFPITWLHSLGQYIYTTY
GDTWAGVEAIIRILQQLLFIHFRIGCQHSRIGIIooRGRRGRNGSGRSo
>C24
MEQAPEDQGPQREPYNEWTLELLEELKNEAVRHFPRIWLHGLGQHIYETY
GDTWTGVEALIRILQQLLFIHFRIGCRHSRIGITooPQRRARNGARRSo
>C25
MEQAPEDQGPQREPYNEWTLELLEELKSEAVRHFPRTWLHSLGQHIYETY
GDTWTGVMALIRMLNQLLFIHFRIGCRHSRIGIMooQHRRPRNGASRSo
>C26
MEQAPEDQGPQREPYNEWTLELLEELKNEAVRHFPRTWLHGLGQHIYNTY
GDTWEGVEDIIRILQQLLFIHFRIGCHHSRIGITooRQRRARNGASRSo
>C27
MEQPPEDQGPQREPYTEWALEILEELKQEAVRHFPRPWLHSLGQYIYETY
GDTWAGVEALTRILQQLLFIHFRIGCRHSRIGVWooRQRRVRNGASRSo
>C28
MEQAPEDQGPQREPYNEWTLELLEELKNEAVRHFPRPWLHGLGQHIYETY
GDTWAGVEAIIRILQQLMFIHFRIGCQHSRIGILoooQRRTRNGANRSo
>C29
MEQAPEDQGPQREPYNEWTLELLEELRSEAVRHFPRVWLHGLGQHIYETY
GDTWAGVELIIRILQQPLFIHFRIGCRHSRIGISooPQRRARNGSSRSo
>C30
MEQTPEDQGPQREPHNEWTLELLEELKNEAVRHFPRPWLHSLGQHIYDTY
GDTWEGVEAIIRILQQLIFVHFRIGCQHSRIGIIooPGRRGRNGAGRSo
>C31
MERAPEDQGPQREPNNEWTLELLEELKNEAVRHFPRPWLHGLGQYIYSNY
GDTWEGVQAMIRILQQLLFVHFRIGCQHSRIGITooPGRRGRNGAGRSo
>C32
MEQAPEDQGPQREPYNEWTLELLEELKREAVRHFPRPWLHSLGQHIYETY
GDTWTGVEAIIRILQQLLFIHFRIGCQHSRIGITooPRRRPRNGSSRSo
>C33
MEQPPEDQGPQREPYNVWTLELLEDLKQEAVRHFPRPWLHGLGQYIYETY
GDTWTGVENMIRMLQQLLFIHFRIGCQHSRIGIMooRQRRARNGASRPo
>C34
MEQTPEDQGPQREPYNEWTLEILEELKQEAVRHFPRPWLHNLGQHIYETY
GDTWAGVESLLRILQQLLFIHFRIGCQHSRIGILooRQRRGRNGASRSo
>C35
MEQAPENQGPQREoooQWALELLEELKNEAVRHFPRPWLLSLGQYIYETY
GDTWAGVEAITRILQQLLFIHFRIGCQHSRIGIIooPQRRSRNGASRSo
>C36
MEQAPEDQGPQREPYNEWTLELLEELKQEAVRHFPRPWLHNLGQYIYETY
GDTWMGVEALIRTLQQLLFIHFRIGCHHSRIGIMooRQRRARNGTSRSo
>C37
MEQAPEDQGPQREPHNEWTLELLEELKEEAVKHFPRPWLHSLGQHIYNTY
GDTWEGVEAIIRILQQLLFIHFRIGCHHSRIGILooRQARLRHGSNRPo
>C38
MERPPEDHGPQREPYNEWTLELLEELKQEAVRHFPRPWLHGLGQYVYENY
GDTWTGVETIIRILQQLLFIHFRIGCQHSRIGIMooRQRRARNGASRSo
>C39
MERAPEDQGPQREPYNEWTLELLEELKREAVRHFPRPWLHSLGQYIYETY
GDTWAGVEAIIRILQQLLFIHFRIGCRHSRIGIMooRQRRTRNGASRSo
>C40
MEQAPGNQGPQREPYNEWTLELLEELMNEAVRHFPREWLHSLGQYIYDTY
GDTWAGVEALIRILQQLLFIHFRIGCRHSRIGIIooRQRRTSNGASGSo
>C41
MEQAPEDQGPQREPYNEWTLELLEELKNEAVRHFPRPWLHGLGQYIYNTY
GDTWEGVEAITRILQQLLFIHFRIGCQHSRIGILooPGRRGRNGAGRSo
>C42
MEQAPEDQGPQREPYNEWTLELLEELKSEAVRHFPRVWLHGLGQHIYETY
GDTWAGVEAIIRILQQLLFIHSRIGCHHSRIGVIooRQRRARIGDRRSY
>C43
MEQLPEDQGPQREPYNEWALEILEELKQEAVRHFPRPWLHILGQYIYDTY
GDTWTGVEALIRTLQQLLFMHFRIGCQHSRIGATooPQRRARNGANRSo
>C44
MEQAPEDQGPQREPYNEWALELLEELKSEAVRHFPRPWLHGLGQHIYETY
GDTWAGVEAIIRILQQLLFIHFRIGCRHSRIGITooooRRARNGASRSo
>C45
MEQAPEDQGPQREPYNEWTLELLEELKSEAVKHFPRPWLHGLGQHIYETY
GDTWAGVEAIIRILQQLLFIHFRIGCQHSRIGITooRoRRTRNGTSRSo
>C46
MEQAPEDQGPQREPYNEWTLELLEELKNEAVRHFPRVWLHGLGQHIYETY
GDTWAGVEAIIRTLQQLLFIHFRIGCRHSRIGITooPQRRTRNGASRSo
>C47
MEQAPEDQGPQREPHNEWTLELLEELKSEAVRHFPRVWLHGLGQLIYETY
GDTWAGVEALVRTLQQLLFIHFRIGCQHSRIGITooQRRRARNGASRSo
>C48
MEQAPEDQGPQREPYNEWTLELLEELKREAVRHFPRIWLHSLGQYIYETY
GDTWTGVEALIIHLQQLLFVHFRIGCQHSRIGILooQRRRARNGASRPo
>C49
MEQPPENQGPQREPYNEWTLEVLEELKQEAVRHFPRPWLHDLGQYIYETY
GDTWTGVEAIIRILQQLLFIHFRIGCQHSRIGILooRQRRARNGASRSo
>C50
MEQAPEDQGPQREPSNEWTLELLEELKSEAVRHFPRTWLHSLGQHIYETY
GDTWAGVEAITRILQRLLFIHFRIGCQHSRIGVVooRQRRARNGSSRSo


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/HIV1_N3/VPR_1_1/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 50 taxa and 309 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon  1 -> C1
      Taxon  2 -> C2
      Taxon  3 -> C3
      Taxon  4 -> C4
      Taxon  5 -> C5
      Taxon  6 -> C6
      Taxon  7 -> C7
      Taxon  8 -> C8
      Taxon  9 -> C9
      Taxon 10 -> C10
      Taxon 11 -> C11
      Taxon 12 -> C12
      Taxon 13 -> C13
      Taxon 14 -> C14
      Taxon 15 -> C15
      Taxon 16 -> C16
      Taxon 17 -> C17
      Taxon 18 -> C18
      Taxon 19 -> C19
      Taxon 20 -> C20
      Taxon 21 -> C21
      Taxon 22 -> C22
      Taxon 23 -> C23
      Taxon 24 -> C24
      Taxon 25 -> C25
      Taxon 26 -> C26
      Taxon 27 -> C27
      Taxon 28 -> C28
      Taxon 29 -> C29
      Taxon 30 -> C30
      Taxon 31 -> C31
      Taxon 32 -> C32
      Taxon 33 -> C33
      Taxon 34 -> C34
      Taxon 35 -> C35
      Taxon 36 -> C36
      Taxon 37 -> C37
      Taxon 38 -> C38
      Taxon 39 -> C39
      Taxon 40 -> C40
      Taxon 41 -> C41
      Taxon 42 -> C42
      Taxon 43 -> C43
      Taxon 44 -> C44
      Taxon 45 -> C45
      Taxon 46 -> C46
      Taxon 47 -> C47
      Taxon 48 -> C48
      Taxon 49 -> C49
      Taxon 50 -> C50
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1519098774
      Setting output file names to "/opt/ADOPS/HIV1_N3/VPR_1_1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1781008725
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0750158122
      Seed = 346863615
      Swapseed = 1519098774
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 54 unique site patterns
      Division 2 has 51 unique site patterns
      Division 3 has 92 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -6595.104125 -- -77.118119
         Chain 2 -- -6545.173202 -- -77.118119
         Chain 3 -- -6630.497934 -- -77.118119
         Chain 4 -- -6536.718162 -- -77.118119

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -6489.303461 -- -77.118119
         Chain 2 -- -6427.518354 -- -77.118119
         Chain 3 -- -6589.840229 -- -77.118119
         Chain 4 -- -6302.511273 -- -77.118119


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-6595.104] (-6545.173) (-6630.498) (-6536.718) * [-6489.303] (-6427.518) (-6589.840) (-6302.511) 
        500 -- (-4918.220) [-4779.610] (-4869.113) (-4929.549) * (-4780.095) (-4804.902) (-5124.708) [-4694.843] -- 0:33:19
       1000 -- (-4370.631) (-4352.025) [-4343.077] (-4469.564) * [-4441.441] (-4462.337) (-4493.713) (-4426.400) -- 0:33:18
       1500 -- (-4259.236) (-4213.417) [-4185.314] (-4268.185) * (-4219.740) [-4191.571] (-4302.587) (-4294.294) -- 0:33:17
       2000 -- (-4252.705) (-4177.744) [-4137.229] (-4163.661) * [-4133.149] (-4128.470) (-4117.315) (-4207.969) -- 0:24:57
       2500 -- (-4190.898) (-4126.574) [-4115.878] (-4102.963) * (-4115.607) (-4086.686) [-4091.387] (-4169.242) -- 0:26:36
       3000 -- (-4145.396) [-4059.929] (-4091.221) (-4084.040) * (-4098.385) [-4066.427] (-4075.245) (-4087.022) -- 0:27:41
       3500 -- (-4127.777) [-4040.946] (-4078.150) (-4050.206) * (-4051.336) [-4045.092] (-4064.843) (-4105.713) -- 0:28:28
       4000 -- (-4079.694) (-4036.009) (-4068.398) [-4018.190] * (-4042.937) [-4016.589] (-4084.913) (-4091.322) -- 0:24:54
       4500 -- (-4087.860) (-4060.939) (-4045.822) [-4040.847] * (-4057.624) [-4023.584] (-4090.694) (-4055.858) -- 0:25:48
       5000 -- (-4089.213) (-4023.070) (-4050.499) [-4027.180] * (-4040.116) (-4027.985) (-4069.055) [-4039.225] -- 0:26:32

      Average standard deviation of split frequencies: 0.118592

       5500 -- (-4085.411) [-4033.647] (-4058.789) (-4027.416) * (-4033.920) (-4049.201) (-4060.224) [-4044.833] -- 0:24:06
       6000 -- (-4069.409) [-4031.750] (-4047.786) (-4029.463) * (-4035.231) (-4051.318) (-4080.573) [-4036.723] -- 0:24:51
       6500 -- (-4065.631) [-4027.018] (-4047.430) (-4027.692) * (-4060.935) (-4039.622) (-4068.970) [-4034.836] -- 0:25:28
       7000 -- (-4040.175) (-4036.280) (-4047.300) [-4031.186] * (-4058.708) [-4018.314] (-4069.516) (-4031.024) -- 0:26:00
       7500 -- [-4027.144] (-4046.142) (-4055.115) (-4042.846) * (-4049.473) [-4012.169] (-4047.336) (-4047.575) -- 0:24:15
       8000 -- [-4013.926] (-4053.394) (-4056.845) (-4025.982) * [-4029.985] (-4030.296) (-4047.454) (-4044.509) -- 0:24:48
       8500 -- (-4027.423) (-4045.137) (-4071.608) [-4028.254] * (-4052.161) (-4022.610) [-4021.880] (-4058.343) -- 0:25:16
       9000 -- [-4034.540] (-4049.685) (-4071.322) (-4024.806) * (-4050.321) (-4037.975) [-4017.557] (-4052.449) -- 0:25:41
       9500 -- (-4038.702) [-4028.877] (-4057.262) (-4032.345) * (-4054.512) (-4023.912) [-4020.044] (-4050.964) -- 0:24:19
      10000 -- (-4040.623) (-4027.256) (-4047.726) [-4029.661] * (-4059.888) [-4020.454] (-4021.578) (-4035.973) -- 0:24:45

      Average standard deviation of split frequencies: 0.107248

      10500 -- (-4042.066) [-4027.915] (-4053.256) (-4034.464) * (-4051.954) [-4009.164] (-4034.393) (-4030.407) -- 0:25:07
      11000 -- (-4030.079) (-4048.643) [-4028.906] (-4044.632) * (-4044.377) (-4027.781) (-4020.737) [-4028.984] -- 0:25:28
      11500 -- (-4064.893) (-4056.039) [-4013.378] (-4033.541) * (-4054.561) [-4017.995] (-4015.924) (-4028.394) -- 0:24:21
      12000 -- (-4061.891) (-4051.375) (-4028.760) [-4026.910] * (-4052.988) (-4030.933) (-4035.969) [-4023.686] -- 0:24:42
      12500 -- (-4052.515) (-4046.578) [-4019.507] (-4040.415) * (-4047.767) (-4043.205) [-4044.987] (-4030.097) -- 0:25:01
      13000 -- (-4039.691) (-4043.115) [-4025.832] (-4073.739) * (-4078.143) (-4056.478) (-4039.561) [-4023.308] -- 0:25:18
      13500 -- (-4042.993) [-4023.627] (-4026.261) (-4052.949) * (-4070.547) (-4040.902) (-4042.841) [-4009.620] -- 0:24:21
      14000 -- [-4056.553] (-4029.685) (-4047.535) (-4058.966) * (-4071.591) (-4048.420) [-4035.288] (-4019.719) -- 0:24:39
      14500 -- (-4064.749) (-4051.794) (-4040.813) [-4029.355] * (-4070.643) (-4060.012) [-4029.649] (-4014.494) -- 0:24:55
      15000 -- (-4051.147) [-4026.220] (-4035.862) (-4033.126) * (-4046.505) (-4042.729) (-4033.640) [-4011.428] -- 0:24:04

      Average standard deviation of split frequencies: 0.095270

      15500 -- (-4055.531) (-4029.511) [-4029.940] (-4039.122) * (-4043.776) (-4052.209) (-4037.426) [-4027.103] -- 0:24:20
      16000 -- (-4059.789) [-4032.562] (-4037.416) (-4035.381) * (-4052.801) (-4059.903) (-4040.909) [-4030.250] -- 0:24:36
      16500 -- (-4046.009) (-4027.652) (-4047.121) [-4021.938] * (-4042.600) [-4021.941] (-4037.471) (-4032.427) -- 0:24:50
      17000 -- [-4030.102] (-4049.233) (-4056.477) (-4044.769) * (-4045.261) [-4025.213] (-4046.967) (-4032.064) -- 0:24:05
      17500 -- [-4023.456] (-4045.075) (-4065.846) (-4030.345) * (-4050.420) (-4019.778) (-4055.391) [-4030.912] -- 0:24:19
      18000 -- [-4025.372] (-4041.795) (-4046.470) (-4029.672) * (-4074.568) (-4041.124) (-4055.642) [-4038.169] -- 0:24:33
      18500 -- (-4028.093) (-4050.136) [-4024.779] (-4018.515) * (-4055.889) [-4017.247] (-4053.741) (-4033.141) -- 0:24:45
      19000 -- (-4038.111) (-4039.251) [-4008.280] (-4027.830) * (-4034.181) [-4018.435] (-4063.838) (-4024.310) -- 0:24:05
      19500 -- (-4040.337) (-4045.181) [-4009.541] (-4032.632) * (-4039.912) (-4026.601) (-4047.225) [-4035.290] -- 0:24:18
      20000 -- (-4032.087) (-4054.792) [-4019.512] (-4044.062) * (-4056.801) [-4016.769] (-4055.326) (-4034.055) -- 0:24:30

      Average standard deviation of split frequencies: 0.081836

      20500 -- [-4027.011] (-4056.397) (-4026.723) (-4065.306) * (-4070.708) [-4027.259] (-4061.125) (-4039.572) -- 0:24:41
      21000 -- [-4028.338] (-4052.623) (-4031.703) (-4057.610) * [-4027.999] (-4019.620) (-4058.405) (-4038.942) -- 0:24:05
      21500 -- [-4026.192] (-4037.119) (-4039.422) (-4036.968) * (-4024.761) [-4018.534] (-4037.357) (-4030.436) -- 0:24:16
      22000 -- [-4027.603] (-4037.104) (-4033.841) (-4055.613) * (-4034.658) [-4023.301] (-4034.888) (-4040.269) -- 0:24:27
      22500 -- (-4029.564) (-4048.259) [-4020.674] (-4047.387) * (-4026.767) [-4029.867] (-4041.624) (-4061.151) -- 0:23:53
      23000 -- [-4023.917] (-4063.513) (-4031.455) (-4066.252) * [-4026.855] (-4043.633) (-4039.869) (-4049.815) -- 0:24:04
      23500 -- (-4017.611) (-4053.417) [-4016.370] (-4043.374) * (-4033.720) [-4031.693] (-4039.270) (-4058.781) -- 0:24:14
      24000 -- [-4011.273] (-4044.231) (-4035.008) (-4052.635) * (-4040.953) [-4018.519] (-4027.459) (-4064.086) -- 0:24:24
      24500 -- [-4030.678] (-4050.928) (-4040.071) (-4038.837) * (-4048.863) [-4023.937] (-4035.448) (-4055.235) -- 0:23:53
      25000 -- [-4031.997] (-4066.309) (-4050.351) (-4048.396) * (-4080.139) (-4027.240) [-4036.897] (-4045.192) -- 0:24:03

      Average standard deviation of split frequencies: 0.068307

      25500 -- (-4034.989) (-4068.879) (-4038.903) [-4031.941] * (-4057.626) [-4032.559] (-4031.153) (-4043.897) -- 0:24:12
      26000 -- (-4034.966) (-4055.202) [-4030.438] (-4041.381) * [-4035.347] (-4026.251) (-4030.761) (-4051.256) -- 0:24:21
      26500 -- (-4047.061) (-4060.054) [-4034.969] (-4023.500) * (-4042.090) (-4011.901) [-4026.207] (-4057.465) -- 0:23:52
      27000 -- (-4047.230) (-4047.826) (-4024.543) [-4030.088] * (-4036.738) (-4025.542) [-4021.210] (-4070.590) -- 0:24:01
      27500 -- (-4029.398) (-4046.139) [-4034.684] (-4030.539) * (-4034.408) (-4032.210) [-4033.720] (-4073.723) -- 0:24:09
      28000 -- (-4031.091) (-4047.088) [-4022.504] (-4026.020) * [-4029.761] (-4039.678) (-4042.217) (-4064.946) -- 0:23:43
      28500 -- (-4036.406) (-4049.305) (-4048.732) [-4030.802] * (-4048.825) [-4037.588] (-4051.890) (-4060.647) -- 0:23:51
      29000 -- (-4032.321) (-4051.630) (-4037.824) [-4023.956] * [-4039.936] (-4022.103) (-4058.734) (-4045.703) -- 0:23:59
      29500 -- (-4050.617) (-4048.872) (-4036.911) [-4023.646] * (-4037.634) [-4012.971] (-4037.151) (-4068.036) -- 0:24:07
      30000 -- (-4042.069) (-4031.427) (-4046.940) [-4006.578] * (-4045.790) (-4032.471) [-4030.844] (-4059.755) -- 0:23:42

      Average standard deviation of split frequencies: 0.065104

      30500 -- (-4049.712) (-4072.498) [-4027.945] (-4015.922) * [-4032.048] (-4035.582) (-4035.180) (-4062.875) -- 0:23:50
      31000 -- (-4046.878) (-4051.682) (-4035.452) [-4017.746] * [-4028.992] (-4027.810) (-4023.898) (-4061.378) -- 0:23:57
      31500 -- (-4049.529) (-4055.698) (-4023.958) [-4016.879] * (-4044.059) (-4039.684) [-4030.211] (-4067.082) -- 0:24:05
      32000 -- (-4042.126) (-4050.823) (-4039.709) [-4019.390] * (-4028.328) (-4040.830) [-4024.166] (-4054.611) -- 0:23:41
      32500 -- (-4026.446) (-4055.858) (-4054.778) [-4030.978] * [-4029.986] (-4041.047) (-4038.401) (-4045.643) -- 0:23:48
      33000 -- [-4016.574] (-4063.273) (-4042.543) (-4015.105) * [-4032.795] (-4052.794) (-4035.175) (-4038.511) -- 0:23:55
      33500 -- [-4012.085] (-4059.423) (-4053.805) (-4023.060) * (-4048.263) (-4053.388) (-4024.440) [-4025.394] -- 0:24:02
      34000 -- [-4008.984] (-4046.593) (-4044.737) (-4028.073) * (-4052.883) (-4063.208) (-4037.995) [-4018.699] -- 0:23:40
      34500 -- (-4033.278) (-4057.335) (-4061.407) [-4022.375] * [-4040.681] (-4084.232) (-4047.750) (-4029.260) -- 0:23:47
      35000 -- (-4023.744) (-4038.452) (-4054.088) [-4018.684] * [-4036.112] (-4090.720) (-4040.221) (-4045.730) -- 0:23:53

      Average standard deviation of split frequencies: 0.068019

      35500 -- [-4033.257] (-4069.819) (-4046.553) (-4043.590) * (-4042.383) (-4083.999) [-4021.238] (-4040.042) -- 0:23:32
      36000 -- [-4014.708] (-4052.727) (-4040.712) (-4038.507) * (-4068.351) (-4053.371) [-4029.790] (-4065.077) -- 0:23:39
      36500 -- [-4024.856] (-4059.221) (-4040.779) (-4019.391) * (-4048.126) (-4047.191) [-4029.644] (-4069.097) -- 0:23:45
      37000 -- [-4016.100] (-4057.112) (-4041.807) (-4029.468) * [-4021.769] (-4072.007) (-4030.254) (-4067.952) -- 0:23:51
      37500 -- [-4022.328] (-4063.483) (-4024.869) (-4036.696) * [-4016.120] (-4064.049) (-4023.937) (-4068.825) -- 0:23:31
      38000 -- (-4032.119) (-4060.561) (-4044.560) [-4039.780] * [-4034.461] (-4054.030) (-4034.191) (-4065.072) -- 0:23:37
      38500 -- (-4061.891) (-4033.084) [-4036.413] (-4032.403) * (-4037.857) (-4051.305) [-4037.324] (-4050.588) -- 0:23:43
      39000 -- (-4060.719) (-4035.852) (-4025.914) [-4015.460] * (-4043.414) (-4061.272) [-4035.418] (-4028.194) -- 0:23:49
      39500 -- (-4040.748) (-4035.255) (-4032.600) [-4025.820] * (-4048.207) (-4053.202) (-4029.370) [-4024.831] -- 0:23:30
      40000 -- (-4045.081) [-4025.330] (-4046.278) (-4033.044) * [-4049.949] (-4043.262) (-4036.439) (-4039.088) -- 0:23:36

      Average standard deviation of split frequencies: 0.063814

      40500 -- (-4039.409) (-4043.828) (-4043.585) [-4019.584] * (-4062.720) (-4048.580) [-4035.299] (-4043.797) -- 0:23:41
      41000 -- (-4037.934) [-4028.911] (-4030.835) (-4038.163) * (-4054.322) (-4039.236) (-4050.789) [-4031.138] -- 0:23:46
      41500 -- (-4032.061) (-4050.876) (-4047.881) [-4025.255] * [-4052.368] (-4041.462) (-4055.473) (-4059.352) -- 0:23:28
      42000 -- (-4042.160) (-4023.977) (-4050.377) [-4017.309] * (-4068.457) (-4063.035) [-4040.405] (-4049.354) -- 0:23:34
      42500 -- (-4032.259) (-4043.338) [-4024.527] (-4036.174) * (-4040.524) (-4044.700) (-4042.795) [-4017.588] -- 0:23:39
      43000 -- (-4042.467) [-4033.119] (-4037.475) (-4030.954) * (-4025.379) (-4053.569) (-4034.470) [-4017.754] -- 0:23:22
      43500 -- (-4048.994) [-4029.048] (-4041.972) (-4030.701) * (-4032.656) (-4043.096) (-4072.220) [-4031.149] -- 0:23:27
      44000 -- (-4041.321) (-4027.245) (-4049.983) [-4035.227] * [-4016.769] (-4055.680) (-4066.367) (-4028.914) -- 0:23:32
      44500 -- (-4052.951) (-4039.494) (-4035.820) [-4029.770] * (-4020.219) (-4064.438) (-4063.725) [-4013.552] -- 0:23:37
      45000 -- (-4042.082) (-4053.769) (-4036.473) [-4026.512] * (-4036.593) (-4067.740) (-4054.395) [-4020.251] -- 0:23:41

      Average standard deviation of split frequencies: 0.056643

      45500 -- (-4051.900) (-4062.387) (-4040.433) [-4028.756] * (-4040.594) (-4056.136) (-4048.573) [-4023.783] -- 0:23:25
      46000 -- (-4071.709) (-4054.285) [-4011.413] (-4023.434) * (-4033.578) (-4067.395) (-4056.625) [-4020.258] -- 0:23:30
      46500 -- (-4053.108) (-4048.399) (-4023.844) [-4023.034] * [-4028.918] (-4072.527) (-4053.740) (-4025.261) -- 0:23:34
      47000 -- (-4054.299) [-4033.946] (-4041.264) (-4034.389) * [-4026.896] (-4055.179) (-4065.370) (-4034.578) -- 0:23:19
      47500 -- (-4050.060) (-4047.349) (-4045.767) [-4014.470] * (-4029.286) (-4066.544) (-4055.959) [-4025.923] -- 0:23:23
      48000 -- (-4049.639) (-4041.690) (-4043.633) [-4006.932] * (-4021.310) (-4064.331) (-4051.603) [-4014.026] -- 0:23:28
      48500 -- (-4039.245) (-4050.029) (-4036.423) [-4006.493] * (-4017.800) (-4066.184) (-4039.988) [-4027.447] -- 0:23:32
      49000 -- (-4054.661) (-4051.690) [-4025.164] (-3997.890) * (-4021.656) (-4058.300) (-4047.210) [-4027.520] -- 0:23:17
      49500 -- (-4058.239) (-4053.302) (-4020.702) [-4019.157] * (-4027.771) [-4046.864] (-4043.424) (-4054.481) -- 0:23:21
      50000 -- (-4044.568) [-4027.537] (-4038.160) (-4028.882) * [-4015.769] (-4073.964) (-4038.680) (-4061.422) -- 0:23:26

      Average standard deviation of split frequencies: 0.054902

      50500 -- (-4045.350) [-4022.032] (-4034.384) (-4044.762) * (-4033.899) (-4026.838) [-4028.952] (-4062.873) -- 0:23:30
      51000 -- (-4050.018) (-4034.685) (-4041.618) [-4034.844] * [-4020.573] (-4034.367) (-4047.251) (-4045.560) -- 0:23:15
      51500 -- [-4022.676] (-4062.187) (-4038.254) (-4042.790) * [-4006.088] (-4042.939) (-4041.030) (-4056.021) -- 0:23:19
      52000 -- (-4050.032) (-4038.200) [-4029.734] (-4066.976) * [-4017.479] (-4048.053) (-4040.470) (-4049.197) -- 0:23:23
      52500 -- (-4036.484) [-4030.460] (-4041.288) (-4073.781) * (-4045.239) [-4044.861] (-4051.741) (-4049.301) -- 0:23:27
      53000 -- (-4029.971) [-4019.850] (-4051.134) (-4072.546) * (-4036.679) (-4045.528) (-4027.459) [-4034.271] -- 0:23:13
      53500 -- (-4032.626) [-4011.102] (-4049.994) (-4061.795) * (-4036.091) (-4028.505) [-4022.297] (-4050.730) -- 0:23:17
      54000 -- (-4014.859) [-4021.833] (-4038.531) (-4052.682) * (-4052.313) (-4017.670) [-4021.157] (-4039.166) -- 0:23:21
      54500 -- [-4006.404] (-4044.684) (-4037.151) (-4049.957) * (-4051.997) (-4003.160) [-4031.525] (-4047.061) -- 0:23:07
      55000 -- [-4020.762] (-4055.096) (-4033.569) (-4043.935) * (-4039.072) (-4019.497) [-4023.801] (-4055.873) -- 0:23:11

      Average standard deviation of split frequencies: 0.052081

      55500 -- [-4027.123] (-4033.426) (-4032.578) (-4038.003) * (-4047.332) [-4019.101] (-4035.005) (-4076.888) -- 0:23:15
      56000 -- [-4020.405] (-4056.871) (-4045.277) (-4038.789) * (-4073.432) [-4016.514] (-4032.070) (-4058.634) -- 0:23:19
      56500 -- (-4035.244) (-4047.184) (-4046.869) [-4044.427] * (-4061.920) [-4017.978] (-4043.815) (-4058.313) -- 0:23:06
      57000 -- (-4036.875) (-4035.850) [-4025.009] (-4036.532) * (-4040.882) [-4024.147] (-4072.412) (-4042.430) -- 0:23:09
      57500 -- (-4025.773) (-4048.147) [-4022.942] (-4050.402) * (-4046.908) (-4034.370) (-4073.579) [-4026.226] -- 0:23:13
      58000 -- (-4029.715) (-4048.778) [-4017.558] (-4048.525) * (-4055.327) [-4023.205] (-4078.438) (-4030.646) -- 0:23:16
      58500 -- (-4021.207) (-4031.739) [-4010.416] (-4048.403) * (-4048.181) [-4008.667] (-4063.687) (-4036.864) -- 0:23:04
      59000 -- (-4044.316) (-4011.158) [-4013.107] (-4055.519) * (-4031.797) (-4029.109) (-4024.310) [-4033.302] -- 0:23:07
      59500 -- (-4043.658) (-4011.884) [-4017.956] (-4051.241) * (-4044.006) (-4011.186) (-4036.356) [-4039.178] -- 0:23:10
      60000 -- (-4041.519) (-4035.622) [-4029.875] (-4042.903) * (-4048.158) [-4015.321] (-4022.716) (-4030.540) -- 0:23:14

      Average standard deviation of split frequencies: 0.050209

      60500 -- (-4044.378) (-4038.904) [-4034.208] (-4032.921) * (-4066.467) [-4010.797] (-4029.520) (-4029.204) -- 0:23:02
      61000 -- [-4026.049] (-4044.631) (-4033.832) (-4030.639) * (-4091.677) [-4001.046] (-4049.102) (-4033.572) -- 0:23:05
      61500 -- [-4024.001] (-4035.644) (-4046.171) (-4027.409) * (-4068.655) (-4011.911) (-4040.627) [-4028.798] -- 0:23:08
      62000 -- (-4038.170) [-4028.700] (-4061.332) (-4040.884) * [-4052.923] (-4040.822) (-4042.334) (-4036.163) -- 0:23:11
      62500 -- (-4043.204) (-4017.130) (-4047.067) [-4025.734] * (-4045.422) [-4020.997] (-4047.379) (-4035.242) -- 0:23:00
      63000 -- (-4046.550) [-4033.757] (-4050.035) (-4033.667) * [-4049.028] (-4029.674) (-4035.065) (-4043.055) -- 0:23:03
      63500 -- (-4040.752) (-4050.277) [-4029.473] (-4020.496) * [-4036.496] (-4027.803) (-4030.598) (-4067.600) -- 0:23:06
      64000 -- (-4033.411) (-4041.512) [-4023.869] (-4042.851) * (-4073.808) (-4032.301) [-4018.724] (-4051.776) -- 0:23:09
      64500 -- (-4043.117) (-4032.340) [-4017.556] (-4046.180) * (-4075.398) (-4027.016) [-4015.146] (-4046.026) -- 0:22:57
      65000 -- (-4048.917) (-4042.896) [-4018.570] (-4042.354) * (-4079.901) [-4017.283] (-4030.399) (-4031.209) -- 0:23:00

      Average standard deviation of split frequencies: 0.042194

      65500 -- [-4028.532] (-4036.510) (-4018.461) (-4043.993) * (-4079.820) (-4023.394) [-4021.877] (-4033.261) -- 0:23:03
      66000 -- (-4057.369) [-4026.673] (-4043.034) (-4050.912) * (-4083.568) (-4029.274) [-4014.366] (-4054.511) -- 0:22:52
      66500 -- (-4051.303) [-4021.177] (-4035.023) (-4060.902) * (-4069.639) (-4027.888) [-4012.489] (-4047.940) -- 0:22:55
      67000 -- (-4035.424) [-4026.167] (-4020.077) (-4058.614) * (-4066.206) (-4031.571) [-4010.360] (-4054.986) -- 0:22:58
      67500 -- (-4038.907) (-4024.769) [-4036.377] (-4056.013) * (-4058.833) (-4039.753) [-4013.475] (-4054.316) -- 0:23:01
      68000 -- (-4034.189) [-4030.994] (-4056.420) (-4041.138) * (-4078.479) (-4034.596) [-4013.849] (-4075.905) -- 0:22:50
      68500 -- [-4029.483] (-4030.346) (-4039.216) (-4076.148) * (-4081.019) (-4038.979) [-4012.115] (-4058.059) -- 0:22:53
      69000 -- [-4017.081] (-4050.302) (-4034.043) (-4057.565) * (-4067.403) (-4019.683) [-4005.104] (-4039.816) -- 0:22:56
      69500 -- (-4019.508) (-4047.490) [-4013.932] (-4055.471) * (-4053.122) (-4026.531) [-4024.178] (-4038.643) -- 0:22:59
      70000 -- (-4028.767) (-4045.252) [-4012.039] (-4042.527) * (-4047.280) (-4019.119) [-4026.296] (-4063.226) -- 0:22:48

      Average standard deviation of split frequencies: 0.040089

      70500 -- [-4036.093] (-4047.369) (-4022.077) (-4058.657) * (-4050.355) (-4026.339) [-4018.279] (-4096.643) -- 0:22:51
      71000 -- (-4030.797) (-4051.819) [-4019.265] (-4069.145) * (-4048.832) (-4041.390) [-4017.193] (-4072.966) -- 0:22:53
      71500 -- (-4035.686) (-4049.259) [-4026.025] (-4053.946) * (-4035.999) (-4063.186) [-4025.577] (-4076.480) -- 0:22:56
      72000 -- (-4039.391) [-4037.963] (-4047.373) (-4050.294) * [-4036.773] (-4046.261) (-4028.069) (-4077.900) -- 0:22:46
      72500 -- (-4024.542) (-4061.568) (-4044.428) [-4038.379] * (-4034.663) (-4047.655) [-4034.124] (-4047.143) -- 0:22:48
      73000 -- (-4037.740) (-4061.388) (-4057.402) [-4019.422] * (-4036.831) (-4032.573) [-4045.507] (-4048.939) -- 0:22:51
      73500 -- (-4040.519) (-4044.545) (-4058.405) [-4033.487] * (-4031.834) [-4035.862] (-4056.631) (-4053.663) -- 0:22:53
      74000 -- [-4044.173] (-4030.151) (-4078.970) (-4022.137) * (-4030.890) (-4040.318) (-4050.526) [-4038.937] -- 0:22:43
      74500 -- (-4057.772) (-4031.270) (-4051.840) [-4009.243] * [-4031.196] (-4050.112) (-4042.869) (-4061.776) -- 0:22:46
      75000 -- (-4039.252) (-4027.289) (-4056.990) [-4006.806] * [-4034.570] (-4041.885) (-4045.551) (-4061.673) -- 0:22:49

      Average standard deviation of split frequencies: 0.038897

      75500 -- (-4038.003) [-4034.403] (-4048.884) (-4022.909) * (-4044.200) [-4021.498] (-4041.367) (-4039.174) -- 0:22:39
      76000 -- (-4050.871) (-4020.450) (-4058.940) [-4012.254] * (-4048.501) [-4020.809] (-4030.559) (-4074.368) -- 0:22:41
      76500 -- (-4043.915) [-4018.036] (-4069.436) (-4014.302) * (-4058.220) [-4011.862] (-4027.460) (-4089.364) -- 0:22:44
      77000 -- (-4066.226) (-4030.123) (-4069.847) [-4018.414] * (-4034.986) (-4018.583) [-4034.179] (-4076.044) -- 0:22:46
      77500 -- [-4052.890] (-4030.031) (-4063.861) (-4034.708) * (-4061.908) [-4017.609] (-4031.331) (-4056.239) -- 0:22:36
      78000 -- (-4048.507) [-4010.053] (-4068.761) (-4043.541) * (-4043.577) [-4011.371] (-4049.163) (-4061.011) -- 0:22:39
      78500 -- (-4050.112) [-4023.925] (-4059.897) (-4036.214) * (-4036.824) (-4010.167) [-4032.378] (-4053.430) -- 0:22:41
      79000 -- (-4047.885) (-4047.553) (-4058.002) [-4034.454] * (-4035.770) (-4031.726) [-4025.967] (-4054.926) -- 0:22:44
      79500 -- (-4061.730) [-4023.173] (-4058.153) (-4027.411) * [-4034.590] (-4036.325) (-4035.810) (-4081.313) -- 0:22:34
      80000 -- (-4047.053) (-4031.097) (-4044.194) [-4024.111] * (-4052.581) [-4026.359] (-4044.604) (-4051.675) -- 0:22:37

      Average standard deviation of split frequencies: 0.040965

      80500 -- (-4051.087) (-4028.364) (-4070.699) [-4025.454] * (-4061.092) [-4017.756] (-4036.714) (-4058.079) -- 0:22:39
      81000 -- (-4056.116) [-4021.948] (-4035.890) (-4038.992) * (-4044.650) [-4006.145] (-4037.387) (-4049.945) -- 0:22:30
      81500 -- (-4043.096) (-4037.085) (-4041.475) [-4028.790] * (-4062.806) [-4004.832] (-4036.888) (-4048.944) -- 0:22:32
      82000 -- (-4040.971) (-4051.480) (-4057.227) [-4053.025] * (-4061.262) [-4016.551] (-4039.341) (-4028.960) -- 0:22:34
      82500 -- [-4039.266] (-4042.786) (-4065.057) (-4052.262) * (-4061.438) [-4018.765] (-4035.417) (-4030.822) -- 0:22:36
      83000 -- (-4032.065) (-4017.596) (-4037.487) [-4031.055] * (-4037.474) [-4022.358] (-4042.337) (-4042.906) -- 0:22:27
      83500 -- (-4032.272) (-4039.924) (-4036.225) [-4024.486] * (-4047.771) [-4010.331] (-4032.123) (-4050.809) -- 0:22:30
      84000 -- (-4039.160) (-4039.261) (-4057.210) [-4012.982] * (-4047.321) (-4047.066) (-4029.390) [-4025.431] -- 0:22:32
      84500 -- (-4054.890) (-4037.197) (-4040.053) [-4022.448] * (-4051.169) [-4041.734] (-4035.203) (-4052.919) -- 0:22:34
      85000 -- (-4061.156) [-4034.947] (-4024.183) (-4016.237) * (-4042.216) (-4030.948) [-4038.640] (-4063.006) -- 0:22:25

      Average standard deviation of split frequencies: 0.039055

      85500 -- (-4050.023) (-4046.898) (-4031.713) [-4023.229] * (-4044.948) (-4047.872) [-4048.743] (-4053.034) -- 0:22:27
      86000 -- (-4046.969) (-4045.866) (-4038.552) [-4009.584] * (-4041.196) (-4038.848) [-4028.211] (-4046.617) -- 0:22:29
      86500 -- (-4049.587) (-4034.045) (-4014.485) [-4003.983] * [-4036.813] (-4050.151) (-4042.138) (-4041.072) -- 0:22:31
      87000 -- (-4046.972) (-4048.894) (-4034.239) [-4024.364] * (-4029.808) [-4032.132] (-4039.099) (-4075.034) -- 0:22:23
      87500 -- (-4053.381) (-4055.846) [-4033.913] (-4025.179) * (-4038.547) [-4042.720] (-4029.489) (-4040.730) -- 0:22:25
      88000 -- (-4025.539) (-4047.876) (-4037.244) [-4028.789] * (-4048.433) (-4033.858) [-4024.866] (-4040.431) -- 0:22:27
      88500 -- (-4029.637) (-4049.857) (-4013.906) [-4023.313] * (-4044.480) (-4041.790) [-4035.570] (-4056.759) -- 0:22:29
      89000 -- (-4041.854) (-4057.560) (-4053.720) [-4023.297] * (-4029.438) (-4043.507) [-4034.137] (-4065.122) -- 0:22:20
      89500 -- (-4054.033) (-4069.552) (-4046.061) [-4028.402] * [-4025.808] (-4043.782) (-4038.425) (-4033.677) -- 0:22:22
      90000 -- (-4058.480) (-4060.572) (-4046.901) [-4041.119] * (-4026.298) [-4025.795] (-4034.192) (-4048.376) -- 0:22:24

      Average standard deviation of split frequencies: 0.040728

      90500 -- (-4058.561) (-4066.093) (-4048.403) [-4028.968] * (-4027.761) [-4037.586] (-4042.408) (-4044.838) -- 0:22:16
      91000 -- (-4050.042) (-4063.676) (-4051.441) [-4024.756] * (-4045.623) [-4018.261] (-4038.628) (-4055.980) -- 0:22:18
      91500 -- (-4037.674) (-4069.223) (-4065.415) [-4018.376] * (-4028.959) (-4024.936) (-4048.051) [-4019.335] -- 0:22:20
      92000 -- (-4053.775) (-4059.203) (-4039.794) [-4036.460] * [-4020.328] (-4043.162) (-4057.433) (-4016.164) -- 0:22:22
      92500 -- [-4033.383] (-4066.980) (-4060.105) (-4028.521) * (-4028.093) (-4043.432) (-4051.947) [-4026.352] -- 0:22:14
      93000 -- [-4022.652] (-4053.677) (-4055.621) (-4022.228) * (-4036.643) (-4039.383) (-4045.586) [-4039.336] -- 0:22:16
      93500 -- (-4041.536) (-4045.305) (-4031.419) [-4021.927] * [-4028.586] (-4046.216) (-4052.991) (-4030.294) -- 0:22:17
      94000 -- (-4045.580) (-4050.021) (-4046.190) [-4032.588] * [-4022.530] (-4048.146) (-4066.684) (-4037.861) -- 0:22:19
      94500 -- (-4050.815) (-4047.333) (-4046.907) [-4037.439] * (-4026.184) (-4056.487) (-4065.687) [-4023.125] -- 0:22:11
      95000 -- (-4059.706) (-4057.231) (-4037.587) [-4023.982] * (-4039.015) (-4052.867) (-4053.761) [-4018.822] -- 0:22:13

      Average standard deviation of split frequencies: 0.039916

      95500 -- (-4054.946) (-4048.701) (-4037.150) [-4030.086] * (-4026.234) (-4059.558) (-4071.724) [-4019.822] -- 0:22:15
      96000 -- (-4058.418) (-4042.600) (-4030.300) [-4014.226] * [-4033.518] (-4058.562) (-4049.222) (-4025.297) -- 0:22:17
      96500 -- (-4048.694) (-4061.683) (-4022.852) [-4024.216] * [-4026.417] (-4074.837) (-4034.787) (-4031.161) -- 0:22:09
      97000 -- (-4051.353) (-4085.271) [-4021.708] (-4028.835) * (-4042.826) (-4069.111) (-4052.323) [-4026.315] -- 0:22:11
      97500 -- (-4036.101) (-4076.177) [-4018.301] (-4033.049) * (-4035.966) (-4037.762) (-4059.698) [-4018.822] -- 0:22:12
      98000 -- (-4057.119) (-4073.191) [-4008.788] (-4046.045) * (-4016.194) [-4014.344] (-4047.928) (-4039.353) -- 0:22:05
      98500 -- (-4025.760) (-4061.379) [-4022.557] (-4036.642) * (-4023.989) (-4024.170) [-4048.249] (-4037.135) -- 0:22:07
      99000 -- (-4046.162) (-4083.491) [-4021.195] (-4032.918) * [-4024.837] (-4030.539) (-4059.975) (-4015.003) -- 0:22:08
      99500 -- [-4025.138] (-4058.614) (-4022.273) (-4040.732) * (-4052.347) (-4047.435) (-4034.708) [-4026.461] -- 0:22:10
      100000 -- [-4015.177] (-4066.018) (-4042.304) (-4020.832) * [-4042.704] (-4053.096) (-4033.105) (-4030.669) -- 0:22:03

      Average standard deviation of split frequencies: 0.036735

      100500 -- [-4021.848] (-4046.828) (-4039.605) (-4037.958) * (-4042.846) (-4064.044) (-4026.390) [-4017.996] -- 0:22:04
      101000 -- (-4045.367) [-4035.617] (-4028.798) (-4055.716) * (-4055.793) (-4040.807) (-4041.878) [-4029.041] -- 0:22:06
      101500 -- (-4045.330) (-4035.039) [-4027.954] (-4052.604) * (-4047.551) (-4039.872) (-4025.095) [-4020.715] -- 0:22:07
      102000 -- (-4029.486) (-4040.774) (-4062.656) [-4042.569] * (-4035.912) (-4054.116) (-4019.274) [-4013.189] -- 0:22:00
      102500 -- [-4017.172] (-4046.562) (-4060.309) (-4029.135) * (-4040.552) (-4067.007) (-4031.694) [-4014.776] -- 0:22:02
      103000 -- [-4011.000] (-4023.534) (-4061.878) (-4025.878) * (-4054.043) (-4036.918) (-4019.121) [-4021.617] -- 0:22:03
      103500 -- [-4018.577] (-4019.822) (-4061.100) (-4030.557) * (-4049.005) (-4028.238) (-4018.306) [-4022.264] -- 0:22:05
      104000 -- (-4021.381) (-4041.689) (-4046.596) [-4027.637] * (-4057.791) [-4015.874] (-4042.546) (-4050.855) -- 0:21:58
      104500 -- (-4028.917) (-4057.959) (-4035.767) [-4019.060] * (-4059.155) [-4013.354] (-4041.416) (-4050.139) -- 0:21:59
      105000 -- [-4024.541] (-4046.505) (-4047.074) (-4031.222) * (-4049.994) [-4024.283] (-4043.744) (-4066.866) -- 0:22:01

      Average standard deviation of split frequencies: 0.035362

      105500 -- [-4034.309] (-4052.646) (-4036.322) (-4025.389) * (-4042.484) [-4041.100] (-4036.211) (-4048.742) -- 0:21:54
      106000 -- (-4051.919) (-4035.702) [-4027.117] (-4044.082) * (-4034.622) [-4009.608] (-4041.644) (-4045.239) -- 0:21:55
      106500 -- (-4046.215) (-4042.453) [-4000.002] (-4040.336) * (-4043.168) (-4029.412) (-4056.342) [-4021.038] -- 0:21:57
      107000 -- (-4047.841) (-4044.758) [-4008.700] (-4036.246) * (-4070.057) [-4020.105] (-4050.097) (-4021.722) -- 0:21:58
      107500 -- (-4042.742) (-4047.800) [-4006.654] (-4029.288) * (-4055.334) (-4037.398) (-4066.341) [-4018.886] -- 0:21:51
      108000 -- (-4033.819) (-4052.637) [-4007.634] (-4031.149) * (-4048.444) [-4029.990] (-4066.998) (-4030.363) -- 0:21:53
      108500 -- (-4039.424) (-4062.130) [-4016.576] (-4044.323) * (-4059.355) (-4042.001) (-4046.532) [-4032.291] -- 0:21:54
      109000 -- (-4053.884) [-4030.933] (-4020.547) (-4042.900) * (-4050.243) [-4042.508] (-4042.443) (-4050.314) -- 0:21:56
      109500 -- (-4054.163) [-4019.951] (-4028.930) (-4053.633) * (-4055.711) (-4018.113) (-4047.819) [-4032.713] -- 0:21:49
      110000 -- (-4055.672) [-4018.171] (-4040.835) (-4054.666) * [-4039.260] (-4031.175) (-4033.895) (-4044.348) -- 0:21:50

      Average standard deviation of split frequencies: 0.036476

      110500 -- (-4061.349) [-4020.249] (-4034.970) (-4046.068) * (-4040.212) (-4029.561) [-4018.763] (-4058.599) -- 0:21:52
      111000 -- (-4067.813) [-4014.204] (-4031.370) (-4047.049) * [-4030.806] (-4037.159) (-4044.177) (-4031.704) -- 0:21:53
      111500 -- (-4051.319) (-4028.131) [-4031.283] (-4045.783) * (-4054.629) (-4018.158) [-4038.652] (-4056.669) -- 0:21:46
      112000 -- (-4056.076) [-4025.800] (-4043.665) (-4044.768) * (-4046.579) [-4029.383] (-4038.702) (-4045.708) -- 0:21:48
      112500 -- (-4045.300) [-4012.649] (-4050.098) (-4079.115) * (-4059.076) [-4016.792] (-4024.631) (-4047.314) -- 0:21:49
      113000 -- (-4052.589) [-4030.877] (-4043.489) (-4053.887) * (-4052.221) [-4007.678] (-4051.847) (-4027.513) -- 0:21:50
      113500 -- [-4037.392] (-4020.801) (-4052.188) (-4041.546) * (-4055.846) [-4004.495] (-4037.163) (-4034.565) -- 0:21:44
      114000 -- (-4049.673) [-4019.783] (-4049.282) (-4037.245) * (-4065.572) [-4020.035] (-4049.657) (-4011.620) -- 0:21:45
      114500 -- (-4040.847) (-4027.629) (-4080.610) [-4027.685] * (-4036.485) (-4031.799) (-4037.511) [-4015.489] -- 0:21:46
      115000 -- [-4020.509] (-4033.436) (-4071.202) (-4025.301) * (-4042.238) [-4026.597] (-4061.685) (-4029.309) -- 0:21:40

      Average standard deviation of split frequencies: 0.036656

      115500 -- (-4028.180) [-4032.079] (-4071.267) (-4029.401) * (-4062.534) [-4021.772] (-4046.293) (-4043.268) -- 0:21:41
      116000 -- [-4016.211] (-4042.948) (-4058.251) (-4044.963) * (-4068.805) [-4019.394] (-4041.616) (-4037.483) -- 0:21:43
      116500 -- (-4015.404) [-4027.891] (-4062.759) (-4051.512) * (-4063.823) [-4022.984] (-4035.222) (-4043.911) -- 0:21:44
      117000 -- (-4024.939) [-4022.484] (-4063.653) (-4033.684) * (-4063.544) [-4022.126] (-4052.142) (-4050.085) -- 0:21:38
      117500 -- (-4029.952) (-4034.679) (-4070.084) [-4029.639] * (-4056.272) (-4019.499) (-4058.642) [-4033.045] -- 0:21:39
      118000 -- (-4039.701) (-4034.271) (-4061.319) [-4036.059] * (-4018.360) [-4020.600] (-4024.958) (-4056.493) -- 0:21:40
      118500 -- (-4037.081) [-4024.612] (-4047.391) (-4038.888) * [-4014.758] (-4021.370) (-4042.543) (-4048.976) -- 0:21:41
      119000 -- [-4023.119] (-4036.749) (-4040.255) (-4048.171) * (-4041.759) [-4020.157] (-4045.743) (-4038.203) -- 0:21:35
      119500 -- [-4026.813] (-4038.539) (-4029.228) (-4072.307) * (-4057.531) [-4023.334] (-4062.970) (-4043.441) -- 0:21:36
      120000 -- [-4015.372] (-4051.614) (-4022.749) (-4058.388) * (-4073.400) (-4032.280) (-4041.877) [-4036.482] -- 0:21:38

      Average standard deviation of split frequencies: 0.035361

      120500 -- [-4030.980] (-4029.382) (-4021.629) (-4071.575) * (-4040.605) [-4016.517] (-4034.650) (-4030.337) -- 0:21:39
      121000 -- [-4031.667] (-4031.337) (-4031.590) (-4056.117) * (-4045.204) [-4009.398] (-4047.794) (-4031.307) -- 0:21:33
      121500 -- (-4039.601) [-4025.009] (-4034.334) (-4053.989) * (-4057.556) (-4026.184) (-4043.391) [-4025.397] -- 0:21:34
      122000 -- (-4047.414) [-4031.613] (-4055.741) (-4058.728) * (-4065.155) [-4029.441] (-4037.557) (-4026.156) -- 0:21:35
      122500 -- (-4033.826) [-4027.338] (-4045.097) (-4042.923) * (-4089.851) [-4027.784] (-4055.291) (-4020.766) -- 0:21:29
      123000 -- (-4038.305) [-4028.099] (-4023.151) (-4051.372) * (-4070.744) (-4033.001) (-4065.465) [-4018.618] -- 0:21:30
      123500 -- (-4032.422) [-4016.661] (-4037.503) (-4061.518) * (-4049.119) (-4026.194) (-4063.126) [-4017.930] -- 0:21:31
      124000 -- (-4020.597) (-4046.754) [-4033.702] (-4053.965) * (-4059.595) [-4014.698] (-4062.087) (-4028.743) -- 0:21:32
      124500 -- [-4041.175] (-4066.613) (-4028.597) (-4059.411) * (-4054.448) (-4017.501) (-4062.838) [-4039.966] -- 0:21:26
      125000 -- [-4030.044] (-4075.756) (-4039.966) (-4034.492) * (-4050.635) [-4014.891] (-4053.124) (-4044.929) -- 0:21:28

      Average standard deviation of split frequencies: 0.035237

      125500 -- (-4036.284) (-4063.302) (-4041.218) [-4032.932] * (-4053.980) [-4018.234] (-4065.502) (-4032.036) -- 0:21:29
      126000 -- (-4040.473) (-4060.269) (-4033.733) [-4028.255] * [-4029.217] (-4038.861) (-4056.898) (-4028.935) -- 0:21:30
      126500 -- (-4051.611) (-4042.800) [-4033.537] (-4034.723) * (-4030.355) [-4029.971] (-4048.648) (-4025.259) -- 0:21:24
      127000 -- [-4028.897] (-4053.732) (-4048.292) (-4052.083) * [-4022.646] (-4041.078) (-4046.977) (-4033.201) -- 0:21:25
      127500 -- (-4036.667) [-4036.811] (-4046.902) (-4046.720) * (-4037.329) (-4067.475) [-4024.103] (-4054.138) -- 0:21:26
      128000 -- (-4038.616) (-4039.016) [-4037.927] (-4053.220) * (-4027.424) (-4047.076) [-4017.084] (-4040.138) -- 0:21:27
      128500 -- [-4021.340] (-4029.661) (-4062.025) (-4061.965) * (-4032.608) (-4036.759) (-4031.710) [-4020.074] -- 0:21:21
      129000 -- (-4025.319) [-4030.777] (-4051.524) (-4054.634) * [-4017.309] (-4035.293) (-4041.040) (-4041.726) -- 0:21:22
      129500 -- [-4014.598] (-4039.480) (-4073.067) (-4050.064) * [-4022.768] (-4036.528) (-4045.399) (-4037.411) -- 0:21:23
      130000 -- [-4016.800] (-4034.703) (-4048.637) (-4043.917) * [-4022.695] (-4043.372) (-4050.546) (-4048.056) -- 0:21:24

      Average standard deviation of split frequencies: 0.033371

      130500 -- [-4021.109] (-4047.760) (-4054.210) (-4056.354) * [-4025.571] (-4032.348) (-4047.973) (-4062.794) -- 0:21:19
      131000 -- [-4013.057] (-4047.562) (-4057.592) (-4031.982) * (-4021.380) (-4066.351) [-4039.944] (-4060.181) -- 0:21:20
      131500 -- [-4022.698] (-4030.017) (-4060.728) (-4037.371) * (-4028.928) (-4069.367) (-4039.478) [-4036.904] -- 0:21:21
      132000 -- (-4031.517) (-4036.824) (-4043.919) [-4012.975] * [-4021.028] (-4072.585) (-4030.987) (-4057.859) -- 0:21:22
      132500 -- (-4032.257) (-4044.868) (-4055.492) [-4017.229] * (-4041.893) (-4055.759) [-4029.108] (-4061.875) -- 0:21:16
      133000 -- (-4043.144) (-4045.905) (-4037.658) [-4040.485] * (-4047.638) (-4055.005) [-4018.326] (-4065.918) -- 0:21:17
      133500 -- (-4046.211) [-4027.913] (-4035.353) (-4060.814) * (-4046.933) (-4039.933) [-4025.352] (-4053.714) -- 0:21:18
      134000 -- [-4028.811] (-4028.658) (-4056.051) (-4061.098) * (-4047.363) [-4014.922] (-4029.488) (-4056.113) -- 0:21:13
      134500 -- (-4033.950) [-4024.587] (-4041.720) (-4059.352) * (-4064.910) (-4022.826) [-4018.143] (-4058.133) -- 0:21:14
      135000 -- [-4020.814] (-4032.799) (-4049.657) (-4050.379) * (-4062.530) [-4029.698] (-4046.533) (-4026.270) -- 0:21:15

      Average standard deviation of split frequencies: 0.032998

      135500 -- [-4023.265] (-4030.479) (-4051.775) (-4033.303) * (-4049.517) (-4031.835) (-4045.457) [-4028.140] -- 0:21:16
      136000 -- (-4028.965) [-4018.529] (-4054.487) (-4035.801) * (-4031.900) (-4040.681) (-4039.368) [-4015.122] -- 0:21:10
      136500 -- (-4031.206) (-4023.106) [-4034.951] (-4060.780) * (-4025.964) (-4030.772) (-4057.966) [-4023.337] -- 0:21:11
      137000 -- (-4032.412) [-4020.368] (-4037.111) (-4041.322) * (-4039.370) [-4032.263] (-4072.401) (-4031.190) -- 0:21:12
      137500 -- (-4037.371) [-4027.455] (-4038.103) (-4035.279) * (-4056.398) (-4047.946) (-4029.859) [-4016.630] -- 0:21:13
      138000 -- (-4013.933) [-4012.022] (-4034.010) (-4034.501) * (-4051.308) (-4036.165) (-4038.239) [-4017.474] -- 0:21:08
      138500 -- (-4019.865) [-4012.978] (-4036.870) (-4040.262) * (-4046.765) (-4055.086) (-4038.943) [-4027.526] -- 0:21:08
      139000 -- (-4023.239) [-4025.594] (-4046.591) (-4031.208) * (-4027.694) (-4053.062) (-4052.068) [-4017.069] -- 0:21:09
      139500 -- (-4020.758) [-4012.698] (-4052.450) (-4038.684) * (-4045.659) (-4047.030) (-4040.529) [-4017.822] -- 0:21:10
      140000 -- (-4025.402) [-4021.033] (-4033.119) (-4039.299) * (-4045.035) [-4036.511] (-4042.832) (-4032.395) -- 0:21:05

      Average standard deviation of split frequencies: 0.031219

      140500 -- (-4036.089) (-4059.374) [-4024.766] (-4045.078) * (-4059.841) (-4036.381) (-4038.993) [-4026.404] -- 0:21:06
      141000 -- [-4029.662] (-4034.420) (-4036.890) (-4047.733) * (-4048.503) (-4032.234) (-4048.584) [-4019.605] -- 0:21:07
      141500 -- [-4014.608] (-4071.265) (-4026.206) (-4051.560) * (-4053.139) (-4018.541) (-4068.400) [-4031.461] -- 0:21:01
      142000 -- [-4015.374] (-4059.605) (-4034.193) (-4052.444) * (-4057.192) [-4028.121] (-4045.908) (-4036.088) -- 0:21:02
      142500 -- [-4010.946] (-4056.339) (-4033.972) (-4040.043) * [-4041.344] (-4015.004) (-4064.450) (-4031.028) -- 0:21:03
      143000 -- [-4016.775] (-4075.256) (-4034.120) (-4043.015) * (-4054.478) [-4025.834] (-4050.647) (-4028.463) -- 0:21:04
      143500 -- (-4016.960) (-4051.509) [-4042.330] (-4048.439) * (-4050.954) (-4027.353) (-4034.577) [-4019.797] -- 0:20:59
      144000 -- [-4029.695] (-4054.216) (-4034.891) (-4060.969) * (-4066.409) (-4028.920) (-4035.653) [-4013.275] -- 0:21:00
      144500 -- (-4037.909) (-4046.603) (-4057.382) [-4036.656] * (-4042.458) (-4048.254) (-4024.040) [-4029.691] -- 0:21:01
      145000 -- (-4032.652) (-4056.626) (-4060.394) [-4022.241] * (-4031.286) [-4030.425] (-4025.200) (-4034.618) -- 0:21:01

      Average standard deviation of split frequencies: 0.029949

      145500 -- (-4051.823) [-4031.681] (-4025.395) (-4031.010) * (-4039.601) (-4023.389) [-4024.008] (-4029.658) -- 0:20:56
      146000 -- (-4070.049) (-4023.024) (-4033.800) [-4031.251] * (-4058.966) [-4021.492] (-4034.113) (-4029.699) -- 0:20:57
      146500 -- (-4050.536) (-4037.909) (-4035.225) [-4030.089] * (-4047.171) [-4030.911] (-4039.957) (-4039.425) -- 0:20:58
      147000 -- (-4040.008) (-4034.641) (-4048.383) [-4028.305] * [-4020.954] (-4032.355) (-4067.406) (-4032.413) -- 0:20:53
      147500 -- (-4036.586) [-4027.520] (-4045.596) (-4013.379) * [-4027.319] (-4021.266) (-4046.744) (-4035.050) -- 0:20:54
      148000 -- (-4023.424) [-4026.642] (-4060.666) (-4046.607) * (-4029.713) (-4038.345) (-4062.977) [-4030.037] -- 0:20:54
      148500 -- [-4032.638] (-4023.328) (-4041.153) (-4052.746) * (-4033.763) (-4039.067) (-4066.435) [-4025.145] -- 0:20:55
      149000 -- [-4035.090] (-4016.453) (-4046.763) (-4045.299) * (-4031.093) (-4056.032) (-4033.063) [-4016.431] -- 0:20:50
      149500 -- (-4026.147) [-4012.153] (-4045.414) (-4034.322) * [-4012.553] (-4037.872) (-4056.749) (-4014.187) -- 0:20:51
      150000 -- [-4017.516] (-4026.494) (-4039.764) (-4028.140) * [-4010.150] (-4047.431) (-4055.033) (-4036.563) -- 0:20:52

      Average standard deviation of split frequencies: 0.028792

      150500 -- [-4030.865] (-4028.449) (-4041.887) (-4014.661) * [-4010.086] (-4058.936) (-4035.554) (-4046.512) -- 0:20:53
      151000 -- (-4018.960) [-4039.202] (-4033.630) (-4032.579) * [-4018.632] (-4072.228) (-4042.600) (-4037.964) -- 0:20:48
      151500 -- (-4051.729) (-4064.555) (-4030.422) [-4018.621] * (-4036.165) (-4047.078) [-4038.533] (-4049.387) -- 0:20:48
      152000 -- (-4032.250) (-4053.064) (-4054.332) [-4028.337] * (-4040.645) [-4036.708] (-4038.929) (-4045.036) -- 0:20:49
      152500 -- [-4041.721] (-4051.396) (-4048.492) (-4050.106) * (-4049.505) [-4032.790] (-4037.791) (-4039.827) -- 0:20:44
      153000 -- (-4036.412) (-4038.259) (-4043.599) [-4041.084] * (-4037.256) (-4029.119) (-4067.650) [-4025.691] -- 0:20:45
      153500 -- (-4011.820) [-4034.301] (-4048.359) (-4037.008) * (-4046.113) (-4036.851) (-4075.134) [-4026.099] -- 0:20:46
      154000 -- [-4019.697] (-4047.648) (-4055.095) (-4061.477) * (-4048.477) (-4032.818) (-4081.658) [-4035.323] -- 0:20:47
      154500 -- [-4033.559] (-4037.143) (-4059.168) (-4050.558) * (-4049.594) (-4026.895) (-4052.322) [-4035.537] -- 0:20:42
      155000 -- (-4026.141) (-4042.268) [-4036.113] (-4056.210) * (-4047.688) [-4014.954] (-4044.554) (-4034.298) -- 0:20:42

      Average standard deviation of split frequencies: 0.029746

      155500 -- [-4023.922] (-4055.915) (-4050.710) (-4030.152) * (-4062.249) (-4030.632) (-4047.633) [-4011.465] -- 0:20:43
      156000 -- [-4019.725] (-4052.270) (-4037.634) (-4036.540) * (-4067.711) (-4044.414) (-4048.663) [-4007.277] -- 0:20:44
      156500 -- [-4028.461] (-4064.334) (-4028.798) (-4044.832) * (-4038.326) (-4063.240) [-4023.876] (-4015.822) -- 0:20:39
      157000 -- (-4041.696) (-4075.422) [-4023.391] (-4057.464) * (-4038.962) (-4060.123) (-4039.030) [-4010.962] -- 0:20:40
      157500 -- (-4048.311) (-4068.267) [-4018.737] (-4056.134) * (-4046.927) (-4037.648) (-4045.193) [-4021.136] -- 0:20:41
      158000 -- (-4053.711) (-4047.290) (-4014.819) [-4022.146] * (-4028.181) (-4039.977) (-4047.027) [-4028.186] -- 0:20:41
      158500 -- (-4058.464) [-4035.168] (-4037.719) (-4026.629) * (-4027.065) [-4023.307] (-4062.209) (-4013.853) -- 0:20:37
      159000 -- (-4066.165) (-4026.607) (-4033.730) [-4018.768] * (-4042.864) (-4051.789) (-4035.753) [-4018.084] -- 0:20:37
      159500 -- (-4046.740) (-4048.463) (-4031.280) [-4030.613] * [-4043.596] (-4044.238) (-4061.835) (-4027.373) -- 0:20:38
      160000 -- (-4032.020) (-4051.352) [-4022.325] (-4060.954) * (-4053.859) (-4042.699) (-4047.301) [-4038.759] -- 0:20:39

      Average standard deviation of split frequencies: 0.029216

      160500 -- [-4029.851] (-4034.154) (-4038.539) (-4051.035) * (-4038.657) (-4041.204) (-4044.319) [-4043.420] -- 0:20:34
      161000 -- [-4013.237] (-4042.104) (-4043.408) (-4043.746) * (-4023.689) (-4044.450) (-4033.797) [-4020.135] -- 0:20:35
      161500 -- [-4020.153] (-4041.820) (-4046.146) (-4044.243) * [-4029.870] (-4047.253) (-4040.473) (-4048.536) -- 0:20:35
      162000 -- [-4020.299] (-4059.319) (-4031.287) (-4036.250) * [-4025.147] (-4041.181) (-4048.408) (-4046.592) -- 0:20:31
      162500 -- (-4032.912) (-4040.844) [-4028.994] (-4036.336) * [-4042.658] (-4044.033) (-4027.823) (-4046.731) -- 0:20:31
      163000 -- (-4033.892) (-4033.559) [-4019.445] (-4062.926) * (-4035.348) [-4026.110] (-4036.967) (-4053.367) -- 0:20:32
      163500 -- (-4035.545) [-4026.641] (-4016.731) (-4052.740) * (-4036.392) (-4040.815) [-4019.281] (-4063.902) -- 0:20:33
      164000 -- (-4045.271) [-4028.743] (-4028.165) (-4056.967) * (-4047.288) (-4023.390) [-4014.041] (-4050.184) -- 0:20:28
      164500 -- (-4047.857) [-4011.014] (-4024.185) (-4040.383) * (-4034.257) (-4042.260) [-4017.708] (-4063.735) -- 0:20:29
      165000 -- (-4067.846) [-4018.928] (-4034.189) (-4052.897) * (-4054.463) (-4040.875) [-4023.804] (-4053.567) -- 0:20:29

      Average standard deviation of split frequencies: 0.029265

      165500 -- (-4046.308) [-4020.478] (-4044.684) (-4054.353) * (-4055.298) (-4035.898) [-4028.964] (-4047.990) -- 0:20:30
      166000 -- [-4033.456] (-4032.804) (-4054.056) (-4066.224) * [-4037.163] (-4048.412) (-4026.604) (-4067.648) -- 0:20:25
      166500 -- (-4039.937) (-4022.416) [-4030.293] (-4066.467) * (-4041.706) (-4054.100) [-4018.474] (-4045.947) -- 0:20:26
      167000 -- (-4020.077) [-4019.041] (-4028.432) (-4046.609) * [-4026.222] (-4036.047) (-4042.813) (-4038.675) -- 0:20:27
      167500 -- [-4019.272] (-4025.971) (-4039.521) (-4057.659) * [-4028.198] (-4039.446) (-4027.764) (-4061.489) -- 0:20:27
      168000 -- [-4029.920] (-4029.839) (-4019.470) (-4080.476) * (-4035.684) (-4053.361) [-4028.283] (-4035.791) -- 0:20:23
      168500 -- [-4014.136] (-4042.212) (-4033.234) (-4069.231) * (-4048.012) (-4040.112) (-4020.254) [-4037.011] -- 0:20:23
      169000 -- (-4007.673) (-4050.240) [-4026.736] (-4037.307) * (-4050.277) (-4060.414) (-4031.406) [-4027.800] -- 0:20:24
      169500 -- [-4021.735] (-4032.472) (-4037.631) (-4047.355) * (-4046.098) (-4050.152) (-4035.194) [-4038.190] -- 0:20:24
      170000 -- [-4017.496] (-4026.863) (-4043.013) (-4045.890) * [-4026.428] (-4072.953) (-4032.550) (-4039.855) -- 0:20:20

      Average standard deviation of split frequencies: 0.028197

      170500 -- [-4020.282] (-4032.716) (-4040.353) (-4046.645) * (-4026.460) (-4046.880) (-4025.941) [-4026.877] -- 0:20:21
      171000 -- (-4018.933) (-4030.579) (-4066.334) [-4022.860] * (-4057.483) (-4056.901) (-4028.090) [-4023.838] -- 0:20:21
      171500 -- (-4036.827) (-4060.215) (-4054.085) [-4034.817] * (-4065.576) (-4060.816) (-4030.112) [-4017.277] -- 0:20:17
      172000 -- (-4040.568) (-4057.483) [-4027.180] (-4060.992) * (-4028.083) (-4055.629) [-4026.548] (-4026.943) -- 0:20:17
      172500 -- (-4065.486) (-4041.859) [-4013.053] (-4056.151) * (-4033.300) (-4038.813) (-4035.992) [-4022.844] -- 0:20:18
      173000 -- (-4053.225) [-4026.711] (-4023.294) (-4054.639) * (-4056.257) (-4039.420) [-4036.353] (-4035.966) -- 0:20:18
      173500 -- [-4035.357] (-4044.569) (-4027.761) (-4056.945) * (-4034.061) [-4026.977] (-4049.589) (-4041.522) -- 0:20:14
      174000 -- (-4042.041) (-4071.047) [-4020.910] (-4045.886) * (-4044.162) (-4030.363) (-4051.922) [-4020.747] -- 0:20:15
      174500 -- (-4030.156) (-4054.733) [-4024.415] (-4064.416) * [-4021.213] (-4028.432) (-4056.192) (-4051.176) -- 0:20:15
      175000 -- (-4042.551) (-4055.366) [-4024.058] (-4047.791) * [-4028.652] (-4021.715) (-4042.000) (-4049.723) -- 0:20:16

      Average standard deviation of split frequencies: 0.027342

      175500 -- (-4040.923) (-4075.166) [-4020.358] (-4035.703) * (-4038.395) (-4020.960) (-4052.475) [-4027.327] -- 0:20:12
      176000 -- [-4027.907] (-4061.315) (-4032.531) (-4040.088) * (-4045.484) [-4012.694] (-4039.023) (-4042.071) -- 0:20:12
      176500 -- (-4029.629) (-4050.868) (-4021.103) [-4020.023] * (-4049.424) (-4034.609) [-4017.084] (-4039.316) -- 0:20:13
      177000 -- (-4043.659) (-4049.530) (-4033.071) [-4016.282] * (-4048.714) [-4033.189] (-4023.039) (-4052.537) -- 0:20:13
      177500 -- (-4057.246) (-4051.832) [-4041.389] (-4027.235) * (-4054.492) [-4023.103] (-4037.578) (-4041.526) -- 0:20:09
      178000 -- (-4069.032) (-4048.427) (-4039.151) [-4023.323] * (-4043.749) (-4025.000) [-4016.071] (-4067.204) -- 0:20:09
      178500 -- (-4062.441) (-4069.893) (-4051.493) [-4009.993] * (-4035.765) [-4013.712] (-4016.487) (-4058.253) -- 0:20:10
      179000 -- (-4060.531) (-4051.202) (-4025.555) [-4016.725] * (-4021.907) [-4023.509] (-4026.203) (-4068.090) -- 0:20:06
      179500 -- (-4069.833) (-4067.534) (-4045.217) [-4017.257] * (-4021.202) [-4019.428] (-4038.645) (-4069.238) -- 0:20:06
      180000 -- (-4046.619) (-4038.405) (-4056.048) [-4014.304] * (-4032.344) [-4014.333] (-4042.089) (-4042.360) -- 0:20:07

      Average standard deviation of split frequencies: 0.026899

      180500 -- (-4048.141) (-4041.430) (-4029.664) [-4029.657] * (-4035.603) [-4019.156] (-4055.104) (-4054.176) -- 0:20:07
      181000 -- (-4047.621) (-4036.851) [-4030.170] (-4025.957) * (-4058.771) [-4018.499] (-4048.092) (-4046.495) -- 0:20:03
      181500 -- (-4069.806) (-4030.103) (-4035.002) [-4027.644] * (-4049.237) [-4018.824] (-4039.792) (-4057.159) -- 0:20:04
      182000 -- (-4049.663) (-4028.523) (-4036.049) [-4035.392] * (-4053.120) (-4033.110) (-4040.597) [-4030.801] -- 0:20:04
      182500 -- (-4054.577) [-4025.696] (-4014.338) (-4039.186) * [-4025.686] (-4032.690) (-4042.334) (-4027.080) -- 0:20:04
      183000 -- (-4057.672) (-4041.377) [-4011.440] (-4036.323) * (-4054.748) (-4023.076) (-4048.713) [-4021.718] -- 0:20:00
      183500 -- (-4048.397) (-4043.798) (-4028.129) [-4026.101] * (-4063.172) (-4023.833) (-4034.978) [-4019.286] -- 0:20:01
      184000 -- (-4021.104) (-4034.985) (-4034.958) [-4030.069] * (-4061.232) (-4037.095) [-4028.405] (-4033.782) -- 0:20:01
      184500 -- [-4027.045] (-4038.779) (-4039.658) (-4030.564) * (-4074.117) (-4042.754) [-4028.197] (-4031.889) -- 0:20:02
      185000 -- [-4030.389] (-4030.478) (-4027.817) (-4058.023) * (-4075.206) [-4006.984] (-4040.072) (-4023.603) -- 0:19:58

      Average standard deviation of split frequencies: 0.025626

      185500 -- (-4037.527) (-4025.832) [-4032.633] (-4055.179) * (-4072.491) [-4021.175] (-4035.522) (-4029.957) -- 0:19:58
      186000 -- [-4029.181] (-4045.712) (-4045.600) (-4054.030) * (-4051.820) (-4015.309) (-4076.270) [-4021.855] -- 0:19:59
      186500 -- [-4026.993] (-4049.857) (-4055.939) (-4042.731) * (-4038.458) (-4021.608) (-4043.515) [-4021.363] -- 0:19:59
      187000 -- (-4032.896) (-4044.182) [-4038.267] (-4038.145) * (-4039.601) (-4037.037) (-4067.424) [-4010.417] -- 0:19:55
      187500 -- [-4028.386] (-4060.050) (-4042.777) (-4041.298) * [-4029.821] (-4042.668) (-4053.176) (-4013.582) -- 0:19:56
      188000 -- [-4031.647] (-4037.543) (-4055.243) (-4039.527) * (-4030.080) (-4055.067) (-4045.945) [-4017.213] -- 0:19:56
      188500 -- [-4043.435] (-4034.690) (-4035.914) (-4061.838) * (-4031.177) (-4060.983) (-4055.308) [-4018.708] -- 0:19:56
      189000 -- (-4033.670) (-4043.241) [-4025.788] (-4068.216) * (-4041.995) (-4029.649) (-4055.548) [-4022.727] -- 0:19:52
      189500 -- (-4035.901) (-4032.880) [-4009.164] (-4058.693) * (-4047.274) [-4037.461] (-4041.332) (-4014.115) -- 0:19:53
      190000 -- (-4032.422) (-4050.115) [-4021.265] (-4051.728) * (-4042.567) (-4036.231) (-4034.116) [-4007.354] -- 0:19:53

      Average standard deviation of split frequencies: 0.025368

      190500 -- [-4015.412] (-4066.943) (-4042.050) (-4041.971) * (-4048.604) (-4032.668) (-4025.268) [-4017.131] -- 0:19:54
      191000 -- (-4022.772) (-4038.130) (-4033.225) [-4028.454] * (-4032.122) (-4044.896) (-4034.671) [-4016.154] -- 0:19:50
      191500 -- (-4024.379) [-4032.483] (-4023.656) (-4030.253) * (-4028.474) (-4072.100) [-4042.387] (-4015.038) -- 0:19:50
      192000 -- [-4032.185] (-4045.693) (-4025.913) (-4040.923) * [-4023.602] (-4045.724) (-4056.262) (-4025.494) -- 0:19:50
      192500 -- (-4073.898) (-4051.800) (-4031.671) [-4037.036] * [-4037.398] (-4062.370) (-4047.790) (-4025.265) -- 0:19:47
      193000 -- (-4059.980) (-4054.444) (-4035.100) [-4009.181] * (-4045.982) (-4070.934) (-4056.447) [-4029.881] -- 0:19:47
      193500 -- (-4056.021) (-4025.569) (-4042.477) [-4023.729] * (-4060.845) (-4056.951) (-4059.472) [-4026.922] -- 0:19:47
      194000 -- (-4049.302) [-4015.016] (-4035.647) (-4041.244) * (-4052.383) (-4059.538) [-4028.327] (-4022.033) -- 0:19:48
      194500 -- (-4061.476) [-4015.086] (-4037.929) (-4033.732) * (-4037.412) (-4049.467) (-4040.543) [-4018.316] -- 0:19:44
      195000 -- (-4065.060) (-4022.586) [-4021.355] (-4042.157) * (-4058.916) (-4042.038) (-4021.656) [-4023.137] -- 0:19:44

      Average standard deviation of split frequencies: 0.024439

      195500 -- (-4064.106) (-4020.966) [-4021.875] (-4033.581) * (-4057.259) (-4052.282) (-4019.946) [-4031.632] -- 0:19:45
      196000 -- (-4070.586) [-4011.068] (-4037.474) (-4052.633) * (-4040.522) (-4075.572) [-4030.426] (-4017.922) -- 0:19:45
      196500 -- (-4077.199) [-4014.928] (-4021.363) (-4058.073) * (-4054.381) (-4061.126) [-4018.119] (-4028.300) -- 0:19:41
      197000 -- (-4059.144) (-4027.641) [-4021.939] (-4055.290) * (-4041.212) (-4067.658) (-4034.068) [-4020.099] -- 0:19:42
      197500 -- (-4057.584) (-4020.610) [-4018.206] (-4050.990) * (-4036.997) (-4061.180) (-4026.632) [-4016.129] -- 0:19:42
      198000 -- (-4040.959) [-4030.403] (-4013.020) (-4056.188) * (-4066.066) (-4063.889) (-4025.784) [-4021.671] -- 0:19:42
      198500 -- (-4052.959) (-4030.864) [-3999.947] (-4051.894) * (-4060.055) (-4055.342) [-4015.066] (-4036.837) -- 0:19:39
      199000 -- (-4056.329) (-4027.524) [-4004.603] (-4048.583) * (-4049.553) (-4071.471) [-4023.653] (-4035.291) -- 0:19:39
      199500 -- (-4053.024) (-4043.675) [-4001.978] (-4049.806) * (-4028.488) (-4060.234) (-4032.765) [-4035.073] -- 0:19:39
      200000 -- (-4055.788) (-4050.462) [-4031.386] (-4028.017) * (-4028.971) (-4068.286) (-4029.779) [-4031.610] -- 0:19:36

      Average standard deviation of split frequencies: 0.024692

      200500 -- (-4062.745) (-4049.070) (-4016.598) [-4035.190] * (-4022.259) (-4049.189) [-4024.803] (-4041.141) -- 0:19:36
      201000 -- (-4039.813) (-4060.212) [-4024.668] (-4041.205) * [-4016.754] (-4056.637) (-4030.367) (-4055.580) -- 0:19:36
      201500 -- (-4045.193) [-4027.202] (-4029.187) (-4038.699) * [-4009.293] (-4052.245) (-4041.610) (-4067.559) -- 0:19:36
      202000 -- [-4038.458] (-4023.007) (-4053.569) (-4051.893) * [-4004.455] (-4074.454) (-4050.754) (-4045.197) -- 0:19:33
      202500 -- (-4027.290) [-4016.552] (-4055.596) (-4055.894) * [-4010.360] (-4021.638) (-4044.671) (-4045.885) -- 0:19:33
      203000 -- [-4021.014] (-4014.769) (-4062.217) (-4054.826) * [-4004.267] (-4037.574) (-4030.340) (-4045.737) -- 0:19:33
      203500 -- (-4023.293) [-4016.961] (-4067.690) (-4036.889) * (-4022.691) (-4059.417) [-4026.889] (-4051.924) -- 0:19:34
      204000 -- [-4033.368] (-4060.936) (-4050.689) (-4029.673) * [-4020.887] (-4070.014) (-4029.560) (-4037.589) -- 0:19:30
      204500 -- (-4052.781) [-4030.675] (-4049.887) (-4028.479) * [-4018.052] (-4044.529) (-4043.131) (-4037.982) -- 0:19:30
      205000 -- (-4049.559) (-4021.547) (-4035.591) [-4038.637] * [-4024.386] (-4037.788) (-4046.999) (-4041.970) -- 0:19:31

      Average standard deviation of split frequencies: 0.023197

      205500 -- (-4040.700) [-4015.468] (-4077.395) (-4063.485) * (-4031.987) (-4052.402) [-4035.849] (-4064.286) -- 0:19:31
      206000 -- (-4034.895) (-4050.731) (-4076.799) [-4024.446] * [-4039.927] (-4033.614) (-4028.845) (-4062.964) -- 0:19:27
      206500 -- (-4034.891) (-4045.937) (-4072.336) [-4023.801] * [-4034.709] (-4053.897) (-4041.698) (-4049.676) -- 0:19:28
      207000 -- [-4024.002] (-4034.554) (-4051.654) (-4034.296) * [-4024.159] (-4036.143) (-4046.222) (-4064.780) -- 0:19:28
      207500 -- (-4056.886) (-4044.324) (-4058.825) [-4031.925] * [-4033.335] (-4039.641) (-4057.349) (-4068.117) -- 0:19:28
      208000 -- (-4049.648) (-4035.872) (-4078.217) [-4044.716] * [-4026.060] (-4067.730) (-4046.099) (-4039.849) -- 0:19:25
      208500 -- (-4041.631) (-4050.416) (-4053.229) [-4021.411] * [-4044.370] (-4047.155) (-4032.442) (-4051.041) -- 0:19:25
      209000 -- (-4035.283) (-4030.323) (-4056.546) [-4030.368] * [-4026.616] (-4057.200) (-4039.311) (-4045.098) -- 0:19:25
      209500 -- [-4021.336] (-4041.947) (-4064.561) (-4041.024) * [-4020.266] (-4045.012) (-4048.271) (-4055.417) -- 0:19:22
      210000 -- (-4030.400) (-4052.268) (-4034.578) [-4011.704] * (-4036.988) [-4029.833] (-4063.708) (-4050.762) -- 0:19:22

      Average standard deviation of split frequencies: 0.022118

      210500 -- (-4033.633) (-4046.842) (-4043.925) [-4024.452] * [-4043.194] (-4051.917) (-4042.823) (-4054.130) -- 0:19:22
      211000 -- [-4028.064] (-4033.550) (-4041.977) (-4022.590) * (-4045.781) [-4023.867] (-4038.512) (-4061.627) -- 0:19:22
      211500 -- [-4033.349] (-4045.980) (-4066.785) (-4027.382) * [-4036.263] (-4035.847) (-4034.503) (-4061.800) -- 0:19:19
      212000 -- (-4037.526) (-4035.437) (-4055.136) [-4025.740] * [-4028.089] (-4041.775) (-4039.226) (-4075.092) -- 0:19:19
      212500 -- [-4026.163] (-4047.974) (-4067.549) (-4025.995) * [-4033.728] (-4061.937) (-4032.056) (-4055.679) -- 0:19:19
      213000 -- [-4026.131] (-4045.153) (-4054.537) (-4031.817) * (-4044.630) [-4054.065] (-4043.278) (-4066.263) -- 0:19:20
      213500 -- (-4035.098) (-4046.367) (-4041.969) [-4018.238] * [-4022.880] (-4070.145) (-4031.273) (-4052.079) -- 0:19:16
      214000 -- (-4039.105) (-4051.402) [-4032.759] (-4039.184) * (-4040.990) [-4044.957] (-4027.181) (-4062.545) -- 0:19:16
      214500 -- [-4029.501] (-4027.077) (-4044.803) (-4058.170) * [-4030.148] (-4051.988) (-4042.504) (-4044.950) -- 0:19:17
      215000 -- (-4065.701) (-4032.692) [-4029.401] (-4072.306) * [-4021.627] (-4054.417) (-4035.720) (-4050.392) -- 0:19:17

      Average standard deviation of split frequencies: 0.022035

      215500 -- (-4040.584) [-4039.247] (-4035.574) (-4088.594) * (-4032.352) (-4047.620) [-4024.309] (-4033.524) -- 0:19:13
      216000 -- (-4047.019) [-4029.448] (-4038.891) (-4070.717) * (-4026.763) (-4031.159) [-4028.229] (-4038.665) -- 0:19:14
      216500 -- (-4064.811) [-4022.893] (-4031.196) (-4058.222) * (-4046.983) (-4026.654) (-4051.640) [-4031.936] -- 0:19:14
      217000 -- (-4065.116) [-4017.943] (-4038.363) (-4045.047) * (-4029.657) [-4023.457] (-4059.021) (-4051.450) -- 0:19:11
      217500 -- (-4052.105) [-4016.372] (-4034.207) (-4069.110) * (-4035.613) [-4031.852] (-4037.360) (-4032.668) -- 0:19:11
      218000 -- [-4034.306] (-4026.578) (-4037.525) (-4070.342) * (-4051.492) (-4034.860) (-4047.632) [-4021.216] -- 0:19:11
      218500 -- (-4040.344) (-4051.909) [-4021.364] (-4069.224) * (-4036.805) [-4035.396] (-4051.673) (-4025.618) -- 0:19:11
      219000 -- (-4037.467) (-4052.383) [-4018.613] (-4049.819) * (-4033.716) (-4051.879) [-4047.255] (-4028.768) -- 0:19:08
      219500 -- (-4046.950) (-4084.291) [-4032.731] (-4037.997) * (-4046.919) (-4039.199) (-4062.256) [-4031.150] -- 0:19:08
      220000 -- (-4050.894) (-4059.761) [-4010.627] (-4046.233) * (-4046.231) [-4030.236] (-4057.552) (-4039.081) -- 0:19:08

      Average standard deviation of split frequencies: 0.021638

      220500 -- [-4030.385] (-4071.730) (-4025.281) (-4046.023) * (-4031.918) (-4027.724) (-4044.567) [-4020.871] -- 0:19:08
      221000 -- (-4026.942) (-4042.847) [-4008.283] (-4046.138) * (-4031.604) [-4023.831] (-4048.582) (-4035.808) -- 0:19:05
      221500 -- (-4026.769) (-4044.068) (-4029.996) [-4030.443] * (-4025.886) [-4029.402] (-4052.124) (-4039.195) -- 0:19:05
      222000 -- [-4044.888] (-4058.689) (-4043.898) (-4040.683) * (-4048.756) [-4024.975] (-4043.219) (-4056.384) -- 0:19:05
      222500 -- (-4067.162) (-4043.075) [-4021.092] (-4055.104) * (-4051.426) [-4015.133] (-4047.612) (-4046.788) -- 0:19:06
      223000 -- (-4048.219) [-4022.597] (-4024.891) (-4038.292) * (-4032.228) [-4027.446] (-4074.992) (-4056.845) -- 0:19:02
      223500 -- (-4047.326) (-4020.008) [-4036.029] (-4046.496) * [-4033.039] (-4022.791) (-4067.105) (-4073.986) -- 0:19:03
      224000 -- [-4034.796] (-4035.823) (-4028.202) (-4058.968) * [-4024.444] (-4017.642) (-4050.931) (-4057.454) -- 0:19:03
      224500 -- (-4051.154) (-4043.340) [-4018.002] (-4060.886) * (-4049.807) [-4022.922] (-4046.502) (-4072.825) -- 0:19:03
      225000 -- (-4053.983) (-4052.722) [-4034.403] (-4053.424) * (-4054.231) (-4031.830) [-4037.028] (-4066.399) -- 0:19:00

      Average standard deviation of split frequencies: 0.021228

      225500 -- (-4030.185) [-4036.966] (-4054.169) (-4045.689) * (-4065.459) [-4027.593] (-4041.676) (-4050.216) -- 0:19:00
      226000 -- (-4039.540) (-4053.886) (-4060.709) [-4026.827] * [-4031.889] (-4042.423) (-4020.748) (-4057.038) -- 0:19:00
      226500 -- (-4040.139) (-4058.691) (-4049.388) [-4024.525] * (-4036.569) (-4031.689) [-4010.767] (-4051.294) -- 0:18:57
      227000 -- (-4044.932) (-4036.611) [-4038.376] (-4022.975) * (-4028.776) (-4024.099) [-4013.024] (-4069.626) -- 0:18:57
      227500 -- (-4033.488) (-4027.722) [-4016.640] (-4038.973) * (-4034.921) (-4031.265) [-4018.366] (-4050.566) -- 0:18:57
      228000 -- [-4030.439] (-4020.640) (-4040.672) (-4037.426) * [-4015.854] (-4054.279) (-4025.972) (-4072.053) -- 0:18:57
      228500 -- [-4029.702] (-4023.890) (-4035.443) (-4038.047) * [-4016.616] (-4060.125) (-4032.510) (-4047.219) -- 0:18:54
      229000 -- [-4023.191] (-4032.656) (-4041.562) (-4055.095) * [-4019.507] (-4068.780) (-4030.696) (-4045.885) -- 0:18:54
      229500 -- [-4014.796] (-4018.105) (-4044.640) (-4058.677) * [-4014.488] (-4053.822) (-4038.477) (-4041.179) -- 0:18:54
      230000 -- (-4032.549) [-4026.658] (-4034.242) (-4080.655) * [-4016.853] (-4056.864) (-4031.615) (-4025.259) -- 0:18:54

      Average standard deviation of split frequencies: 0.020974

      230500 -- (-4030.670) [-4016.304] (-4044.589) (-4046.046) * (-4026.805) (-4049.949) (-4035.311) [-4019.665] -- 0:18:51
      231000 -- (-4040.695) (-4034.106) [-4025.596] (-4063.364) * (-4031.532) (-4040.113) [-4029.945] (-4045.374) -- 0:18:51
      231500 -- (-4053.128) [-4026.296] (-4022.718) (-4050.438) * (-4039.028) (-4050.086) [-4019.062] (-4042.110) -- 0:18:52
      232000 -- (-4054.256) (-4039.625) [-4026.897] (-4077.906) * (-4032.221) (-4060.730) [-4021.755] (-4054.609) -- 0:18:52
      232500 -- (-4060.134) [-4035.337] (-4036.520) (-4066.650) * (-4044.017) (-4062.191) [-4011.490] (-4036.551) -- 0:18:48
      233000 -- (-4064.518) (-4047.879) [-4033.294] (-4056.806) * (-4029.507) (-4036.498) [-4027.664] (-4031.568) -- 0:18:49
      233500 -- (-4077.771) (-4027.923) [-4035.731] (-4043.439) * [-4030.991] (-4043.155) (-4048.868) (-4045.750) -- 0:18:49
      234000 -- (-4050.689) [-4033.254] (-4043.332) (-4043.974) * [-4016.416] (-4043.183) (-4040.298) (-4052.068) -- 0:18:49
      234500 -- (-4057.046) [-4021.592] (-4049.890) (-4039.706) * [-4015.992] (-4028.018) (-4041.827) (-4029.931) -- 0:18:46
      235000 -- (-4039.940) [-4033.679] (-4063.769) (-4061.219) * (-4042.732) (-4044.155) [-4035.957] (-4036.479) -- 0:18:46

      Average standard deviation of split frequencies: 0.019736

      235500 -- [-4019.234] (-4044.370) (-4071.362) (-4037.018) * (-4041.690) (-4063.048) [-4026.042] (-4040.799) -- 0:18:46
      236000 -- (-4027.311) [-4031.480] (-4063.350) (-4028.736) * [-4033.194] (-4060.244) (-4055.528) (-4038.763) -- 0:18:43
      236500 -- (-4028.960) [-4018.993] (-4061.012) (-4060.837) * (-4038.395) (-4050.768) (-4058.880) [-4020.529] -- 0:18:43
      237000 -- [-4038.347] (-4044.910) (-4081.572) (-4046.294) * (-4029.971) (-4037.779) (-4065.173) [-4016.899] -- 0:18:43
      237500 -- (-4056.822) [-4034.398] (-4058.674) (-4029.857) * [-4041.449] (-4043.506) (-4045.102) (-4039.371) -- 0:18:43
      238000 -- [-4030.657] (-4042.092) (-4057.093) (-4029.420) * [-4037.120] (-4065.866) (-4068.796) (-4041.832) -- 0:18:40
      238500 -- [-4024.543] (-4056.714) (-4050.880) (-4049.908) * (-4046.108) (-4078.006) (-4036.155) [-4027.031] -- 0:18:40
      239000 -- (-4026.258) (-4038.505) (-4058.169) [-4029.364] * [-4029.901] (-4050.327) (-4035.925) (-4022.264) -- 0:18:40
      239500 -- (-4035.099) (-4027.434) [-4040.222] (-4039.588) * [-4026.471] (-4040.848) (-4018.323) (-4028.133) -- 0:18:40
      240000 -- [-4025.087] (-4023.569) (-4069.012) (-4047.919) * (-4048.379) (-4043.674) [-4016.160] (-4021.586) -- 0:18:37

      Average standard deviation of split frequencies: 0.018892

      240500 -- (-4024.630) [-4041.438] (-4068.918) (-4048.705) * (-4038.921) (-4076.319) [-4023.885] (-4034.006) -- 0:18:37
      241000 -- (-4041.799) [-4036.386] (-4046.166) (-4027.434) * (-4033.429) [-4031.851] (-4031.577) (-4032.853) -- 0:18:38
      241500 -- (-4065.952) [-4020.189] (-4049.933) (-4039.320) * [-4029.886] (-4039.350) (-4039.353) (-4060.155) -- 0:18:38
      242000 -- (-4056.375) [-4012.604] (-4049.748) (-4037.519) * (-4030.549) (-4040.733) (-4029.459) [-4039.033] -- 0:18:35
      242500 -- (-4061.980) [-4018.827] (-4033.229) (-4030.991) * [-4027.912] (-4047.291) (-4044.778) (-4041.689) -- 0:18:35
      243000 -- (-4077.728) (-4028.290) [-4029.280] (-4031.426) * (-4042.645) (-4046.721) [-4024.120] (-4058.025) -- 0:18:35
      243500 -- (-4058.055) [-4016.693] (-4037.821) (-4030.153) * [-4040.121] (-4044.988) (-4048.990) (-4037.480) -- 0:18:35
      244000 -- (-4063.463) [-4034.273] (-4056.560) (-4030.018) * (-4031.377) [-4030.639] (-4036.550) (-4031.091) -- 0:18:32
      244500 -- (-4048.727) [-4044.189] (-4049.075) (-4033.027) * (-4053.280) [-4026.139] (-4022.536) (-4031.207) -- 0:18:32
      245000 -- (-4071.368) (-4034.487) (-4048.458) [-4021.095] * [-4037.772] (-4023.311) (-4032.803) (-4038.336) -- 0:18:32

      Average standard deviation of split frequencies: 0.018659

      245500 -- (-4045.765) (-4027.354) (-4049.723) [-4014.782] * (-4036.708) [-4006.889] (-4033.230) (-4040.155) -- 0:18:29
      246000 -- (-4052.330) (-4022.521) [-4033.689] (-4036.170) * (-4030.727) [-4031.765] (-4047.973) (-4048.374) -- 0:18:29
      246500 -- (-4055.713) [-4023.161] (-4057.838) (-4030.754) * (-4032.247) (-4051.499) [-4023.043] (-4054.957) -- 0:18:29
      247000 -- (-4059.392) (-4028.864) (-4045.185) [-4040.281] * (-4047.343) (-4051.635) [-4025.496] (-4046.502) -- 0:18:29
      247500 -- [-4024.326] (-4028.129) (-4049.165) (-4024.404) * [-4029.264] (-4054.021) (-4021.093) (-4049.082) -- 0:18:26
      248000 -- (-4049.804) (-4032.251) (-4056.508) [-4022.275] * [-4032.596] (-4055.643) (-4035.411) (-4062.907) -- 0:18:26
      248500 -- (-4073.976) (-4036.121) (-4034.692) [-4026.641] * (-4041.207) (-4044.912) [-4034.694] (-4052.210) -- 0:18:26
      249000 -- (-4051.066) (-4034.828) (-4039.640) [-4023.771] * (-4041.580) (-4048.755) [-4025.101] (-4038.592) -- 0:18:26
      249500 -- (-4053.306) (-4026.620) (-4047.504) [-4022.818] * (-4043.170) (-4049.010) [-4033.352] (-4036.155) -- 0:18:23
      250000 -- (-4031.580) [-4033.826] (-4054.357) (-4040.088) * (-4068.017) (-4055.855) [-4026.788] (-4036.870) -- 0:18:24

      Average standard deviation of split frequencies: 0.017532

      250500 -- [-4015.730] (-4032.923) (-4064.143) (-4046.106) * (-4052.734) (-4044.805) (-4053.387) [-4030.088] -- 0:18:24
      251000 -- [-4022.699] (-4039.114) (-4054.681) (-4067.109) * (-4064.513) [-4031.954] (-4048.600) (-4044.852) -- 0:18:24
      251500 -- [-4024.280] (-4043.085) (-4032.857) (-4081.836) * [-4035.197] (-4036.443) (-4082.814) (-4053.994) -- 0:18:21
      252000 -- (-4026.042) (-4046.586) [-4050.734] (-4070.891) * (-4037.439) (-4064.856) (-4071.073) [-4042.763] -- 0:18:21
      252500 -- [-4025.208] (-4039.189) (-4059.280) (-4052.117) * (-4030.505) (-4051.743) (-4062.656) [-4029.891] -- 0:18:21
      253000 -- [-4027.106] (-4052.570) (-4044.134) (-4043.925) * (-4035.881) (-4055.592) (-4048.492) [-4029.126] -- 0:18:21
      253500 -- [-4020.615] (-4033.287) (-4028.173) (-4055.063) * [-4030.079] (-4039.670) (-4051.178) (-4018.731) -- 0:18:18
      254000 -- (-4045.095) [-4022.252] (-4022.841) (-4060.064) * (-4042.667) (-4058.557) (-4062.618) [-4010.812] -- 0:18:18
      254500 -- [-4024.951] (-4020.771) (-4011.893) (-4062.315) * (-4034.470) (-4047.999) (-4047.160) [-4010.329] -- 0:18:18
      255000 -- (-4043.619) (-4059.411) [-4019.835] (-4054.088) * [-4021.699] (-4044.023) (-4065.277) (-4019.024) -- 0:18:15

      Average standard deviation of split frequencies: 0.017634

      255500 -- [-4025.528] (-4055.175) (-4015.869) (-4062.968) * [-4017.009] (-4030.946) (-4049.777) (-4024.753) -- 0:18:15
      256000 -- (-4027.845) (-4047.514) [-4016.792] (-4065.235) * (-4026.156) [-4024.848] (-4062.934) (-4029.661) -- 0:18:15
      256500 -- (-4019.101) [-4032.371] (-4023.233) (-4045.768) * (-4020.120) [-4014.289] (-4078.100) (-4033.317) -- 0:18:15
      257000 -- (-4045.565) (-4020.152) [-4010.803] (-4058.662) * (-4037.036) (-4043.793) [-4024.723] (-4057.556) -- 0:18:12
      257500 -- (-4041.344) [-4049.503] (-4044.688) (-4049.710) * (-4052.353) (-4046.567) [-4026.361] (-4040.441) -- 0:18:12
      258000 -- (-4037.319) (-4053.753) [-4024.629] (-4043.412) * (-4048.459) (-4043.885) [-4036.644] (-4040.276) -- 0:18:12
      258500 -- [-4036.099] (-4047.050) (-4024.714) (-4032.870) * [-4035.245] (-4034.729) (-4053.107) (-4061.267) -- 0:18:12
      259000 -- (-4029.231) [-4027.436] (-4069.698) (-4034.849) * [-4015.764] (-4036.739) (-4022.817) (-4075.364) -- 0:18:10
      259500 -- (-4044.582) [-4027.464] (-4063.405) (-4040.859) * (-4031.382) (-4030.613) [-4006.602] (-4050.627) -- 0:18:10
      260000 -- [-4002.202] (-4028.903) (-4038.979) (-4035.031) * (-4034.008) [-4019.214] (-4029.432) (-4048.019) -- 0:18:10

      Average standard deviation of split frequencies: 0.018204

      260500 -- [-4010.674] (-4033.225) (-4034.452) (-4064.125) * (-4021.711) [-4025.886] (-4034.129) (-4054.349) -- 0:18:10
      261000 -- [-4016.283] (-4038.324) (-4064.131) (-4038.503) * (-4030.478) [-4037.960] (-4048.604) (-4044.036) -- 0:18:07
      261500 -- [-4010.985] (-4055.433) (-4029.222) (-4059.409) * (-4018.476) [-4024.058] (-4051.150) (-4052.996) -- 0:18:07
      262000 -- [-4019.525] (-4038.157) (-4042.554) (-4029.715) * [-4002.754] (-4058.385) (-4056.877) (-4051.649) -- 0:18:07
      262500 -- [-4017.882] (-4023.794) (-4031.451) (-4053.186) * [-4014.245] (-4036.116) (-4069.506) (-4052.537) -- 0:18:04
      263000 -- (-4018.252) (-4024.481) [-4022.414] (-4081.639) * (-4018.290) (-4057.221) (-4068.116) [-4042.972] -- 0:18:04
      263500 -- (-4030.165) (-4035.478) [-4016.111] (-4060.353) * [-4010.201] (-4042.698) (-4063.710) (-4048.676) -- 0:18:04
      264000 -- [-4032.514] (-4044.441) (-4024.096) (-4057.997) * [-4021.122] (-4059.452) (-4063.456) (-4032.258) -- 0:18:04
      264500 -- (-4040.356) (-4055.853) [-4025.771] (-4076.036) * [-4027.558] (-4030.023) (-4055.282) (-4036.753) -- 0:18:01
      265000 -- (-4037.016) (-4039.689) [-4029.823] (-4060.992) * (-4018.123) (-4049.402) [-4034.220] (-4036.429) -- 0:18:01

      Average standard deviation of split frequencies: 0.018454

      265500 -- [-4039.248] (-4057.087) (-4061.926) (-4040.354) * (-4033.960) (-4063.756) [-4033.420] (-4033.934) -- 0:18:01
      266000 -- [-4030.135] (-4028.739) (-4088.725) (-4034.590) * (-4035.785) (-4057.539) [-4022.124] (-4042.863) -- 0:18:01
      266500 -- (-4031.459) [-4045.825] (-4053.145) (-4041.779) * (-4038.348) (-4055.179) (-4038.287) [-4028.644] -- 0:17:58
      267000 -- (-4039.026) [-4035.817] (-4032.594) (-4041.281) * [-4010.985] (-4049.752) (-4032.053) (-4034.566) -- 0:17:58
      267500 -- (-4040.769) (-4055.112) [-4033.414] (-4034.296) * (-4021.128) [-4037.430] (-4043.630) (-4048.351) -- 0:17:58
      268000 -- (-4068.412) (-4042.514) [-4020.233] (-4025.909) * (-4040.158) (-4049.170) [-4036.473] (-4057.187) -- 0:17:56
      268500 -- (-4064.270) (-4049.521) [-4025.369] (-4026.048) * (-4025.935) [-4023.765] (-4054.672) (-4046.367) -- 0:17:56
      269000 -- (-4051.774) (-4051.013) (-4033.551) [-4012.936] * (-4029.672) (-4046.751) [-4050.700] (-4051.755) -- 0:17:56
      269500 -- (-4050.220) (-4063.994) [-4024.533] (-4010.870) * [-4026.633] (-4042.650) (-4044.742) (-4045.344) -- 0:17:56
      270000 -- (-4070.053) (-4055.127) (-4049.428) [-4012.130] * (-4037.803) (-4041.429) [-4021.813] (-4049.016) -- 0:17:53

      Average standard deviation of split frequencies: 0.018500

      270500 -- (-4075.805) [-4047.162] (-4046.557) (-4034.681) * [-4028.511] (-4034.284) (-4034.547) (-4046.956) -- 0:17:53
      271000 -- (-4063.602) (-4043.555) (-4049.049) [-4031.578] * (-4054.162) (-4029.718) [-4024.461] (-4032.610) -- 0:17:53
      271500 -- (-4064.021) (-4042.235) [-4018.127] (-4027.754) * (-4034.683) (-4033.234) [-4045.937] (-4044.158) -- 0:17:53
      272000 -- (-4081.622) (-4043.856) [-4023.560] (-4022.341) * (-4042.256) [-4034.098] (-4051.945) (-4043.995) -- 0:17:50
      272500 -- (-4060.437) [-4021.509] (-4027.187) (-4035.317) * [-4044.202] (-4061.568) (-4073.973) (-4042.429) -- 0:17:50
      273000 -- (-4065.661) (-4009.817) [-4026.152] (-4033.596) * (-4034.722) (-4039.156) (-4068.782) [-4024.117] -- 0:17:50
      273500 -- (-4067.197) (-4025.251) [-4022.536] (-4034.080) * (-4013.185) (-4030.868) (-4070.771) [-4019.094] -- 0:17:50
      274000 -- (-4060.745) (-4024.457) [-4024.170] (-4018.914) * [-4021.530] (-4027.119) (-4069.282) (-4021.653) -- 0:17:47
      274500 -- (-4051.105) [-4013.313] (-4018.171) (-4020.926) * (-4029.881) [-4016.258] (-4066.656) (-4019.379) -- 0:17:47
      275000 -- (-4062.523) [-4017.998] (-4021.725) (-4031.225) * [-4027.436] (-4048.592) (-4063.288) (-4037.755) -- 0:17:47

      Average standard deviation of split frequencies: 0.018750

      275500 -- (-4033.797) (-4029.258) [-4007.779] (-4047.541) * (-4011.147) (-4040.999) (-4060.160) [-4025.271] -- 0:17:47
      276000 -- (-4044.036) [-4021.900] (-4030.000) (-4054.084) * [-4017.817] (-4034.887) (-4063.219) (-4024.730) -- 0:17:45
      276500 -- (-4052.444) [-4001.488] (-4026.828) (-4027.236) * (-4026.624) (-4065.071) (-4049.830) [-4013.139] -- 0:17:44
      277000 -- (-4039.089) [-4016.291] (-4028.414) (-4037.218) * (-4024.372) (-4041.700) (-4066.661) [-4009.383] -- 0:17:44
      277500 -- (-4049.210) (-4030.109) [-4017.974] (-4040.576) * (-4026.626) (-4050.353) (-4063.686) [-4017.221] -- 0:17:42
      278000 -- (-4046.654) (-4039.260) (-4022.822) [-4032.736] * [-4020.234] (-4060.800) (-4063.126) (-4027.311) -- 0:17:42
      278500 -- (-4053.267) (-4040.362) [-4018.397] (-4029.935) * [-4028.930] (-4042.056) (-4063.979) (-4036.028) -- 0:17:42
      279000 -- (-4028.884) (-4045.288) [-4015.390] (-4039.197) * [-4022.868] (-4059.084) (-4072.819) (-4035.526) -- 0:17:42
      279500 -- [-4030.795] (-4029.030) (-4059.643) (-4038.814) * (-4023.678) (-4043.752) [-4051.480] (-4033.298) -- 0:17:39
      280000 -- (-4056.047) (-4034.108) (-4036.266) [-4024.018] * [-4021.356] (-4055.332) (-4067.429) (-4043.888) -- 0:17:39

      Average standard deviation of split frequencies: 0.017940

      280500 -- (-4052.845) (-4035.437) (-4030.859) [-4027.801] * [-4028.965] (-4041.023) (-4065.216) (-4040.832) -- 0:17:39
      281000 -- (-4045.842) (-4036.784) [-4027.668] (-4043.506) * (-4030.197) (-4029.447) (-4068.108) [-4027.522] -- 0:17:39
      281500 -- (-4034.383) [-4026.670] (-4038.803) (-4039.419) * (-4026.933) (-4047.122) (-4074.157) [-4012.895] -- 0:17:36
      282000 -- (-4040.054) [-4020.724] (-4053.461) (-4031.260) * [-4017.494] (-4053.804) (-4078.343) (-4023.411) -- 0:17:36
      282500 -- (-4031.713) (-4022.320) (-4056.647) [-4012.017] * (-4027.120) (-4043.953) (-4060.295) [-4018.647] -- 0:17:36
      283000 -- (-4030.615) (-4030.004) (-4050.337) [-4023.832] * (-4030.030) (-4041.198) (-4062.747) [-4025.231] -- 0:17:36
      283500 -- [-4026.702] (-4035.942) (-4044.900) (-4033.595) * (-4026.611) (-4041.013) (-4071.319) [-4028.847] -- 0:17:33
      284000 -- (-4021.293) (-4032.299) (-4047.615) [-4022.832] * [-4035.620] (-4040.300) (-4069.369) (-4035.333) -- 0:17:33
      284500 -- (-4046.769) (-4052.666) [-4024.877] (-4037.109) * (-4023.459) [-4024.624] (-4054.221) (-4027.272) -- 0:17:33
      285000 -- (-4050.557) (-4043.110) (-4047.531) [-4029.528] * (-4026.860) [-4025.226] (-4055.744) (-4058.468) -- 0:17:33

      Average standard deviation of split frequencies: 0.018096

      285500 -- (-4049.374) (-4037.054) (-4060.137) [-4023.936] * [-4036.325] (-4019.714) (-4044.330) (-4051.328) -- 0:17:31
      286000 -- (-4047.179) (-4042.050) (-4047.489) [-4017.488] * (-4050.420) [-4016.465] (-4027.714) (-4040.615) -- 0:17:31
      286500 -- [-4027.327] (-4025.414) (-4034.285) (-4034.435) * (-4036.896) [-4013.161] (-4049.917) (-4038.782) -- 0:17:30
      287000 -- [-4029.308] (-4037.386) (-4050.436) (-4037.102) * (-4047.607) [-4007.488] (-4045.891) (-4054.888) -- 0:17:30
      287500 -- (-4026.335) (-4031.071) (-4045.284) [-4038.809] * (-4049.848) [-4009.675] (-4029.082) (-4052.738) -- 0:17:28
      288000 -- [-4019.997] (-4032.308) (-4037.384) (-4051.040) * (-4048.774) [-4014.754] (-4045.036) (-4063.085) -- 0:17:28
      288500 -- (-4045.335) (-4056.570) [-4031.820] (-4024.302) * (-4053.935) [-4025.441] (-4049.674) (-4046.502) -- 0:17:28
      289000 -- [-4039.586] (-4066.696) (-4034.855) (-4019.251) * (-4055.716) (-4020.068) (-4045.276) [-4032.150] -- 0:17:25
      289500 -- (-4058.383) [-4034.561] (-4036.194) (-4041.992) * (-4045.247) [-4016.127] (-4035.289) (-4046.746) -- 0:17:25
      290000 -- (-4064.846) (-4044.443) [-4035.241] (-4047.320) * (-4052.073) [-4021.790] (-4041.246) (-4044.373) -- 0:17:25

      Average standard deviation of split frequencies: 0.017452

      290500 -- (-4058.194) (-4044.361) [-4033.737] (-4035.856) * (-4079.411) (-4008.856) (-4033.247) [-4041.284] -- 0:17:25
      291000 -- (-4050.333) (-4044.387) (-4023.076) [-4025.844] * (-4069.421) [-4018.925] (-4052.764) (-4058.817) -- 0:17:22
      291500 -- (-4038.494) [-4039.710] (-4025.267) (-4039.413) * (-4065.274) (-4017.842) [-4042.675] (-4065.366) -- 0:17:22
      292000 -- (-4046.016) (-4050.404) [-4026.189] (-4023.189) * (-4062.795) (-4033.709) [-4027.897] (-4067.048) -- 0:17:22
      292500 -- (-4052.246) [-4025.662] (-4025.647) (-4022.746) * (-4045.961) [-4035.112] (-4040.224) (-4038.649) -- 0:17:22
      293000 -- (-4037.098) (-4043.838) [-4016.484] (-4020.918) * (-4030.756) (-4045.808) (-4047.696) [-4039.096] -- 0:17:19
      293500 -- (-4054.656) (-4054.009) (-4020.991) [-4013.338] * [-4032.695] (-4040.303) (-4063.208) (-4053.844) -- 0:17:19
      294000 -- (-4025.783) (-4039.814) [-4036.186] (-4023.314) * [-4023.868] (-4028.216) (-4044.980) (-4069.298) -- 0:17:19
      294500 -- [-4027.362] (-4047.751) (-4036.810) (-4032.433) * (-4040.922) [-4030.725] (-4053.526) (-4066.553) -- 0:17:19
      295000 -- (-4037.433) (-4053.269) (-4041.112) [-4032.770] * (-4031.012) (-4049.344) [-4032.189] (-4065.840) -- 0:17:17

      Average standard deviation of split frequencies: 0.016888

      295500 -- (-4037.581) (-4043.468) (-4064.212) [-4020.752] * [-4032.069] (-4055.423) (-4021.109) (-4054.410) -- 0:17:17
      296000 -- (-4040.910) (-4036.379) (-4057.233) [-4009.158] * (-4033.356) (-4049.800) (-4027.806) [-4030.925] -- 0:17:16
      296500 -- (-4053.735) (-4029.020) (-4052.572) [-4023.867] * [-4029.402] (-4062.370) (-4031.649) (-4033.696) -- 0:17:16
      297000 -- (-4053.266) (-4045.341) (-4050.253) [-4011.286] * (-4031.580) (-4058.277) (-4044.790) [-4030.982] -- 0:17:14
      297500 -- (-4051.072) (-4058.063) (-4037.564) [-4011.573] * [-4016.442] (-4059.562) (-4056.473) (-4020.992) -- 0:17:14
      298000 -- (-4044.693) (-4056.520) (-4054.552) [-4020.482] * (-4036.344) (-4070.434) (-4057.244) [-4022.523] -- 0:17:14
      298500 -- (-4059.483) (-4040.383) (-4058.104) [-4025.730] * [-4021.703] (-4060.989) (-4046.735) (-4036.047) -- 0:17:11
      299000 -- (-4020.624) [-4019.898] (-4078.343) (-4023.724) * [-4022.295] (-4037.784) (-4041.825) (-4037.391) -- 0:17:11
      299500 -- (-4042.010) (-4028.903) (-4056.925) [-4034.918] * (-4035.235) [-4029.430] (-4064.264) (-4047.590) -- 0:17:11
      300000 -- [-4032.323] (-4036.046) (-4058.909) (-4029.471) * [-4032.378] (-4043.691) (-4063.561) (-4041.794) -- 0:17:11

      Average standard deviation of split frequencies: 0.016764

      300500 -- (-4053.555) (-4019.015) (-4079.781) [-4032.943] * (-4038.454) (-4036.287) [-4055.671] (-4040.263) -- 0:17:11
      301000 -- (-4054.022) [-4011.790] (-4083.140) (-4029.171) * (-4044.492) (-4031.798) [-4040.199] (-4040.594) -- 0:17:08
      301500 -- (-4053.114) [-4016.324] (-4066.858) (-4022.191) * (-4053.050) (-4049.443) (-4034.920) [-4033.956] -- 0:17:08
      302000 -- (-4057.163) [-4020.374] (-4031.434) (-4024.195) * (-4051.056) (-4049.912) [-4031.717] (-4026.556) -- 0:17:08
      302500 -- (-4048.230) [-4043.492] (-4028.032) (-4035.030) * (-4047.228) (-4045.128) [-4032.246] (-4043.028) -- 0:17:06
      303000 -- [-4037.856] (-4086.930) (-4034.608) (-4025.638) * (-4055.303) [-4031.543] (-4049.136) (-4034.484) -- 0:17:05
      303500 -- [-4037.888] (-4071.712) (-4038.885) (-4042.856) * (-4066.943) [-4025.178] (-4047.104) (-4038.795) -- 0:17:05
      304000 -- (-4045.578) (-4060.138) (-4040.037) [-4033.371] * (-4057.898) [-4027.142] (-4036.794) (-4043.427) -- 0:17:05
      304500 -- [-4037.577] (-4035.636) (-4066.510) (-4029.871) * (-4058.669) (-4021.008) [-4021.224] (-4036.592) -- 0:17:03
      305000 -- (-4037.811) [-4031.852] (-4078.090) (-4051.843) * (-4046.950) [-4027.738] (-4035.559) (-4046.385) -- 0:17:03

      Average standard deviation of split frequencies: 0.016243

      305500 -- (-4041.930) [-4024.838] (-4070.536) (-4042.213) * (-4054.522) (-4060.185) (-4023.416) [-4024.938] -- 0:17:02
      306000 -- (-4050.617) (-4036.100) (-4055.460) [-4035.125] * (-4077.143) (-4045.781) [-4027.264] (-4028.777) -- 0:17:02
      306500 -- [-4026.032] (-4023.757) (-4083.302) (-4038.030) * (-4051.535) (-4045.358) (-4044.630) [-4033.042] -- 0:17:00
      307000 -- (-4046.672) [-4013.360] (-4081.148) (-4055.590) * (-4055.807) [-4029.640] (-4050.746) (-4029.769) -- 0:17:00
      307500 -- (-4053.631) [-4018.459] (-4075.884) (-4050.415) * (-4056.397) (-4026.071) (-4042.637) [-4022.651] -- 0:17:00
      308000 -- (-4056.971) [-4017.289] (-4086.534) (-4035.344) * (-4078.439) (-4041.264) (-4050.525) [-4031.209] -- 0:16:57
      308500 -- (-4053.123) [-4019.887] (-4066.637) (-4030.432) * (-4065.219) [-4035.064] (-4037.577) (-4036.845) -- 0:16:57
      309000 -- (-4041.769) [-4015.115] (-4070.468) (-4025.690) * (-4057.254) (-4032.101) [-4024.369] (-4053.574) -- 0:16:57
      309500 -- (-4033.993) (-4022.288) (-4073.200) [-4038.473] * (-4073.896) (-4035.898) (-4041.123) [-4047.162] -- 0:16:57
      310000 -- [-4024.970] (-4020.504) (-4041.938) (-4040.621) * (-4072.206) (-4036.123) [-4021.128] (-4051.163) -- 0:16:54

      Average standard deviation of split frequencies: 0.015933

      310500 -- [-4029.589] (-4035.568) (-4058.246) (-4055.716) * (-4071.348) (-4042.259) [-4015.305] (-4041.113) -- 0:16:54
      311000 -- (-4029.873) [-4029.707] (-4043.271) (-4044.906) * (-4070.272) (-4025.775) [-4016.292] (-4038.864) -- 0:16:54
      311500 -- [-4030.501] (-4035.400) (-4038.754) (-4054.659) * (-4071.945) (-4049.842) [-4022.626] (-4042.830) -- 0:16:54
      312000 -- (-4026.403) [-4028.926] (-4025.063) (-4048.321) * (-4064.652) (-4055.878) [-4013.070] (-4047.777) -- 0:16:52
      312500 -- (-4044.682) [-4030.558] (-4033.462) (-4034.859) * (-4031.061) (-4060.526) [-4016.117] (-4044.667) -- 0:16:52
      313000 -- (-4047.641) (-4028.820) [-4025.926] (-4038.425) * (-4048.836) (-4047.976) [-4019.056] (-4083.304) -- 0:16:51
      313500 -- (-4035.580) (-4012.814) [-4025.945] (-4045.321) * (-4055.387) (-4040.784) [-4008.850] (-4062.043) -- 0:16:51
      314000 -- (-4038.885) (-4055.164) [-4028.267] (-4053.950) * (-4063.319) [-4042.763] (-4045.144) (-4059.826) -- 0:16:49
      314500 -- (-4048.536) (-4053.333) [-4028.061] (-4064.371) * (-4059.467) (-4033.071) [-4020.942] (-4055.926) -- 0:16:49
      315000 -- (-4046.645) (-4027.160) [-4023.333] (-4064.031) * (-4058.967) [-4029.306] (-4021.781) (-4068.192) -- 0:16:49

      Average standard deviation of split frequencies: 0.016194

      315500 -- (-4028.748) (-4013.849) [-4018.312] (-4085.559) * (-4049.620) [-4019.658] (-4018.719) (-4037.933) -- 0:16:48
      316000 -- (-4030.453) [-4026.935] (-4018.826) (-4070.291) * (-4055.213) (-4031.500) [-4031.891] (-4036.144) -- 0:16:46
      316500 -- (-4024.459) (-4033.638) [-4018.190] (-4060.163) * (-4059.824) (-4031.379) [-4023.975] (-4040.359) -- 0:16:46
      317000 -- (-4025.926) (-4064.620) [-4023.841] (-4064.995) * (-4054.597) [-4026.029] (-4025.107) (-4045.703) -- 0:16:46
      317500 -- [-4024.956] (-4063.016) (-4032.920) (-4051.193) * (-4062.170) (-4038.537) [-4030.565] (-4033.654) -- 0:16:43
      318000 -- [-4018.099] (-4031.256) (-4038.495) (-4059.271) * (-4077.109) [-4031.530] (-4031.793) (-4053.873) -- 0:16:43
      318500 -- (-4029.317) (-4048.719) [-4038.771] (-4061.607) * (-4072.113) [-4033.546] (-4019.273) (-4092.692) -- 0:16:43
      319000 -- [-4020.300] (-4052.711) (-4044.808) (-4075.062) * (-4049.161) (-4037.484) [-4037.047] (-4076.216) -- 0:16:43
      319500 -- (-4037.449