--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Sat Nov 04 00:51:58 WET 2017 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta= input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS1/revmuscle/S5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/revmuscle/S5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS1/revmuscle/S5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -7424.07 -7444.15 2 -7424.04 -7441.68 -------------------------------------- TOTAL -7424.05 -7443.54 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS1/revmuscle/S5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/revmuscle/S5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS1/revmuscle/S5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 1.426375 0.003662 1.306126 1.543630 1.423657 1383.30 1414.01 1.000 r(A<->C){all} 0.107254 0.000134 0.084813 0.129427 0.107064 980.02 1043.24 1.000 r(A<->G){all} 0.323886 0.000373 0.287849 0.363455 0.323110 604.51 637.98 1.000 r(A<->T){all} 0.078767 0.000061 0.063585 0.093697 0.078639 1035.32 1037.82 1.000 r(C<->G){all} 0.138346 0.000213 0.110366 0.167488 0.137772 984.30 1054.38 1.000 r(C<->T){all} 0.270755 0.000301 0.236655 0.304718 0.270668 880.28 918.88 1.001 r(G<->T){all} 0.080992 0.000084 0.063736 0.098878 0.080549 1102.07 1132.03 1.000 pi(A){all} 0.292442 0.000112 0.271284 0.312944 0.292706 1043.16 1198.88 1.000 pi(C){all} 0.174849 0.000078 0.158255 0.192544 0.174745 980.85 1078.25 1.000 pi(G){all} 0.195289 0.000081 0.178568 0.213335 0.195274 991.53 1051.25 1.000 pi(T){all} 0.337420 0.000127 0.316082 0.359862 0.337484 1115.48 1172.99 1.000 alpha{1,2} 0.883018 0.025913 0.611356 1.205751 0.855502 935.91 1093.07 1.000 alpha{3} 1.509877 0.160454 0.867752 2.316765 1.435413 903.97 1051.19 1.000 pinvar{all} 0.060048 0.001930 0.000026 0.142941 0.051618 1027.63 1084.58 1.001 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -3649.488118 Model 2: PositiveSelection -3625.008556 Model 0: one-ratio -3727.832062 Model 3: discrete -3622.128473 Model 7: beta -3648.567478 Model 8: beta&w>1 -3621.601279 Model 0 vs 1 156.68788799999948 Model 2 vs 1 48.959123999999974 Additional information for M1 vs M2: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: S5_SFBB1) Pr(w>1) post mean +- SE for w 8 L 0.593 2.778 36 R 0.872 3.616 44 I 0.999** 3.996 46 T 1.000** 3.997 63 Q 0.845 3.533 75 Q 0.566 2.697 78 Y 0.709 3.125 107 E 0.998** 3.991 110 C 0.955* 3.863 126 T 1.000** 3.998 128 E 0.969* 3.905 156 K 0.705 3.114 176 P 0.761 3.283 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: S5_SFBB1) Pr(w>1) post mean +- SE for w 8 L 0.513 2.543 +- 1.562 36 R 0.824 3.594 +- 1.331 44 I 0.999** 4.201 +- 0.684 46 T 0.999** 4.203 +- 0.680 63 Q 0.812 3.580 +- 1.377 75 Q 0.505 2.550 +- 1.596 78 Y 0.636 2.955 +- 1.558 107 E 0.997** 4.194 +- 0.699 110 C 0.941 4.004 +- 0.994 126 T 1.000** 4.204 +- 0.677 128 E 0.960* 4.070 +- 0.910 156 K 0.630 2.939 +- 1.563 176 P 0.705 3.207 +- 1.524 Model 8 vs 7 53.93239799999992 Additional information for M7 vs M8: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: S5_SFBB1) Pr(w>1) post mean +- SE for w 8 L 0.730 2.730 21 G 0.620 2.447 36 R 0.916 3.192 44 I 0.999** 3.397 46 T 1.000** 3.398 63 Q 0.888 3.119 75 Q 0.685 2.612 78 Y 0.813 2.937 107 E 0.998** 3.394 110 C 0.970* 3.324 126 T 1.000** 3.399 128 E 0.978* 3.345 156 K 0.807 2.918 176 P 0.848 3.020 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: S5_SFBB1) Pr(w>1) post mean +- SE for w 8 L 0.648 2.455 +- 1.250 21 G 0.550 2.190 +- 1.271 36 R 0.878 3.129 +- 1.032 44 I 0.999** 3.484 +- 0.676 46 T 0.999** 3.485 +- 0.674 63 Q 0.858 3.086 +- 1.092 75 Q 0.622 2.402 +- 1.292 78 Y 0.745 2.738 +- 1.204 107 E 0.997** 3.478 +- 0.685 110 C 0.960* 3.373 +- 0.829 126 T 1.000** 3.486 +- 0.673 128 E 0.971* 3.407 +- 0.789 156 K 0.737 2.717 +- 1.218 176 P 0.799 2.906 +- 1.171
>C1 KCIRKSWCTLINTPSFVAKHLNNSMNNKLSSSTCILLNRCQNHVFPDRSW KPEVFWSIINLSIDSDDHNLHYDAEDLNIPCPLEGHDFVEIGGYCNGIVC VLAWKTLHWIYVILCNPATGEFRQLPHSCLLQPSRSRRKFELNTISTLLG FGYDCKAKEYKVVQVIENCEYSDAEQYDYHRIALPHTAEVYTTTANSWRE IKIDISSETYCYTCSVYLNGFCYWIATDEEDFILSFDLGDEIFHRIQLPS RRDSDFKFSNLFLCNKSIASFGYCCNPSDEDSTLyooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo ooooo >C2 CNGIVCVIAGNNFLLCNPATREFMQLPDSCLLLPPAEGKFELDTTFEALG FGYDCKGKEYKVVQIIENCEYSDDEQTFNHCTTLPHTAEVYTTAVNSWKE IKIDISSTTYSWSCSVYLKGFCYWYATDDEEYVLSFDLCNETFHRIQFPS RGESGFTFFYIFLRNESLASFCSRYDRSGDSQSCEIWVMDDYDRVKSSWT KLITVGPLQGIEKPLTFWKNDELLMLASDGRATSYNSSTRNLKYVHIPoo oooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo ooooo >C3 SLMRFKCIHKSWFSLINSLSFVAKHLSNSVDNKLSSSACILLNRSQPHIF PDQSWKQEVFWCVINFSIDSDENNLHYDVEDLTIPFPLKDHDFVLIFGYC NGIVCVEAGKNVLLCNPATKKFRQLPDSCLLLPSPLEGKFKLETSFQALG FGYDCNAKEYKVVRIIENCEYSDDERTFYNRIALPHTAELYTTPANSWKE IKIDISSTTYSCSRSVFMKGFCYWYATDGEEYILSFDLGDDTFHIIQLPS RREFGFRFYYIFLRNESLASFCSRYERSEDSESCEIWVMDDYDRVKSSWT KLLTIGPLQGIKKPLTFWKSDEVLMLDSDGRATSYNSNTRNLKYLHIPPI LKRVVDFEVLIYVKSooooooooooooooooooooooooooooooooooo ooooo >C4 KCIRKSWCTLINSPSFVAKHLNNSMDNELSSSTCILLNRSQAHIFPDQSW KQEVFWsTINLSIDSDEHNLHYDVEDLIIPFPLEDHDFVLIFGYCNGIIC VDAGKNVLLCNPATREFRQLPNSCLLLPPPKGKFELETTFQALGFGYDCN AKEYKVVRIIENGEYSDDEQTFHHRIALPHTAEVYTTAANSWKEIKIDIS SQTYHCSCSVYLKGFCYWFASDSEEYILSFYLGDETFHIIQLPSRRESGF TFDYIFLRDESLASFCSPYSPSEDSKLFEIWVMDDFDGVKSSWTKLLTVG PFKGIEYPLTLWKCDELLMLASDGRATSYNSSTGNLKYLHIPPILNKVVD FEoooooooooooooooooooooooooooooooooooooooooooooooo ooooo >C5 MFEVRESKTPEDMVVEIMSKLPPKSLMRFKCIRKSWCTLINSPSFVAKHL NNSVDNKLSSSTCILLNRSQAHVFPDNSWKPEVFWSMINLSIDSNEHNLH YDVENLNIPFPLEGHDFVEIDGYCHGIVCVIAGKNLHLINIILCNPATGE FRQLPHSCLLLPSRPKGKFELETIFGALGFGYDCKAKEYKVVQIIENCEY SDDEQYYYHRIALPHTAEVYTTAANSWREIKIDISSDTYHYSFSVYLKGF CYWFATDGEKYILSFDIGDEIFHRIQLPSRKESDFEFLNIFLCNTSIASF CSCCDPSDADSTLCEIWVMDDYDGIKSSWTKLLTFGPLKGIENPFTLWKT DELLMVASGGRVTSYNSSTENLNYLHIPPILNEVRDFQALIYMESIVPVK ooooo >C6 KSLMRFKCTRKSWCTLINSSSFVAKHLSNSVDNILSSSTCILLNRSQMPV FPDKSWKYEILWSMIYLSIYSDEHSYHYDVEDLNIPFPLEDHHPVQIHGY CNGIVCVIAGKTVIILCNPGTGEFRQLPDSCLLVPLPKEKFQLETIFGGL GFGYDCKAKEYKVVQIIENCEYSDDERTFYHSIPLPHTAEVYSIAANSWK EIKIDISTKTYPSSCSVYLKGFCYWFASDGEEYILSFDLGDEIFHRIQLP SRRESSFKFYDLFLYNESITSYCSHYDPSEoooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo ooooo >C7 ESEAPEDRVVEILSRLPPKSLMRFKCIRKSWYTLINSPRFVAKHLNNSVD NKLSSSTCILLHRSQMPIFPYDSWKREFFWSMINFSIDSDESNLHYDVED LTNVPLLQWEDHHEVEIHGYCNGIVCVTVGEYFFLCNPATGEFSQLPNSR LLLPLPRGKGKFGLETTVKGLGFGYDCKAKEYKVVRIIENYDCEYSDGEE TYIEHAALPHTAELYTTTANSWKEIKINISSKILSFYSYPYSCSVYLKGF CYWLSSDDEEYICSFDLGEEIFDRIELPSRRESGFKLDGIFLYNESITYY CTSYEESSRLFEIWVMDICDGVNSSWTKHLTAGPFKGIEFPLTLWKHDEL LMIASDGRATSYNSSTGNLKYLYIPIIIYRNRVIDYAKSIVPVKRVEGKV PFSPI >C8 MFEVRESKTPEDMVVEIMSKLPPKSLMRFKCIRKSWCTLINSPSFVAKHL NNSVDNKLSSSTCILLNRSQTHVFPDNSWKQEVFWSMINISIDSDEHNLH YDVEDLNIPFPLEDQDYVLILGYCNGIVCVSAGKNILLCNPTTREFMRLP SSCLLLPSHPKGKFELETVFRALGFGYDCKAKEYKVVQIIENSEYSDDER TYYHRIPLPHTAEVYTTAANSWREIKIDISTRTYSCSCQVYLKGFCYWYA TDAEEYILSFDLGDEIFHRIQLPSRRESGFKFYYIFLRNESLASFCSRYD RSDKSESCoooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo ooooo >C9 LLNRSEMPVFPDDSWKYEVLWSMINLSIDSDDHnLHYNVEDLNIPFPMEY HHPVLIHGYCDGIFCVITGENVVLCNPAIGEFRQLPDSCLLLPAPPERKF ELETTFRALGFGYDCKAKEYKVVRIIENCEYSDDEQTYNHRISLPYTAEV YTTTGNSWKEINIDVSSKAYPCSCSVYLKGFCYWFATDGEEYILSFDLGD EIFSRIQLPARKESGFKFYSLFLYNESVTSYCSHYDPSEDSKLFEIWVMD oooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo ooooo >C10 KCIRKSWCTLIISTSFVAKHLSNSLDYKHSSSTCILLNRSQFHIFPDQSW KREVLWSMINLSSDSDVHNLHYDVKPLNIPFSRDDHNPVQIHGYCNGIVC LIEGDNVLLCNPSTREFRLLPNSCLLVPHPEGKFELETTFHGMGFGYDCK ANEYKVVQIVENCEYSDDEQTYQHCIAYPYTAEVYTTAANFWKEIKIDIS SSTHPYPYSVYLKGFCYWFATDGEECILSFDLGDEIFHRIQLPSKIESGF NFCGLFLYNESITSYCCRYDPSEDSKLFEIWVMDGYGGVKNSWTKLLooo oooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo ooooo >C11 MSQVRETETPEDRVVAIMSKLPPKSLMRFKCIRKSWCTLINNPSFVAKHL SNSVVNNFSSYTCILLNRSQVHVFPDKSWKHEVLWSMINFFNDRVSRTLY YNVEDLNIPFPRDDHEHILIHGYCNGIVCVISGKNILLCNPATREFRQLP DSFLLLPSPLGGKFELETDFGGLGFGYDCRAKDYKVVRIIENCEYSDDER TYYHRIPLPHTAEVYTMATNSWKEVKIDISSKTYPCSCSVYLKGFCYWFT RDGEEFILSFDLGDERFHRIQLPSRRESSFEFYYIFLCNESIASFCSLYD RSEDSKSCEIWVMDDYDGVKSSWTKLLVAGPFKGIEKPLTLWKCDELLMI DTDGRVISYNSGIGYLTYLHIPPIINRVIDSQALIYVESIVPVKoooooo ooooo >C12 ETPEDQVVEILSRLPPKSLMRFKCIRKSWCTIINSSSFVAKHLSNSIDNK LSSSTCILLNRCQVHVFPDRNWKQDVFWSMINLSIDGDKNNLHYDVEDLN IPFPMEDQDNVELHGYCNGIVCVIVGKNVLLCNPATEEFRQLPDSSLLLP LPKGRFGLETVFKGLGFGYDCKAKEYKVVRIIENCDCEYSEGEESYYERI LLPHTAEVYTMTTNSWKEIKIDVTSDTDPYCIPYSCSVYLKGFCYWFAMD NGEYIFSFDLGDEIFHIIELPSRRDFGFKFYGIFLYNESITSYCSRYEED CKLFEIWVMDDYDGVKSSWTKLLTIGPFKDIDYPLTLGKCDEVLMLGSYG RAAFCNSSTGNLKYLHIPPIINEVIDFEVLSYVESIVPIKoooooooooo ooooo >C13 MSQVHESETPEDKVVEILSRLSPKSLMRFKCVHKSWCTIINSPSFVAKHL SNTVDNKFSSCTRILFNRCQVHVFPDRSWKRDVFWSMINLSIDSDEHNLR YDVEDRNIPFPIEVQDNVQLYGYCNGIVCVIVGENVLLCNPATREFKQLP DSSLLLPLPTGKFGLETLFKGLGFGYDCKTKEYKVVRIIENCDCEYSDGK ESYIERILLPYTAEVYTTAANSWKEIKIDTSSDTDPYCIPYSCSMYLKGF CYWFANDNGEYIFSFDLGDEIFHRIELPFRRESDFKFCGLFLYNESVASY CSCYEEDCKLVEIWVMDDYDGVKSSWTKLLTVGPFKDIESPLTFWKCDEV LILSSYGKATSYNSSooooooooooooooooooooooooooooooooooo ooooo >C14 SKLSSTACILLNRCQVHVFPDRsWKQDVFWSMINLSIDSDEHNLHYDVED LNIPFPMEDQDNMELHGYCNGIACVIVGKNVLLCNPATGEFRQLPNSSLL LPLPKGRFGLETTFKGMGFGYDCKTKEYKVVRIIENCDCEYSEDGESYYE RILLPHTAEVYTTTANSWKEIKIDISIETRWYCIPYSCSVYLKGFCYWFA YDNGEYVFSFDLGDEIFNRIELPSRRESDFKFYGIFLYNESVTSYCYRHE EDCELFEIWVMDGYDGVKSSWTKLQTIGPLKDIDYPLTLWKCDEILMLGS YGRAASCNSSTGNLKYLHIPPIINWMIDYVKSIVPVKooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo ooooo >C15 MSQVRECETPEDRMVEILSRLPPKSLMRFKCIRKSWCTLFNSPCFVAKHL SDSVDNKLSSSTCILLNCSQAHVCSEESWKQGVLWSVINLSIDGDELHYG IEDLTNVPFLRDDHHELEIHGYCDGIICVTVNENFFLCNPATGEFRQLPD SCLLLPLPGVKEKFGLETTLKGLGFGYDCKAKEYKVVRIIDNYDCEYSDD GETYIEHIALPHTAEVYTMAANSWKEITIDILSKILSSYSEPYSYSVYLK GFCYWLSCDVEEYIFSFDLANEISDMIELPFRGEFGFKRDGIFLYNESLT YYCTSYEEPSTLFooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo ooooo >C16 KSLMRFKCIRKSWCTVINNPSFIAKHLSNSVDNKFSSSTCILLHRSQMPV FPDRSWKREYFWSMINLSHDSDEHNLYYDVEDLNIQFPLEDHDNVSIHGY CNGIVCLIVGKNAVLYNPATRELKQLPDSCLLLPSLPEGKFELESTFQGM GFGYDSKAKEYKVVKIIENCEYSDDMRTFSHRIALPHTAEVYVTTTNSWR VIEIEISSDTYNCSCSVYLKEFCYWFASDGEEYILSFDLGDEIFHRIQLP YRKESGFLFYDLFLYNESIASFCSHYDKSDNSGILEILEIWVMDoooooo oooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo ooooo CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=99, Nseq=16, Len=612 C1 -----------------------------KCIRKSWCTLINTPSFVAKHL C2 -------------------------------------------------- C3 ------------------------SLMRFKCIHKSWFSLINSLSFVAKHL C4 -----------------------------KCIRKSWCTLINSPSFVAKHL C5 MFEVRESKTPEDMVVEIMSKLPPKSLMRFKCIRKSWCTLINSPSFVAKHL C6 -----------------------KSLMRFKCTRKSWCTLINSSSFVAKHL C7 -----ESEAPEDRVVEILSRLPPKSLMRFKCIRKSWYTLINSPRFVAKHL C8 MFEVRESKTPEDMVVEIMSKLPPKSLMRFKCIRKSWCTLINSPSFVAKHL C9 -------------------------------------------------- C10 -----------------------------KCIRKSWCTLIISTSFVAKHL C11 MSQVRETETPEDRVVAIMSKLPPKSLMRFKCIRKSWCTLINNPSFVAKHL C12 -------ETPEDQVVEILSRLPPKSLMRFKCIRKSWCTIINSSSFVAKHL C13 MSQVHESETPEDKVVEILSRLSPKSLMRFKCVHKSWCTIINSPSFVAKHL C14 -------------------------------------------------- C15 MSQVRECETPEDRMVEILSRLPPKSLMRFKCIRKSWCTLFNSPCFVAKHL C16 -----------------------KSLMRFKCIRKSWCTVINNPSFIAKHL C1 NNSMNNKLSSSTCILLNRCQNHVFPDRSWKPEVFWSIINLSIDSDDHNLH C2 -------------------------------------------------- C3 SNSVDNKLSSSACILLNRSQPHIFPDQSWKQEVFWCVINFSIDSDENNLH C4 NNSMDNELSSSTCILLNRSQAHIFPDQSWKQEVFWsTINLSIDSDEHNLH C5 NNSVDNKLSSSTCILLNRSQAHVFPDNSWKPEVFWSMINLSIDSNEHNLH C6 SNSVDNILSSSTCILLNRSQMPVFPDKSWKYEILWSMIYLSIYSDEHSYH C7 NNSVDNKLSSSTCILLHRSQMPIFPYDSWKREFFWSMINFSIDSDESNLH C8 NNSVDNKLSSSTCILLNRSQTHVFPDNSWKQEVFWSMINISIDSDEHNLH C9 --------------LLNRSEMPVFPDDSWKYEVLWSMINLSIDSDDHnLH C10 SNSLDYKHSSSTCILLNRSQFHIFPDQSWKREVLWSMINLSSDSDVHNLH C11 SNSVVNNFSSYTCILLNRSQVHVFPDKSWKHEVLWSMINFFNDRVSRTLY C12 SNSIDNKLSSSTCILLNRCQVHVFPDRNWKQDVFWSMINLSIDGDKNNLH C13 SNTVDNKFSSCTRILFNRCQVHVFPDRSWKRDVFWSMINLSIDSDEHNLR C14 -----SKLSSTACILLNRCQVHVFPDRsWKQDVFWSMINLSIDSDEHNLH C15 SDSVDNKLSSSTCILLNCSQAHVCSEESWKQGVLWSVINLSIDGDE--LH C16 SNSVDNKFSSSTCILLHRSQMPVFPDRSWKREYFWSMINLSHDSDEHNLY C1 YDAEDL-NIPCPL-EGHDFVEIGGYCNGIVCVLAWKTLHWIYVILCNPAT C2 -------------------------CNGIVCVIAGN-----NFLLCNPAT C3 YDVEDL-TIPFPL-KDHDFVLIFGYCNGIVCVEAGK-----NVLLCNPAT C4 YDVEDL-IIPFPL-EDHDFVLIFGYCNGIICVDAGK-----NVLLCNPAT C5 YDVENL-NIPFPL-EGHDFVEIDGYCHGIVCVIAGKNLHLINIILCNPAT C6 YDVEDL-NIPFPL-EDHHPVQIHGYCNGIVCVIAGKT----VIILCNPGT C7 YDVEDLTNVPLLQWEDHHEVEIHGYCNGIVCVTVGE-----YFFLCNPAT C8 YDVEDL-NIPFPL-EDQDYVLILGYCNGIVCVSAGK-----NILLCNPTT C9 YNVEDL-NIPFPM-EYHHPVLIHGYCDGIFCVITGE-----NVVLCNPAI C10 YDVKPL-NIPFSR-DDHNPVQIHGYCNGIVCLIEGD-----NVLLCNPST C11 YNVEDL-NIPFPR-DDHEHILIHGYCNGIVCVISGK-----NILLCNPAT C12 YDVEDL-NIPFPM-EDQDNVELHGYCNGIVCVIVGK-----NVLLCNPAT C13 YDVEDR-NIPFPI-EVQDNVQLYGYCNGIVCVIVGE-----NVLLCNPAT C14 YDVEDL-NIPFPM-EDQDNMELHGYCNGIACVIVGK-----NVLLCNPAT C15 YGIEDLTNVPFLR-DDHHELEIHGYCDGIICVTVNE-----NFFLCNPAT C16 YDVEDL-NIQFPL-EDHDNVSIHGYCNGIVCLIVGK-----NAVLYNPAT *.** *: . .* ** C1 GEFRQLPHSCLLQPSRS-RRKFELNTISTLLGFGYDCKAKEYKVVQVIEN C2 REFMQLPDSCLLLP-PA-EGKFELDTTFEALGFGYDCKGKEYKVVQIIEN C3 KKFRQLPDSCLLLPSPL-EGKFKLETSFQALGFGYDCNAKEYKVVRIIEN C4 REFRQLPNSCLLLPPP--KGKFELETTFQALGFGYDCNAKEYKVVRIIEN C5 GEFRQLPHSCLLLPSRP-KGKFELETIFGALGFGYDCKAKEYKVVQIIEN C6 GEFRQLPDSCLLVPLP--KEKFQLETIFGGLGFGYDCKAKEYKVVQIIEN C7 GEFSQLPNSRLLLPLPRGKGKFGLETTVKGLGFGYDCKAKEYKVVRIIEN C8 REFMRLPSSCLLLPSHP-KGKFELETVFRALGFGYDCKAKEYKVVQIIEN C9 GEFRQLPDSCLLLPAPP-ERKFELETTFRALGFGYDCKAKEYKVVRIIEN C10 REFRLLPNSCLLVPHP--EGKFELETTFHGMGFGYDCKANEYKVVQIVEN C11 REFRQLPDSFLLLPSPL-GGKFELETDFGGLGFGYDCRAKDYKVVRIIEN C12 EEFRQLPDSSLLLPLP--KGRFGLETVFKGLGFGYDCKAKEYKVVRIIEN C13 REFKQLPDSSLLLPLP--TGKFGLETLFKGLGFGYDCKTKEYKVVRIIEN C14 GEFRQLPNSSLLLPLP--KGRFGLETTFKGMGFGYDCKTKEYKVVRIIEN C15 GEFRQLPDSCLLLPLPGVKEKFGLETTLKGLGFGYDCKAKEYKVVRIIDN C16 RELKQLPDSCLLLPSLP-EGKFELESTFQGMGFGYDSKAKEYKVVKIIEN :: ** * ** * :* *:: :*****.. ::****::::* C1 --CEYSDAEQYDYHRIALPHTAEVYTTTANSWREIKIDISSET-----YC C2 --CEYSDDEQTFNHCTTLPHTAEVYTTAVNSWKEIKIDISSTT-----YS C3 --CEYSDDERTFYNRIALPHTAELYTTPANSWKEIKIDISSTT-----YS C4 --GEYSDDEQTFHHRIALPHTAEVYTTAANSWKEIKIDISSQT-----YH C5 --CEYSDDEQYYYHRIALPHTAEVYTTAANSWREIKIDISSDT-----YH C6 --CEYSDDERTFYHSIPLPHTAEVYSIAANSWKEIKIDISTKT-----YP C7 YDCEYSDGEETYIEHAALPHTAELYTTTANSWKEIKINISSKILSFYSYP C8 --SEYSDDERTYYHRIPLPHTAEVYTTAANSWREIKIDISTRT-----YS C9 --CEYSDDEQTYNHRISLPYTAEVYTTTGNSWKEINIDVSSKA-----YP C10 --CEYSDDEQTYQHCIAYPYTAEVYTTAANFWKEIKIDISSST-----HP C11 --CEYSDDERTYYHRIPLPHTAEVYTMATNSWKEVKIDISSKT-----YP C12 CDCEYSEGEESYYERILLPHTAEVYTMTTNSWKEIKIDVTSDT-DPYCIP C13 CDCEYSDGKESYIERILLPYTAEVYTTAANSWKEIKIDTSSDT-DPYCIP C14 CDCEYSEDGESYYERILLPHTAEVYTTTANSWKEIKIDISIET-RWYCIP C15 YDCEYSDDGETYIEHIALPHTAEVYTMAANSWKEITIDILSKILSSYSEP C16 --CEYSDDMRTFSHRIALPHTAEVYVTTTNSWRVIEIEISSDT-----YN ***: . . *:***:* . * *: : *: C1 YTCSVYLNGFCYWIATDEEDFILSFDLGDEIFHRIQLPSRRDSDFKFSNL C2 WSCSVYLKGFCYWYATDDEEYVLSFDLCNETFHRIQFPSRGESGFTFFYI C3 CSRSVFMKGFCYWYATDGEEYILSFDLGDDTFHIIQLPSRREFGFRFYYI C4 CSCSVYLKGFCYWFASDSEEYILSFYLGDETFHIIQLPSRRESGFTFDYI C5 YSFSVYLKGFCYWFATDGEKYILSFDIGDEIFHRIQLPSRKESDFEFLNI C6 SSCSVYLKGFCYWFASDGEEYILSFDLGDEIFHRIQLPSRRESSFKFYDL C7 YSCSVYLKGFCYWLSSDDEEYICSFDLGEEIFDRIELPSRRESGFKLDGI C8 CSCQVYLKGFCYWYATDAEEYILSFDLGDEIFHRIQLPSRRESGFKFYYI C9 CSCSVYLKGFCYWFATDGEEYILSFDLGDEIFSRIQLPARKESGFKFYSL C10 YPYSVYLKGFCYWFATDGEECILSFDLGDEIFHRIQLPSKIESGFNFCGL C11 CSCSVYLKGFCYWFTRDGEEFILSFDLGDERFHRIQLPSRRESSFEFYYI C12 YSCSVYLKGFCYWFAMDNGEYIFSFDLGDEIFHIIELPSRRDFGFKFYGI C13 YSCSMYLKGFCYWFANDNGEYIFSFDLGDEIFHRIELPFRRESDFKFCGL C14 YSCSVYLKGFCYWFAYDNGEYVFSFDLGDEIFNRIELPSRRESDFKFYGI C15 YSYSVYLKGFCYWLSCDVEEYIFSFDLANEISDMIELPFRGEFGFKRDGI C16 CSCSVYLKEFCYWFASDGEEYILSFDLGDEIFHRIQLPYRKESGFLFYDL . .:::: **** : * . : ** : :: *::* : : .* : C1 FLCNKSIASFGYCCNPSDEDSTLyo----ooooooooooooooooooooo C2 FLRNESLASFCSRYDRSG-DSQSCEI---WVMDDYDRVKSSWTKLITVGP C3 FLRNESLASFCSRYERSE-DSESCEI---WVMDDYDRVKSSWTKLLTIGP C4 FLRDESLASFCSPYSPSE-DSKLFEI---WVMDDFDGVKSSWTKLLTVGP C5 FLCNTSIASFCSCCDPSDADSTLCEI---WVMDDYDGIKSSWTKLLTFGP C6 FLYNESITSYCSHYDPSE-ooooooo---ooooooooooooooooooooo C7 FLYNESITYYCTSYEE---SSRLFEI---WVMDICDGVNSSWTKHLTAGP C8 FLRNESLASFCSRYDRSD-KSESCoo---ooooooooooooooooooooo C9 FLYNESVTSYCSHYDPSE-DSKLFEI---WVMDooooooooooooooooo C10 FLYNESITSYCCRYDPSE-DSKLFEI---WVMDGYGGVKNSWTKLLoooo C11 FLCNESIASFCSLYDRSE-DSKSCEI---WVMDDYDGVKSSWTKLLVAGP C12 FLYNESITSYCSRYEE---DCKLFEI---WVMDDYDGVKSSWTKLLTIGP C13 FLYNESVASYCSCYEE---DCKLVEI---WVMDDYDGVKSSWTKLLTVGP C14 FLYNESVTSYCYRHEE---DCELFEI---WVMDGYDGVKSSWTKLQTIGP C15 FLYNESLTYYCTSYEE---PSTLFoo---ooooooooooooooooooooo C16 FLYNESIASFCSHYDKSD-NSGILEILEIWVMDooooooooooooooooo ** : *:: : . C1 ooooooooooooooooooooooooooooooooooooooooo--------- C2 LQGIEKPLTFWKNDELLMLASDGRATSYNSSTRNLKYVHIPooooooooo C3 LQGIKKPLTFWKSDEVLMLDSDGRATSYNSNTRNLKYLHIP--------- C4 FKGIEYPLTLWKCDELLMLASDGRATSYNSSTGNLKYLHIP--------- C5 LKGIENPFTLWKTDELLMVASGGRVTSYNSSTENLNYLHIP--------- C6 ooooooooooooooooooooooooooooooooooooooooo--------- C7 FKGIEFPLTLWKHDELLMIASDGRATSYNSSTGNLKYLYIP--------- C8 ooooooooooooooooooooooooooooooooooooooooo--------- C9 ooooooooooooooooooooooooooooooooooooooooo--------- C10 ooooooooooooooooooooooooooooooooooooooooo--------- C11 FKGIEKPLTLWKCDELLMIDTDGRVISYNSGIGYLTYLHIP--------- C12 FKDIDYPLTLGKCDEVLMLGSYGRAAFCNSSTGNLKYLHIP--------- C13 FKDIESPLTFWKCDEVLILSSYGKATSYNSSoooooooooo--------- C14 LKDIDYPLTLWKCDEILMLGSYGRAASCNSSTGNLKYLHIP--------- C15 ooooooooooooooooooooooooooooooooooooooooo--------- C16 ooooooooooooooooooooooooooooooooooooooooo--------- C1 -------------------------------------------------- C2 oooooooooooooooooooooooooooooooooooooooooooooooooo C3 -------------------------------------------------- C4 -------------------------------------------------- C5 -------------------------------------------------- C6 -------------------------------------------------- C7 -------------------------------------------------- C8 -------------------------------------------------- C9 -------------------------------------------------- C10 -------------------------------------------------- C11 -------------------------------------------------- C12 -------------------------------------------------- C13 -------------------------------------------------- C14 -------------------------------------------------- C15 -------------------------------------------------- C16 -------------------------------------------------- C1 -------------------------------------------------- C2 oooooooooooooooooooooooooooooooooooooooooooooooooo C3 -------------------------------------------------- C4 -------------------------------------------------- C5 -------------------------------------------------- C6 -------------------------------------------------- C7 -------------------------------------------------- C8 -------------------------------------------------- C9 -------------------------------------------------- C10 -------------------------------------------------- C11 -------------------------------------------------- C12 -------------------------------------------------- C13 -------------------------------------------------- C14 -------------------------------------------------- C15 -------------------------------------------------- C16 -------------------------------------------------- C1 -------------ooo--oooooooooooooooooooooooooooooooo C2 oooooooooooooooooooooooooooooooooooooooooooooooo-- C3 -------------PIL--KRVVDFEVLIYVKSoooooooooooooooooo C4 -------------PIL--NKVVDFEooooooooooooooooooooooooo C5 -------------PIL--NEVRDFQALIYMESIVPVKooooo-------- C6 -------------ooo--oooooooooooooooooooooooooooooooo C7 -------------IIIYRNRVID-----YAKSIVPVKRVEGKVPFSPI-- C8 -------------ooo--oooooooooooooooooooooooooooooo-- C9 -------------ooo--oooooooooooooooooooooooooooooooo C10 -------------ooo--oooooooooooooooooooooooooooooooo C11 -------------PII--NRVIDSQALIYVESIVPVKooooooooooo-- C12 -------------PII--NEVIDFEVLSYVESIVPIKooooooooooooo C13 ------------------oooooooooooooooooooooooooooooo-- C14 -------------PII--NWMID-----YVKSIVPVKooooooooooooo C15 -------------ooo--ooooooooooooooooooooooooo------- C16 -------------ooo--oooooooooooooooooooooooooooooooo C1 oooooooooooooooooooooo---------------------------- C2 -------------------------------------------------- C3 oooooooooooooooooooooo---------------------------- C4 oooooooooooooooooooooooooooo---------------------- C5 -------------------------------------------------- C6 ooooooooooooooooooooo----------------------------- C7 -------------------------------------------------- C8 -------------------------------------------------- C9 oooooooooooooooooooooooooooooooooooooooooooooooooo C10 oooooooooooooooooooooooooooo---------------------- C11 -------------------------------------------------- C12 oo------------------------------------------------ C13 -------------------------------------------------- C14 oooooooooooooooooooooooooooooooooooooooooooooooooo C15 -------------------------------------------------- C16 oooooooooooooooooo-------------------------------- C1 ------------ C2 ------------ C3 ------------ C4 ------------ C5 ------------ C6 ------------ C7 ------------ C8 ------------ C9 oooooooooooo C10 ------------ C11 ------------ C12 ------------ C13 ------------ C14 ooooo------- C15 ------------ C16 ------------ PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 16 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 405 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 405 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [238784] Library Relaxation: Multi_proc [72] Relaxation Summary: [238784]--->[82361] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 30.127 Mb, Max= 35.877 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 CNGIVCVLAWKYVILCNPATGEFRQLPHSCLLQPRRRKFELNTISTLLGF C2 CNGIVCVIAGNNFLLCNPATREFMQLPDSCLLLPPEGKFELDTTFEALGF C3 CNGIVCVEAGKNVLLCNPATKKFRQLPDSCLLLPPEGKFKLETSFQALGF C4 CNGIICVDAGKNVLLCNPATREFRQLPNSCLLLPPKGKFELETTFQALGF C5 CHGIVCVIAGKNIILCNPATGEFRQLPHSCLLLPRKGKFELETIFGALGF C6 CNGIVCVIAGKVIILCNPGTGEFRQLPDSCLLVPPKEKFQLETIFGGLGF C7 CNGIVCVTVGEYFFLCNPATGEFSQLPNSRLLLPPKGKFGLETTVKGLGF C8 CNGIVCVSAGKNILLCNPTTREFMRLPSSCLLLPHKGKFELETVFRALGF C9 CDGIFCVITGENVVLCNPAIGEFRQLPDSCLLLPPERKFELETTFRALGF C10 CNGIVCLIEGDNVLLCNPSTREFRLLPNSCLLVPPEGKFELETTFHGMGF C11 CNGIVCVISGKNILLCNPATREFRQLPDSFLLLPPGGKFELETDFGGLGF C12 CNGIVCVIVGKNVLLCNPATEEFRQLPDSSLLLPPKGRFGLETVFKGLGF C13 CNGIVCVIVGENVLLCNPATREFKQLPDSSLLLPPTGKFGLETLFKGLGF C14 CNGIACVIVGKNVLLCNPATGEFRQLPNSSLLLPPKGRFGLETTFKGMGF C15 CDGIICVTVNENFFLCNPATGEFRQLPDSCLLLPPKEKFGLETTLKGLGF C16 CNGIVCLIVGKNAVLYNPATRELKQLPDSCLLLPLEGKFELESTFQGMGF *.** *: . .* ** :: ** * ** * :* *:: :** C1 GYDCKAKEYKVVQVIENCEYSDAEQYDYHRIALPHTAEVYTTTANSWREI C2 GYDCKGKEYKVVQIIENCEYSDDEQTFNHCTTLPHTAEVYTTAVNSWKEI C3 GYDCNAKEYKVVRIIENCEYSDDERTFYNRIALPHTAELYTTPANSWKEI C4 GYDCNAKEYKVVRIIENGEYSDDEQTFHHRIALPHTAEVYTTAANSWKEI C5 GYDCKAKEYKVVQIIENCEYSDDEQYYYHRIALPHTAEVYTTAANSWREI C6 GYDCKAKEYKVVQIIENCEYSDDERTFYHSIPLPHTAEVYSIAANSWKEI C7 GYDCKAKEYKVVRIIENCEYSDGEETYIEHAALPHTAELYTTTANSWKEI C8 GYDCKAKEYKVVQIIENSEYSDDERTYYHRIPLPHTAEVYTTAANSWREI C9 GYDCKAKEYKVVRIIENCEYSDDEQTYNHRISLPYTAEVYTTTGNSWKEI C10 GYDCKANEYKVVQIVENCEYSDDEQTYQHCIAYPYTAEVYTTAANFWKEI C11 GYDCRAKDYKVVRIIENCEYSDDERTYYHRIPLPHTAEVYTMATNSWKEV C12 GYDCKAKEYKVVRIIENCEYSEGEESYYERILLPHTAEVYTMTTNSWKEI C13 GYDCKTKEYKVVRIIENCEYSDGKESYIERILLPYTAEVYTTAANSWKEI C14 GYDCKTKEYKVVRIIENCEYSEDGESYYERILLPHTAEVYTTTANSWKEI C15 GYDCKAKEYKVVRIIDNCEYSDDGETYIEHIALPHTAEVYTMAANSWKEI C16 GYDSKAKEYKVVKIIENCEYSDDMRTFSHRIALPHTAEVYVTTTNSWRVI ***.. ::****::::* ***: . . *:***:* . * *: : C1 KIDISSETYCYTCSVYLNGFCYWIATDEEDFILSFDLGDEIFHRIQLPSR C2 KIDISSTTYSWSCSVYLKGFCYWYATDDEEYVLSFDLCNETFHRIQFPSR C3 KIDISSTTYSCSRSVFMKGFCYWYATDGEEYILSFDLGDDTFHIIQLPSR C4 KIDISSQTYHCSCSVYLKGFCYWFASDSEEYILSFYLGDETFHIIQLPSR C5 KIDISSDTYHYSFSVYLKGFCYWFATDGEKYILSFDIGDEIFHRIQLPSR C6 KIDISTKTYPSSCSVYLKGFCYWFASDGEEYILSFDLGDEIFHRIQLPSR C7 KINISSKIYPYSCSVYLKGFCYWLSSDDEEYICSFDLGEEIFDRIELPSR C8 KIDISTRTYSCSCQVYLKGFCYWYATDAEEYILSFDLGDEIFHRIQLPSR C9 NIDVSSKAYPCSCSVYLKGFCYWFATDGEEYILSFDLGDEIFSRIQLPAR C10 KIDISSSTHPYPYSVYLKGFCYWFATDGEECILSFDLGDEIFHRIQLPSK C11 KIDISSKTYPCSCSVYLKGFCYWFTRDGEEFILSFDLGDERFHRIQLPSR C12 KIDVTSDTIPYSCSVYLKGFCYWFAMDNGEYIFSFDLGDEIFHIIELPSR C13 KIDTSSDTIPYSCSMYLKGFCYWFANDNGEYIFSFDLGDEIFHRIELPFR C14 KIDISIETIPYSCSVYLKGFCYWFAYDNGEYVFSFDLGDEIFNRIELPSR C15 TIDILSKIEPYSYSVYLKGFCYWLSCDVEEYIFSFDLANEISDMIELPFR C16 EIEISSDTYNCSCSVYLKEFCYWFASDGEEYILSFDLGDEIFHRIQLPYR *: . .:::: **** : * . : ** : :: *::* : C1 RDSDFKFSNLFLCNKSIASFGYCCNPDSTLyooooooooooooooooooo C2 GESGFTFFYIFLRNESLASFCSRYDRDSQSCEWVMDDYDRVKSSWTKLIT C3 REFGFRFYYIFLRNESLASFCSRYERDSESCEWVMDDYDRVKSSWTKLLT C4 RESGFTFDYIFLRDESLASFCSPYSPDSKLFEWVMDDFDGVKSSWTKLLT C5 KESDFEFLNIFLCNTSIASFCSCCDPDSTLCEWVMDDYDGIKSSWTKLLT C6 RESSFKFYDLFLYNESITSYCSHYDPoooooooooooooooooooooooo C7 RESGFKLDGIFLYNESITYYCTSYEESSRLFEWVMDICDGVNSSWTKHLT C8 RESGFKFYYIFLRNESLASFCSRYDRKSESCooooooooooooooooooo C9 KESGFKFYSLFLYNESVTSYCSHYDPDSKLFEWVMDoooooooooooooo C10 IESGFNFCGLFLYNESITSYCCRYDPDSKLFEWVMDGYGGVKNSWTKLLo C11 RESSFEFYYIFLCNESIASFCSLYDRDSKSCEWVMDDYDGVKSSWTKLLV C12 RDFGFKFYGIFLYNESITSYCSRYEEDCKLFEWVMDDYDGVKSSWTKLLT C13 RESDFKFCGLFLYNESVASYCSCYEEDCKLVEWVMDDYDGVKSSWTKLLT C14 RESDFKFYGIFLYNESVTSYCYRHEEDCELFEWVMDGYDGVKSSWTKLQT C15 GEFGFKRDGIFLYNESLTYYCTSYEEPSTLFooooooooooooooooooo C16 KESGFLFYDLFLYNESIASFCSHYDKNSGILEWVMDoooooooooooooo : .* :** : *:: : . C1 oooooooooooooooooooooooooooooooooooooooooooooooooo C2 VGPLQGIEKPLTFWKNDELLMLASDGRATSYNSSTRNLKYVHIPoooooo C3 IGPLQGIKKPLTFWKSDEVLMLDSDGRATSYNSNTRNLKYLHIPKRVVDY C4 VGPFKGIEYPLTLWKCDELLMLASDGRATSYNSSTGNLKYLHIPNKVVDo C5 FGPLKGIENPFTLWKTDELLMVASGGRVTSYNSSTENLNYLHIPNEVRDY C6 oooooooooooooooooooooooooooooooooooooooooooooooooo C7 AGPFKGIEFPLTLWKHDELLMIASDGRATSYNSSTGNLKYLYIPNRVIDY C8 oooooooooooooooooooooooooooooooooooooooooooooooooo C9 oooooooooooooooooooooooooooooooooooooooooooooooooo C10 oooooooooooooooooooooooooooooooooooooooooooooooooo C11 AGPFKGIEKPLTLWKCDELLMIDTDGRVISYNSGIGYLTYLHIPNRVIDY C12 IGPFKDIDYPLTLGKCDEVLMLGSYGRAAFCNSSTGNLKYLHIPNEVIDY C13 VGPFKDIESPLTFWKCDEVLILSSYGKATSYNSSoooooooooooooooo C14 IGPLKDIDYPLTLWKCDEILMLGSYGRAASCNSSTGNLKYLHIPNWMIDY C15 oooooooooooooooooooooooooooooooooooooooooooooooooo C16 oooooooooooooooooooooooooooooooooooooooooooooooooo C1 ooooooooooooo C2 ooooooooooooo C3 VKSoooooooooo C4 ooooooooooooo C5 MESIVPVKooooo C6 ooooooooooooo C7 AKSIVPVKRVEGK C8 ooooooooooooo C9 ooooooooooooo C10 ooooooooooooo C11 VESIVPVKooooo C12 VESIVPIKooooo C13 ooooooooooooo C14 VKSIVPVKooooo C15 ooooooooooooo C16 ooooooooooooo FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:61 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # SEQ_INDEX C7 6 # SEQ_INDEX C8 7 # SEQ_INDEX C9 8 # SEQ_INDEX C10 9 # SEQ_INDEX C11 10 # SEQ_INDEX C12 11 # SEQ_INDEX C13 12 # SEQ_INDEX C14 13 # SEQ_INDEX C15 14 # SEQ_INDEX C16 15 # PW_SEQ_DISTANCES BOT 0 1 54.29 C1 C2 54.29 TOP 1 0 54.29 C2 C1 54.29 BOT 0 2 57.39 C1 C3 57.39 TOP 2 0 57.39 C3 C1 57.39 BOT 0 3 63.07 C1 C4 63.07 TOP 3 0 63.07 C4 C1 63.07 BOT 0 4 63.20 C1 C5 63.20 TOP 4 0 63.20 C5 C1 63.20 BOT 0 5 78.89 C1 C6 78.89 TOP 5 0 78.89 C6 C1 78.89 BOT 0 6 49.18 C1 C7 49.18 TOP 6 0 49.18 C7 C1 49.18 BOT 0 7 80.27 C1 C8 80.27 TOP 7 0 80.27 C8 C1 80.27 BOT 0 8 76.92 C1 C9 76.92 TOP 8 0 76.92 C9 C1 76.92 BOT 0 9 72.11 C1 C10 72.11 TOP 9 0 72.11 C10 C1 72.11 BOT 0 10 52.27 C1 C11 52.27 TOP 10 0 52.27 C11 C1 52.27 BOT 0 11 53.99 C1 C12 53.99 TOP 11 0 53.99 C12 C1 53.99 BOT 0 12 60.16 C1 C13 60.16 TOP 12 0 60.16 C13 C1 60.16 BOT 0 13 55.62 C1 C14 55.62 TOP 13 0 55.62 C14 C1 55.62 BOT 0 14 69.13 C1 C15 69.13 TOP 14 0 69.13 C15 C1 69.13 BOT 0 15 75.44 C1 C16 75.44 TOP 15 0 75.44 C16 C1 75.44 BOT 1 2 76.51 C2 C3 76.51 TOP 2 1 76.51 C3 C2 76.51 BOT 1 3 78.57 C2 C4 78.57 TOP 3 1 78.57 C4 C2 78.57 BOT 1 4 68.73 C2 C5 68.73 TOP 4 1 68.73 C5 C2 68.73 BOT 1 5 57.86 C2 C6 57.86 TOP 5 1 57.86 C6 C2 57.86 BOT 1 6 60.51 C2 C7 60.51 TOP 6 1 60.51 C7 C2 60.51 BOT 1 7 63.70 C2 C8 63.70 TOP 7 1 63.70 C8 C2 63.70 BOT 1 8 60.85 C2 C9 60.85 TOP 8 1 60.85 C9 C2 60.85 BOT 1 9 62.86 C2 C10 62.86 TOP 9 1 62.86 C10 C2 62.86 BOT 1 10 69.04 C2 C11 69.04 TOP 10 1 69.04 C11 C2 69.04 BOT 1 11 62.95 C2 C12 62.95 TOP 11 1 62.95 C12 C2 62.95 BOT 1 12 70.55 C2 C13 70.55 TOP 12 1 70.55 C13 C2 70.55 BOT 1 13 64.84 C2 C14 64.84 TOP 13 1 64.84 C14 C2 64.84 BOT 1 14 51.46 C2 C15 51.46 TOP 14 1 51.46 C15 C2 51.46 BOT 1 15 58.72 C2 C16 58.72 TOP 15 1 58.72 C16 C2 58.72 BOT 2 3 81.95 C3 C4 81.95 TOP 3 2 81.95 C4 C3 81.95 BOT 2 4 73.33 C3 C5 73.33 TOP 4 2 73.33 C5 C3 73.33 BOT 2 5 59.80 C3 C6 59.80 TOP 5 2 59.80 C6 C3 59.80 BOT 2 6 65.24 C3 C7 65.24 TOP 6 2 65.24 C7 C3 65.24 BOT 2 7 64.04 C3 C8 64.04 TOP 7 2 64.04 C8 C3 64.04 BOT 2 8 59.18 C3 C9 59.18 TOP 8 2 59.18 C9 C3 59.18 BOT 2 9 61.40 C3 C10 61.40 TOP 9 2 61.40 C10 C3 61.40 BOT 2 10 72.70 C3 C11 72.70 TOP 10 2 72.70 C11 C3 72.70 BOT 2 11 72.25 C3 C12 72.25 TOP 11 2 72.25 C12 C3 72.25 BOT 2 12 65.60 C3 C13 65.60 TOP 12 2 65.60 C13 C3 65.60 BOT 2 13 71.31 C3 C14 71.31 TOP 13 2 71.31 C14 C3 71.31 BOT 2 14 50.81 C3 C15 50.81 TOP 14 2 50.81 C15 C3 50.81 BOT 2 15 59.85 C3 C16 59.85 TOP 15 2 59.85 C16 C3 59.85 BOT 3 4 77.78 C4 C5 77.78 TOP 4 3 77.78 C5 C4 77.78 BOT 3 5 63.57 C4 C6 63.57 TOP 5 3 63.57 C6 C4 63.57 BOT 3 6 69.57 C4 C7 69.57 TOP 6 3 69.57 C7 C4 69.57 BOT 3 7 66.67 C4 C8 66.67 TOP 7 3 66.67 C8 C4 66.67 BOT 3 8 65.14 C4 C9 65.14 TOP 8 3 65.14 C9 C4 65.14 BOT 3 9 67.41 C4 C10 67.41 TOP 9 3 67.41 C10 C4 67.41 BOT 3 10 73.07 C4 C11 73.07 TOP 10 3 73.07 C11 C4 73.07 BOT 3 11 73.47 C4 C12 73.47 TOP 11 3 73.47 C12 C4 73.47 BOT 3 12 70.81 C4 C13 70.81 TOP 12 3 70.81 C13 C4 70.81 BOT 3 13 73.92 C4 C14 73.92 TOP 13 3 73.92 C14 C4 73.92 BOT 3 14 54.92 C4 C15 54.92 TOP 14 3 54.92 C15 C4 54.92 BOT 3 15 63.54 C4 C16 63.54 TOP 15 3 63.54 C16 C4 63.54 BOT 4 5 59.57 C5 C6 59.57 TOP 5 4 59.57 C6 C5 59.57 BOT 4 6 69.77 C5 C7 69.77 TOP 6 4 69.77 C7 C5 69.77 BOT 4 7 66.17 C5 C8 66.17 TOP 7 4 66.17 C8 C5 66.17 BOT 4 8 57.01 C5 C9 57.01 TOP 8 4 57.01 C9 C5 57.01 BOT 4 9 60.16 C5 C10 60.16 TOP 9 4 60.16 C10 C5 60.16 BOT 4 10 75.19 C5 C11 75.19 TOP 10 4 75.19 C11 C5 75.19 BOT 4 11 72.49 C5 C12 72.49 TOP 11 4 72.49 C12 C5 72.49 BOT 4 12 66.41 C5 C13 66.41 TOP 12 4 66.41 C13 C5 66.41 BOT 4 13 71.13 C5 C14 71.13 TOP 13 4 71.13 C14 C5 71.13 BOT 4 14 51.90 C5 C15 51.90 TOP 14 4 51.90 C15 C5 51.90 BOT 4 15 59.57 C5 C16 59.57 TOP 15 4 59.57 C16 C5 59.57 BOT 5 6 54.01 C6 C7 54.01 TOP 6 5 54.01 C7 C6 54.01 BOT 5 7 83.20 C6 C8 83.20 TOP 7 5 83.20 C8 C6 83.20 BOT 5 8 82.64 C6 C9 82.64 TOP 8 5 82.64 C9 C6 82.64 BOT 5 9 76.38 C6 C10 76.38 TOP 9 5 76.38 C10 C6 76.38 BOT 5 10 59.06 C6 C11 59.06 TOP 10 5 59.06 C11 C6 59.06 BOT 5 11 57.44 C6 C12 57.44 TOP 11 5 57.44 C12 C6 57.44 BOT 5 12 63.03 C6 C13 63.03 TOP 12 5 63.03 C13 C6 63.03 BOT 5 13 56.99 C6 C14 56.99 TOP 13 5 56.99 C14 C6 56.99 BOT 5 14 75.00 C6 C15 75.00 TOP 14 5 75.00 C15 C6 75.00 BOT 5 15 80.05 C6 C16 80.05 TOP 15 5 80.05 C16 C6 80.05 BOT 6 7 53.94 C7 C8 53.94 TOP 7 6 53.94 C8 C7 53.94 BOT 6 8 52.10 C7 C9 52.10 TOP 8 6 52.10 C9 C7 52.10 BOT 6 9 54.08 C7 C10 54.08 TOP 9 6 54.08 C10 C7 54.08 BOT 6 10 66.67 C7 C11 66.67 TOP 10 6 66.67 C11 C7 66.67 BOT 6 11 70.96 C7 C12 70.96 TOP 11 6 70.96 C12 C7 70.96 BOT 6 12 64.56 C7 C13 64.56 TOP 12 6 64.56 C13 C7 64.56 BOT 6 13 69.25 C7 C14 69.25 TOP 13 6 69.25 C14 C7 69.25 BOT 6 14 60.76 C7 C15 60.76 TOP 14 6 60.76 C15 C7 60.76 BOT 6 15 52.80 C7 C16 52.80 TOP 15 6 52.80 C16 C7 52.80 BOT 7 8 78.59 C8 C9 78.59 TOP 8 7 78.59 C9 C8 78.59 BOT 7 9 73.60 C8 C10 73.60 TOP 9 7 73.60 C10 C8 73.60 BOT 7 10 60.99 C8 C11 60.99 TOP 10 7 60.99 C11 C8 60.99 BOT 7 11 58.48 C8 C12 58.48 TOP 11 7 58.48 C12 C8 58.48 BOT 7 12 64.16 C8 C13 64.16 TOP 12 7 64.16 C13 C8 64.16 BOT 7 13 55.56 C8 C14 55.56 TOP 13 7 55.56 C14 C8 55.56 BOT 7 14 72.98 C8 C15 72.98 TOP 14 7 72.98 C15 C8 72.98 BOT 7 15 79.84 C8 C16 79.84 TOP 15 7 79.84 C16 C8 79.84 BOT 8 9 79.46 C9 C10 79.46 TOP 9 8 79.46 C10 C9 79.46 BOT 8 10 56.60 C9 C11 56.60 TOP 10 8 56.60 C11 C9 56.60 BOT 8 11 56.43 C9 C12 56.43 TOP 11 8 56.43 C12 C9 56.43 BOT 8 12 64.78 C9 C13 64.78 TOP 12 8 64.78 C13 C9 64.78 BOT 8 13 63.08 C9 C14 63.08 TOP 13 8 63.08 C14 C9 63.08 BOT 8 14 73.49 C9 C15 73.49 TOP 14 8 73.49 C15 C9 73.49 BOT 8 15 81.44 C9 C16 81.44 TOP 15 8 81.44 C16 C9 81.44 BOT 9 10 59.20 C10 C11 59.20 TOP 10 9 59.20 C11 C10 59.20 BOT 9 11 58.89 C10 C12 58.89 TOP 11 9 58.89 C12 C10 58.89 BOT 9 12 66.22 C10 C13 66.22 TOP 12 9 66.22 C13 C10 66.22 BOT 9 13 61.02 C10 C14 61.02 TOP 13 9 61.02 C14 C10 61.02 BOT 9 14 67.76 C10 C15 67.76 TOP 14 9 67.76 C15 C10 67.76 BOT 9 15 74.94 C10 C16 74.94 TOP 15 9 74.94 C16 C10 74.94 BOT 10 11 72.41 C11 C12 72.41 TOP 11 10 72.41 C12 C11 72.41 BOT 10 12 65.16 C11 C13 65.16 TOP 12 10 65.16 C13 C11 65.16 BOT 10 13 68.71 C11 C14 68.71 TOP 13 10 68.71 C14 C11 68.71 BOT 10 14 51.52 C11 C15 51.52 TOP 14 10 51.52 C15 C11 51.52 BOT 10 15 58.12 C11 C16 58.12 TOP 15 10 58.12 C16 C11 58.12 BOT 11 12 77.14 C12 C13 77.14 TOP 12 11 77.14 C13 C12 77.14 BOT 11 13 87.22 C12 C14 87.22 TOP 13 11 87.22 C14 C12 87.22 BOT 11 14 56.09 C12 C15 56.09 TOP 14 11 56.09 C15 C12 56.09 BOT 11 15 56.40 C12 C16 56.40 TOP 15 11 56.40 C16 C12 56.40 BOT 12 13 75.65 C13 C14 75.65 TOP 13 12 75.65 C14 C13 75.65 BOT 12 14 60.55 C13 C15 60.55 TOP 14 12 60.55 C15 C13 60.55 BOT 12 15 64.36 C13 C16 64.36 TOP 15 12 64.36 C16 C13 64.36 BOT 13 14 51.91 C14 C15 51.91 TOP 14 13 51.91 C15 C14 51.91 BOT 13 15 55.80 C14 C16 55.80 TOP 15 13 55.80 C16 C14 55.80 BOT 14 15 68.36 C15 C16 68.36 TOP 15 14 68.36 C16 C15 68.36 AVG 0 C1 * 64.13 AVG 1 C2 * 64.09 AVG 2 C3 * 66.09 AVG 3 C4 * 69.56 AVG 4 C5 * 66.16 AVG 5 C6 * 67.17 AVG 6 C7 * 60.89 AVG 7 C8 * 68.15 AVG 8 C9 * 67.18 AVG 9 C10 * 66.37 AVG 10 C11 * 64.05 AVG 11 C12 * 65.77 AVG 12 C13 * 66.61 AVG 13 C14 * 65.47 AVG 14 C15 * 61.11 AVG 15 C16 * 65.95 TOT TOT * 65.55 CLUSTAL W (1.83) multiple sequence alignment C1 -------------------------------------------------- C2 -------------------------------------------------- C3 -------------------------------------------------- C4 -------------------------------------------------- C5 ATGTTCGAGGTGCGTGAAAGTAAAACTCCTGAAGATATGGTGGTTGAAAT C6 -------------------------------------------------- C7 ---------------GAAAGTGAAGCTCCTGAAGATAGGGTGGTCGAAAT C8 ATGTTCGAGGTGCGTGAAAGTAAAACTCCTGAAGATATGGTGGTTGAAAT C9 -------------------------------------------------- C10 -------------------------------------------------- C11 ATGTCCCAGGTGCGTGAAACTGAAACTCCTGAAGATAGGGTGGTCGCAAT C12 ---------------------GAAACTCCAGAAGATCAGGTGGTCGAAAT C13 ATGTCCCAGGTGCATGAAAGTGAAACTCCTGAAGATAAGGTGGTCGAAAT C14 -------------------------------------------------- C15 ATGTCCCAGGTGCGTGAATGTGAAACTCCTGAAGATAGGATGGTTGAAAT C16 -------------------------------------------------- C1 -------------------------------------AAATGCATACGCA C2 -------------------------------------------------- C3 ----------------------TCTCTGATGCGGTTCAAATGCATACACA C4 -------------------------------------AAATGCATACGCA C5 CATGTCTAAGTTGCCGCCCAAGTCTCTAATGCGATTCAAATGCATACGCA C6 -------------------AAGTCCCTGATGCGATTCAAATGCACACGCA C7 CCTGTCCAGGTTGCCGCCCAAGTCTCTGATGCGATTCAAATGCATACGCA C8 CATGTCTAAGTTGCCGCCCAAGTCTCTAATGCGATTCAAATGCATACGCA C9 -------------------------------------------------- C10 -------------------------------------AAATGCATACGCA C11 CATGTCCAAGTTGCCGCCCAAGTCTCTGATGCGATTCAAATGCATACGCA C12 CCTGTCCAGGTTGCCACCCAAGTCTCTAATGAGATTCAAATGTATACGTA C13 CTTGTCAAGGTTGTCGCCCAAGTCCCTGATGAGATTCAAATGCGTACACA C14 -------------------------------------------------- C15 CTTGTCCAGGTTGCCACCTAAGTCTCTGATGCGATTCAAATGCATACGCA C16 -------------------AAGTCTCTGATGCGGTTCAAATGTATACGCA C1 AGTCTTGGTGCACTCTCATCAATACTCCAAGTTTTGTTGCCAAACACCTC C2 -------------------------------------------------- C3 AGTCTTGGTTCTCTCTCATCAATAGTCTAAGTTTTGTGGCCAAACACCTC C4 AGTCTTGGTGCACTCTCATCAATAGTCCAAGTTTTGTAGCCAAACACCTC C5 AGTCTTGGTGCACTCTCATCAATAGTCCAAGTTTTGTGGCCAAACACCTC C6 AGTCTTGGTGCACTCTCATCAATAGTTCAAGCTTTGTTGCCAAACACCTC C7 AGTCTTGGTACACGCTCATCAATAGTCCTCGTTTTGTGGCCAAACACCTC C8 AGTCTTGGTGCACTCTCATCAATAGTCCAAGTTTTGTGGCCAAACACCTC C9 -------------------------------------------------- C10 AGTCTTGGTGCACTCTCATCATTAGTACAAGTTTTGTTGCCAAACACCTC C11 AGTCTTGGTGCACTCTCATCAATAATCCAAGTTTTGTGGCCAAACACCTC C12 AGTCTTGGTGCACTATCATCAATAGTTCAAGTTTTGTGGCCAAACACCTC C13 AATCATGGTGCACTATCATCAATAGTCCAAGTTTTGTGGCCAAACACCTC C14 -------------------------------------------------- C15 AATCTTGGTGCACTCTTTTCAATAGTCCATGTTTTGTGGCCAAACACCTC C16 AGTCTTGGTGCACGGTCATCAACAATCCAAGTTTTATTGCCAAACACCTC C1 AACAATTCTATGAACAACAAACTATCgTCCTCCACTTGCATCCTTCTCAA C2 -------------------------------------------------- C3 AGCAATTCCGTGGACAACAAACTCTCATCCTCCGCTTGTATCCTTCTCAA C4 AACAATTCTAtGGACAACGAACTCTCATCCTCCACTTGTATCCTTCTCAA C5 AACAATTCCGTGGATAACAAACTATCATCTTCCACTTGCATCCTTCTCAA C6 AGCAACTCCGTAGACAACATACTCTCATCCTCCACTTGTATCCTGCTCAA C7 AACAATTCCGTGGACAACAAACTATCATCCTCCACATGTATCCTTCTCCA C8 AACAATTCCGTGGATAACAAACTATCATCTTCCACTTGCATCCTTCTCAA C9 ------------------------------------------CTTCTCAA C10 AGCAATTCCTTGGACTACAAACACTCATCCTCCACTTGTATCCTTCTTAA C11 AGCAATTCTGTGGTCAACAATTTCTCATCCTACACTTGTATCCTCCTCAA C12 AGCAATTCCATAGACAACAAACTCTCATCCTCCACTTGTATCCTTCTTAA C13 AGCAATACCGTGGACAACAAATTCTCATCCTGCACTCGCATCCTTTTCAA C14 ---------------AgCAAACTCTCATCCACCGCTTGTATCCTTCTCAA C15 AGCGATTCTGTGGACAACAAACTCTCATCCTCCACTTGTATCCTTCTCAA C16 AGCAATTCCGTTGACAACAAGTTCTCATCCTCCACTTGTATCCTTCTCCA C1 CCGTTGTCAGAATCATGTTTTCCCGGATAGAAGTTGGAAACCAGAAGTTT C2 -------------------------------------------------- C3 CCGTTCTCAGCCTCACATTTTCCCAGACCAGAGTTGGAAACAAGAAGTTT C4 CCGTTCTCAGGCTCACATTTTCCCAGACCAGAGTTGGAAACAAGAAGTTT C5 CCGTTCTCAGGCTCATGTTTTCCCAGATAACAGTTGGAAACCAGAAGTTT C6 CCGTTCTCAGATGCCGGTTTTCCCAGACAAAAGTTGGAAATATGAAATTT C7 CCGTTCTCAGATGCCCATTTTCCCTTACGACAGTTGGAAACGAGAATTTT C8 CCGTTCTCAGACTCATGTTTTCCCAGACAATAGTTGGAAACAAGAAGTTT C9 CCGTTCTGAAATGCCCGTTTTCCCGGACGACAGTTGGAAGTATGAAGTTT C10 CCGTTCTCAGTTTCACATTTTCCCGGATCAGAGTTGGAAACGTGAAGTTT C11 CCGTTCTCAGGTTCACGTTTTCCCGGACAAGAGTTGGAAACATGAAGTTT C12 CCGTTGTCAGGTTCATGTTTTCCCGGATAGGAATTGGAAACAAGACGTTT C13 CCGATGTCAGGTTCATGTCTTCCCGGACAGGAGTTGGAAAAGAGATGTTT C14 CCGTTGTCAGGtTCATGTTTTCCCGGACAGGaGTTGGAAACAAGACGTTT C15 CTGTTCTCAGGCTCACGTTTGCTCGGAAGAGAGTTGGAAACAAGGAGTTT C16 CCGTTCTCAGATGCCCGTTTTCCCGGACAGAAGTTGGAAACGAGAATATT C1 TCTGGTCCATAATTAATCTTTCCATTGATAGCGATGATCACAACCTTCAT C2 -------------------------------------------------- C3 TCTGGTGCGTGATTAATTTTTCCATTGATAGTGATGAGAACAACCTTCAT C4 TCTGGtCCACGATTAATCTTTCTATTGATAGTGATGAGCATAACCTTCAT C5 TCTGGTCCATGATTAATCTTTCCATCGATAGTAACGAGCACAACCTTCAT C6 TATGGTCCATGATTTATCTTTCCATTTATAGTGATGAGCACAGCTATCAT C7 TCTGGTCCATGATTAATTTTTCCATTGATAGTGATGAGAGCAACCTTCAT C8 TCTGGTCCATGATCAATATTTCTATTGATAGTGATGAGCACAACCTTCAT C9 TATGGTCCATGATTAATCTTTCCATTGATAGTGATGATCACaACCTTCAT C10 TATGGTCCATGATTAATCTTTCCAGTGATAGTGATGTGCACAACCTTCAT C11 TATGGTCCATGATTAATTTTTTTAATGATAGAGTTTCACGCACCCTTTAT C12 TCTGGTCCATGATTAATCTTTCCATTGATGGTGATAAGAATAACCTTCAT C13 TCTGGTCTATGATTAATCTTTCCATTGATAGTGATGAGCACAACCTTCGT C14 TCTGGTCCATGATTAATCTTTCCATTGATAGTGATGAGCACAACCTTCAT C15 TATGGTCCGTGATTAATCTTTCCATTGATGGTGATGAA------CTTCAT C16 TCTGGTCCATGATTAATCTTTCCCATGATAGTGATGAGCACAACCTTTAT C1 TATGATGCTGAGGACCTC---AATATACCGTGTCCATTG---GAAGGTCA C2 -------------------------------------------------- C3 TATGATGTTGAGGACCTA---ACTATACCGTTTCCATTG---AAAGATCA C4 TATGATGTTGAGGACCTA---ATTATACCGTTTCCATTG---GAAGATCA C5 TATGACGTTGAGAACCTA---AATATACCGTTTCCATTG---GAAGGTCA C6 TATGATGTTGAGGACCTA---AACATACCCTTTCCATTA---GAGGATCA C7 TATGATGTTGAGGACCTTACAAATGTACCGTTATTGCAATGGGAAGACCA C8 TATGATGTTGAGGACCTA---AATATACCATTTCCGCTG---GAAGATCA C9 TATAATGTTGAGGACCTA---AATATACCGTTTCCAATG---GAATACCA C10 TATGATGTTAAGCCCTTA---AATATACCGTTTTCTAGG---GATGACCA C11 TATAATGTTGAGGACCTA---AATATACCGTTTCCAAGG---GATGACCA C12 TACGATGTTGAGGACCTA---AATATACCATTTCCAATG---GAAGATCA C13 TATGATGTCGAGGACCGA---AATATACCCTTTCCTATA---GAAGTTCA C14 TATGATGTTGAGGACCTA---AATATACCGTTTCCAATG---GAAGATCA C15 TATGGTATTGAGGACCTAACTAATGTACCGTTTCTAAGG---GATGACCA C16 TATGATGTTGAGGACCTG---AATATACAATTTCCATTA---GAAGATCA C1 TGATTTTGTAGAGATTGGTGGCTATTGCAATGGGATTGTCTGTGTACTAG C2 -------------------------TGCAATGGGATTGTATGTGTAATAG C3 TGACTTTGTACTGATTTTTGGTTATTGCAATGGGATTGTCTGTGTAGAAG C4 TGATTTTGTACTGATTTTTGGTTATTGCAATGGGATTATCTGTGTAGATG C5 TGATTTTGTAGAAATTGATGGCTATTGCCATGGGATTGTCTGTGTAATAG C6 TCATCCTGTACAGATTCACGGTTATTGCAATGGGATTGTCTGTGTAATAG C7 TCATGAAGTAGAGATTCACGGTTATTGCAATGGGATTGTCTGTGTAACAG C8 GGATTACGTATTGATTCTCGGTTATTGCAATGGGATTGTTTGTGTATCAG C9 TCATCCTGTATTGATTCACGGTTATTGCGATGGTATTTTCTGTGTAATTA C10 TAATCCTGTACAGATTCACGGGTATTGCAATGGGATTGTATGTCTAATAG C11 TGAACATATACTGATTCATGGTTATTGCAATGGAATTGTTTGTGTAATAT C12 AGACAATGTAGAGCTTCACGGTTATTGCAATGGGATTGTCTGTGTAATAG C13 AGACAATGTACAGCTTTACGGTTATTGCAATGGGATTGTCTGTGTAATAG C14 AGACAATATGGAGCTTCACGGTTATTGCAATGGGATTGCCTGTGTAATAG C15 TCATGAATTAGAGATTCACGGTTATTGCGATGGGATTATTTGTGTAACAG C16 TGATAATGTATCGATTCATGGCTATTGCAATGGGATTGTCTGTCTAATAG *** **** *** *** ** : C1 CATGGAAAACTCTTCATTGGATATATGTTATTTTATGCAATCCTGCAACT C2 CAGGGAAC---------------AATTTTCTTTTATGCAATCCTGCAACG C3 CAGGGAAA---------------AATGTTCTTTTATGCAATCCTGCAACG C4 CAGGGAAA---------------AATGTTCTTTTATGCAATCCTGCAACA C5 CAGGGAAAAATCTTCATTTGATAAATATTATTTTATGCAATCCTGCAACG C6 CAGGGAAAACT------------GTTATTATTTTATGCAATCCTGGAACC C7 TAGGGGAA---------------TATTTTTTTTTGTGCAATCCTGCAACG C8 CAGGTAAA---------------AATATTCTTTTATGCAATCCTACAACG C9 CAGGTGAA---------------AATGTTGTTTTATGCAATCCTGCAATT C10 AAGGGGAT---------------AATGTTCTTCTATGCAATCCTTCAACG C11 CAGGGAAA---------------AATATTCTTTTATGCAATCCTGCAACG C12 TAGGGAAA---------------AATGTTCTTTTATGCAATCCTGCGACG C13 TAGGGGAG---------------AATGTTCTTCTATGCAATCCTGCAACA C14 TAGGGAAA---------------AATGTTCTTTTATGCAATCCTGCAACG C15 TAAACGAA---------------AATTTCTTTTTGTGCAATCCTGCAACG C16 TAGGGAAA---------------AATGCTGTTTTATACAATCCTGCAACG * . .* :* ** *.*.******* .* C1 GGGGAATTTAGGCAACTTCCCCATTCATGCCTTCTTCAACCTTCCCGTTC C2 AGGGAATTCATGCAACTTCCCGATTCATGCCTTCTTCTACCC---CCTGC C3 AAGAAATTCAGGCAACTTCCCGATTCATGTCTTCTTCTACCTTCCCCTCT C4 AGAGAATTTAGGCAACTTCCCAATTCATGCCTTCTTCTACCCCCTCCC-- C5 GGGGAATTCAGGCAACTTCCCCATTCATGCCTTCTTTTACCTTCCCGTCC C6 GGGGAATTCAGGCAACTTCCCGATTCATGCCTTCTTGTACCCCTTCCC-- C7 GGGGAATTCAGTCAACTTCCCAATTCACGCCTTCTTCTACCCCTCCCCAG C8 AGGGAATTCATGCGACTTCCCAGTTCATGCCTTCTTCTGCCTTCCCATCC C9 GGGGAATTCAGGCAACTTCCCGATTCATGCCTTCTTCTACCTGCTCCTCC C10 AGGGAATTCAGGCTACTTCCCAATTCATGCCTTCTTGTACCCCATCCC-- C11 AGGGAATTCAGGCAACTTCCTGATTCATTCCTTCTCCTACCTTCCCCTCT C12 GAAGAATTCAGGCAACTTCCTGATTCATCCCTTCTGCTACCCCTTCCC-- C13 AGAGAATTCAAGCAACTTCCCGATTCATCCCTTCTTCTACCCCTTCCC-- C14 GGAGAATTCAGGCAACTTCCCAATTCATCTCTTCTTCTACCCCTTCCC-- C15 GGGGAATTCAGGCAACTTCCTGATTCATGCCTTCTTCTACCCCTTCCCGG C16 AGGGAACTGAAGCAACTACCTGATTCATGCCTTCTTCTACCTTCCCTTCC ....** * * * ***:** .**** ***** :.** * C1 T---AGGAGAAAATTTGAATTGAACACGATCTCTACATTATTGGGATTTG C2 T---GAGGGAAAATTCGAATTGGATACAACCTTTGAAGCATTGGGATTTG C3 T---GAGGGAAAATTCAAATTGGAAACGAGCTTTCAAGCATTGGGATTCG C4 ----AAGGGAAAATTCGAGTTGGAAACGACCTTTCAAGCATTGGGATTTG C5 T---AAGGGAAAATTCGAATTGGAGACGATCTTCGGAGCATTGGGATTTG C6 ----AAGGAAAAATTCCAATTGGAGACGATTTTTGGAGGATTGGGATTTG C7 GGGAAAAGGAAAATTTGGATTGGAAACGACCGTTAAAGGATTGGGATTTG C8 C---AAGGGAAAATTCGAATTGGAAACGGTCTTTCGAGCATTAGGATTTG C9 T---GAGAGAAAATTCGAATTGGAAACGACCTTTCGGGCATTGGGATTTG C10 ----GAGGGAAAATTCGAATTGGAAACGACCTTTCACGGAATGGGTTTTG C11 C---GGTGGAAAATTCGAATTGGAGACCGATTTTGGAGGATTGGGATTTG C12 ----AAGGGAAGATTTGGATTGGAAACGGTCTTTAAGGGATTGGGATTTG C13 ----ACGGGAAAATTCGGATTGGAAACGCTCTTTAAAGGATTGGGATTTG C14 ----AAAGGAAGATTCGGATTGGAAACGACCTTTAAAGGAATGGGATTTG C15 TGTAAAAGAAAAATTCGGATTGGAAACGACACTTAAAGGACTGGGATTTG C16 G---GAGGGAAAATTCGAATTGGAATCGACCTTTCAAGGAATGGGATTTG . ..**.*** ..***.* :* * *.**:** * C1 GTTATGATTGCAAAGCTAAAGAATACAAGGTCGTGCAAGTTATTGAAAAT C2 GCTATGATTGCAAAGGCAAAGAATACAAGGTAGTGCAAATTATAGAAAAT C3 GCTATGATTGCAATGCTAAAGAATACAAGGTTGTGCGAATTATAGAAAAT C4 GCTATGACTGCAATGCTAAAGAATACAAGGTTGTGCGAATTATAGAAAAT C5 GTTATGATTGCAAAGCTAAAGAATACAAGGTTGTGCAAATTATAGAAAAT C6 GTTATGATTGCAAAGCTAAAGAATACAAGGTTGTGCAAATTATAGAAAAT C7 GCTATGATTGTAAAGCTAAAGAATACAAGGTTGTGCGAATTATAGAAAAT C8 GCTATGATTGCAAAGCTAAAGAATACAAGGTAGTGCAAATTATAGAAAAT C9 GCTATGATTGCAAAGCTAAAGAATACAAGGTTGTGCGAATTATAGAAAAT C10 GCTATGATTGCAAAGCTAATGAATACAAGGTTGTGCAAATTGTAGAAAAT C11 GCTATGATTGCAGAGCTAAAGATTACAAGGTTGTGCGAATTATAGAAAAT C12 GCTATGATTGCAAAGCTAAAGAATACAAGGTCGTGCGAATTATAGAAAAT C13 GGTATGATTGCAAAACTAAAGAATACAAGGTTGTACGAATTATAGAAAAT C14 GCTATGATTGCAAAACTAAAGAATACAAGGTTGTGCGAATTATAGAAAAT C15 GTTATGATTGCAAAGCTAAAGAATACAAGGTTGTGCGAATTATAGATAAT C16 GCTATGATAGCAAAGCTAAAGAATACAAGGTTGTGAAAATTATAGAAAAT * ***** :* *.:. **:**:******** **...*.**.*:**:*** C1 ------TGTGAGTATTCAGATGCTGAGCAATATGATTATCATCGTATTGC C2 ------TGTGAGTATTCAGATGATGAGCAAACATTTAATCATTGTACTAC C3 ------TGTGAGTATTCAGATGATGAACGAACGTTTTACAATCGTATTGC C4 ------GGTGAGTATTCAGATGATGAGCAAACATTTCATCATCGTATTGC C5 ------TGTGAGTATTCAGATGATGAGCAATACTACTATCATCGTATTGC C6 ------TGTGAGTATTCAGATGATGAGCGAACATTTTATCATAGTATTCC C7 TATGATTGTGAGTATTCAGATGGTGAAGAAACATATATTGAACATGCTGC C8 ------TCTGAGTATTCAGATGATGAGCGAACATATTATCATCGTATTCC C9 ------TGTGAATATTCTGATGATGAGCAAACATATAATCATCGTATTTC C10 ------TGTGAGTATTCGGATGATGAGCAAACATATCAACATTGTATTGC C11 ------TGTGAGTATTCAGATGATGAGCGAACATATTATCATCGTATTCC C12 TGTGATTGTGAGTATTCAGAAGGTGAAGAATCATATTATGAGCGTATTCT C13 TGTGATTGTGAGTACTCAGATGGTAAAGAATCATATATTGAGCGTATTCT C14 TGTGATTGTGAGTATTCAGAAGATGGAGAATCATACTATGAGCGTATTCT C15 TATGATTGTGAGTATTCAGATGATGGAGAAACATATATCGAGCATATTGC C16 ------TGTGAGTATTCAGATGATATGCGAACATTTTCTCATCGTATTGC ***.** ** **:* *. . .*:. : * .*. * C1 TCTTCCTCACACGGCTGAGGTATATACCACGACTGCTAACTCTTGGAGAG C2 TCTTCCTCACACGGCTGAGGTATACACCACGGCTGTTAACTCTTGGAAAG C3 TCTTCCTCACACGGCTGAGTTATACACCACACCTGCTAACTCTTGGAAAG C4 TCTTCCTCACACAGCTGAGGTATACACAACGGCTGCTAACTCTTGGAAAG C5 TCTTCCTCACACGGCTGAGGTATATACCACGGCTGCTAACTCTTGGAGGG C6 TCTTCCTCACACGGCTGAGGTATACTCCATAGCTGCTAACTCTTGGAAGG C7 TCTTCCTCACACGGCTGAGTTATACACAACAACTGCTAACTCTTGGAAAG C8 TCTTCCTCACACGGCTGAGGTATACACAACGGCTGCTAACTCTTGGAGAG C9 TCTTCCTTACACTGCTGAGGTATACACAACGACTGGTAACTCTTGGAAAG C10 TTATCCTTACACGGCTGAGGTATACACCACGGCTGCTAACTTTTGGAAAG C11 TCTGCCTCACACGGCTGAGGTATACACCATGGCTACTAACTCTTGGAAAG C12 TCTTCCTCACACGGCTGAGGTATACACCATGACTACTAACTCTTGGAAAG C13 TCTTCCTTACACGGCTGAGGTATACACCACGGCTGCTAACTCTTGGAAAG C14 TCTTCCTCACACGGCTGAGGTATACACGACGACTGCTAACTCTTGGAAAG C15 TCTTCCTCACACTGCTGAAGTATACACCATGGCTGCTAACTCTTGGAAAG C16 TCTTCCTCACACGGCTGAGGTATACGTCACAACTACTAACTCTTGGAGAG * : *** **** *****. **** * . **. ***** *****..* C1 AGATCAAGATTGATATATCAAGTGAAACC---------------TATTGT C2 AGATCAAGATTGATATATCAAGTACAACC---------------TATTCT C3 AAATCAAGATTGATATATCAAGTACAACC---------------TATTCT C4 AGATCAAGATTGATATATCAAGTCAAACT---------------TATCAT C5 AGATCAAGATTGATATATCAAGTGATACC---------------TATCAT C6 AGATTAAGATTGATATATCAACTAAAACC---------------TATCCC C7 AGATTAAGATAAATATATCAAGTAAAATATTGTCATTTTATAGCTATCCC C8 AGATCAAGATTGATATATCAACTAGAACT---------------TATTCC C9 AGATCAATATTGATGTATCAAGTAAAGCC---------------TATCCA C10 AGATCAAGATTGATATATCAAGTTCAACC---------------CATCCC C11 AGGTCAAGATTGATATATCAAGTAAAACT---------------TATCCC C12 AGATCAAGATTGATGTAACAAGTGATACT---GATCCGTATTGCATTCCT C13 AGATCAAGATTGATACATCAAGTGATACT---GATCCGTATTGCATTCCC C14 AGATTAAGATTGATATATCAATTGAAACT---CGTTGGTATTGCATTCCC C15 AGATCACGATTGATATATTAAGTAAAATATTATCATCATATAGCGAACCA C16 TGATCGAGATTGAAATATCAAGTGATACC---------------TATAAC :..* .. **:.*:. *: ** * :. :: C1 TATACTTGTTCAGTGTACTTGAATGGATTTTGTTATTGGATTGCAACCGA C2 TGGTCTTGTTCAGTGTACTTGAAGGGATTTTGTTACTGGTATGCAACAGA C3 TGTTCTCGTTCAGTGTTCATGAAGGGATTTTGTTATTGGTATGCAACGGA C4 TGTTCTTGTTCAGTGTACTTGAAGGGATTTTGTTATTGGTTTGCAAGCGA C5 TATTCTTTTTCAGTGTACTTGAAGGGATTTTGTTATTGGTTTGCAACCGA C6 AGTTCTTGTTCAGTGTACTTGAAGGGATTTTGTTATTGGTTTGCAAGCGA C7 TATTCATGTTCAGTGTACTTGAAGGGATTTTGTTATTGGTTGTCAAGCGA C8 TGTTCTTGTCAAGTGTACTTGAAGGGATTTTGTTATTGGTATGCAACGGA C9 TGTTCTTGTTCAGTGTACTTGAAGGGATTTTGTTATTGGTTTGCAACAGA C10 TATCCCTATTCTGTGTACTTGAAGGGATTTTGTTATTGGTTTGCAACGGA C11 TGTTCTTGTTCAGTGTACTTGAAGGGATTTTGTTATTGGTTTACAAGGGA C12 TATTCTTGTTCAGTGTACTTGAAGGGATTTTGTTATTGGTTTGCAATGGA C13 TATTCTTGTTCAATGTACTTGAAGGGATTTTGTTATTGGTTTGCAAACGA C14 TATTCTTGTTCAGTGTACTTGAAGGGATTTTGTTATTGGTTTGCATACGA C15 TATTCTTATTCAGTGTATTTGAAAGGGTTTTGTTATTGGTTGTCATGCGA C16 TGTTCTTGTTCAGTATACTTGAAGGAATTTTGTTATTGGTTTGCAAGCGA :. * * .:.*.*: :**** *..******** ***:: **: ** C1 TGAAGAAGATTTCATACTTTCATTTGATTTAGGTGATGAGATATTTCATA C2 TGACGAGGAATACGTACTTTCATTTGATTTATGTAATGAGACATTTCATA C3 TGGCGAGGAATACATACTTTCTTTTGATTTAGGTGATGACACATTTCATA C4 TAGCGAGGAATACATACTTTCATTTTATTTAGGTGATGAGACGTTTCATA C5 TGGCGAGAAATACATACTTTCATTTGATATAGGTGATGAGATATTTCATA C6 TGGCGAGGAATACATACTTTCATTTGATTTAGGTGATGAGATATTTCATA C7 TGACGAGGAATACATATGTTCATTTGATTTAGGTGAGGAGATATTCGATA C8 TGCTGAGGAATACATACTTTCATTTGATTTAGGTGATGAGATATTTCATA C9 TGGCGAGGAATACATACTTTCATTTGACTTAGGAGATGAGATATTTTCCA C10 TGGCGAAGAATGCATACTTTCATTTGATTTAGGTGACGAGATATTTCATA C11 TGGTGAGGAATTCATACTTTCATTTGATTTAGGCGATGAGAGATTTCATA C12 TAACGGGGAATACATATTTTCATTTGATTTAGGTGATGAGATCTTTCATA C13 TAACGGGGAATACATATTTTCATTTGATTTAGGTGATGAGATATTTCATA C14 TAACGGGGAGTACGTATTTTCATTTGATTTAGGTGATGAGATATTTAATA C15 TGTAGAGGAATACATTTTTTCATTTGATTTAGCTAATGAAATATCTGATA C16 TGgCGAGGAATACATACTTTCATTTGATTTAGGTGATGAGATATTTCATA *. *...* * *.*: ***:*** * :** .* ** * * . * C1 GAATACAATTGCCTTCTAGGAGAGACTCTGATTTTAAGTTTTCTAATCTC C2 GAATACAATTCCCTTCTAGAGGAGAATCTGGCTTTACGTTTTTTTATATT C3 TAATACAACTGCCTTCTAGGAGAGAATTCGGTTTCAGGTTTTATTATATT C4 TTATACAATTGCCTTCTAGGAGAGAATCCGGTTTTACATTTGATTATATT C5 GAATACAATTGCCTTCTAGGAAAGAATCCGATTTTGAGTTTTTAAATATT C6 GAATACAATTGCCTTCTAGGAGAGAATCCAGTTTTAAGTTTTATGATCTT C7 GGATAGAATTGCCTTCTAGGAGAGAATCTGGTTTTAAGCTTGATGGTATT C8 GAATACAATTGCCTTCTAGAAGAGAATCCGGTTTTAAGTTTTATTATATC C9 GAATACAATTGCCTGCTAGGAAAGAATCCGGTTTTAAGTTTTATAGTCTT C10 GAATACAATTGCCTTCTAAGATAGAATCCGGTTTTAACTTTTGTGGTCTT C11 GAATACAATTGCCTTCTAGGAGAGAATCCAGTTTTGAGTTTTATTATATT C12 TAATAGAATTGCCTTCTAGGAGAGATTTTGGTTTTAAGTTTTATGGTATT C13 GAATAGAATTGCCTTTTCGGAGAGAATCCGATTTTAAGTTTTGTGGTCTT C14 GAATAGAATTGCCTTCTAGGAGAGAATCCGATTTCAAGTTTTATGGTATT C15 TGATAGAATTGCCTTTTAGGGGAGAATTCGGTTTTAAGCGTGATGGTATT C16 GAATACAATTGCCTTATAGGAAAGAATCCGGTTTTTTGTTTTATGATCTT *** ** * *** *.... *** * .. ** * : .*.* C1 TTTCTGTGTAATAAATCGATTGCTTCTTTTGGTTATTGTTGCAATCCAAG C2 TTTCTTCGTAATGAATCCCTCGCTTCTTTTTGCTCTCGTTACGATCGAAG C3 TTTCTGCGAAATGAATCCCTTGCTTCTTTTTGCTCTCGTTACGAACGGAG C4 TTTCTCCGAGATGAATCCCTTGCTTCTTTTTGCTCTCCCTACAGTCCAAG C5 TTTCTATGTAATACATCGATTGCTTCTTTTTGCTCTTGTTGCGACCCAAG C6 TTTCTGTATAATGAATCCATCACTTCTTATTGCTCTCATTATGATCCAAg C7 TTTCTATATAATGAATCCATCACTTATTATTGCACTAGTTACGAAGAG-- C8 TTTCTTCGTAATGAATCCCTTGCTTCGTTTTGCTCTCGTTACGATCGAAG C9 TTTCTGTATAATGAATCAGTCACTTCTTATTGCTCTCATTACGATCCAAG C10 TTTCTTTATAATGAATCTATCACTTCTTATTGTTGTCGTTATGATCCAAG C11 TTTCTGTGTAATGAATCCATTGCTTCTTTTTGCTCTCTTTATGATCGAAG C12 TTTTTGTATAATGAATCCATCACTTCTTATTGCTCTCGTTACGAAGAG-- C13 TTTCTGTATAATGAATCCGTCGCTTCTTATTGCTCTTGTTACGAAGAG-- C14 TTTCTGTATAATGAATCCGTGACTTCGTATTGCTATCGTCACGAAGAG-- C15 TTTCTGTATAATGAATCCCTCACTTATTATTGCACTAGTTACGAAGAG-- C16 TTTCTGTATAATGAATCCATCGCTTCTTTTTGCTCTCACTATGATAAAAG *** * .:.**..*** * .***. *:* * : * . .. . C1 TGATGAGGATTCTACATTatat---------------------------- C2 TGGG---GATTCTCAATCGTGTGAAATA---------TGGGTAATGGACG C3 TGAG---GATTCTGAATCATGTGAAATA---------TGGGTAATGGACG C4 TGAG---GATTCTAAATTATTTGAAATA---------TGGGTAATGGATG C5 TGATGCGGATTCTACATTATGTGAAATA---------TGGGTAATGGATG C6 TGAG---------------------------------------------- C7 -------AGTTCCAGATTATTTGAAATA---------TGGGTAATGGATA C8 TGAT---AAGTCTGAATCATGT---------------------------- C9 CGAG---GATTCTAAATTATTTGAAATA---------TGGGTGATGGAC- C10 TGAG---GATTCTAAATTATTTGAAATA---------TGGGTAATGGATG C11 TGAA---GATTCTAAGTCATGTGAAATA---------TGGGTAATGGACG C12 -------GATTGTAAATTATTTGAAATA---------TGGGTAATGGACG C13 -------GATTGTAAATTGGTTGAAATA---------TGGGTAATGGATG C14 -------GATTGTGAATTATTTGAAATA---------TGGGTAATGGATG C15 -------CCTTCCACATTATTT---------------------------- C16 TGAC---AATTCTGGAATATTGGAAATACTTGAAATATGGGTAATGGAC- C1 -------------------------------------------------- C2 ACTATGACAGAGTGAAGAGTTCATGGACAAAACTCATAACCGTTGGACCC C3 ACTATGACAGAGTGAAAAGTTCATGGACAAAACTCTTAACCATTGGACCC C4 ACTTTGATGGAGTTAAGAGTTCATGGACAAAACTCCTAACCGTTGGACCC C5 ATTATGATGGAATTAAGAGTTCATGGACAAAACTCCTAACCTTTGGACCC C6 -------------------------------------------------- C7 TCTGTGACGGAGTTAACAGTTCATGGACAAAACATCTAACAGCTGGACCC C8 -------------------------------------------------- C9 -------------------------------------------------- C10 GGTATGGCGGAGTTAAGAATTCATGGACAAAACTCCTA------------ C11 ACTATGATGGAGTCAAGAGTTCATGGACAAAACTCCTAGTCGCTGGACCC C12 ACTATGACGGAGTTAAGAGTTCATGGACAAAATTGCTAACCATTGGACCC C13 ATTATGATGGAGTGAAGAGTTCATGGACAAAACTTCTAACCGTTGGACCC C14 GCTATGATGGAGTTAAGAGTTCATGGACAAAACTGCAAACCATTGGACCC C15 -------------------------------------------------- C16 -------------------------------------------------- C1 -------------------------------------------------- C2 TTACAAGGCATTGAGAAGCCATTGACATTTTGGAAAAATGACGAGCTTCT C3 TTACAAGGCATTAAGAAGCCATTGACATTTTGGAAAAGTGACGAGGTTCT C4 TTTAAAGGCATCGAGTATCCATTGACACTTTGGAAATGCGACGAGCTTCT C5 TTAAAAGGCATTGAGAATCCATTTACATTATGGAAAACTGATGAGCTTCT C6 -------------------------------------------------- C7 TTTAAAGGCATTGAGTTTCCATTGACACTTTGGAAACATGACGAGCTTCT C8 -------------------------------------------------- C9 -------------------------------------------------- C10 -------------------------------------------------- C11 TTTAAAGGCATTGAGAAGCCATTGACACTTTGGAAATGTGATGAGCTTCT C12 TTTAAAGACATTGATTATCCATTGACACTTGGGAAATGTGATGAGGTTCT C13 TTTAAAGACATTGAGTCTCCTTTGACATTTTGGAAATGTGACGAGGTTCT C14 CTTAAAGACATTGATTATCCATTGACACTTTGGAAATGTGACGAGATTCT C15 -------------------------------------------------- C16 -------------------------------------------------- C1 -------------------------------------------------- C2 TATGCTTGCTTCCGATGGAAGAGCCACCTCTTATAATTCTAGTACTAGAA C3 TATGCTTGACTCTGATGGAAGAGCCACCTCTTATAATTCTAATACCAGAA C4 TATGCTTGCGTCCGATGGAAGAGCCACCTCTTATAATTCTAGTACCGGAA C5 TATGGTTGCCTCCGGTGGAAGAGTCACCTCATATAATTCCAGTACCGAAA C6 -------------------------------------------------- C7 TATGATTGCCTCTGATGGAAGAGCCACATCTTATAATTCTAGTACCGGAA C8 -------------------------------------------------- C9 -------------------------------------------------- C10 -------------------------------------------------- C11 TATGATTGACACTGATGGAAGAGTCATCTCTTATAATTCTGGTATTGGAT C12 TATGCTTGGCTCGTATGGAAGAGCCGCCTTTTGTAATTCTAGTACCGGAA C13 TATCCTTTCCTCATATGGAAAAGCCACCTCTTATAATTCTAGT------- C14 TATGCTTGGCTCGTATGGAAGAGCGGCCTCTTGTAATTCTAGTACTGGAA C15 -------------------------------------------------- C16 -------------------------------------------------- C1 -------------------------------------------------- C2 ATCTGAAGTATGTTCATATTCCT--------------------------- C3 ATCTCAAGTATCTTCATATTCCT--------------------------- C4 ATCTCAAATATCTTCATATTCCT--------------------------- C5 ATCTCAACTATCTTCATATTCCT--------------------------- C6 -------------------------------------------------- C7 ATCTCAAGTATCTTTATATTCCT--------------------------- C8 -------------------------------------------------- C9 -------------------------------------------------- C10 -------------------------------------------------- C11 ATCTCACCTATCTTCATATTCCT--------------------------- C12 ATCTCAAGTATCTTCATATTCCT--------------------------- C13 -------------------------------------------------- C14 ATCTCAAGTATCTTCATATTCCC--------------------------- C15 -------------------------------------------------- C16 -------------------------------------------------- C1 -------------------------------------------------- C2 -------------------------------------------------- C3 -------------------------------------------------- C4 -------------------------------------------------- C5 -------------------------------------------------- C6 -------------------------------------------------- C7 -------------------------------------------------- C8 -------------------------------------------------- C9 -------------------------------------------------- C10 -------------------------------------------------- C11 -------------------------------------------------- C12 -------------------------------------------------- C13 -------------------------------------------------- C14 -------------------------------------------------- C15 -------------------------------------------------- C16 -------------------------------------------------- C1 -------------------------------------------------- C2 -------------------------------------------------- C3 -------------------------------------------------- C4 -------------------------------------------------- C5 -------------------------------------------------- C6 -------------------------------------------------- C7 -------------------------------------------------- C8 -------------------------------------------------- C9 -------------------------------------------------- C10 -------------------------------------------------- C11 -------------------------------------------------- C12 -------------------------------------------------- C13 -------------------------------------------------- C14 -------------------------------------------------- C15 -------------------------------------------------- C16 -------------------------------------------------- C1 -------------------------------------------------- C2 -------------------------------------------------- C3 -------------------------------------------------- C4 -------------------------------------------------- C5 -------------------------------------------------- C6 -------------------------------------------------- C7 -------------------------------------------------- C8 -------------------------------------------------- C9 -------------------------------------------------- C10 -------------------------------------------------- C11 -------------------------------------------------- C12 -------------------------------------------------- C13 -------------------------------------------------- C14 -------------------------------------------------- C15 -------------------------------------------------- C16 -------------------------------------------------- C1 -------------------------------------------------- C2 -------------------------------------------------- C3 -------------------------------------------------- C4 -------------------------------------------------- C5 -------------------------------------------------- C6 -------------------------------------------------- C7 -------------------------------------------------- C8 -------------------------------------------------- C9 -------------------------------------------------- C10 -------------------------------------------------- C11 -------------------------------------------------- C12 -------------------------------------------------- C13 -------------------------------------------------- C14 -------------------------------------------------- C15 -------------------------------------------------- C16 -------------------------------------------------- C1 -------------------------------------------------- C2 -------------------------------------------------- C3 -------------------------------------------------- C4 -------------------------------------------------- C5 -------------------------------------------------- C6 -------------------------------------------------- C7 -------------------------------------------------- C8 -------------------------------------------------- C9 -------------------------------------------------- C10 -------------------------------------------------- C11 -------------------------------------------------- C12 -------------------------------------------------- C13 -------------------------------------------------- C14 -------------------------------------------------- C15 -------------------------------------------------- C16 -------------------------------------------------- C1 -------------------------------------------------- C2 -------------------------------------------------- C3 -------------------------------------------------- C4 -------------------------------------------------- C5 -------------------------------------------------- C6 -------------------------------------------------- C7 -------------------------------------------------- C8 -------------------------------------------------- C9 -------------------------------------------------- C10 -------------------------------------------------- C11 -------------------------------------------------- C12 -------------------------------------------------- C13 -------------------------------------------------- C14 -------------------------------------------------- C15 -------------------------------------------------- C16 -------------------------------------------------- C1 -------------------------------------------------- C2 -------------------------------------------------- C3 ---------------------------------------CCTATTCTC-- C4 ---------------------------------------CCTATTCTC-- C5 ---------------------------------------CCTATCCTC-- C6 -------------------------------------------------- C7 ---------------------------------------ATTATTATCTA C8 -------------------------------------------------- C9 -------------------------------------------------- C10 -------------------------------------------------- C11 ---------------------------------------CCGATTATC-- C12 ---------------------------------------CCTATTATC-- C13 -------------------------------------------------- C14 ---------------------------------------CCTATTATC-- C15 -------------------------------------------------- C16 -------------------------------------------------- C1 -------------------------------------------------- C2 -------------------------------------------------- C3 ----AAGAGGGTTGTAGATTTCGAAGTTCTTATTTATGTGAAAAGT---- C4 ----AATAAGGTTGTAGATTTTGAA------------------------- C5 ----AATGAAGTTAGAGATTTCCAAGCTCTTATTTACATGGAAAGTATTG C6 -------------------------------------------------- C7 TAGGAATAGGGTTATAGAT---------------TACGCAAAAAGTATTG C8 -------------------------------------------------- C9 -------------------------------------------------- C10 -------------------------------------------------- C11 ----AATAGGGTCATAGATTCTCAAGCTCTTATTTATGTAGAAAGTATTG C12 ----AATGAGGTTATTGATTTCGAAGTTCTTAGTTATGTGGAAAGTATTG C13 -------------------------------------------------- C14 ----AATTGGATGATAGAC---------------TATGTGAAAAGTATTG C15 -------------------------------------------------- C16 -------------------------------------------------- C1 -------------------------------------------------- C2 -------------------------------------------------- C3 -------------------------------------------------- C4 -------------------------------------------------- C5 TTCCAGTCAAG--------------------------------------- C6 -------------------------------------------------- C7 TTCCAGTTAAGCGAGTTGAGGGCAAAGTTCCATTTTCTCCTATT------ C8 -------------------------------------------------- C9 -------------------------------------------------- C10 -------------------------------------------------- C11 TTCCAGTCAAG--------------------------------------- C12 TTCCGATCAAG--------------------------------------- C13 -------------------------------------------------- C14 TTCCAGTCAAG--------------------------------------- C15 -------------------------------------------------- C16 -------------------------------------------------- C1 -------------------------------------------------- C2 -------------------------------------------------- C3 -------------------------------------------------- C4 -------------------------------------------------- C5 -------------------------------------------------- C6 -------------------------------------------------- C7 -------------------------------------------------- C8 -------------------------------------------------- C9 -------------------------------------------------- C10 -------------------------------------------------- C11 -------------------------------------------------- C12 -------------------------------------------------- C13 -------------------------------------------------- C14 -------------------------------------------------- C15 -------------------------------------------------- C16 -------------------------------------------------- C1 -------------------------------------------------- C2 -------------------------------------------------- C3 -------------------------------------------------- C4 -------------------------------------------------- C5 -------------------------------------------------- C6 -------------------------------------------------- C7 -------------------------------------------------- C8 -------------------------------------------------- C9 -------------------------------------------------- C10 -------------------------------------------------- C11 -------------------------------------------------- C12 -------------------------------------------------- C13 -------------------------------------------------- C14 -------------------------------------------------- C15 -------------------------------------------------- C16 -------------------------------------------------- C1 -------------------------------------------------- C2 -------------------------------------------------- C3 -------------------------------------------------- C4 -------------------------------------------------- C5 -------------------------------------------------- C6 -------------------------------------------------- C7 -------------------------------------------------- C8 -------------------------------------------------- C9 -------------------------------------------------- C10 -------------------------------------------------- C11 -------------------------------------------------- C12 -------------------------------------------------- C13 -------------------------------------------------- C14 -------------------------------------------------- C15 -------------------------------------------------- C16 -------------------------------------------------- C1 ------------------------------------ C2 ------------------------------------ C3 ------------------------------------ C4 ------------------------------------ C5 ------------------------------------ C6 ------------------------------------ C7 ------------------------------------ C8 ------------------------------------ C9 ------------------------------------ C10 ------------------------------------ C11 ------------------------------------ C12 ------------------------------------ C13 ------------------------------------ C14 ------------------------------------ C15 ------------------------------------ C16 ------------------------------------ >C1 -------------------------------------------------- -------------------------------------AAATGCATACGCA AGTCTTGGTGCACTCTCATCAATACTCCAAGTTTTGTTGCCAAACACCTC AACAATTCTATGAACAACAAACTATCgTCCTCCACTTGCATCCTTCTCAA CCGTTGTCAGAATCATGTTTTCCCGGATAGAAGTTGGAAACCAGAAGTTT TCTGGTCCATAATTAATCTTTCCATTGATAGCGATGATCACAACCTTCAT TATGATGCTGAGGACCTC---AATATACCGTGTCCATTG---GAAGGTCA TGATTTTGTAGAGATTGGTGGCTATTGCAATGGGATTGTCTGTGTACTAG CATGGAAAACTCTTCATTGGATATATGTTATTTTATGCAATCCTGCAACT GGGGAATTTAGGCAACTTCCCCATTCATGCCTTCTTCAACCTTCCCGTTC T---AGGAGAAAATTTGAATTGAACACGATCTCTACATTATTGGGATTTG GTTATGATTGCAAAGCTAAAGAATACAAGGTCGTGCAAGTTATTGAAAAT ------TGTGAGTATTCAGATGCTGAGCAATATGATTATCATCGTATTGC TCTTCCTCACACGGCTGAGGTATATACCACGACTGCTAACTCTTGGAGAG AGATCAAGATTGATATATCAAGTGAAACC---------------TATTGT TATACTTGTTCAGTGTACTTGAATGGATTTTGTTATTGGATTGCAACCGA TGAAGAAGATTTCATACTTTCATTTGATTTAGGTGATGAGATATTTCATA GAATACAATTGCCTTCTAGGAGAGACTCTGATTTTAAGTTTTCTAATCTC TTTCTGTGTAATAAATCGATTGCTTCTTTTGGTTATTGTTGCAATCCAAG TGATGAGGATTCTACATTatat---------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------ >C2 -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------TGCAATGGGATTGTATGTGTAATAG CAGGGAAC---------------AATTTTCTTTTATGCAATCCTGCAACG AGGGAATTCATGCAACTTCCCGATTCATGCCTTCTTCTACCC---CCTGC T---GAGGGAAAATTCGAATTGGATACAACCTTTGAAGCATTGGGATTTG GCTATGATTGCAAAGGCAAAGAATACAAGGTAGTGCAAATTATAGAAAAT ------TGTGAGTATTCAGATGATGAGCAAACATTTAATCATTGTACTAC TCTTCCTCACACGGCTGAGGTATACACCACGGCTGTTAACTCTTGGAAAG AGATCAAGATTGATATATCAAGTACAACC---------------TATTCT TGGTCTTGTTCAGTGTACTTGAAGGGATTTTGTTACTGGTATGCAACAGA TGACGAGGAATACGTACTTTCATTTGATTTATGTAATGAGACATTTCATA GAATACAATTCCCTTCTAGAGGAGAATCTGGCTTTACGTTTTTTTATATT TTTCTTCGTAATGAATCCCTCGCTTCTTTTTGCTCTCGTTACGATCGAAG TGGG---GATTCTCAATCGTGTGAAATA---------TGGGTAATGGACG ACTATGACAGAGTGAAGAGTTCATGGACAAAACTCATAACCGTTGGACCC TTACAAGGCATTGAGAAGCCATTGACATTTTGGAAAAATGACGAGCTTCT TATGCTTGCTTCCGATGGAAGAGCCACCTCTTATAATTCTAGTACTAGAA ATCTGAAGTATGTTCATATTCCT--------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------ >C3 -------------------------------------------------- ----------------------TCTCTGATGCGGTTCAAATGCATACACA AGTCTTGGTTCTCTCTCATCAATAGTCTAAGTTTTGTGGCCAAACACCTC AGCAATTCCGTGGACAACAAACTCTCATCCTCCGCTTGTATCCTTCTCAA CCGTTCTCAGCCTCACATTTTCCCAGACCAGAGTTGGAAACAAGAAGTTT TCTGGTGCGTGATTAATTTTTCCATTGATAGTGATGAGAACAACCTTCAT TATGATGTTGAGGACCTA---ACTATACCGTTTCCATTG---AAAGATCA TGACTTTGTACTGATTTTTGGTTATTGCAATGGGATTGTCTGTGTAGAAG CAGGGAAA---------------AATGTTCTTTTATGCAATCCTGCAACG AAGAAATTCAGGCAACTTCCCGATTCATGTCTTCTTCTACCTTCCCCTCT T---GAGGGAAAATTCAAATTGGAAACGAGCTTTCAAGCATTGGGATTCG GCTATGATTGCAATGCTAAAGAATACAAGGTTGTGCGAATTATAGAAAAT ------TGTGAGTATTCAGATGATGAACGAACGTTTTACAATCGTATTGC TCTTCCTCACACGGCTGAGTTATACACCACACCTGCTAACTCTTGGAAAG AAATCAAGATTGATATATCAAGTACAACC---------------TATTCT TGTTCTCGTTCAGTGTTCATGAAGGGATTTTGTTATTGGTATGCAACGGA TGGCGAGGAATACATACTTTCTTTTGATTTAGGTGATGACACATTTCATA TAATACAACTGCCTTCTAGGAGAGAATTCGGTTTCAGGTTTTATTATATT TTTCTGCGAAATGAATCCCTTGCTTCTTTTTGCTCTCGTTACGAACGGAG TGAG---GATTCTGAATCATGTGAAATA---------TGGGTAATGGACG ACTATGACAGAGTGAAAAGTTCATGGACAAAACTCTTAACCATTGGACCC TTACAAGGCATTAAGAAGCCATTGACATTTTGGAAAAGTGACGAGGTTCT TATGCTTGACTCTGATGGAAGAGCCACCTCTTATAATTCTAATACCAGAA ATCTCAAGTATCTTCATATTCCT--------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ---------------------------------------CCTATTCTC-- ----AAGAGGGTTGTAGATTTCGAAGTTCTTATTTATGTGAAAAGT---- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------ >C4 -------------------------------------------------- -------------------------------------AAATGCATACGCA AGTCTTGGTGCACTCTCATCAATAGTCCAAGTTTTGTAGCCAAACACCTC AACAATTCTAtGGACAACGAACTCTCATCCTCCACTTGTATCCTTCTCAA CCGTTCTCAGGCTCACATTTTCCCAGACCAGAGTTGGAAACAAGAAGTTT TCTGGtCCACGATTAATCTTTCTATTGATAGTGATGAGCATAACCTTCAT TATGATGTTGAGGACCTA---ATTATACCGTTTCCATTG---GAAGATCA TGATTTTGTACTGATTTTTGGTTATTGCAATGGGATTATCTGTGTAGATG CAGGGAAA---------------AATGTTCTTTTATGCAATCCTGCAACA AGAGAATTTAGGCAACTTCCCAATTCATGCCTTCTTCTACCCCCTCCC-- ----AAGGGAAAATTCGAGTTGGAAACGACCTTTCAAGCATTGGGATTTG GCTATGACTGCAATGCTAAAGAATACAAGGTTGTGCGAATTATAGAAAAT ------GGTGAGTATTCAGATGATGAGCAAACATTTCATCATCGTATTGC TCTTCCTCACACAGCTGAGGTATACACAACGGCTGCTAACTCTTGGAAAG AGATCAAGATTGATATATCAAGTCAAACT---------------TATCAT TGTTCTTGTTCAGTGTACTTGAAGGGATTTTGTTATTGGTTTGCAAGCGA TAGCGAGGAATACATACTTTCATTTTATTTAGGTGATGAGACGTTTCATA TTATACAATTGCCTTCTAGGAGAGAATCCGGTTTTACATTTGATTATATT TTTCTCCGAGATGAATCCCTTGCTTCTTTTTGCTCTCCCTACAGTCCAAG TGAG---GATTCTAAATTATTTGAAATA---------TGGGTAATGGATG ACTTTGATGGAGTTAAGAGTTCATGGACAAAACTCCTAACCGTTGGACCC TTTAAAGGCATCGAGTATCCATTGACACTTTGGAAATGCGACGAGCTTCT TATGCTTGCGTCCGATGGAAGAGCCACCTCTTATAATTCTAGTACCGGAA ATCTCAAATATCTTCATATTCCT--------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ---------------------------------------CCTATTCTC-- ----AATAAGGTTGTAGATTTTGAA------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------ >C5 ATGTTCGAGGTGCGTGAAAGTAAAACTCCTGAAGATATGGTGGTTGAAAT CATGTCTAAGTTGCCGCCCAAGTCTCTAATGCGATTCAAATGCATACGCA AGTCTTGGTGCACTCTCATCAATAGTCCAAGTTTTGTGGCCAAACACCTC AACAATTCCGTGGATAACAAACTATCATCTTCCACTTGCATCCTTCTCAA CCGTTCTCAGGCTCATGTTTTCCCAGATAACAGTTGGAAACCAGAAGTTT TCTGGTCCATGATTAATCTTTCCATCGATAGTAACGAGCACAACCTTCAT TATGACGTTGAGAACCTA---AATATACCGTTTCCATTG---GAAGGTCA TGATTTTGTAGAAATTGATGGCTATTGCCATGGGATTGTCTGTGTAATAG CAGGGAAAAATCTTCATTTGATAAATATTATTTTATGCAATCCTGCAACG GGGGAATTCAGGCAACTTCCCCATTCATGCCTTCTTTTACCTTCCCGTCC T---AAGGGAAAATTCGAATTGGAGACGATCTTCGGAGCATTGGGATTTG GTTATGATTGCAAAGCTAAAGAATACAAGGTTGTGCAAATTATAGAAAAT ------TGTGAGTATTCAGATGATGAGCAATACTACTATCATCGTATTGC TCTTCCTCACACGGCTGAGGTATATACCACGGCTGCTAACTCTTGGAGGG AGATCAAGATTGATATATCAAGTGATACC---------------TATCAT TATTCTTTTTCAGTGTACTTGAAGGGATTTTGTTATTGGTTTGCAACCGA TGGCGAGAAATACATACTTTCATTTGATATAGGTGATGAGATATTTCATA GAATACAATTGCCTTCTAGGAAAGAATCCGATTTTGAGTTTTTAAATATT TTTCTATGTAATACATCGATTGCTTCTTTTTGCTCTTGTTGCGACCCAAG TGATGCGGATTCTACATTATGTGAAATA---------TGGGTAATGGATG ATTATGATGGAATTAAGAGTTCATGGACAAAACTCCTAACCTTTGGACCC TTAAAAGGCATTGAGAATCCATTTACATTATGGAAAACTGATGAGCTTCT TATGGTTGCCTCCGGTGGAAGAGTCACCTCATATAATTCCAGTACCGAAA ATCTCAACTATCTTCATATTCCT--------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ---------------------------------------CCTATCCTC-- ----AATGAAGTTAGAGATTTCCAAGCTCTTATTTACATGGAAAGTATTG TTCCAGTCAAG--------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------ >C6 -------------------------------------------------- -------------------AAGTCCCTGATGCGATTCAAATGCACACGCA AGTCTTGGTGCACTCTCATCAATAGTTCAAGCTTTGTTGCCAAACACCTC AGCAACTCCGTAGACAACATACTCTCATCCTCCACTTGTATCCTGCTCAA CCGTTCTCAGATGCCGGTTTTCCCAGACAAAAGTTGGAAATATGAAATTT TATGGTCCATGATTTATCTTTCCATTTATAGTGATGAGCACAGCTATCAT TATGATGTTGAGGACCTA---AACATACCCTTTCCATTA---GAGGATCA TCATCCTGTACAGATTCACGGTTATTGCAATGGGATTGTCTGTGTAATAG CAGGGAAAACT------------GTTATTATTTTATGCAATCCTGGAACC GGGGAATTCAGGCAACTTCCCGATTCATGCCTTCTTGTACCCCTTCCC-- ----AAGGAAAAATTCCAATTGGAGACGATTTTTGGAGGATTGGGATTTG GTTATGATTGCAAAGCTAAAGAATACAAGGTTGTGCAAATTATAGAAAAT ------TGTGAGTATTCAGATGATGAGCGAACATTTTATCATAGTATTCC TCTTCCTCACACGGCTGAGGTATACTCCATAGCTGCTAACTCTTGGAAGG AGATTAAGATTGATATATCAACTAAAACC---------------TATCCC AGTTCTTGTTCAGTGTACTTGAAGGGATTTTGTTATTGGTTTGCAAGCGA TGGCGAGGAATACATACTTTCATTTGATTTAGGTGATGAGATATTTCATA GAATACAATTGCCTTCTAGGAGAGAATCCAGTTTTAAGTTTTATGATCTT TTTCTGTATAATGAATCCATCACTTCTTATTGCTCTCATTATGATCCAAg TGAG---------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------ >C7 ---------------GAAAGTGAAGCTCCTGAAGATAGGGTGGTCGAAAT CCTGTCCAGGTTGCCGCCCAAGTCTCTGATGCGATTCAAATGCATACGCA AGTCTTGGTACACGCTCATCAATAGTCCTCGTTTTGTGGCCAAACACCTC AACAATTCCGTGGACAACAAACTATCATCCTCCACATGTATCCTTCTCCA CCGTTCTCAGATGCCCATTTTCCCTTACGACAGTTGGAAACGAGAATTTT TCTGGTCCATGATTAATTTTTCCATTGATAGTGATGAGAGCAACCTTCAT TATGATGTTGAGGACCTTACAAATGTACCGTTATTGCAATGGGAAGACCA TCATGAAGTAGAGATTCACGGTTATTGCAATGGGATTGTCTGTGTAACAG TAGGGGAA---------------TATTTTTTTTTGTGCAATCCTGCAACG GGGGAATTCAGTCAACTTCCCAATTCACGCCTTCTTCTACCCCTCCCCAG GGGAAAAGGAAAATTTGGATTGGAAACGACCGTTAAAGGATTGGGATTTG GCTATGATTGTAAAGCTAAAGAATACAAGGTTGTGCGAATTATAGAAAAT TATGATTGTGAGTATTCAGATGGTGAAGAAACATATATTGAACATGCTGC TCTTCCTCACACGGCTGAGTTATACACAACAACTGCTAACTCTTGGAAAG AGATTAAGATAAATATATCAAGTAAAATATTGTCATTTTATAGCTATCCC TATTCATGTTCAGTGTACTTGAAGGGATTTTGTTATTGGTTGTCAAGCGA TGACGAGGAATACATATGTTCATTTGATTTAGGTGAGGAGATATTCGATA GGATAGAATTGCCTTCTAGGAGAGAATCTGGTTTTAAGCTTGATGGTATT TTTCTATATAATGAATCCATCACTTATTATTGCACTAGTTACGAAGAG-- -------AGTTCCAGATTATTTGAAATA---------TGGGTAATGGATA TCTGTGACGGAGTTAACAGTTCATGGACAAAACATCTAACAGCTGGACCC TTTAAAGGCATTGAGTTTCCATTGACACTTTGGAAACATGACGAGCTTCT TATGATTGCCTCTGATGGAAGAGCCACATCTTATAATTCTAGTACCGGAA ATCTCAAGTATCTTTATATTCCT--------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ---------------------------------------ATTATTATCTA TAGGAATAGGGTTATAGAT---------------TACGCAAAAAGTATTG TTCCAGTTAAGCGAGTTGAGGGCAAAGTTCCATTTTCTCCTATT------ -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------ >C8 ATGTTCGAGGTGCGTGAAAGTAAAACTCCTGAAGATATGGTGGTTGAAAT CATGTCTAAGTTGCCGCCCAAGTCTCTAATGCGATTCAAATGCATACGCA AGTCTTGGTGCACTCTCATCAATAGTCCAAGTTTTGTGGCCAAACACCTC AACAATTCCGTGGATAACAAACTATCATCTTCCACTTGCATCCTTCTCAA CCGTTCTCAGACTCATGTTTTCCCAGACAATAGTTGGAAACAAGAAGTTT TCTGGTCCATGATCAATATTTCTATTGATAGTGATGAGCACAACCTTCAT TATGATGTTGAGGACCTA---AATATACCATTTCCGCTG---GAAGATCA GGATTACGTATTGATTCTCGGTTATTGCAATGGGATTGTTTGTGTATCAG CAGGTAAA---------------AATATTCTTTTATGCAATCCTACAACG AGGGAATTCATGCGACTTCCCAGTTCATGCCTTCTTCTGCCTTCCCATCC C---AAGGGAAAATTCGAATTGGAAACGGTCTTTCGAGCATTAGGATTTG GCTATGATTGCAAAGCTAAAGAATACAAGGTAGTGCAAATTATAGAAAAT ------TCTGAGTATTCAGATGATGAGCGAACATATTATCATCGTATTCC TCTTCCTCACACGGCTGAGGTATACACAACGGCTGCTAACTCTTGGAGAG AGATCAAGATTGATATATCAACTAGAACT---------------TATTCC TGTTCTTGTCAAGTGTACTTGAAGGGATTTTGTTATTGGTATGCAACGGA TGCTGAGGAATACATACTTTCATTTGATTTAGGTGATGAGATATTTCATA GAATACAATTGCCTTCTAGAAGAGAATCCGGTTTTAAGTTTTATTATATC TTTCTTCGTAATGAATCCCTTGCTTCGTTTTGCTCTCGTTACGATCGAAG TGAT---AAGTCTGAATCATGT---------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------ >C9 -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------------CTTCTCAA CCGTTCTGAAATGCCCGTTTTCCCGGACGACAGTTGGAAGTATGAAGTTT TATGGTCCATGATTAATCTTTCCATTGATAGTGATGATCACaACCTTCAT TATAATGTTGAGGACCTA---AATATACCGTTTCCAATG---GAATACCA TCATCCTGTATTGATTCACGGTTATTGCGATGGTATTTTCTGTGTAATTA CAGGTGAA---------------AATGTTGTTTTATGCAATCCTGCAATT GGGGAATTCAGGCAACTTCCCGATTCATGCCTTCTTCTACCTGCTCCTCC T---GAGAGAAAATTCGAATTGGAAACGACCTTTCGGGCATTGGGATTTG GCTATGATTGCAAAGCTAAAGAATACAAGGTTGTGCGAATTATAGAAAAT ------TGTGAATATTCTGATGATGAGCAAACATATAATCATCGTATTTC TCTTCCTTACACTGCTGAGGTATACACAACGACTGGTAACTCTTGGAAAG AGATCAATATTGATGTATCAAGTAAAGCC---------------TATCCA TGTTCTTGTTCAGTGTACTTGAAGGGATTTTGTTATTGGTTTGCAACAGA TGGCGAGGAATACATACTTTCATTTGACTTAGGAGATGAGATATTTTCCA GAATACAATTGCCTGCTAGGAAAGAATCCGGTTTTAAGTTTTATAGTCTT TTTCTGTATAATGAATCAGTCACTTCTTATTGCTCTCATTACGATCCAAG CGAG---GATTCTAAATTATTTGAAATA---------TGGGTGATGGAC- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------ >C10 -------------------------------------------------- -------------------------------------AAATGCATACGCA AGTCTTGGTGCACTCTCATCATTAGTACAAGTTTTGTTGCCAAACACCTC AGCAATTCCTTGGACTACAAACACTCATCCTCCACTTGTATCCTTCTTAA CCGTTCTCAGTTTCACATTTTCCCGGATCAGAGTTGGAAACGTGAAGTTT TATGGTCCATGATTAATCTTTCCAGTGATAGTGATGTGCACAACCTTCAT TATGATGTTAAGCCCTTA---AATATACCGTTTTCTAGG---GATGACCA TAATCCTGTACAGATTCACGGGTATTGCAATGGGATTGTATGTCTAATAG AAGGGGAT---------------AATGTTCTTCTATGCAATCCTTCAACG AGGGAATTCAGGCTACTTCCCAATTCATGCCTTCTTGTACCCCATCCC-- ----GAGGGAAAATTCGAATTGGAAACGACCTTTCACGGAATGGGTTTTG GCTATGATTGCAAAGCTAATGAATACAAGGTTGTGCAAATTGTAGAAAAT ------TGTGAGTATTCGGATGATGAGCAAACATATCAACATTGTATTGC TTATCCTTACACGGCTGAGGTATACACCACGGCTGCTAACTTTTGGAAAG AGATCAAGATTGATATATCAAGTTCAACC---------------CATCCC TATCCCTATTCTGTGTACTTGAAGGGATTTTGTTATTGGTTTGCAACGGA TGGCGAAGAATGCATACTTTCATTTGATTTAGGTGACGAGATATTTCATA GAATACAATTGCCTTCTAAGATAGAATCCGGTTTTAACTTTTGTGGTCTT TTTCTTTATAATGAATCTATCACTTCTTATTGTTGTCGTTATGATCCAAG TGAG---GATTCTAAATTATTTGAAATA---------TGGGTAATGGATG GGTATGGCGGAGTTAAGAATTCATGGACAAAACTCCTA------------ -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------ >C11 ATGTCCCAGGTGCGTGAAACTGAAACTCCTGAAGATAGGGTGGTCGCAAT CATGTCCAAGTTGCCGCCCAAGTCTCTGATGCGATTCAAATGCATACGCA AGTCTTGGTGCACTCTCATCAATAATCCAAGTTTTGTGGCCAAACACCTC AGCAATTCTGTGGTCAACAATTTCTCATCCTACACTTGTATCCTCCTCAA CCGTTCTCAGGTTCACGTTTTCCCGGACAAGAGTTGGAAACATGAAGTTT TATGGTCCATGATTAATTTTTTTAATGATAGAGTTTCACGCACCCTTTAT TATAATGTTGAGGACCTA---AATATACCGTTTCCAAGG---GATGACCA TGAACATATACTGATTCATGGTTATTGCAATGGAATTGTTTGTGTAATAT CAGGGAAA---------------AATATTCTTTTATGCAATCCTGCAACG AGGGAATTCAGGCAACTTCCTGATTCATTCCTTCTCCTACCTTCCCCTCT C---GGTGGAAAATTCGAATTGGAGACCGATTTTGGAGGATTGGGATTTG GCTATGATTGCAGAGCTAAAGATTACAAGGTTGTGCGAATTATAGAAAAT ------TGTGAGTATTCAGATGATGAGCGAACATATTATCATCGTATTCC TCTGCCTCACACGGCTGAGGTATACACCATGGCTACTAACTCTTGGAAAG AGGTCAAGATTGATATATCAAGTAAAACT---------------TATCCC TGTTCTTGTTCAGTGTACTTGAAGGGATTTTGTTATTGGTTTACAAGGGA TGGTGAGGAATTCATACTTTCATTTGATTTAGGCGATGAGAGATTTCATA GAATACAATTGCCTTCTAGGAGAGAATCCAGTTTTGAGTTTTATTATATT TTTCTGTGTAATGAATCCATTGCTTCTTTTTGCTCTCTTTATGATCGAAG TGAA---GATTCTAAGTCATGTGAAATA---------TGGGTAATGGACG ACTATGATGGAGTCAAGAGTTCATGGACAAAACTCCTAGTCGCTGGACCC TTTAAAGGCATTGAGAAGCCATTGACACTTTGGAAATGTGATGAGCTTCT TATGATTGACACTGATGGAAGAGTCATCTCTTATAATTCTGGTATTGGAT ATCTCACCTATCTTCATATTCCT--------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ---------------------------------------CCGATTATC-- ----AATAGGGTCATAGATTCTCAAGCTCTTATTTATGTAGAAAGTATTG TTCCAGTCAAG--------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------ >C12 ---------------------GAAACTCCAGAAGATCAGGTGGTCGAAAT CCTGTCCAGGTTGCCACCCAAGTCTCTAATGAGATTCAAATGTATACGTA AGTCTTGGTGCACTATCATCAATAGTTCAAGTTTTGTGGCCAAACACCTC AGCAATTCCATAGACAACAAACTCTCATCCTCCACTTGTATCCTTCTTAA CCGTTGTCAGGTTCATGTTTTCCCGGATAGGAATTGGAAACAAGACGTTT TCTGGTCCATGATTAATCTTTCCATTGATGGTGATAAGAATAACCTTCAT TACGATGTTGAGGACCTA---AATATACCATTTCCAATG---GAAGATCA AGACAATGTAGAGCTTCACGGTTATTGCAATGGGATTGTCTGTGTAATAG TAGGGAAA---------------AATGTTCTTTTATGCAATCCTGCGACG GAAGAATTCAGGCAACTTCCTGATTCATCCCTTCTGCTACCCCTTCCC-- ----AAGGGAAGATTTGGATTGGAAACGGTCTTTAAGGGATTGGGATTTG GCTATGATTGCAAAGCTAAAGAATACAAGGTCGTGCGAATTATAGAAAAT TGTGATTGTGAGTATTCAGAAGGTGAAGAATCATATTATGAGCGTATTCT TCTTCCTCACACGGCTGAGGTATACACCATGACTACTAACTCTTGGAAAG AGATCAAGATTGATGTAACAAGTGATACT---GATCCGTATTGCATTCCT TATTCTTGTTCAGTGTACTTGAAGGGATTTTGTTATTGGTTTGCAATGGA TAACGGGGAATACATATTTTCATTTGATTTAGGTGATGAGATCTTTCATA TAATAGAATTGCCTTCTAGGAGAGATTTTGGTTTTAAGTTTTATGGTATT TTTTTGTATAATGAATCCATCACTTCTTATTGCTCTCGTTACGAAGAG-- -------GATTGTAAATTATTTGAAATA---------TGGGTAATGGACG ACTATGACGGAGTTAAGAGTTCATGGACAAAATTGCTAACCATTGGACCC TTTAAAGACATTGATTATCCATTGACACTTGGGAAATGTGATGAGGTTCT TATGCTTGGCTCGTATGGAAGAGCCGCCTTTTGTAATTCTAGTACCGGAA ATCTCAAGTATCTTCATATTCCT--------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ---------------------------------------CCTATTATC-- ----AATGAGGTTATTGATTTCGAAGTTCTTAGTTATGTGGAAAGTATTG TTCCGATCAAG--------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------ >C13 ATGTCCCAGGTGCATGAAAGTGAAACTCCTGAAGATAAGGTGGTCGAAAT CTTGTCAAGGTTGTCGCCCAAGTCCCTGATGAGATTCAAATGCGTACACA AATCATGGTGCACTATCATCAATAGTCCAAGTTTTGTGGCCAAACACCTC AGCAATACCGTGGACAACAAATTCTCATCCTGCACTCGCATCCTTTTCAA CCGATGTCAGGTTCATGTCTTCCCGGACAGGAGTTGGAAAAGAGATGTTT TCTGGTCTATGATTAATCTTTCCATTGATAGTGATGAGCACAACCTTCGT TATGATGTCGAGGACCGA---AATATACCCTTTCCTATA---GAAGTTCA AGACAATGTACAGCTTTACGGTTATTGCAATGGGATTGTCTGTGTAATAG TAGGGGAG---------------AATGTTCTTCTATGCAATCCTGCAACA AGAGAATTCAAGCAACTTCCCGATTCATCCCTTCTTCTACCCCTTCCC-- ----ACGGGAAAATTCGGATTGGAAACGCTCTTTAAAGGATTGGGATTTG GGTATGATTGCAAAACTAAAGAATACAAGGTTGTACGAATTATAGAAAAT TGTGATTGTGAGTACTCAGATGGTAAAGAATCATATATTGAGCGTATTCT TCTTCCTTACACGGCTGAGGTATACACCACGGCTGCTAACTCTTGGAAAG AGATCAAGATTGATACATCAAGTGATACT---GATCCGTATTGCATTCCC TATTCTTGTTCAATGTACTTGAAGGGATTTTGTTATTGGTTTGCAAACGA TAACGGGGAATACATATTTTCATTTGATTTAGGTGATGAGATATTTCATA GAATAGAATTGCCTTTTCGGAGAGAATCCGATTTTAAGTTTTGTGGTCTT TTTCTGTATAATGAATCCGTCGCTTCTTATTGCTCTTGTTACGAAGAG-- -------GATTGTAAATTGGTTGAAATA---------TGGGTAATGGATG ATTATGATGGAGTGAAGAGTTCATGGACAAAACTTCTAACCGTTGGACCC TTTAAAGACATTGAGTCTCCTTTGACATTTTGGAAATGTGACGAGGTTCT TATCCTTTCCTCATATGGAAAAGCCACCTCTTATAATTCTAGT------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------ >C14 -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ---------------AgCAAACTCTCATCCACCGCTTGTATCCTTCTCAA CCGTTGTCAGGtTCATGTTTTCCCGGACAGGaGTTGGAAACAAGACGTTT TCTGGTCCATGATTAATCTTTCCATTGATAGTGATGAGCACAACCTTCAT TATGATGTTGAGGACCTA---AATATACCGTTTCCAATG---GAAGATCA AGACAATATGGAGCTTCACGGTTATTGCAATGGGATTGCCTGTGTAATAG TAGGGAAA---------------AATGTTCTTTTATGCAATCCTGCAACG GGAGAATTCAGGCAACTTCCCAATTCATCTCTTCTTCTACCCCTTCCC-- ----AAAGGAAGATTCGGATTGGAAACGACCTTTAAAGGAATGGGATTTG GCTATGATTGCAAAACTAAAGAATACAAGGTTGTGCGAATTATAGAAAAT TGTGATTGTGAGTATTCAGAAGATGGAGAATCATACTATGAGCGTATTCT TCTTCCTCACACGGCTGAGGTATACACGACGACTGCTAACTCTTGGAAAG AGATTAAGATTGATATATCAATTGAAACT---CGTTGGTATTGCATTCCC TATTCTTGTTCAGTGTACTTGAAGGGATTTTGTTATTGGTTTGCATACGA TAACGGGGAGTACGTATTTTCATTTGATTTAGGTGATGAGATATTTAATA GAATAGAATTGCCTTCTAGGAGAGAATCCGATTTCAAGTTTTATGGTATT TTTCTGTATAATGAATCCGTGACTTCGTATTGCTATCGTCACGAAGAG-- -------GATTGTGAATTATTTGAAATA---------TGGGTAATGGATG GCTATGATGGAGTTAAGAGTTCATGGACAAAACTGCAAACCATTGGACCC CTTAAAGACATTGATTATCCATTGACACTTTGGAAATGTGACGAGATTCT TATGCTTGGCTCGTATGGAAGAGCGGCCTCTTGTAATTCTAGTACTGGAA ATCTCAAGTATCTTCATATTCCC--------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ---------------------------------------CCTATTATC-- ----AATTGGATGATAGAC---------------TATGTGAAAAGTATTG TTCCAGTCAAG--------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------ >C15 ATGTCCCAGGTGCGTGAATGTGAAACTCCTGAAGATAGGATGGTTGAAAT CTTGTCCAGGTTGCCACCTAAGTCTCTGATGCGATTCAAATGCATACGCA AATCTTGGTGCACTCTTTTCAATAGTCCATGTTTTGTGGCCAAACACCTC AGCGATTCTGTGGACAACAAACTCTCATCCTCCACTTGTATCCTTCTCAA CTGTTCTCAGGCTCACGTTTGCTCGGAAGAGAGTTGGAAACAAGGAGTTT TATGGTCCGTGATTAATCTTTCCATTGATGGTGATGAA------CTTCAT TATGGTATTGAGGACCTAACTAATGTACCGTTTCTAAGG---GATGACCA TCATGAATTAGAGATTCACGGTTATTGCGATGGGATTATTTGTGTAACAG TAAACGAA---------------AATTTCTTTTTGTGCAATCCTGCAACG GGGGAATTCAGGCAACTTCCTGATTCATGCCTTCTTCTACCCCTTCCCGG TGTAAAAGAAAAATTCGGATTGGAAACGACACTTAAAGGACTGGGATTTG GTTATGATTGCAAAGCTAAAGAATACAAGGTTGTGCGAATTATAGATAAT TATGATTGTGAGTATTCAGATGATGGAGAAACATATATCGAGCATATTGC TCTTCCTCACACTGCTGAAGTATACACCATGGCTGCTAACTCTTGGAAAG AGATCACGATTGATATATTAAGTAAAATATTATCATCATATAGCGAACCA TATTCTTATTCAGTGTATTTGAAAGGGTTTTGTTATTGGTTGTCATGCGA TGTAGAGGAATACATTTTTTCATTTGATTTAGCTAATGAAATATCTGATA TGATAGAATTGCCTTTTAGGGGAGAATTCGGTTTTAAGCGTGATGGTATT TTTCTGTATAATGAATCCCTCACTTATTATTGCACTAGTTACGAAGAG-- -------CCTTCCACATTATTT---------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------ >C16 -------------------------------------------------- -------------------AAGTCTCTGATGCGGTTCAAATGTATACGCA AGTCTTGGTGCACGGTCATCAACAATCCAAGTTTTATTGCCAAACACCTC AGCAATTCCGTTGACAACAAGTTCTCATCCTCCACTTGTATCCTTCTCCA CCGTTCTCAGATGCCCGTTTTCCCGGACAGAAGTTGGAAACGAGAATATT TCTGGTCCATGATTAATCTTTCCCATGATAGTGATGAGCACAACCTTTAT TATGATGTTGAGGACCTG---AATATACAATTTCCATTA---GAAGATCA TGATAATGTATCGATTCATGGCTATTGCAATGGGATTGTCTGTCTAATAG TAGGGAAA---------------AATGCTGTTTTATACAATCCTGCAACG AGGGAACTGAAGCAACTACCTGATTCATGCCTTCTTCTACCTTCCCTTCC G---GAGGGAAAATTCGAATTGGAATCGACCTTTCAAGGAATGGGATTTG GCTATGATAGCAAAGCTAAAGAATACAAGGTTGTGAAAATTATAGAAAAT ------TGTGAGTATTCAGATGATATGCGAACATTTTCTCATCGTATTGC TCTTCCTCACACGGCTGAGGTATACGTCACAACTACTAACTCTTGGAGAG TGATCGAGATTGAAATATCAAGTGATACC---------------TATAAC TGTTCTTGTTCAGTATACTTGAAGGAATTTTGTTATTGGTTTGCAAGCGA TGgCGAGGAATACATACTTTCATTTGATTTAGGTGATGAGATATTTCATA GAATACAATTGCCTTATAGGAAAGAATCCGGTTTTTTGTTTTATGATCTT TTTCTGTATAATGAATCCATCGCTTCTTTTTGCTCTCACTATGATAAAAG TGAC---AATTCTGGAATATTGGAAATACTTGAAATATGGGTAATGGAC- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------ >C1 oooooooooooooooooooooooooooooKCIRKSWCTLINTPSFVAKHL NNSMNNKLSSSTCILLNRCQNHVFPDRSWKPEVFWSIINLSIDSDDHNLH YDAEDLoNIPCPLoEGHDFVEIGGYCNGIVCVLAWKTLHWIYVILCNPAT GEFRQLPHSCLLQPSRSoRRKFELNTISTLLGFGYDCKAKEYKVVQVIEN ooCEYSDAEQYDYHRIALPHTAEVYTTTANSWREIKIDISSEToooooYC YTCSVYLNGFCYWIATDEEDFILSFDLGDEIFHRIQLPSRRDSDFKFSNL FLCNKSIASFGYCCNPSDEDSTLyoooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooo >C2 oooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooCNGIVCVIAGNoooooNFLLCNPAT REFMQLPDSCLLLPoPAoEGKFELDTTFEALGFGYDCKGKEYKVVQIIEN ooCEYSDDEQTFNHCTTLPHTAEVYTTAVNSWKEIKIDISSTToooooYS WSCSVYLKGFCYWYATDDEEYVLSFDLCNETFHRIQFPSRGESGFTFFYI FLRNESLASFCSRYDRSGoDSQSCEIoooWVMDDYDRVKSSWTKLITVGP LQGIEKPLTFWKNDELLMLASDGRATSYNSSTRNLKYVHIPooooooooo oooooooooooooooooooooooooo >C3 ooooooooooooooooooooooooSLMRFKCIHKSWFSLINSLSFVAKHL SNSVDNKLSSSACILLNRSQPHIFPDQSWKQEVFWCVINFSIDSDENNLH YDVEDLoTIPFPLoKDHDFVLIFGYCNGIVCVEAGKoooooNVLLCNPAT KKFRQLPDSCLLLPSPLoEGKFKLETSFQALGFGYDCNAKEYKVVRIIEN ooCEYSDDERTFYNRIALPHTAELYTTPANSWKEIKIDISSTToooooYS CSRSVFMKGFCYWYATDGEEYILSFDLGDDTFHIIQLPSRREFGFRFYYI FLRNESLASFCSRYERSEoDSESCEIoooWVMDDYDRVKSSWTKLLTIGP LQGIKKPLTFWKSDEVLMLDSDGRATSYNSNTRNLKYLHIPPILooKRVV DFEVLIYVKSoooooooooooooooo >C4 oooooooooooooooooooooooooooooKCIRKSWCTLINSPSFVAKHL NNSMDNELSSSTCILLNRSQAHIFPDQSWKQEVFWsTINLSIDSDEHNLH YDVEDLoIIPFPLoEDHDFVLIFGYCNGIICVDAGKoooooNVLLCNPAT REFRQLPNSCLLLPPPooKGKFELETTFQALGFGYDCNAKEYKVVRIIEN ooGEYSDDEQTFHHRIALPHTAEVYTTAANSWKEIKIDISSQToooooYH CSCSVYLKGFCYWFASDSEEYILSFYLGDETFHIIQLPSRRESGFTFDYI FLRDESLASFCSPYSPSEoDSKLFEIoooWVMDDFDGVKSSWTKLLTVGP FKGIEYPLTLWKCDELLMLASDGRATSYNSSTGNLKYLHIPPILooNKVV DFEooooooooooooooooooooooo >C5 MFEVRESKTPEDMVVEIMSKLPPKSLMRFKCIRKSWCTLINSPSFVAKHL NNSVDNKLSSSTCILLNRSQAHVFPDNSWKPEVFWSMINLSIDSNEHNLH YDVENLoNIPFPLoEGHDFVEIDGYCHGIVCVIAGKNLHLINIILCNPAT GEFRQLPHSCLLLPSRPoKGKFELETIFGALGFGYDCKAKEYKVVQIIEN ooCEYSDDEQYYYHRIALPHTAEVYTTAANSWREIKIDISSDToooooYH YSFSVYLKGFCYWFATDGEKYILSFDIGDEIFHRIQLPSRKESDFEFLNI FLCNTSIASFCSCCDPSDADSTLCEIoooWVMDDYDGIKSSWTKLLTFGP LKGIENPFTLWKTDELLMVASGGRVTSYNSSTENLNYLHIPPILooNEVR DFQALIYMESIVPVKooooooooooo >C6 oooooooooooooooooooooooKSLMRFKCTRKSWCTLINSSSFVAKHL SNSVDNILSSSTCILLNRSQMPVFPDKSWKYEILWSMIYLSIYSDEHSYH YDVEDLoNIPFPLoEDHHPVQIHGYCNGIVCVIAGKTooooVIILCNPGT GEFRQLPDSCLLVPLPooKEKFQLETIFGGLGFGYDCKAKEYKVVQIIEN ooCEYSDDERTFYHSIPLPHTAEVYSIAANSWKEIKIDISTKToooooYP SSCSVYLKGFCYWFASDGEEYILSFDLGDEIFHRIQLPSRRESSFKFYDL FLYNESITSYCSHYDPSEoooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooo >C7 oooooESEAPEDRVVEILSRLPPKSLMRFKCIRKSWYTLINSPRFVAKHL NNSVDNKLSSSTCILLHRSQMPIFPYDSWKREFFWSMINFSIDSDESNLH YDVEDLTNVPLLQWEDHHEVEIHGYCNGIVCVTVGEoooooYFFLCNPAT GEFSQLPNSRLLLPLPRGKGKFGLETTVKGLGFGYDCKAKEYKVVRIIEN YDCEYSDGEETYIEHAALPHTAELYTTTANSWKEIKINISSKILSFYSYP YSCSVYLKGFCYWLSSDDEEYICSFDLGEEIFDRIELPSRRESGFKLDGI FLYNESITYYCTSYEEoooSSRLFEIoooWVMDICDGVNSSWTKHLTAGP FKGIEFPLTLWKHDELLMIASDGRATSYNSSTGNLKYLYIPIIIYRNRVI DoooooYAKSIVPVKRVEGKVPFSPI >C8 MFEVRESKTPEDMVVEIMSKLPPKSLMRFKCIRKSWCTLINSPSFVAKHL NNSVDNKLSSSTCILLNRSQTHVFPDNSWKQEVFWSMINISIDSDEHNLH YDVEDLoNIPFPLoEDQDYVLILGYCNGIVCVSAGKoooooNILLCNPTT REFMRLPSSCLLLPSHPoKGKFELETVFRALGFGYDCKAKEYKVVQIIEN ooSEYSDDERTYYHRIPLPHTAEVYTTAANSWREIKIDISTRToooooYS CSCQVYLKGFCYWYATDAEEYILSFDLGDEIFHRIQLPSRRESGFKFYYI FLRNESLASFCSRYDRSDoKSESCoooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooo >C9 oooooooooooooooooooooooooooooooooooooooooooooooooo ooooooooooooooLLNRSEMPVFPDDSWKYEVLWSMINLSIDSDDHnLH YNVEDLoNIPFPMoEYHHPVLIHGYCDGIFCVITGEoooooNVVLCNPAI GEFRQLPDSCLLLPAPPoERKFELETTFRALGFGYDCKAKEYKVVRIIEN ooCEYSDDEQTYNHRISLPYTAEVYTTTGNSWKEINIDVSSKAoooooYP CSCSVYLKGFCYWFATDGEEYILSFDLGDEIFSRIQLPARKESGFKFYSL FLYNESVTSYCSHYDPSEoDSKLFEIoooWVMDooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooo >C10 oooooooooooooooooooooooooooooKCIRKSWCTLIISTSFVAKHL SNSLDYKHSSSTCILLNRSQFHIFPDQSWKREVLWSMINLSSDSDVHNLH YDVKPLoNIPFSRoDDHNPVQIHGYCNGIVCLIEGDoooooNVLLCNPST REFRLLPNSCLLVPHPooEGKFELETTFHGMGFGYDCKANEYKVVQIVEN ooCEYSDDEQTYQHCIAYPYTAEVYTTAANFWKEIKIDISSSToooooHP YPYSVYLKGFCYWFATDGEECILSFDLGDEIFHRIQLPSKIESGFNFCGL FLYNESITSYCCRYDPSEoDSKLFEIoooWVMDGYGGVKNSWTKLLoooo oooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooo >C11 MSQVRETETPEDRVVAIMSKLPPKSLMRFKCIRKSWCTLINNPSFVAKHL SNSVVNNFSSYTCILLNRSQVHVFPDKSWKHEVLWSMINFFNDRVSRTLY YNVEDLoNIPFPRoDDHEHILIHGYCNGIVCVISGKoooooNILLCNPAT REFRQLPDSFLLLPSPLoGGKFELETDFGGLGFGYDCRAKDYKVVRIIEN ooCEYSDDERTYYHRIPLPHTAEVYTMATNSWKEVKIDISSKToooooYP CSCSVYLKGFCYWFTRDGEEFILSFDLGDERFHRIQLPSRRESSFEFYYI FLCNESIASFCSLYDRSEoDSKSCEIoooWVMDDYDGVKSSWTKLLVAGP FKGIEKPLTLWKCDELLMIDTDGRVISYNSGIGYLTYLHIPPIIooNRVI DSQALIYVESIVPVKooooooooooo >C12 oooooooETPEDQVVEILSRLPPKSLMRFKCIRKSWCTIINSSSFVAKHL SNSIDNKLSSSTCILLNRCQVHVFPDRNWKQDVFWSMINLSIDGDKNNLH YDVEDLoNIPFPMoEDQDNVELHGYCNGIVCVIVGKoooooNVLLCNPAT EEFRQLPDSSLLLPLPooKGRFGLETVFKGLGFGYDCKAKEYKVVRIIEN CDCEYSEGEESYYERILLPHTAEVYTMTTNSWKEIKIDVTSDToDPYCIP YSCSVYLKGFCYWFAMDNGEYIFSFDLGDEIFHIIELPSRRDFGFKFYGI FLYNESITSYCSRYEEoooDCKLFEIoooWVMDDYDGVKSSWTKLLTIGP FKDIDYPLTLGKCDEVLMLGSYGRAAFCNSSTGNLKYLHIPPIIooNEVI DFEVLSYVESIVPIKooooooooooo >C13 MSQVHESETPEDKVVEILSRLSPKSLMRFKCVHKSWCTIINSPSFVAKHL SNTVDNKFSSCTRILFNRCQVHVFPDRSWKRDVFWSMINLSIDSDEHNLR YDVEDRoNIPFPIoEVQDNVQLYGYCNGIVCVIVGEoooooNVLLCNPAT REFKQLPDSSLLLPLPooTGKFGLETLFKGLGFGYDCKTKEYKVVRIIEN CDCEYSDGKESYIERILLPYTAEVYTTAANSWKEIKIDTSSDToDPYCIP YSCSMYLKGFCYWFANDNGEYIFSFDLGDEIFHRIELPFRRESDFKFCGL FLYNESVASYCSCYEEoooDCKLVEIoooWVMDDYDGVKSSWTKLLTVGP FKDIESPLTFWKCDEVLILSSYGKATSYNSSooooooooooooooooooo oooooooooooooooooooooooooo >C14 oooooooooooooooooooooooooooooooooooooooooooooooooo oooooSKLSSTACILLNRCQVHVFPDRsWKQDVFWSMINLSIDSDEHNLH YDVEDLoNIPFPMoEDQDNMELHGYCNGIACVIVGKoooooNVLLCNPAT GEFRQLPNSSLLLPLPooKGRFGLETTFKGMGFGYDCKTKEYKVVRIIEN CDCEYSEDGESYYERILLPHTAEVYTTTANSWKEIKIDISIEToRWYCIP YSCSVYLKGFCYWFAYDNGEYVFSFDLGDEIFNRIELPSRRESDFKFYGI FLYNESVTSYCYRHEEoooDCELFEIoooWVMDGYDGVKSSWTKLQTIGP LKDIDYPLTLWKCDEILMLGSYGRAASCNSSTGNLKYLHIPPIIooNWMI DoooooYVKSIVPVKooooooooooo >C15 MSQVRECETPEDRMVEILSRLPPKSLMRFKCIRKSWCTLFNSPCFVAKHL SDSVDNKLSSSTCILLNCSQAHVCSEESWKQGVLWSVINLSIDGDEooLH YGIEDLTNVPFLRoDDHHELEIHGYCDGIICVTVNEoooooNFFLCNPAT GEFRQLPDSCLLLPLPGVKEKFGLETTLKGLGFGYDCKAKEYKVVRIIDN YDCEYSDDGETYIEHIALPHTAEVYTMAANSWKEITIDILSKILSSYSEP YSYSVYLKGFCYWLSCDVEEYIFSFDLANEISDMIELPFRGEFGFKRDGI FLYNESLTYYCTSYEEoooPSTLFoooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooo >C16 oooooooooooooooooooooooKSLMRFKCIRKSWCTVINNPSFIAKHL SNSVDNKFSSSTCILLHRSQMPVFPDRSWKREYFWSMINLSHDSDEHNLY YDVEDLoNIQFPLoEDHDNVSIHGYCNGIVCLIVGKoooooNAVLYNPAT RELKQLPDSCLLLPSLPoEGKFELESTFQGMGFGYDSKAKEYKVVKIIEN ooCEYSDDMRTFSHRIALPHTAEVYVTTTNSWRVIEIEISSDToooooYN CSCSVYLKEFCYWFASDGEEYILSFDLGDEIFHRIQLPYRKESGFLFYDL FLYNESIASFCSHYDKSDoNSGILEILEIWVMDooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooo MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS1/revmuscle/S5/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 16 taxa and 1836 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Taxon 7 -> C7 Taxon 8 -> C8 Taxon 9 -> C9 Taxon 10 -> C10 Taxon 11 -> C11 Taxon 12 -> C12 Taxon 13 -> C13 Taxon 14 -> C14 Taxon 15 -> C15 Taxon 16 -> C16 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1509753860 Setting output file names to "/opt/ADOPS1/revmuscle/S5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 763541547 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 8380179775 Seed = 1282826691 Swapseed = 1509753860 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 274 unique site patterns Division 2 has 239 unique site patterns Division 3 has 274 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -9226.599882 -- -27.253948 Chain 2 -- -9062.331986 -- -27.253948 Chain 3 -- -9165.244106 -- -27.253948 Chain 4 -- -8987.954240 -- -27.253948 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -9250.385713 -- -27.253948 Chain 2 -- -9318.806113 -- -27.253948 Chain 3 -- -9259.307847 -- -27.253948 Chain 4 -- -9148.268700 -- -27.253948 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-9226.600] (-9062.332) (-9165.244) (-8987.954) * [-9250.386] (-9318.806) (-9259.308) (-9148.269) 500 -- (-7772.680) [-7590.803] (-7637.486) (-7624.595) * (-7656.793) (-7649.163) (-7627.861) [-7611.453] -- 0:33:19 1000 -- (-7552.880) (-7490.012) [-7463.011] (-7454.498) * (-7536.104) (-7518.969) (-7532.659) [-7507.938] -- 0:33:18 1500 -- (-7454.218) (-7463.495) (-7458.143) [-7426.022] * [-7471.347] (-7458.881) (-7467.550) (-7501.574) -- 0:22:11 2000 -- (-7445.346) (-7452.613) [-7441.008] (-7432.179) * [-7441.368] (-7447.678) (-7446.595) (-7462.594) -- 0:24:57 2500 -- (-7448.947) (-7428.828) [-7434.365] (-7432.198) * (-7440.225) (-7437.431) [-7431.338] (-7447.424) -- 0:26:36 3000 -- (-7434.909) (-7428.455) (-7429.843) [-7428.483] * (-7454.089) (-7438.273) [-7435.114] (-7424.738) -- 0:27:41 3500 -- (-7440.926) [-7425.902] (-7433.720) (-7432.230) * (-7436.856) (-7432.605) (-7437.863) [-7434.764] -- 0:28:28 4000 -- [-7433.170] (-7430.432) (-7441.506) (-7443.607) * [-7432.926] (-7433.152) (-7430.594) (-7443.172) -- 0:29:03 4500 -- [-7427.262] (-7441.819) (-7427.424) (-7438.307) * [-7428.322] (-7434.499) (-7432.951) (-7427.100) -- 0:25:48 5000 -- (-7435.541) [-7431.112] (-7423.800) (-7432.530) * (-7438.712) (-7430.566) [-7440.541] (-7427.440) -- 0:26:32 Average standard deviation of split frequencies: 0.111304 5500 -- (-7432.096) (-7441.997) (-7433.293) [-7431.542] * (-7436.940) (-7426.705) (-7434.216) [-7435.126] -- 0:27:07 6000 -- [-7429.640] (-7433.571) (-7434.000) (-7432.968) * (-7441.742) [-7424.169] (-7438.665) (-7440.370) -- 0:27:36 6500 -- (-7426.171) [-7431.652] (-7439.993) (-7428.561) * (-7431.049) [-7434.426] (-7435.946) (-7429.477) -- 0:28:01 7000 -- (-7435.507) (-7428.913) (-7447.222) [-7429.895] * (-7440.025) [-7424.666] (-7432.637) (-7427.120) -- 0:28:22 7500 -- (-7438.289) [-7427.743] (-7431.793) (-7425.960) * (-7446.378) (-7421.903) [-7423.144] (-7430.720) -- 0:26:28 8000 -- (-7445.297) [-7423.556] (-7438.218) (-7430.586) * (-7433.171) (-7436.650) [-7423.880] (-7430.916) -- 0:26:52 8500 -- (-7436.378) (-7425.972) (-7431.932) [-7430.992] * [-7432.833] (-7430.690) (-7424.608) (-7431.514) -- 0:27:13 9000 -- [-7428.425] (-7431.203) (-7436.162) (-7437.548) * (-7432.858) [-7424.284] (-7427.105) (-7436.143) -- 0:27:31 9500 -- [-7425.219] (-7434.145) (-7439.567) (-7437.827) * (-7433.619) [-7420.748] (-7429.437) (-7433.407) -- 0:27:48 10000 -- (-7426.923) (-7438.861) [-7430.777] (-7437.837) * (-7436.268) (-7437.701) [-7423.631] (-7441.344) -- 0:28:03 Average standard deviation of split frequencies: 0.035908 10500 -- (-7431.697) (-7437.427) [-7430.414] (-7428.673) * (-7438.500) (-7435.521) [-7432.334] (-7439.004) -- 0:28:16 11000 -- (-7445.284) [-7430.099] (-7431.024) (-7426.697) * (-7428.497) (-7440.328) [-7425.527] (-7431.125) -- 0:26:58 11500 -- [-7424.762] (-7437.850) (-7436.857) (-7429.068) * (-7435.459) (-7431.728) [-7435.699] (-7431.798) -- 0:27:13 12000 -- (-7438.160) (-7432.096) [-7431.146] (-7439.474) * [-7432.523] (-7434.537) (-7440.125) (-7434.245) -- 0:27:26 12500 -- (-7423.914) [-7429.271] (-7438.281) (-7430.720) * (-7446.766) [-7438.671] (-7430.497) (-7438.212) -- 0:27:39 13000 -- (-7428.205) [-7433.944] (-7441.672) (-7439.994) * (-7430.140) [-7428.322] (-7423.825) (-7430.576) -- 0:27:50 13500 -- (-7427.035) (-7429.330) (-7427.023) [-7424.937] * (-7428.586) [-7428.985] (-7437.997) (-7429.953) -- 0:28:00 14000 -- (-7439.603) [-7436.658] (-7421.089) (-7435.367) * (-7420.383) (-7427.919) (-7439.422) [-7433.494] -- 0:26:59 14500 -- (-7438.917) (-7443.725) (-7430.187) [-7420.985] * [-7429.624] (-7439.164) (-7429.980) (-7442.521) -- 0:27:11 15000 -- (-7429.860) [-7432.158] (-7435.946) (-7426.339) * [-7431.886] (-7435.165) (-7432.121) (-7442.739) -- 0:27:21 Average standard deviation of split frequencies: 0.045061 15500 -- (-7431.590) (-7424.360) [-7427.763] (-7430.048) * (-7443.338) (-7444.190) (-7428.750) [-7433.741] -- 0:27:31 16000 -- (-7429.708) (-7427.483) [-7431.658] (-7430.943) * (-7433.667) [-7430.412] (-7433.535) (-7426.333) -- 0:27:40 16500 -- (-7432.085) (-7430.866) (-7430.226) [-7431.470] * (-7441.019) [-7425.449] (-7444.364) (-7425.284) -- 0:27:48 17000 -- [-7429.037] (-7428.706) (-7437.705) (-7434.651) * (-7444.322) [-7430.360] (-7441.522) (-7429.902) -- 0:26:59 17500 -- (-7441.501) (-7425.841) [-7429.603] (-7442.010) * (-7430.185) [-7430.233] (-7441.617) (-7431.708) -- 0:27:08 18000 -- (-7447.644) (-7435.333) [-7428.988] (-7436.659) * [-7434.894] (-7434.704) (-7443.868) (-7428.658) -- 0:27:16 18500 -- (-7432.963) (-7433.689) [-7426.024] (-7434.951) * (-7434.574) (-7428.505) (-7441.340) [-7430.610] -- 0:27:24 19000 -- (-7436.625) (-7440.283) (-7431.186) [-7433.554] * (-7429.209) [-7426.552] (-7433.475) (-7436.416) -- 0:27:32 19500 -- (-7436.912) (-7440.612) [-7429.686] (-7430.386) * (-7436.367) (-7427.508) [-7434.012] (-7427.982) -- 0:27:39 20000 -- (-7433.360) [-7433.116] (-7427.173) (-7426.842) * [-7429.454] (-7432.198) (-7433.302) (-7431.283) -- 0:27:46 Average standard deviation of split frequencies: 0.036227 20500 -- [-7431.015] (-7432.717) (-7431.055) (-7433.200) * [-7427.121] (-7422.182) (-7434.631) (-7429.976) -- 0:27:04 21000 -- (-7438.870) [-7435.872] (-7434.316) (-7440.905) * (-7433.304) (-7431.489) (-7442.832) [-7424.135] -- 0:27:11 21500 -- (-7445.352) (-7438.273) [-7425.444] (-7445.434) * (-7438.852) (-7426.034) (-7432.718) [-7430.211] -- 0:27:18 22000 -- (-7442.206) [-7429.341] (-7429.212) (-7433.472) * (-7433.748) (-7427.473) (-7433.365) [-7424.769] -- 0:27:24 22500 -- [-7426.182] (-7437.140) (-7429.299) (-7431.996) * (-7438.744) (-7426.140) (-7433.982) [-7417.951] -- 0:27:30 23000 -- (-7431.180) (-7445.297) [-7429.828] (-7444.805) * (-7432.661) (-7434.687) (-7432.437) [-7427.967] -- 0:27:36 23500 -- [-7432.601] (-7429.496) (-7435.967) (-7443.734) * (-7442.501) (-7438.579) (-7433.400) [-7436.586] -- 0:27:42 24000 -- (-7429.593) [-7424.620] (-7431.781) (-7445.378) * (-7433.485) (-7444.483) (-7436.306) [-7424.629] -- 0:27:06 24500 -- (-7429.142) (-7444.257) (-7434.487) [-7436.606] * (-7439.036) (-7438.303) (-7437.369) [-7429.337] -- 0:27:12 25000 -- [-7426.743] (-7431.169) (-7438.767) (-7438.145) * (-7440.031) (-7439.149) (-7441.514) [-7437.378] -- 0:27:18 Average standard deviation of split frequencies: 0.028796 25500 -- (-7424.796) (-7431.794) [-7430.184] (-7438.060) * (-7437.684) (-7429.527) (-7432.933) [-7427.565] -- 0:27:23 26000 -- (-7446.242) (-7432.295) (-7432.769) [-7428.541] * (-7437.621) [-7427.261] (-7438.299) (-7433.078) -- 0:27:28 26500 -- (-7436.099) (-7447.714) (-7425.407) [-7440.722] * (-7437.369) (-7424.569) [-7427.591] (-7442.660) -- 0:27:33 27000 -- (-7427.739) (-7443.207) [-7431.810] (-7437.310) * (-7448.377) (-7431.434) (-7430.967) [-7429.969] -- 0:27:01 27500 -- (-7431.416) (-7441.688) (-7435.752) [-7422.571] * (-7451.117) [-7431.308] (-7431.942) (-7438.635) -- 0:27:06 28000 -- [-7428.130] (-7428.716) (-7424.809) (-7433.440) * (-7456.365) (-7435.048) [-7426.671] (-7432.825) -- 0:27:11 28500 -- (-7442.475) (-7440.815) [-7437.366] (-7433.511) * (-7443.744) [-7423.689] (-7440.671) (-7434.204) -- 0:27:16 29000 -- (-7430.380) [-7424.793] (-7429.655) (-7434.976) * (-7436.272) (-7432.403) (-7426.138) [-7432.435] -- 0:27:20 29500 -- (-7431.255) [-7426.048] (-7440.281) (-7433.572) * (-7440.441) (-7437.122) [-7427.088] (-7432.636) -- 0:27:24 30000 -- (-7440.160) [-7430.252] (-7433.586) (-7442.706) * (-7437.091) (-7426.787) [-7429.780] (-7435.672) -- 0:26:56 Average standard deviation of split frequencies: 0.018085 30500 -- (-7434.363) (-7442.291) [-7438.004] (-7435.275) * (-7439.216) (-7431.496) [-7426.319] (-7428.553) -- 0:27:01 31000 -- (-7436.465) [-7433.054] (-7433.164) (-7432.298) * (-7429.169) [-7427.030] (-7429.739) (-7439.719) -- 0:27:05 31500 -- (-7446.481) [-7430.048] (-7434.348) (-7431.716) * (-7430.765) (-7428.241) [-7431.793] (-7428.104) -- 0:27:09 32000 -- (-7431.778) [-7427.629] (-7445.689) (-7437.667) * (-7433.839) (-7424.243) (-7438.854) [-7429.375] -- 0:27:13 32500 -- [-7431.995] (-7429.830) (-7432.334) (-7436.399) * (-7432.803) (-7439.640) (-7443.367) [-7438.454] -- 0:27:17 33000 -- (-7436.299) [-7425.889] (-7432.577) (-7439.756) * [-7432.932] (-7436.713) (-7458.006) (-7445.622) -- 0:27:20 33500 -- (-7426.673) (-7428.545) (-7441.412) [-7424.042] * (-7434.872) (-7437.035) [-7430.277] (-7430.694) -- 0:27:24 34000 -- (-7450.001) [-7432.969] (-7433.733) (-7424.604) * (-7432.611) (-7428.832) [-7431.253] (-7427.737) -- 0:27:27 34500 -- (-7444.780) [-7427.092] (-7428.866) (-7441.766) * [-7421.666] (-7444.133) (-7437.038) (-7438.268) -- 0:27:31 35000 -- (-7441.819) [-7434.651] (-7435.745) (-7446.024) * (-7439.067) (-7440.799) (-7441.478) [-7434.101] -- 0:27:34 Average standard deviation of split frequencies: 0.016946 35500 -- [-7429.767] (-7443.197) (-7440.286) (-7441.392) * [-7425.075] (-7439.122) (-7434.263) (-7439.367) -- 0:27:37 36000 -- (-7442.549) (-7438.686) [-7444.405] (-7441.141) * (-7431.309) [-7424.755] (-7432.098) (-7432.578) -- 0:27:40 36500 -- (-7433.615) (-7433.648) [-7439.292] (-7442.702) * [-7429.752] (-7424.412) (-7435.543) (-7435.085) -- 0:27:43 37000 -- (-7430.247) (-7429.427) (-7433.174) [-7431.643] * (-7427.907) (-7430.922) (-7426.381) [-7428.938] -- 0:27:45 37500 -- [-7425.288] (-7434.779) (-7427.948) (-7429.214) * (-7424.178) [-7433.220] (-7437.681) (-7426.960) -- 0:27:22 38000 -- (-7437.144) (-7428.091) [-7438.895] (-7437.437) * [-7426.125] (-7441.566) (-7429.545) (-7428.221) -- 0:27:25 38500 -- (-7430.486) (-7430.975) (-7448.444) [-7427.940] * (-7434.913) [-7430.195] (-7427.763) (-7437.615) -- 0:27:28 39000 -- (-7431.182) [-7438.118] (-7443.357) (-7433.911) * (-7434.294) (-7439.598) [-7428.298] (-7444.349) -- 0:27:30 39500 -- (-7427.531) (-7438.724) (-7434.116) [-7428.927] * [-7437.416] (-7437.461) (-7420.811) (-7448.036) -- 0:27:33 40000 -- (-7439.245) (-7440.933) (-7429.906) [-7431.372] * (-7439.451) [-7431.964] (-7426.421) (-7450.203) -- 0:27:36 Average standard deviation of split frequencies: 0.012274 40500 -- (-7443.303) (-7438.022) [-7431.668] (-7426.059) * (-7445.337) [-7426.938] (-7445.101) (-7446.767) -- 0:27:38 41000 -- (-7429.549) [-7427.625] (-7435.203) (-7434.073) * (-7435.139) (-7435.515) (-7455.471) [-7430.827] -- 0:27:17 41500 -- (-7436.537) [-7430.057] (-7440.166) (-7432.352) * [-7430.972] (-7445.315) (-7438.624) (-7426.563) -- 0:27:19 42000 -- (-7432.969) (-7421.731) (-7431.217) [-7434.675] * (-7429.979) (-7444.455) (-7442.801) [-7424.351] -- 0:27:22 42500 -- [-7434.752] (-7422.007) (-7425.743) (-7424.520) * (-7431.729) (-7440.542) [-7431.684] (-7430.037) -- 0:27:24 43000 -- [-7428.451] (-7430.534) (-7432.132) (-7431.355) * [-7428.754] (-7435.671) (-7442.266) (-7434.654) -- 0:27:26 43500 -- (-7434.552) [-7425.022] (-7438.055) (-7434.323) * [-7432.754] (-7435.563) (-7431.222) (-7437.749) -- 0:27:29 44000 -- [-7424.926] (-7426.953) (-7440.453) (-7427.815) * (-7442.768) (-7436.905) [-7435.167] (-7426.386) -- 0:27:09 44500 -- (-7426.591) [-7429.819] (-7441.057) (-7436.406) * (-7436.332) (-7435.726) [-7434.059] (-7441.980) -- 0:27:11 45000 -- (-7442.389) (-7435.234) (-7430.330) [-7425.704] * (-7432.837) [-7445.271] (-7440.000) (-7450.249) -- 0:27:14 Average standard deviation of split frequencies: 0.010817 45500 -- (-7432.009) [-7438.515] (-7432.877) (-7431.678) * [-7427.662] (-7430.506) (-7429.582) (-7440.194) -- 0:27:16 46000 -- (-7438.412) (-7437.300) (-7433.412) [-7427.888] * [-7432.574] (-7430.207) (-7446.076) (-7446.598) -- 0:27:18 46500 -- (-7430.844) (-7454.239) (-7428.937) [-7436.296] * [-7426.724] (-7437.078) (-7443.619) (-7442.429) -- 0:27:20 47000 -- (-7428.166) (-7440.846) (-7431.498) [-7428.472] * [-7426.603] (-7428.111) (-7431.824) (-7447.983) -- 0:27:22 47500 -- (-7431.222) (-7435.999) [-7426.632] (-7423.825) * [-7433.225] (-7442.089) (-7425.612) (-7427.525) -- 0:27:24 48000 -- [-7435.885] (-7430.728) (-7427.997) (-7433.995) * (-7436.299) (-7428.527) (-7432.449) [-7436.035] -- 0:27:26 48500 -- (-7425.347) (-7432.966) [-7435.180] (-7429.934) * (-7435.352) [-7425.805] (-7436.158) (-7432.766) -- 0:27:27 49000 -- (-7432.445) [-7431.394] (-7434.917) (-7433.314) * (-7430.689) [-7432.539] (-7444.698) (-7426.366) -- 0:27:29 49500 -- (-7426.591) (-7426.543) (-7438.627) [-7434.650] * (-7433.897) (-7432.238) (-7432.673) [-7422.672] -- 0:27:31 50000 -- [-7431.343] (-7437.250) (-7435.986) (-7436.871) * (-7445.468) (-7431.728) (-7427.608) [-7427.888] -- 0:27:33 Average standard deviation of split frequencies: 0.017057 50500 -- (-7436.219) (-7433.406) [-7433.176] (-7444.988) * [-7441.147] (-7431.460) (-7434.431) (-7432.778) -- 0:27:34 51000 -- (-7443.373) [-7440.493] (-7433.872) (-7440.099) * (-7433.856) (-7427.493) [-7436.299] (-7425.926) -- 0:27:36 51500 -- [-7432.888] (-7434.097) (-7438.134) (-7436.193) * (-7438.402) (-7437.997) [-7431.243] (-7428.477) -- 0:27:19 52000 -- [-7434.920] (-7438.512) (-7426.310) (-7451.484) * (-7434.971) (-7435.064) (-7429.071) [-7424.537] -- 0:27:20 52500 -- (-7441.522) (-7432.165) [-7431.663] (-7434.920) * [-7432.843] (-7429.110) (-7434.279) (-7435.036) -- 0:27:22 53000 -- (-7423.834) (-7434.737) (-7436.517) [-7431.780] * (-7427.238) (-7435.950) (-7439.149) [-7432.534] -- 0:27:23 53500 -- (-7438.400) [-7425.619] (-7432.037) (-7429.192) * (-7429.521) (-7435.040) [-7428.311] (-7432.144) -- 0:27:25 54000 -- (-7436.274) [-7433.039] (-7427.719) (-7435.368) * [-7423.582] (-7434.350) (-7432.191) (-7436.819) -- 0:27:26 54500 -- [-7428.740] (-7435.259) (-7427.088) (-7437.189) * (-7426.845) (-7429.020) (-7430.599) [-7435.156] -- 0:27:28 55000 -- (-7444.087) [-7437.432] (-7435.078) (-7441.104) * (-7423.784) (-7430.920) (-7430.716) [-7428.046] -- 0:27:29 Average standard deviation of split frequencies: 0.020302 55500 -- (-7447.377) (-7438.921) [-7434.256] (-7428.008) * [-7432.446] (-7430.161) (-7429.018) (-7431.873) -- 0:27:30 56000 -- (-7441.229) (-7437.526) [-7424.438] (-7436.802) * (-7428.503) [-7429.891] (-7440.416) (-7439.963) -- 0:27:32 56500 -- (-7438.283) (-7438.645) [-7427.988] (-7427.603) * [-7431.136] (-7441.525) (-7437.318) (-7431.907) -- 0:27:33 57000 -- (-7427.940) [-7427.729] (-7433.556) (-7435.450) * [-7430.057] (-7425.078) (-7443.960) (-7441.061) -- 0:27:34 57500 -- (-7430.534) [-7437.382] (-7439.496) (-7445.944) * (-7440.079) (-7432.285) (-7442.245) [-7431.350] -- 0:27:35 58000 -- (-7427.348) (-7437.651) [-7425.513] (-7435.903) * (-7440.749) (-7430.182) [-7430.925] (-7430.148) -- 0:27:36 58500 -- (-7430.025) [-7430.021] (-7431.146) (-7437.833) * (-7440.647) [-7425.350] (-7441.777) (-7426.717) -- 0:27:21 59000 -- (-7435.318) (-7434.903) [-7433.325] (-7438.333) * [-7439.205] (-7424.246) (-7429.636) (-7429.781) -- 0:27:22 59500 -- (-7430.064) (-7430.166) [-7421.412] (-7430.438) * (-7448.697) (-7429.779) [-7429.425] (-7433.442) -- 0:27:23 60000 -- (-7441.935) (-7432.690) (-7428.292) [-7433.970] * (-7432.699) (-7429.199) [-7432.583] (-7434.533) -- 0:27:25 Average standard deviation of split frequencies: 0.018740 60500 -- (-7427.834) (-7429.183) [-7428.931] (-7440.626) * [-7433.637] (-7427.011) (-7430.152) (-7435.288) -- 0:27:26 61000 -- (-7429.379) (-7440.642) (-7445.413) [-7432.377] * [-7425.484] (-7433.057) (-7430.641) (-7443.353) -- 0:27:27 61500 -- (-7427.977) (-7438.308) [-7423.880] (-7432.028) * (-7429.046) (-7438.554) (-7441.218) [-7432.370] -- 0:27:12 62000 -- (-7442.052) (-7440.553) [-7428.317] (-7430.162) * (-7422.853) (-7420.655) [-7431.845] (-7434.324) -- 0:27:13 62500 -- (-7437.067) (-7437.242) (-7432.456) [-7435.311] * [-7427.105] (-7433.651) (-7428.255) (-7435.701) -- 0:27:15 63000 -- [-7433.492] (-7436.473) (-7442.696) (-7436.170) * (-7438.645) [-7423.248] (-7435.118) (-7438.055) -- 0:27:16 63500 -- (-7426.063) [-7433.624] (-7446.641) (-7435.242) * [-7425.826] (-7436.476) (-7436.131) (-7427.980) -- 0:27:17 64000 -- (-7435.283) [-7432.372] (-7437.910) (-7431.768) * (-7427.506) (-7437.268) (-7441.507) [-7426.409] -- 0:27:18 64500 -- (-7435.072) (-7443.007) [-7431.238] (-7436.775) * (-7427.710) (-7432.413) [-7430.866] (-7431.124) -- 0:27:04 65000 -- (-7435.936) (-7437.797) (-7443.669) [-7431.262] * (-7437.596) [-7429.889] (-7432.667) (-7428.219) -- 0:27:05 Average standard deviation of split frequencies: 0.019172 65500 -- [-7430.333] (-7452.347) (-7428.824) (-7434.245) * (-7434.364) [-7429.636] (-7433.452) (-7438.645) -- 0:27:06 66000 -- (-7432.912) (-7434.823) (-7434.266) [-7433.659] * (-7434.198) (-7437.438) [-7429.044] (-7431.242) -- 0:27:07 66500 -- (-7432.055) [-7432.902] (-7437.191) (-7428.678) * [-7428.129] (-7434.183) (-7436.747) (-7427.052) -- 0:27:08 67000 -- [-7431.009] (-7442.552) (-7428.336) (-7435.897) * (-7427.296) (-7438.870) [-7421.499] (-7427.064) -- 0:27:09 67500 -- (-7432.758) [-7422.166] (-7427.292) (-7437.635) * [-7421.127] (-7453.846) (-7430.781) (-7429.137) -- 0:26:56 68000 -- [-7427.396] (-7425.554) (-7428.707) (-7436.460) * (-7421.842) (-7460.694) (-7433.977) [-7428.191] -- 0:26:57 68500 -- [-7420.496] (-7428.487) (-7428.764) (-7437.896) * [-7431.330] (-7433.415) (-7422.236) (-7435.379) -- 0:26:58 69000 -- (-7428.659) [-7428.577] (-7432.517) (-7439.929) * [-7431.550] (-7432.214) (-7429.334) (-7436.518) -- 0:26:59 69500 -- (-7432.402) (-7426.032) (-7445.028) [-7433.828] * [-7432.377] (-7427.080) (-7428.485) (-7435.251) -- 0:27:00 70000 -- (-7433.650) (-7425.241) [-7433.068] (-7447.322) * (-7433.438) (-7435.474) (-7435.520) [-7430.357] -- 0:27:00 Average standard deviation of split frequencies: 0.017048 70500 -- (-7436.772) [-7432.900] (-7434.730) (-7439.061) * (-7430.645) [-7423.066] (-7442.378) (-7434.515) -- 0:26:48 71000 -- (-7441.639) (-7426.561) [-7430.613] (-7431.308) * [-7431.452] (-7434.106) (-7445.690) (-7445.325) -- 0:26:49 71500 -- (-7439.830) [-7434.154] (-7429.987) (-7431.846) * (-7426.030) [-7426.212] (-7441.047) (-7433.366) -- 0:26:50 72000 -- (-7458.913) (-7431.567) [-7433.031] (-7436.987) * (-7428.530) (-7437.502) (-7445.608) [-7431.517] -- 0:26:51 72500 -- (-7445.318) (-7434.716) (-7430.730) [-7438.622] * (-7426.618) (-7447.287) [-7433.159] (-7427.766) -- 0:26:51 73000 -- (-7456.036) (-7431.670) (-7425.346) [-7428.693] * (-7435.598) (-7439.127) [-7430.188] (-7427.743) -- 0:26:52 73500 -- (-7436.747) (-7436.508) [-7432.007] (-7426.201) * (-7435.543) (-7433.804) [-7427.857] (-7434.178) -- 0:26:40 74000 -- (-7433.762) (-7429.021) (-7429.623) [-7428.979] * (-7452.551) (-7433.604) [-7425.633] (-7438.833) -- 0:26:41 74500 -- (-7440.449) [-7428.974] (-7424.045) (-7436.754) * (-7430.023) (-7435.590) (-7431.564) [-7436.391] -- 0:26:42 75000 -- (-7436.192) (-7433.379) (-7430.469) [-7426.755] * (-7430.981) (-7436.146) [-7432.164] (-7444.427) -- 0:26:43 Average standard deviation of split frequencies: 0.016541 75500 -- (-7443.800) (-7431.028) (-7437.565) [-7424.369] * (-7429.210) [-7429.629] (-7429.738) (-7440.918) -- 0:26:44 76000 -- (-7435.868) [-7432.258] (-7435.548) (-7439.021) * (-7427.344) (-7432.932) [-7436.861] (-7430.273) -- 0:26:44 76500 -- (-7431.844) [-7436.421] (-7438.451) (-7441.422) * (-7437.191) (-7439.585) (-7438.522) [-7429.124] -- 0:26:33 77000 -- (-7425.814) [-7426.735] (-7440.852) (-7434.745) * (-7435.106) (-7437.157) (-7438.953) [-7428.266] -- 0:26:34 77500 -- [-7421.515] (-7431.246) (-7435.508) (-7435.308) * [-7427.911] (-7433.450) (-7433.038) (-7435.706) -- 0:26:35 78000 -- [-7437.091] (-7425.818) (-7442.627) (-7435.834) * (-7433.018) [-7430.856] (-7435.568) (-7436.558) -- 0:26:35 78500 -- (-7439.270) (-7428.868) (-7438.669) [-7429.435] * [-7422.520] (-7436.384) (-7432.794) (-7430.027) -- 0:26:36 79000 -- (-7442.251) [-7428.380] (-7438.695) (-7424.883) * (-7432.446) [-7434.724] (-7429.136) (-7435.720) -- 0:26:37 79500 -- (-7440.872) (-7430.855) (-7434.895) [-7428.357] * (-7424.688) (-7431.404) (-7427.440) [-7438.849] -- 0:26:37 80000 -- (-7438.599) (-7434.452) (-7430.386) [-7433.224] * [-7433.332] (-7429.436) (-7433.707) (-7433.842) -- 0:26:27 Average standard deviation of split frequencies: 0.012986 80500 -- (-7429.317) (-7437.311) [-7429.729] (-7437.592) * (-7429.286) [-7427.959] (-7433.246) (-7434.433) -- 0:26:27 81000 -- [-7426.246] (-7431.490) (-7442.011) (-7444.075) * [-7427.817] (-7431.808) (-7438.284) (-7449.889) -- 0:26:28 81500 -- [-7429.472] (-7434.183) (-7440.655) (-7440.206) * (-7433.344) (-7428.152) [-7427.547] (-7442.521) -- 0:26:29 82000 -- [-7432.623] (-7428.072) (-7436.355) (-7441.677) * (-7447.029) [-7429.431] (-7430.264) (-7448.885) -- 0:26:29 82500 -- (-7440.419) (-7429.021) [-7429.223] (-7442.509) * [-7450.921] (-7434.685) (-7441.894) (-7435.078) -- 0:26:30 83000 -- [-7443.849] (-7424.583) (-7429.421) (-7440.449) * (-7444.762) [-7429.199] (-7441.270) (-7431.938) -- 0:26:19 83500 -- (-7441.284) [-7425.388] (-7431.987) (-7446.630) * (-7442.958) [-7433.443] (-7431.330) (-7435.261) -- 0:26:20 84000 -- (-7427.425) (-7433.880) [-7434.928] (-7433.089) * (-7442.707) [-7426.922] (-7445.147) (-7430.516) -- 0:26:21 84500 -- [-7429.687] (-7429.743) (-7437.258) (-7437.228) * (-7436.420) [-7427.266] (-7430.538) (-7436.469) -- 0:26:21 85000 -- (-7436.154) [-7428.239] (-7426.945) (-7439.818) * [-7432.336] (-7433.606) (-7441.388) (-7428.360) -- 0:26:22 Average standard deviation of split frequencies: 0.017887 85500 -- (-7443.354) (-7425.259) [-7433.348] (-7448.379) * (-7432.755) (-7454.957) (-7425.235) [-7435.049] -- 0:26:22 86000 -- (-7433.618) [-7429.260] (-7422.282) (-7438.943) * (-7432.595) [-7434.678] (-7425.056) (-7430.368) -- 0:26:12 86500 -- [-7426.236] (-7430.984) (-7424.104) (-7438.155) * (-7443.594) [-7436.464] (-7429.319) (-7437.487) -- 0:26:13 87000 -- (-7430.907) (-7434.792) [-7430.904] (-7436.904) * (-7433.129) (-7432.741) [-7429.881] (-7428.601) -- 0:26:14 87500 -- [-7431.626] (-7437.548) (-7431.619) (-7432.520) * (-7436.758) (-7444.467) (-7431.873) [-7424.281] -- 0:26:14 88000 -- (-7427.175) (-7438.045) [-7433.624] (-7433.995) * (-7440.440) (-7433.327) [-7425.060] (-7428.956) -- 0:26:15 88500 -- (-7445.428) (-7435.521) [-7431.457] (-7429.972) * (-7436.016) [-7426.118] (-7426.496) (-7436.717) -- 0:26:15 89000 -- (-7431.032) (-7432.218) (-7443.131) [-7431.832] * (-7440.032) (-7434.152) (-7436.727) [-7432.220] -- 0:26:16 89500 -- [-7434.687] (-7436.458) (-7445.254) (-7447.381) * (-7436.726) (-7435.747) (-7429.936) [-7426.109] -- 0:26:06 90000 -- [-7433.766] (-7432.332) (-7437.344) (-7430.845) * (-7434.371) (-7430.103) (-7450.280) [-7426.425] -- 0:26:07 Average standard deviation of split frequencies: 0.020797 90500 -- (-7429.588) (-7431.864) (-7427.778) [-7436.276] * (-7431.271) (-7434.128) (-7438.564) [-7431.376] -- 0:26:07 91000 -- (-7435.612) (-7440.239) [-7424.569] (-7431.221) * [-7430.658] (-7432.533) (-7431.766) (-7426.399) -- 0:26:08 91500 -- [-7424.313] (-7441.183) (-7451.262) (-7436.411) * (-7433.412) [-7428.226] (-7437.843) (-7434.801) -- 0:26:08 92000 -- [-7432.978] (-7436.231) (-7427.304) (-7428.759) * (-7429.780) (-7443.916) (-7429.901) [-7433.637] -- 0:26:09 92500 -- (-7442.171) (-7439.930) (-7430.566) [-7425.706] * (-7429.215) (-7434.173) [-7429.219] (-7428.204) -- 0:25:59 93000 -- (-7431.931) (-7442.169) (-7432.261) [-7429.461] * (-7439.538) (-7432.815) [-7424.290] (-7432.100) -- 0:26:00 93500 -- (-7432.875) (-7435.546) [-7428.019] (-7427.753) * (-7430.028) (-7438.439) (-7440.912) [-7433.200] -- 0:26:00 94000 -- (-7433.677) (-7435.512) (-7430.079) [-7424.381] * [-7427.226] (-7436.648) (-7437.124) (-7426.689) -- 0:26:01 94500 -- [-7423.615] (-7425.329) (-7435.788) (-7431.769) * [-7430.259] (-7434.578) (-7432.498) (-7437.942) -- 0:26:01 95000 -- (-7434.646) (-7437.076) (-7432.895) [-7430.931] * (-7424.089) (-7432.968) (-7435.906) [-7432.667] -- 0:26:02 Average standard deviation of split frequencies: 0.020733 95500 -- (-7441.856) (-7438.023) [-7441.793] (-7431.466) * (-7428.775) (-7441.118) (-7445.928) [-7428.604] -- 0:26:02 96000 -- (-7436.969) [-7434.776] (-7435.429) (-7429.580) * [-7431.542] (-7440.339) (-7436.429) (-7432.518) -- 0:25:53 96500 -- (-7434.237) (-7436.702) (-7432.926) [-7436.618] * (-7428.101) (-7434.704) (-7442.181) [-7432.152] -- 0:25:54 97000 -- [-7424.823] (-7431.620) (-7439.739) (-7426.389) * (-7430.508) (-7437.407) (-7436.557) [-7428.003] -- 0:25:54 97500 -- (-7424.840) (-7434.009) [-7436.692] (-7432.062) * (-7438.297) [-7431.370] (-7430.847) (-7436.832) -- 0:25:55 98000 -- [-7428.274] (-7428.499) (-7425.893) (-7442.232) * [-7432.180] (-7448.968) (-7444.634) (-7433.783) -- 0:25:55 98500 -- (-7436.669) (-7431.317) [-7425.745] (-7445.390) * [-7430.515] (-7438.733) (-7441.802) (-7437.909) -- 0:25:55 99000 -- (-7451.086) [-7427.046] (-7426.100) (-7441.893) * (-7432.109) [-7437.972] (-7441.342) (-7428.903) -- 0:25:47 99500 -- (-7434.962) (-7431.159) [-7428.511] (-7435.117) * (-7436.452) (-7435.258) [-7441.839] (-7432.830) -- 0:25:47 100000 -- (-7436.736) (-7430.056) [-7432.710] (-7433.565) * (-7436.864) (-7437.158) [-7431.959] (-7438.000) -- 0:25:48 Average standard deviation of split frequencies: 0.018211 100500 -- (-7422.333) (-7431.282) [-7426.885] (-7427.841) * (-7435.702) (-7431.408) [-7430.226] (-7430.336) -- 0:25:48 101000 -- (-7426.292) (-7430.251) [-7442.327] (-7433.878) * (-7436.747) (-7430.395) [-7429.929] (-7432.623) -- 0:25:48 101500 -- (-7429.514) (-7430.311) [-7431.643] (-7436.468) * (-7442.791) (-7430.501) [-7429.999] (-7426.581) -- 0:25:49 102000 -- [-7427.844] (-7434.258) (-7429.899) (-7434.760) * (-7429.846) (-7432.049) [-7431.548] (-7430.972) -- 0:25:40 102500 -- [-7432.394] (-7428.388) (-7431.543) (-7438.656) * (-7429.904) (-7436.254) [-7428.664] (-7436.702) -- 0:25:41 103000 -- (-7421.574) [-7430.957] (-7437.336) (-7450.375) * (-7435.435) (-7429.119) (-7435.809) [-7431.882] -- 0:25:41 103500 -- (-7437.388) [-7434.236] (-7435.140) (-7434.800) * (-7432.262) (-7430.573) (-7437.482) [-7429.930] -- 0:25:41 104000 -- (-7439.709) [-7428.366] (-7425.455) (-7430.877) * (-7451.739) (-7427.930) [-7432.543] (-7439.993) -- 0:25:42 104500 -- (-7435.058) [-7431.662] (-7428.723) (-7443.726) * (-7433.899) [-7434.408] (-7436.124) (-7433.287) -- 0:25:42 105000 -- (-7432.936) [-7430.614] (-7430.124) (-7432.188) * (-7434.652) [-7422.420] (-7432.713) (-7437.534) -- 0:25:42 Average standard deviation of split frequencies: 0.019024 105500 -- (-7441.329) [-7431.453] (-7424.979) (-7432.754) * (-7434.831) [-7429.512] (-7446.969) (-7442.674) -- 0:25:34 106000 -- (-7434.530) (-7438.394) [-7430.894] (-7430.357) * (-7432.174) (-7441.735) (-7440.051) [-7433.133] -- 0:25:34 106500 -- (-7425.694) (-7440.474) [-7426.242] (-7428.770) * (-7432.955) (-7430.930) (-7444.832) [-7433.755] -- 0:25:35 107000 -- (-7436.659) (-7435.530) [-7427.172] (-7432.984) * (-7439.569) [-7433.266] (-7441.079) (-7431.792) -- 0:25:35 107500 -- [-7440.941] (-7440.715) (-7441.060) (-7432.157) * [-7434.143] (-7432.258) (-7435.285) (-7435.308) -- 0:25:35 108000 -- (-7440.412) [-7437.653] (-7440.731) (-7423.681) * (-7435.578) (-7431.006) (-7429.964) [-7431.217] -- 0:25:36 108500 -- (-7427.987) (-7435.421) [-7433.223] (-7429.307) * (-7439.289) [-7432.269] (-7428.069) (-7429.273) -- 0:25:28 109000 -- (-7436.299) (-7431.998) [-7431.937] (-7430.280) * (-7432.937) (-7435.491) [-7425.208] (-7434.507) -- 0:25:28 109500 -- (-7441.401) (-7427.189) [-7432.857] (-7430.180) * (-7434.840) [-7431.605] (-7430.526) (-7431.376) -- 0:25:28 110000 -- (-7437.653) [-7423.449] (-7426.965) (-7443.955) * [-7425.885] (-7434.071) (-7438.888) (-7424.698) -- 0:25:29 Average standard deviation of split frequencies: 0.018160 110500 -- (-7433.072) [-7430.917] (-7428.090) (-7437.076) * (-7428.459) (-7428.562) (-7446.253) [-7435.836] -- 0:25:29 111000 -- (-7433.238) (-7437.456) [-7431.267] (-7446.871) * (-7436.880) (-7424.344) (-7436.989) [-7426.430] -- 0:25:29 111500 -- (-7434.432) [-7435.279] (-7431.905) (-7440.108) * (-7430.017) (-7437.925) (-7435.376) [-7427.526] -- 0:25:22 112000 -- (-7449.781) [-7426.114] (-7440.004) (-7441.266) * [-7427.067] (-7431.845) (-7437.973) (-7444.948) -- 0:25:22 112500 -- (-7435.201) (-7430.421) [-7431.950] (-7436.980) * (-7430.470) (-7439.225) [-7434.838] (-7429.948) -- 0:25:22 113000 -- (-7448.846) [-7434.918] (-7435.104) (-7439.242) * (-7424.528) (-7428.975) (-7444.176) [-7422.834] -- 0:25:22 113500 -- (-7427.756) (-7446.139) (-7439.498) [-7433.181] * [-7426.443] (-7436.510) (-7426.239) (-7433.505) -- 0:25:23 114000 -- (-7442.572) (-7427.618) (-7435.393) [-7425.002] * (-7437.692) [-7423.351] (-7435.227) (-7440.181) -- 0:25:23 114500 -- (-7437.500) (-7439.177) (-7434.652) [-7430.088] * (-7438.037) [-7426.675] (-7432.470) (-7440.923) -- 0:25:15 115000 -- (-7430.063) (-7438.734) (-7437.743) [-7424.433] * (-7433.284) [-7432.653] (-7454.795) (-7440.253) -- 0:25:16 Average standard deviation of split frequencies: 0.018394 115500 -- [-7428.493] (-7434.415) (-7431.139) (-7429.063) * (-7433.372) [-7425.564] (-7431.096) (-7429.281) -- 0:25:16 116000 -- (-7428.501) [-7431.652] (-7427.642) (-7426.987) * (-7431.199) [-7421.219] (-7437.924) (-7431.770) -- 0:25:16 116500 -- [-7431.719] (-7444.910) (-7444.972) (-7425.610) * [-7434.914] (-7421.618) (-7429.274) (-7432.378) -- 0:25:16 117000 -- (-7438.286) (-7430.551) [-7434.066] (-7425.237) * [-7427.947] (-7432.446) (-7434.113) (-7430.310) -- 0:25:16 117500 -- (-7434.598) (-7427.453) [-7426.957] (-7429.071) * (-7429.191) (-7428.946) [-7434.745] (-7434.374) -- 0:25:09 118000 -- (-7447.972) [-7429.206] (-7432.331) (-7430.840) * (-7438.867) (-7427.251) [-7423.973] (-7436.401) -- 0:25:09 118500 -- (-7430.569) (-7447.031) [-7434.493] (-7439.520) * [-7435.259] (-7429.176) (-7429.149) (-7436.534) -- 0:25:10 119000 -- [-7424.848] (-7437.071) (-7432.477) (-7436.352) * [-7430.510] (-7427.794) (-7426.738) (-7436.679) -- 0:25:10 119500 -- (-7433.837) (-7434.813) [-7426.833] (-7435.238) * [-7435.166] (-7432.608) (-7436.271) (-7435.140) -- 0:25:10 120000 -- (-7438.961) (-7441.223) (-7422.860) [-7430.959] * (-7441.733) [-7431.718] (-7437.669) (-7425.908) -- 0:25:10 Average standard deviation of split frequencies: 0.015832 120500 -- (-7439.158) (-7439.521) [-7434.403] (-7429.367) * (-7432.363) (-7428.316) [-7432.353] (-7430.202) -- 0:25:03 121000 -- (-7444.878) (-7431.916) (-7427.938) [-7434.765] * (-7443.212) [-7438.458] (-7431.798) (-7430.452) -- 0:25:03 121500 -- (-7441.165) (-7432.996) [-7429.123] (-7437.800) * [-7439.233] (-7438.835) (-7426.933) (-7438.859) -- 0:25:03 122000 -- [-7426.408] (-7430.279) (-7437.331) (-7446.483) * (-7437.309) (-7437.499) (-7433.085) [-7433.473] -- 0:25:04 122500 -- (-7427.622) (-7439.661) (-7438.480) [-7443.145] * (-7441.793) (-7439.603) [-7427.879] (-7425.318) -- 0:25:04 123000 -- (-7438.933) [-7434.007] (-7435.591) (-7438.847) * (-7440.228) (-7435.415) [-7427.115] (-7438.366) -- 0:25:04 123500 -- (-7429.861) (-7437.012) (-7424.928) [-7425.317] * (-7443.040) (-7435.141) [-7430.801] (-7434.525) -- 0:24:57 124000 -- (-7437.483) (-7427.274) (-7425.676) [-7429.833] * (-7436.398) [-7430.340] (-7437.722) (-7444.924) -- 0:24:57 124500 -- (-7451.564) [-7432.787] (-7434.526) (-7427.522) * (-7432.584) [-7426.295] (-7437.978) (-7441.346) -- 0:24:57 125000 -- (-7439.512) (-7430.018) (-7440.866) [-7424.183] * (-7425.084) (-7444.472) [-7428.645] (-7442.794) -- 0:24:58 Average standard deviation of split frequencies: 0.018707 125500 -- (-7445.179) [-7427.179] (-7433.031) (-7437.417) * (-7426.685) (-7431.753) [-7441.903] (-7434.080) -- 0:24:58 126000 -- (-7441.644) (-7424.163) [-7429.487] (-7447.169) * (-7426.703) (-7455.482) (-7433.498) [-7429.158] -- 0:24:58 126500 -- (-7430.047) (-7424.535) (-7439.692) [-7436.714] * [-7432.530] (-7427.355) (-7442.170) (-7434.821) -- 0:24:51 127000 -- [-7427.105] (-7433.798) (-7430.633) (-7439.244) * (-7429.321) (-7440.964) (-7433.259) [-7425.896] -- 0:24:51 127500 -- (-7426.780) [-7428.404] (-7425.522) (-7449.662) * (-7433.695) (-7435.339) [-7430.407] (-7427.072) -- 0:24:51 128000 -- (-7448.818) [-7429.693] (-7435.138) (-7440.469) * (-7433.153) (-7434.907) (-7432.673) [-7435.983] -- 0:24:51 128500 -- (-7432.305) [-7434.119] (-7431.743) (-7451.728) * (-7434.889) (-7440.702) [-7437.558] (-7435.848) -- 0:24:52 129000 -- (-7431.824) [-7428.291] (-7428.328) (-7439.966) * (-7437.760) (-7439.339) (-7435.130) [-7427.911] -- 0:24:52 129500 -- (-7442.924) (-7433.312) (-7454.358) [-7428.686] * (-7432.337) (-7429.110) (-7437.904) [-7428.784] -- 0:24:45 130000 -- (-7437.568) (-7435.372) [-7427.826] (-7438.918) * [-7429.589] (-7439.402) (-7438.566) (-7432.583) -- 0:24:45 Average standard deviation of split frequencies: 0.018988 130500 -- (-7448.449) [-7430.799] (-7431.698) (-7432.169) * (-7441.448) (-7429.865) [-7426.589] (-7449.821) -- 0:24:45 131000 -- (-7445.474) (-7428.467) [-7423.501] (-7425.518) * (-7426.774) [-7429.146] (-7431.394) (-7435.155) -- 0:24:45 131500 -- (-7444.769) (-7429.963) [-7429.621] (-7425.118) * (-7434.593) [-7425.842] (-7429.955) (-7440.914) -- 0:24:46 132000 -- (-7443.960) [-7424.037] (-7440.270) (-7430.589) * (-7440.604) [-7429.534] (-7433.404) (-7443.812) -- 0:24:46 132500 -- (-7447.396) [-7431.302] (-7430.927) (-7434.076) * (-7434.065) [-7425.720] (-7447.300) (-7446.765) -- 0:24:46 133000 -- (-7439.691) (-7439.045) [-7423.885] (-7427.929) * (-7448.965) [-7430.626] (-7444.526) (-7445.635) -- 0:24:46 133500 -- (-7434.815) (-7427.313) (-7432.029) [-7427.546] * (-7435.783) (-7428.968) [-7434.756] (-7440.596) -- 0:24:46 134000 -- (-7437.805) (-7429.718) (-7439.240) [-7434.319] * (-7432.832) [-7424.575] (-7429.804) (-7433.696) -- 0:24:46 134500 -- (-7435.322) (-7438.956) [-7429.785] (-7428.268) * (-7429.494) [-7425.525] (-7443.502) (-7430.788) -- 0:24:40 135000 -- (-7433.837) (-7431.663) [-7432.001] (-7439.630) * (-7431.998) (-7435.059) [-7441.027] (-7447.914) -- 0:24:40 Average standard deviation of split frequencies: 0.019338 135500 -- (-7422.365) (-7440.237) (-7432.872) [-7428.448] * (-7426.564) (-7427.154) (-7439.219) [-7431.812] -- 0:24:40 136000 -- [-7426.404] (-7447.895) (-7437.801) (-7429.336) * [-7427.070] (-7427.820) (-7440.452) (-7434.517) -- 0:24:40 136500 -- (-7423.929) (-7432.890) (-7428.762) [-7423.390] * (-7427.093) (-7439.243) [-7429.732] (-7440.339) -- 0:24:40 137000 -- (-7434.477) (-7443.407) (-7428.772) [-7428.579] * [-7434.143] (-7438.044) (-7433.962) (-7426.574) -- 0:24:40 137500 -- (-7434.053) [-7430.683] (-7435.291) (-7432.162) * (-7434.319) [-7434.445] (-7428.499) (-7431.752) -- 0:24:40 138000 -- (-7430.024) [-7429.066] (-7430.698) (-7431.859) * (-7425.890) (-7430.836) [-7437.657] (-7433.618) -- 0:24:40 138500 -- (-7433.520) (-7428.475) (-7430.973) [-7424.027] * (-7443.858) [-7430.712] (-7435.347) (-7439.668) -- 0:24:40 139000 -- (-7437.799) [-7432.099] (-7426.006) (-7443.656) * (-7452.993) (-7441.626) [-7434.635] (-7428.065) -- 0:24:40 139500 -- (-7439.455) (-7429.698) [-7425.309] (-7435.256) * (-7435.232) (-7434.308) (-7446.459) [-7441.171] -- 0:24:34 140000 -- (-7433.524) (-7435.370) [-7427.099] (-7430.137) * (-7432.509) (-7427.150) [-7437.962] (-7442.902) -- 0:24:34 Average standard deviation of split frequencies: 0.019402 140500 -- [-7432.782] (-7424.895) (-7428.290) (-7435.896) * (-7432.432) (-7424.806) (-7430.090) [-7432.579] -- 0:24:34 141000 -- (-7443.269) (-7439.601) (-7428.894) [-7421.571] * (-7436.749) (-7440.865) (-7429.485) [-7424.941] -- 0:24:34 141500 -- (-7430.260) (-7436.065) (-7437.436) [-7425.694] * [-7430.130] (-7451.063) (-7436.570) (-7428.151) -- 0:24:34 142000 -- [-7429.513] (-7435.937) (-7434.129) (-7435.677) * (-7431.204) (-7458.425) [-7423.860] (-7426.446) -- 0:24:34 142500 -- (-7431.814) [-7423.788] (-7433.459) (-7455.166) * (-7433.598) (-7440.038) (-7431.612) [-7425.614] -- 0:24:34 143000 -- (-7440.411) (-7436.512) [-7426.277] (-7438.783) * (-7434.172) (-7435.031) (-7438.248) [-7424.451] -- 0:24:34 143500 -- (-7432.375) (-7432.593) [-7426.765] (-7432.089) * (-7437.176) [-7429.941] (-7433.902) (-7426.382) -- 0:24:28 144000 -- (-7424.761) (-7424.408) [-7425.055] (-7438.039) * (-7429.862) (-7424.369) (-7437.211) [-7430.854] -- 0:24:28 144500 -- (-7427.882) (-7437.447) [-7428.877] (-7437.526) * (-7440.291) (-7435.916) (-7435.090) [-7439.488] -- 0:24:28 145000 -- (-7426.421) (-7439.544) [-7438.984] (-7435.828) * (-7448.427) (-7443.578) [-7440.336] (-7435.188) -- 0:24:28 Average standard deviation of split frequencies: 0.017503 145500 -- (-7434.354) (-7436.210) (-7431.437) [-7426.970] * [-7430.625] (-7436.749) (-7434.140) (-7439.746) -- 0:24:28 146000 -- (-7431.281) (-7449.089) (-7436.487) [-7433.971] * (-7434.265) (-7429.578) [-7433.088] (-7435.737) -- 0:24:28 146500 -- (-7424.298) (-7447.674) (-7433.066) [-7430.783] * [-7433.115] (-7440.257) (-7434.202) (-7433.874) -- 0:24:28 147000 -- (-7439.107) (-7447.303) (-7438.426) [-7428.815] * (-7439.751) (-7431.031) (-7424.552) [-7423.224] -- 0:24:28 147500 -- (-7434.707) [-7447.174] (-7430.447) (-7434.978) * (-7429.683) [-7423.074] (-7435.269) (-7434.160) -- 0:24:28 148000 -- (-7435.507) [-7433.215] (-7446.955) (-7425.480) * (-7429.357) (-7433.325) (-7434.923) [-7433.583] -- 0:24:27 148500 -- (-7434.875) (-7434.264) (-7436.634) [-7420.772] * (-7438.773) [-7428.260] (-7432.430) (-7434.659) -- 0:24:22 149000 -- (-7434.797) (-7423.323) (-7426.628) [-7423.385] * (-7429.117) (-7431.770) (-7430.908) [-7427.395] -- 0:24:22 149500 -- (-7427.688) [-7431.824] (-7422.470) (-7428.061) * [-7433.751] (-7438.938) (-7432.957) (-7440.279) -- 0:24:22 150000 -- [-7432.357] (-7436.278) (-7431.600) (-7431.495) * (-7433.655) (-7426.950) [-7424.797] (-7431.374) -- 0:24:22 Average standard deviation of split frequencies: 0.015973 150500 -- (-7439.997) (-7427.963) [-7432.120] (-7433.062) * (-7427.850) (-7428.715) [-7426.699] (-7427.050) -- 0:24:21 151000 -- (-7428.149) (-7437.381) [-7428.467] (-7442.216) * [-7425.046] (-7428.372) (-7430.587) (-7425.883) -- 0:24:21 151500 -- (-7426.387) (-7438.538) [-7421.385] (-7430.903) * (-7424.776) (-7441.838) (-7427.045) [-7421.704] -- 0:24:21 152000 -- (-7433.368) (-7428.589) [-7434.275] (-7425.150) * (-7428.230) (-7435.313) [-7426.505] (-7427.234) -- 0:24:16 152500 -- (-7426.164) (-7436.377) [-7426.125] (-7441.966) * (-7434.044) (-7428.773) [-7428.602] (-7442.654) -- 0:24:16 153000 -- (-7439.838) (-7438.899) (-7429.140) [-7431.915] * (-7436.690) (-7435.456) [-7432.018] (-7438.570) -- 0:24:15 153500 -- (-7440.772) [-7430.836] (-7436.809) (-7433.951) * (-7439.586) (-7438.118) [-7421.548] (-7437.276) -- 0:24:15 154000 -- (-7439.064) [-7437.036] (-7442.465) (-7439.527) * (-7446.521) (-7429.250) (-7429.339) [-7437.522] -- 0:24:15 154500 -- (-7442.471) [-7431.962] (-7434.938) (-7430.064) * (-7435.834) [-7428.409] (-7438.839) (-7434.016) -- 0:24:15 155000 -- (-7446.597) [-7430.375] (-7437.018) (-7437.502) * (-7438.369) [-7422.845] (-7428.674) (-7433.103) -- 0:24:15 Average standard deviation of split frequencies: 0.015427 155500 -- (-7441.761) (-7425.259) [-7433.310] (-7434.135) * [-7433.028] (-7443.325) (-7426.223) (-7440.306) -- 0:24:10 156000 -- (-7425.928) (-7432.791) [-7427.974] (-7442.283) * (-7442.474) [-7440.931] (-7431.288) (-7442.433) -- 0:24:09 156500 -- (-7441.302) (-7446.920) [-7421.928] (-7438.096) * (-7431.417) [-7430.024] (-7445.840) (-7429.690) -- 0:24:09 157000 -- (-7442.742) (-7430.064) [-7422.871] (-7444.256) * [-7426.982] (-7434.817) (-7437.713) (-7452.322) -- 0:24:09 157500 -- (-7438.301) (-7430.344) [-7424.771] (-7430.771) * (-7426.148) [-7442.905] (-7437.468) (-7450.806) -- 0:24:09 158000 -- (-7436.353) (-7433.543) (-7423.135) [-7429.309] * (-7433.769) (-7431.688) [-7429.426] (-7454.576) -- 0:24:09 158500 -- (-7428.140) (-7432.088) [-7427.033] (-7437.238) * (-7446.613) (-7447.136) (-7428.624) [-7433.708] -- 0:24:09 159000 -- (-7437.146) (-7438.792) [-7426.730] (-7446.065) * (-7439.557) [-7422.930] (-7422.706) (-7434.908) -- 0:24:03 159500 -- [-7428.059] (-7427.011) (-7426.950) (-7437.766) * (-7434.063) (-7432.772) [-7428.825] (-7435.520) -- 0:24:03 160000 -- [-7431.685] (-7431.600) (-7424.144) (-7447.309) * (-7434.437) [-7438.056] (-7437.560) (-7435.440) -- 0:24:03 Average standard deviation of split frequencies: 0.015597 160500 -- (-7432.379) (-7427.464) (-7431.286) [-7432.344] * (-7429.209) (-7445.116) (-7434.465) [-7424.989] -- 0:24:03 161000 -- (-7437.401) (-7440.317) (-7438.702) [-7434.401] * (-7440.061) (-7437.595) (-7438.568) [-7428.990] -- 0:24:03 161500 -- [-7429.438] (-7430.995) (-7437.310) (-7426.000) * (-7433.631) (-7440.761) (-7433.462) [-7433.287] -- 0:24:03 162000 -- (-7432.040) (-7433.426) [-7426.249] (-7425.722) * (-7430.230) [-7433.627] (-7427.887) (-7434.403) -- 0:24:03 162500 -- [-7430.434] (-7430.384) (-7430.270) (-7432.117) * (-7439.039) (-7427.159) [-7430.366] (-7435.356) -- 0:23:57 163000 -- [-7426.603] (-7429.588) (-7429.251) (-7434.498) * (-7429.324) (-7432.556) [-7431.327] (-7440.718) -- 0:23:57 163500 -- (-7432.340) (-7433.166) [-7421.194] (-7440.209) * (-7432.563) [-7431.744] (-7435.434) (-7438.820) -- 0:23:57 164000 -- (-7429.897) (-7440.269) [-7422.814] (-7442.559) * (-7437.099) (-7431.268) [-7429.925] (-7432.767) -- 0:23:57 164500 -- (-7431.957) (-7431.714) [-7424.287] (-7432.883) * (-7431.945) (-7438.382) (-7438.112) [-7425.365] -- 0:23:57 165000 -- (-7436.382) (-7434.307) [-7426.884] (-7430.686) * (-7443.011) (-7435.682) [-7430.204] (-7433.309) -- 0:23:57 Average standard deviation of split frequencies: 0.017786 165500 -- (-7431.531) (-7433.352) [-7427.993] (-7424.744) * (-7430.275) (-7434.941) (-7438.097) [-7428.828] -- 0:23:57 166000 -- (-7430.729) (-7440.646) (-7432.121) [-7436.828] * (-7439.505) (-7431.168) (-7438.392) [-7432.953] -- 0:23:51 166500 -- (-7437.494) (-7425.289) [-7423.877] (-7439.614) * (-7429.847) [-7428.977] (-7434.069) (-7438.469) -- 0:23:51 167000 -- [-7429.769] (-7436.151) (-7434.912) (-7438.421) * (-7433.882) [-7433.350] (-7427.241) (-7437.506) -- 0:23:51 167500 -- [-7426.135] (-7429.000) (-7435.246) (-7431.438) * [-7426.701] (-7438.725) (-7423.927) (-7434.669) -- 0:23:51 168000 -- [-7426.880] (-7444.634) (-7428.269) (-7434.648) * (-7436.233) [-7437.460] (-7432.117) (-7441.086) -- 0:23:51 168500 -- (-7431.828) (-7436.403) (-7429.235) [-7432.269] * (-7435.360) [-7428.711] (-7430.500) (-7437.590) -- 0:23:51 169000 -- [-7437.095] (-7435.490) (-7424.496) (-7440.712) * (-7439.641) [-7428.302] (-7433.126) (-7446.037) -- 0:23:50 169500 -- (-7442.453) (-7435.024) (-7424.690) [-7436.914] * (-7434.061) (-7426.804) [-7437.299] (-7431.361) -- 0:23:45 170000 -- (-7433.328) (-7431.676) [-7422.249] (-7444.652) * (-7434.980) [-7429.052] (-7437.650) (-7432.900) -- 0:23:45 Average standard deviation of split frequencies: 0.014578 170500 -- (-7453.720) [-7424.822] (-7433.941) (-7436.744) * (-7428.053) (-7432.386) [-7427.512] (-7433.865) -- 0:23:45 171000 -- (-7440.757) (-7436.727) (-7444.671) [-7427.316] * (-7445.788) (-7433.187) [-7431.168] (-7433.856) -- 0:23:45 171500 -- [-7432.792] (-7444.386) (-7444.574) (-7428.750) * (-7433.880) (-7432.747) [-7437.116] (-7432.061) -- 0:23:45 172000 -- (-7434.425) [-7435.668] (-7439.391) (-7426.963) * (-7440.576) [-7425.409] (-7435.846) (-7439.714) -- 0:23:44 172500 -- (-7430.781) (-7423.431) (-7432.621) [-7430.250] * [-7442.559] (-7419.494) (-7432.089) (-7436.719) -- 0:23:39 173000 -- [-7431.929] (-7451.219) (-7424.485) (-7433.078) * (-7439.597) [-7426.765] (-7438.033) (-7428.955) -- 0:23:39 173500 -- (-7434.717) (-7434.105) (-7439.940) [-7426.431] * (-7432.452) (-7433.275) [-7432.015] (-7431.190) -- 0:23:39 174000 -- (-7435.998) (-7434.310) (-7431.693) [-7440.964] * (-7434.047) (-7422.599) [-7424.421] (-7424.413) -- 0:23:39 174500 -- (-7434.818) [-7434.155] (-7433.688) (-7424.853) * (-7437.921) (-7429.565) [-7431.091] (-7437.120) -- 0:23:39 175000 -- [-7430.330] (-7430.272) (-7448.424) (-7436.024) * (-7428.619) (-7433.723) [-7422.913] (-7436.149) -- 0:23:39 Average standard deviation of split frequencies: 0.012202 175500 -- [-7429.652] (-7434.542) (-7429.718) (-7431.434) * (-7429.562) (-7436.907) (-7427.789) [-7424.069] -- 0:23:38 176000 -- (-7428.294) (-7450.218) [-7431.215] (-7439.145) * (-7443.216) (-7430.060) [-7426.256] (-7436.670) -- 0:23:33 176500 -- (-7435.231) (-7451.379) [-7425.053] (-7435.730) * [-7430.058] (-7433.390) (-7429.619) (-7427.622) -- 0:23:33 177000 -- (-7431.953) (-7443.605) [-7428.569] (-7429.348) * (-7425.867) (-7426.225) [-7428.850] (-7432.496) -- 0:23:33 177500 -- (-7436.631) (-7442.624) [-7426.874] (-7433.738) * (-7434.105) (-7431.311) (-7430.922) [-7432.795] -- 0:23:33 178000 -- (-7432.073) (-7434.865) [-7435.687] (-7431.646) * [-7429.843] (-7432.620) (-7429.410) (-7432.347) -- 0:23:33 178500 -- [-7431.181] (-7442.504) (-7437.573) (-7439.194) * (-7432.916) [-7437.250] (-7434.771) (-7439.310) -- 0:23:32 179000 -- (-7440.273) (-7434.263) (-7435.059) [-7435.212] * (-7433.674) (-7440.996) [-7428.619] (-7436.822) -- 0:23:32 179500 -- (-7446.049) (-7432.413) [-7431.934] (-7441.675) * (-7438.341) (-7437.150) [-7434.105] (-7442.028) -- 0:23:27 180000 -- (-7441.783) (-7438.318) [-7428.384] (-7430.348) * (-7440.372) (-7437.898) [-7435.715] (-7439.547) -- 0:23:27 Average standard deviation of split frequencies: 0.012901 180500 -- (-7446.707) (-7450.230) (-7440.835) [-7431.626] * (-7431.687) (-7435.739) [-7432.615] (-7432.950) -- 0:23:27 181000 -- (-7443.953) (-7435.674) [-7435.882] (-7433.440) * [-7431.723] (-7437.942) (-7434.516) (-7436.707) -- 0:23:27 181500 -- (-7447.626) (-7451.312) (-7438.143) [-7427.901] * (-7434.895) (-7434.231) [-7429.882] (-7432.099) -- 0:23:27 182000 -- [-7428.285] (-7444.198) (-7441.874) (-7434.921) * (-7429.221) [-7427.827] (-7435.092) (-7434.914) -- 0:23:26 182500 -- (-7440.043) (-7442.540) (-7431.110) [-7426.025] * (-7424.874) (-7432.734) (-7424.294) [-7433.382] -- 0:23:26 183000 -- (-7446.592) (-7442.451) [-7440.058] (-7431.198) * (-7430.574) (-7432.278) [-7429.015] (-7431.287) -- 0:23:21 183500 -- (-7444.373) (-7436.159) [-7419.980] (-7430.446) * (-7437.909) (-7431.615) (-7429.796) [-7434.300] -- 0:23:21 184000 -- (-7447.903) (-7436.772) [-7430.222] (-7424.292) * (-7422.835) (-7431.205) [-7428.497] (-7436.422) -- 0:23:21 184500 -- (-7434.287) [-7428.948] (-7431.298) (-7431.120) * (-7428.034) [-7431.305] (-7437.776) (-7423.284) -- 0:23:21 185000 -- (-7436.639) (-7433.018) [-7436.299] (-7428.780) * (-7428.542) (-7436.402) (-7440.219) [-7419.293] -- 0:23:20 Average standard deviation of split frequencies: 0.013376 185500 -- (-7436.013) (-7431.074) (-7439.328) [-7422.710] * [-7432.343] (-7425.023) (-7441.537) (-7423.793) -- 0:23:20 186000 -- (-7440.148) (-7432.895) (-7429.223) [-7428.791] * (-7424.980) (-7429.656) (-7437.470) [-7422.828] -- 0:23:20 186500 -- (-7426.266) (-7428.513) (-7434.756) [-7429.783] * (-7440.039) (-7431.208) (-7429.066) [-7423.476] -- 0:23:15 187000 -- (-7428.772) (-7430.993) (-7434.740) [-7426.353] * [-7429.310] (-7428.542) (-7441.769) (-7432.738) -- 0:23:15 187500 -- (-7428.516) (-7436.956) (-7428.376) [-7429.931] * (-7433.344) (-7434.314) [-7437.796] (-7438.617) -- 0:23:15 188000 -- (-7430.916) (-7430.565) (-7434.411) [-7433.349] * (-7430.709) [-7426.014] (-7422.513) (-7430.556) -- 0:23:15 188500 -- (-7440.956) (-7437.186) (-7425.005) [-7428.203] * [-7430.797] (-7425.585) (-7425.832) (-7435.148) -- 0:23:14 189000 -- (-7437.750) (-7436.483) [-7421.669] (-7423.100) * (-7432.609) (-7427.882) [-7435.391] (-7430.754) -- 0:23:14 189500 -- (-7436.982) [-7424.001] (-7428.902) (-7438.347) * (-7438.141) (-7445.882) (-7428.133) [-7437.275] -- 0:23:14 190000 -- (-7439.698) [-7422.284] (-7430.748) (-7425.350) * (-7438.996) (-7437.899) [-7423.624] (-7429.757) -- 0:23:09 Average standard deviation of split frequencies: 0.012362 190500 -- (-7439.793) (-7430.576) (-7439.537) [-7429.995] * (-7429.713) (-7436.233) [-7418.929] (-7429.614) -- 0:23:09 191000 -- [-7438.193] (-7447.818) (-7429.760) (-7435.441) * [-7432.344] (-7446.781) (-7425.283) (-7427.953) -- 0:23:09 191500 -- (-7446.834) (-7440.831) [-7423.943] (-7434.763) * (-7438.333) (-7442.776) (-7427.645) [-7429.389] -- 0:23:09 192000 -- (-7455.190) (-7442.169) [-7434.548] (-7440.121) * (-7433.038) (-7438.186) (-7429.646) [-7424.323] -- 0:23:08 192500 -- (-7445.621) (-7445.189) [-7428.299] (-7434.421) * [-7433.704] (-7440.037) (-7432.354) (-7437.030) -- 0:23:08 193000 -- [-7431.330] (-7444.403) (-7431.507) (-7438.369) * (-7438.329) (-7432.607) (-7430.499) [-7429.277] -- 0:23:08 193500 -- [-7435.490] (-7437.086) (-7435.501) (-7439.695) * (-7436.449) (-7445.068) (-7430.422) [-7429.271] -- 0:23:07 194000 -- [-7427.915] (-7440.126) (-7438.807) (-7432.407) * [-7430.696] (-7428.836) (-7434.961) (-7439.796) -- 0:23:07 194500 -- (-7439.883) (-7426.512) (-7436.726) [-7430.659] * (-7430.513) [-7437.205] (-7434.600) (-7439.133) -- 0:23:07 195000 -- [-7430.654] (-7433.982) (-7430.746) (-7429.327) * (-7432.315) [-7443.243] (-7436.173) (-7433.518) -- 0:23:02 Average standard deviation of split frequencies: 0.010957 195500 -- (-7425.908) [-7436.082] (-7442.315) (-7432.250) * (-7426.426) [-7431.109] (-7437.190) (-7427.180) -- 0:23:02 196000 -- (-7439.839) (-7444.519) [-7438.691] (-7428.370) * (-7428.972) [-7436.249] (-7436.200) (-7424.857) -- 0:23:02 196500 -- [-7436.651] (-7432.234) (-7443.703) (-7438.919) * (-7434.922) (-7427.956) (-7432.859) [-7428.815] -- 0:23:02 197000 -- (-7437.195) [-7435.556] (-7447.258) (-7431.107) * [-7429.847] (-7436.523) (-7431.397) (-7434.571) -- 0:23:01 197500 -- [-7430.829] (-7437.236) (-7430.617) (-7428.436) * [-7428.561] (-7429.335) (-7433.770) (-7435.745) -- 0:23:01 198000 -- (-7427.919) (-7435.246) [-7430.185] (-7432.777) * [-7429.618] (-7433.337) (-7437.247) (-7421.778) -- 0:23:01 198500 -- (-7440.957) [-7435.436] (-7433.779) (-7431.426) * (-7433.100) (-7429.705) (-7438.931) [-7430.044] -- 0:22:56 199000 -- [-7434.834] (-7433.865) (-7427.405) (-7439.936) * (-7431.552) [-7431.331] (-7424.600) (-7424.138) -- 0:22:56 199500 -- (-7431.794) (-7434.544) [-7429.562] (-7442.956) * (-7437.663) (-7433.371) (-7443.031) [-7424.783] -- 0:22:56 200000 -- (-7433.385) (-7437.557) [-7426.253] (-7447.190) * (-7434.705) [-7426.825] (-7440.049) (-7430.598) -- 0:22:56 Average standard deviation of split frequencies: 0.011746 200500 -- (-7441.618) (-7443.890) (-7431.025) [-7435.444] * (-7428.736) (-7438.264) (-7429.083) [-7427.844] -- 0:22:55 201000 -- (-7425.141) [-7429.404] (-7432.821) (-7430.294) * (-7435.791) (-7445.243) [-7429.457] (-7427.532) -- 0:22:55 201500 -- (-7428.263) (-7429.354) [-7424.394] (-7433.216) * (-7435.155) [-7434.610] (-7441.639) (-7431.771) -- 0:22:55 202000 -- (-7439.612) [-7429.026] (-7436.418) (-7432.612) * (-7431.004) (-7440.196) [-7430.320] (-7433.132) -- 0:22:54 202500 -- (-7443.324) [-7425.510] (-7425.705) (-7438.890) * (-7441.478) [-7425.659] (-7433.143) (-7443.446) -- 0:22:50 203000 -- (-7434.260) (-7430.277) (-7425.093) [-7429.013] * [-7435.609] (-7435.478) (-7440.192) (-7444.435) -- 0:22:50 203500 -- (-7442.225) (-7425.617) [-7434.303] (-7431.981) * (-7444.837) (-7430.105) (-7437.009) [-7431.426] -- 0:22:49 204000 -- (-7441.027) [-7429.216] (-7434.553) (-7433.829) * (-7442.421) [-7428.189] (-7436.050) (-7428.085) -- 0:22:49 204500 -- (-7446.985) [-7425.117] (-7441.640) (-7434.660) * [-7436.547] (-7440.023) (-7428.010) (-7429.054) -- 0:22:49 205000 -- (-7439.927) (-7431.758) (-7439.806) [-7426.383] * [-7430.960] (-7422.296) (-7436.805) (-7436.957) -- 0:22:48 Average standard deviation of split frequencies: 0.010933 205500 -- (-7436.430) (-7430.815) (-7436.030) [-7425.573] * [-7431.066] (-7422.766) (-7443.413) (-7437.315) -- 0:22:48 206000 -- (-7434.596) [-7441.974] (-7437.927) (-7439.113) * (-7440.510) [-7430.512] (-7438.915) (-7435.206) -- 0:22:44 206500 -- [-7440.673] (-7427.818) (-7435.046) (-7438.514) * [-7435.473] (-7433.357) (-7447.776) (-7431.732) -- 0:22:44 207000 -- (-7451.103) [-7429.216] (-7430.413) (-7439.947) * (-7442.995) [-7426.527] (-7435.167) (-7429.874) -- 0:22:43 207500 -- (-7444.461) [-7434.998] (-7425.715) (-7434.777) * (-7439.384) [-7430.293] (-7441.256) (-7426.668) -- 0:22:43 208000 -- (-7442.228) (-7431.208) (-7437.134) [-7429.050] * [-7439.908] (-7439.858) (-7438.457) (-7433.587) -- 0:22:43 208500 -- (-7435.740) (-7437.793) [-7438.350] (-7439.811) * (-7434.241) (-7437.106) (-7443.148) [-7432.891] -- 0:22:42 209000 -- (-7436.574) (-7429.178) (-7435.855) [-7428.798] * (-7455.978) (-7428.228) (-7437.482) [-7429.380] -- 0:22:42 209500 -- (-7438.024) (-7425.532) [-7434.376] (-7427.033) * (-7457.661) [-7424.237] (-7441.919) (-7430.523) -- 0:22:38 210000 -- [-7430.784] (-7434.802) (-7438.019) (-7438.627) * (-7458.773) (-7432.558) [-7433.761] (-7432.255) -- 0:22:38 Average standard deviation of split frequencies: 0.010443 210500 -- (-7437.590) (-7433.567) (-7436.887) [-7426.807] * (-7433.382) (-7442.209) (-7454.639) [-7433.310] -- 0:22:37 211000 -- (-7436.472) (-7426.897) (-7435.656) [-7428.238] * [-7431.647] (-7431.067) (-7443.337) (-7435.931) -- 0:22:37 211500 -- (-7439.924) (-7428.783) [-7429.413] (-7439.367) * [-7426.097] (-7440.286) (-7431.894) (-7435.557) -- 0:22:37 212000 -- (-7430.230) [-7431.809] (-7443.393) (-7424.973) * (-7429.905) (-7443.513) (-7439.918) [-7430.520] -- 0:22:36 212500 -- (-7429.364) (-7436.937) (-7432.240) [-7427.479] * (-7423.264) (-7437.330) [-7422.165] (-7426.627) -- 0:22:36 213000 -- [-7434.538] (-7432.404) (-7433.405) (-7432.420) * (-7429.179) [-7433.842] (-7431.419) (-7432.951) -- 0:22:32 213500 -- (-7435.328) (-7435.974) [-7431.030] (-7435.677) * (-7433.263) [-7428.099] (-7426.290) (-7429.993) -- 0:22:31 214000 -- (-7432.785) (-7430.442) (-7434.307) [-7432.467] * (-7432.321) (-7427.224) [-7427.331] (-7441.336) -- 0:22:31 214500 -- (-7435.325) (-7427.408) [-7434.243] (-7432.893) * (-7435.595) [-7429.407] (-7428.741) (-7446.509) -- 0:22:31 215000 -- (-7434.811) (-7428.993) [-7430.382] (-7429.439) * (-7426.769) [-7430.683] (-7432.624) (-7427.489) -- 0:22:30 Average standard deviation of split frequencies: 0.012125 215500 -- (-7433.446) (-7434.807) [-7428.839] (-7438.173) * [-7433.452] (-7428.297) (-7444.670) (-7434.721) -- 0:22:30 216000 -- (-7434.002) (-7434.509) (-7435.766) [-7426.314] * (-7427.849) (-7427.884) [-7437.068] (-7434.019) -- 0:22:30 216500 -- (-7429.148) (-7429.524) [-7427.587] (-7433.905) * (-7429.219) [-7433.380] (-7429.816) (-7432.857) -- 0:22:29 217000 -- (-7438.932) (-7428.428) [-7433.352] (-7435.474) * (-7431.226) [-7423.032] (-7446.712) (-7434.756) -- 0:22:25 217500 -- [-7434.493] (-7440.633) (-7437.494) (-7432.306) * (-7442.415) [-7432.395] (-7437.162) (-7434.052) -- 0:22:25 218000 -- [-7439.598] (-7433.491) (-7438.048) (-7431.579) * (-7438.017) (-7436.299) [-7432.264] (-7438.602) -- 0:22:25 218500 -- (-7442.679) [-7438.436] (-7426.436) (-7444.269) * (-7437.587) (-7435.723) [-7434.216] (-7436.040) -- 0:22:24 219000 -- [-7438.474] (-7432.497) (-7431.866) (-7438.201) * (-7429.053) (-7440.781) (-7438.057) [-7430.984] -- 0:22:24 219500 -- (-7420.796) (-7429.972) (-7435.534) [-7430.759] * [-7425.084] (-7429.432) (-7432.892) (-7432.202) -- 0:22:24 220000 -- [-7434.970] (-7427.528) (-7429.779) (-7435.760) * (-7431.790) [-7431.570] (-7427.905) (-7445.474) -- 0:22:23 Average standard deviation of split frequencies: 0.012224 220500 -- (-7434.424) (-7426.786) [-7432.378] (-7425.075) * [-7425.767] (-7436.404) (-7432.428) (-7433.605) -- 0:22:19 221000 -- (-7443.009) [-7428.242] (-7438.160) (-7425.545) * (-7430.324) (-7439.771) [-7425.821] (-7435.591) -- 0:22:19 221500 -- [-7425.335] (-7427.519) (-7434.875) (-7425.680) * [-7437.541] (-7436.908) (-7429.034) (-7448.406) -- 0:22:19 222000 -- (-7435.507) [-7434.776] (-7434.846) (-7429.326) * (-7436.060) [-7430.865] (-7433.129) (-7435.430) -- 0:22:18 222500 -- [-7426.783] (-7435.151) (-7435.945) (-7425.704) * (-7437.832) (-7438.952) [-7430.199] (-7431.861) -- 0:22:18 223000 -- [-7426.028] (-7424.358) (-7442.374) (-7435.584) * [-7435.207] (-7430.219) (-7438.654) (-7425.349) -- 0:22:17 223500 -- [-7425.533] (-7424.761) (-7441.702) (-7439.826) * (-7444.806) (-7430.891) (-7429.113) [-7423.445] -- 0:22:17 224000 -- [-7421.109] (-7435.658) (-7447.191) (-7433.256) * (-7432.090) (-7435.268) (-7433.843) [-7438.276] -- 0:22:13 224500 -- [-7431.315] (-7429.958) (-7456.261) (-7443.489) * [-7439.493] (-7434.689) (-7436.502) (-7444.571) -- 0:22:13 225000 -- (-7434.957) [-7428.207] (-7448.174) (-7432.788) * [-7429.833] (-7429.097) (-7432.176) (-7436.412) -- 0:22:13 Average standard deviation of split frequencies: 0.011936 225500 -- (-7442.496) [-7421.787] (-7431.541) (-7442.313) * (-7433.058) [-7427.095] (-7447.191) (-7431.484) -- 0:22:12 226000 -- (-7443.722) [-7430.894] (-7451.965) (-7442.838) * (-7425.585) [-7425.745] (-7442.647) (-7425.539) -- 0:22:12 226500 -- (-7442.957) [-7423.551] (-7438.575) (-7433.390) * (-7457.469) [-7427.118] (-7431.747) (-7434.121) -- 0:22:11 227000 -- (-7426.700) [-7428.976] (-7443.297) (-7435.768) * (-7435.848) (-7426.974) [-7429.998] (-7438.315) -- 0:22:11 227500 -- (-7426.377) (-7438.004) [-7443.525] (-7434.318) * (-7439.510) [-7430.614] (-7439.037) (-7445.194) -- 0:22:07 228000 -- (-7424.302) (-7437.420) [-7425.765] (-7433.114) * (-7435.835) [-7432.437] (-7434.788) (-7435.452) -- 0:22:07 228500 -- [-7424.868] (-7430.591) (-7445.052) (-7437.054) * (-7443.884) (-7430.303) [-7430.149] (-7427.557) -- 0:22:06 229000 -- [-7435.342] (-7441.744) (-7433.464) (-7434.890) * (-7426.210) [-7427.115] (-7438.937) (-7439.438) -- 0:22:06 229500 -- (-7435.791) (-7431.094) [-7434.014] (-7439.120) * (-7434.073) [-7433.307] (-7432.543) (-7438.531) -- 0:22:06 230000 -- [-7430.042] (-7439.379) (-7432.611) (-7430.773) * (-7432.204) [-7428.588] (-7431.849) (-7440.000) -- 0:22:05 Average standard deviation of split frequencies: 0.011354 230500 -- (-7431.872) (-7427.715) (-7432.072) [-7442.436] * (-7432.307) (-7440.941) [-7429.816] (-7448.134) -- 0:22:05 231000 -- (-7432.898) (-7439.611) [-7433.193] (-7424.190) * (-7433.086) [-7433.489] (-7432.575) (-7436.363) -- 0:22:04 231500 -- [-7431.100] (-7438.780) (-7429.694) (-7434.583) * (-7434.067) (-7426.054) (-7428.247) [-7432.414] -- 0:22:01 232000 -- (-7433.116) [-7445.273] (-7448.582) (-7431.058) * (-7437.550) (-7438.647) (-7428.844) [-7426.270] -- 0:22:00 232500 -- (-7429.310) (-7449.664) (-7438.177) [-7430.045] * (-7437.382) [-7425.168] (-7433.669) (-7425.816) -- 0:22:00 233000 -- (-7432.345) (-7438.059) [-7442.665] (-7437.073) * (-7431.271) (-7428.232) (-7437.068) [-7424.509] -- 0:22:00 233500 -- (-7434.077) [-7440.315] (-7439.017) (-7435.468) * (-7425.928) [-7444.502] (-7443.726) (-7430.451) -- 0:21:59 234000 -- (-7446.289) [-7426.770] (-7441.522) (-7431.151) * (-7436.413) (-7428.929) (-7439.829) [-7426.809] -- 0:21:59 234500 -- (-7446.183) (-7430.274) (-7431.791) [-7424.793] * [-7435.949] (-7430.171) (-7444.304) (-7435.160) -- 0:21:58 235000 -- (-7436.185) (-7433.337) (-7430.106) [-7428.670] * (-7430.443) [-7425.575] (-7429.714) (-7436.587) -- 0:21:55 Average standard deviation of split frequencies: 0.010098 235500 -- (-7438.548) (-7432.922) (-7436.954) [-7434.171] * [-7428.070] (-7449.137) (-7430.864) (-7427.437) -- 0:21:54 236000 -- (-7437.052) [-7429.358] (-7430.854) (-7432.123) * (-7423.438) (-7442.428) (-7426.786) [-7425.715] -- 0:21:54 236500 -- (-7434.477) [-7432.130] (-7452.145) (-7429.906) * (-7424.556) (-7445.134) [-7425.717] (-7433.151) -- 0:21:53 237000 -- (-7438.018) [-7433.437] (-7444.788) (-7438.772) * (-7449.166) [-7433.852] (-7430.274) (-7437.884) -- 0:21:53 237500 -- (-7432.068) [-7433.429] (-7429.717) (-7441.131) * (-7439.307) (-7432.130) (-7431.404) [-7429.326] -- 0:21:53 238000 -- (-7425.769) (-7430.849) (-7431.534) [-7431.747] * (-7428.413) (-7439.027) (-7432.034) [-7431.923] -- 0:21:52 238500 -- (-7444.015) (-7434.662) [-7436.649] (-7441.685) * [-7420.880] (-7436.225) (-7429.929) (-7430.073) -- 0:21:49 239000 -- (-7443.693) [-7428.665] (-7438.367) (-7434.856) * [-7427.503] (-7434.471) (-7432.067) (-7431.028) -- 0:21:48 239500 -- [-7422.457] (-7437.682) (-7433.931) (-7434.122) * (-7435.527) (-7439.244) (-7429.412) [-7433.310] -- 0:21:48 240000 -- (-7434.626) (-7435.020) (-7430.082) [-7434.923] * (-7431.989) [-7431.867] (-7436.531) (-7433.078) -- 0:21:47 Average standard deviation of split frequencies: 0.010447 240500 -- (-7437.655) (-7433.258) (-7436.554) [-7427.866] * [-7430.163] (-7427.040) (-7447.269) (-7434.032) -- 0:21:47 241000 -- (-7435.528) (-7430.870) [-7426.183] (-7430.733) * [-7431.676] (-7439.265) (-7433.777) (-7437.906) -- 0:21:46 241500 -- (-7427.832) [-7428.599] (-7436.806) (-7433.091) * (-7425.726) (-7437.330) (-7438.717) [-7434.557] -- 0:21:46 242000 -- (-7429.495) (-7425.778) (-7430.263) [-7428.135] * (-7431.860) (-7440.696) (-7431.440) [-7427.326] -- 0:21:43 242500 -- (-7439.408) (-7428.656) [-7432.333] (-7442.795) * [-7426.942] (-7432.692) (-7440.433) (-7427.811) -- 0:21:42 243000 -- [-7432.994] (-7436.429) (-7433.126) (-7446.555) * (-7428.316) (-7436.823) [-7434.260] (-7439.079) -- 0:21:42 243500 -- (-7444.363) (-7427.390) (-7438.537) [-7426.549] * [-7434.314] (-7425.889) (-7431.477) (-7433.634) -- 0:21:41 244000 -- (-7437.791) [-7434.353] (-7441.803) (-7432.755) * (-7436.003) [-7433.003] (-7424.452) (-7432.981) -- 0:21:41 244500 -- (-7437.550) [-7427.274] (-7433.079) (-7440.908) * (-7441.705) (-7444.812) (-7439.667) [-7429.911] -- 0:21:40 245000 -- [-7430.223] (-7446.298) (-7427.476) (-7442.841) * (-7436.945) [-7425.253] (-7435.834) (-7444.883) -- 0:21:40 Average standard deviation of split frequencies: 0.009901 245500 -- (-7433.942) [-7434.673] (-7426.820) (-7431.702) * (-7429.176) [-7422.848] (-7428.848) (-7440.779) -- 0:21:36 246000 -- (-7429.919) (-7426.250) (-7426.011) [-7429.398] * [-7432.688] (-7428.038) (-7430.006) (-7432.950) -- 0:21:36 246500 -- (-7427.433) (-7436.574) (-7432.058) [-7426.533] * (-7428.478) (-7432.691) [-7425.206] (-7441.452) -- 0:21:36 247000 -- [-7430.830] (-7431.658) (-7438.290) (-7426.232) * (-7436.518) (-7433.676) [-7432.017] (-7433.596) -- 0:21:35 247500 -- (-7435.345) (-7440.100) (-7431.237) [-7427.082] * [-7425.436] (-7438.363) (-7435.071) (-7433.143) -- 0:21:35 248000 -- [-7424.879] (-7432.662) (-7442.863) (-7434.158) * [-7430.688] (-7443.913) (-7430.778) (-7441.438) -- 0:21:34 248500 -- (-7427.046) [-7428.425] (-7432.854) (-7434.652) * (-7432.712) (-7429.767) (-7432.058) [-7434.957] -- 0:21:34 249000 -- (-7431.704) [-7425.704] (-7432.013) (-7445.241) * (-7433.336) (-7438.826) [-7425.764] (-7439.733) -- 0:21:33 249500 -- (-7430.761) [-7420.029] (-7432.914) (-7440.612) * (-7432.998) (-7428.559) (-7443.542) [-7433.334] -- 0:21:33 250000 -- (-7439.914) (-7432.378) [-7428.711] (-7431.286) * (-7428.645) [-7427.884] (-7446.690) (-7433.833) -- 0:21:30 Average standard deviation of split frequencies: 0.008672 250500 -- [-7427.738] (-7440.039) (-7435.378) (-7443.671) * [-7438.937] (-7432.766) (-7442.692) (-7440.555) -- 0:21:29 251000 -- [-7428.208] (-7440.799) (-7439.050) (-7432.718) * (-7430.517) [-7428.224] (-7440.223) (-7436.644) -- 0:21:29 251500 -- (-7427.022) (-7450.686) (-7433.669) [-7439.901] * (-7430.617) (-7425.863) (-7434.895) [-7434.759] -- 0:21:28 252000 -- [-7430.977] (-7435.950) (-7425.338) (-7437.163) * (-7430.578) (-7434.956) (-7428.792) [-7431.825] -- 0:21:28 252500 -- (-7424.467) (-7435.075) [-7423.541] (-7453.152) * (-7444.830) (-7437.371) [-7429.142] (-7438.318) -- 0:21:27 253000 -- (-7430.180) (-7455.026) [-7427.945] (-7432.217) * (-7440.206) (-7439.394) (-7435.261) [-7439.906] -- 0:21:27 253500 -- (-7435.537) [-7427.259] (-7427.109) (-7435.643) * (-7436.071) (-7431.340) [-7436.318] (-7433.084) -- 0:21:23 254000 -- (-7442.689) (-7435.429) [-7427.703] (-7435.321) * (-7431.537) (-7426.355) (-7435.849) [-7425.637] -- 0:21:23 254500 -- (-7427.315) (-7429.321) [-7429.390] (-7435.464) * (-7436.957) (-7427.851) (-7443.158) [-7424.288] -- 0:21:23 255000 -- (-7429.130) (-7435.122) [-7424.278] (-7438.029) * (-7434.870) [-7429.240] (-7431.900) (-7422.387) -- 0:21:22 Average standard deviation of split frequencies: 0.009719 255500 -- (-7427.196) [-7425.756] (-7423.039) (-7446.993) * (-7433.074) (-7437.882) [-7428.635] (-7428.899) -- 0:21:22 256000 -- (-7435.326) [-7430.282] (-7434.633) (-7444.019) * (-7428.243) (-7426.355) [-7427.678] (-7432.197) -- 0:21:21 256500 -- (-7445.610) [-7430.460] (-7426.628) (-7433.305) * (-7429.696) (-7427.665) [-7438.166] (-7437.238) -- 0:21:21 257000 -- (-7448.064) (-7436.767) [-7432.332] (-7438.592) * (-7440.561) (-7436.013) (-7442.118) [-7438.003] -- 0:21:17 257500 -- [-7423.502] (-7426.499) (-7428.951) (-7426.422) * (-7434.773) (-7429.775) [-7429.829] (-7433.680) -- 0:21:17 258000 -- (-7429.787) [-7435.296] (-7444.357) (-7441.066) * [-7433.390] (-7440.561) (-7435.488) (-7430.694) -- 0:21:16 258500 -- [-7432.074] (-7427.150) (-7438.630) (-7438.792) * (-7435.739) [-7438.239] (-7445.950) (-7435.831) -- 0:21:16 259000 -- (-7430.654) (-7424.661) (-7435.965) [-7426.331] * (-7428.743) (-7442.960) [-7428.144] (-7442.276) -- 0:21:16 259500 -- (-7428.929) (-7426.523) [-7424.626] (-7425.941) * [-7425.746] (-7432.886) (-7424.189) (-7435.557) -- 0:21:15 260000 -- (-7432.339) [-7429.599] (-7438.324) (-7428.947) * (-7432.903) (-7435.981) (-7442.958) [-7430.412] -- 0:21:15 Average standard deviation of split frequencies: 0.009746 260500 -- (-7440.913) (-7431.320) (-7429.963) [-7430.838] * [-7430.957] (-7435.908) (-7436.311) (-7431.976) -- 0:21:11 261000 -- (-7450.210) (-7435.348) [-7429.465] (-7423.554) * (-7436.098) (-7432.381) (-7438.254) [-7424.141] -- 0:21:11 261500 -- (-7437.526) (-7434.577) [-7429.458] (-7426.022) * [-7428.700] (-7443.350) (-7440.167) (-7426.216) -- 0:21:10 262000 -- (-7435.260) (-7427.995) [-7431.209] (-7433.527) * [-7436.817] (-7426.011) (-7442.571) (-7436.255) -- 0:21:10 262500 -- [-7433.111] (-7432.850) (-7434.076) (-7434.209) * (-7440.441) (-7432.660) (-7432.803) [-7423.439] -- 0:21:09 263000 -- [-7429.496] (-7430.475) (-7431.123) (-7428.781) * (-7440.729) [-7431.705] (-7435.111) (-7433.566) -- 0:21:09 263500 -- [-7430.386] (-7426.705) (-7438.251) (-7439.062) * (-7443.806) (-7430.347) (-7445.856) [-7425.838] -- 0:21:08 264000 -- (-7430.345) [-7427.264] (-7435.205) (-7441.410) * (-7427.176) (-7427.786) (-7436.413) [-7430.119] -- 0:21:05 264500 -- (-7442.208) (-7433.933) (-7438.578) [-7433.202] * [-7428.536] (-7428.657) (-7441.928) (-7444.317) -- 0:21:05 265000 -- [-7426.169] (-7436.789) (-7430.195) (-7427.108) * (-7430.193) (-7437.758) (-7433.445) [-7440.203] -- 0:21:04 Average standard deviation of split frequencies: 0.010830 265500 -- (-7437.095) (-7432.769) [-7427.070] (-7422.921) * (-7439.298) (-7430.993) [-7430.737] (-7439.030) -- 0:21:04 266000 -- (-7442.287) (-7433.771) (-7439.012) [-7431.693] * [-7432.413] (-7435.531) (-7430.175) (-7433.860) -- 0:21:03 266500 -- (-7432.540) (-7442.158) (-7444.909) [-7430.434] * (-7441.488) [-7429.237] (-7436.090) (-7437.209) -- 0:21:03 267000 -- (-7437.296) [-7430.829] (-7434.350) (-7433.633) * (-7428.037) [-7425.549] (-7429.562) (-7429.936) -- 0:21:02 267500 -- [-7431.901] (-7438.968) (-7439.337) (-7437.802) * (-7429.467) (-7428.543) [-7424.626] (-7431.859) -- 0:20:59 268000 -- (-7432.984) [-7430.088] (-7438.785) (-7436.549) * (-7429.496) [-7431.587] (-7436.632) (-7438.891) -- 0:20:59 268500 -- [-7421.307] (-7444.336) (-7428.187) (-7437.271) * (-7439.840) [-7430.812] (-7429.134) (-7435.384) -- 0:20:58 269000 -- (-7431.204) [-7433.068] (-7433.720) (-7428.130) * [-7423.703] (-7432.864) (-7427.603) (-7435.688) -- 0:20:58 269500 -- [-7426.780] (-7444.398) (-7438.881) (-7435.706) * (-7433.718) [-7430.639] (-7424.771) (-7427.535) -- 0:20:57 270000 -- (-7430.529) (-7435.577) (-7443.032) [-7438.633] * (-7432.580) [-7421.735] (-7425.071) (-7434.121) -- 0:20:57 Average standard deviation of split frequencies: 0.010063 270500 -- (-7431.751) (-7429.625) (-7436.297) [-7427.895] * (-7439.612) (-7421.849) (-7440.574) [-7431.193] -- 0:20:56 271000 -- (-7437.591) (-7437.421) [-7439.815] (-7439.946) * (-7432.560) [-7427.018] (-7444.935) (-7425.883) -- 0:20:53 271500 -- (-7447.417) (-7433.735) [-7435.170] (-7434.462) * (-7439.325) (-7435.408) (-7434.912) [-7437.069] -- 0:20:53 272000 -- (-7446.784) [-7428.069] (-7429.176) (-7427.941) * (-7430.829) (-7440.087) [-7430.616] (-7440.667) -- 0:20:52 272500 -- (-7440.248) (-7434.086) [-7432.765] (-7438.518) * (-7432.629) (-7431.191) [-7427.335] (-7431.635) -- 0:20:52 273000 -- (-7429.012) (-7424.888) [-7431.740] (-7430.756) * [-7439.181] (-7434.013) (-7432.575) (-7436.265) -- 0:20:51 273500 -- (-7440.968) (-7440.416) (-7443.489) [-7427.067] * [-7432.069] (-7432.443) (-7429.443) (-7444.498) -- 0:20:51 274000 -- (-7431.325) (-7435.647) (-7426.872) [-7424.758] * [-7427.099] (-7437.949) (-7435.284) (-7435.510) -- 0:20:50 274500 -- (-7435.914) (-7446.186) (-7443.295) [-7426.544] * (-7429.610) [-7436.561] (-7436.565) (-7423.768) -- 0:20:47 275000 -- (-7429.453) (-7435.864) (-7435.440) [-7424.809] * [-7435.414] (-7423.720) (-7441.928) (-7432.733) -- 0:20:47 Average standard deviation of split frequencies: 0.009773 275500 -- (-7433.026) (-7441.234) [-7435.815] (-7441.263) * (-7437.961) (-7428.872) [-7432.654] (-7439.466) -- 0:20:46 276000 -- [-7420.383] (-7432.364) (-7439.842) (-7432.216) * [-7429.722] (-7436.238) (-7440.722) (-7441.792) -- 0:20:46 276500 -- (-7431.034) (-7432.299) (-7428.381) [-7437.929] * (-7431.572) [-7426.942] (-7437.483) (-7438.855) -- 0:20:45 277000 -- (-7427.116) [-7432.270] (-7448.405) (-7433.945) * (-7432.298) (-7431.402) [-7433.571] (-7440.872) -- 0:20:45 277500 -- [-7441.675] (-7433.022) (-7440.656) (-7439.035) * (-7426.960) (-7432.553) [-7437.172] (-7439.494) -- 0:20:44 278000 -- (-7435.907) (-7422.777) (-7434.249) [-7426.784] * [-7425.489] (-7431.813) (-7439.015) (-7437.558) -- 0:20:41 278500 -- (-7429.977) (-7429.772) (-7450.957) [-7430.272] * [-7425.911] (-7434.414) (-7446.355) (-7428.138) -- 0:20:40 279000 -- [-7427.589] (-7429.158) (-7438.212) (-7435.994) * [-7429.722] (-7429.957) (-7437.039) (-7438.431) -- 0:20:40 279500 -- (-7440.047) [-7431.405] (-7435.280) (-7433.059) * [-7428.029] (-7435.734) (-7427.205) (-7433.017) -- 0:20:39 280000 -- (-7445.776) (-7426.808) (-7432.431) [-7430.391] * (-7436.532) (-7439.377) (-7429.509) [-7434.763] -- 0:20:39 Average standard deviation of split frequencies: 0.010275 280500 -- (-7439.681) (-7433.049) [-7432.914] (-7439.234) * (-7436.963) (-7431.859) (-7436.644) [-7445.218] -- 0:20:38 281000 -- (-7433.299) (-7438.341) [-7426.084] (-7430.692) * (-7443.716) (-7426.321) (-7432.849) [-7438.337] -- 0:20:38 281500 -- (-7430.203) (-7443.202) [-7430.387] (-7433.821) * (-7441.015) (-7426.104) (-7428.924) [-7432.217] -- 0:20:35 282000 -- (-7433.185) (-7434.792) (-7443.296) [-7426.673] * [-7434.085] (-7435.324) (-7425.651) (-7432.429) -- 0:20:34 282500 -- [-7426.404] (-7433.524) (-7434.182) (-7430.685) * (-7436.558) [-7424.019] (-7427.096) (-7428.188) -- 0:20:34 283000 -- (-7432.033) (-7433.133) [-7439.366] (-7431.866) * (-7439.325) (-7436.471) [-7437.703] (-7437.230) -- 0:20:33 283500 -- [-7435.090] (-7430.110) (-7426.550) (-7438.915) * (-7438.257) (-7430.258) [-7438.551] (-7433.718) -- 0:20:33 284000 -- (-7438.887) (-7431.882) [-7423.577] (-7437.019) * (-7435.091) (-7431.293) (-7434.475) [-7432.288] -- 0:20:32 284500 -- (-7430.402) [-7431.199] (-7429.130) (-7432.668) * (-7441.961) [-7425.266] (-7431.191) (-7434.350) -- 0:20:32 285000 -- (-7433.590) (-7426.605) [-7430.346] (-7432.699) * [-7439.651] (-7435.160) (-7441.828) (-7435.473) -- 0:20:29 Average standard deviation of split frequencies: 0.010622 285500 -- [-7429.715] (-7438.935) (-7431.324) (-7429.457) * (-7431.086) (-7439.959) (-7429.872) [-7423.470] -- 0:20:28 286000 -- (-7433.364) (-7442.969) (-7433.821) [-7431.766] * (-7434.420) (-7448.963) (-7432.445) [-7432.878] -- 0:20:28 286500 -- [-7435.530] (-7427.717) (-7437.287) (-7433.154) * (-7431.338) (-7447.492) (-7432.479) [-7439.053] -- 0:20:27 287000 -- [-7431.252] (-7431.193) (-7441.803) (-7435.541) * (-7427.329) [-7434.530] (-7430.937) (-7442.893) -- 0:20:27 287500 -- [-7425.257] (-7442.511) (-7446.591) (-7433.924) * [-7428.442] (-7436.411) (-7433.914) (-7441.404) -- 0:20:26 288000 -- (-7422.850) [-7436.583] (-7441.474) (-7432.294) * (-7427.742) [-7431.142] (-7431.427) (-7441.608) -- 0:20:23 288500 -- (-7420.100) (-7427.829) (-7446.563) [-7424.777] * (-7427.133) (-7432.098) (-7438.326) [-7428.439] -- 0:20:23 289000 -- [-7420.950] (-7443.929) (-7445.699) (-7425.559) * (-7432.698) (-7446.319) (-7440.840) [-7424.664] -- 0:20:22 289500 -- [-7425.549] (-7430.880) (-7425.640) (-7422.340) * (-7432.955) [-7432.909] (-7435.515) (-7423.675) -- 0:20:22 290000 -- (-7427.382) [-7439.573] (-7426.898) (-7434.663) * [-7430.263] (-7435.775) (-7428.023) (-7431.562) -- 0:20:21 Average standard deviation of split frequencies: 0.008681 290500 -- [-7421.484] (-7432.747) (-7432.119) (-7440.802) * [-7437.548] (-7431.726) (-7427.526) (-7424.128) -- 0:20:21 291000 -- [-7426.622] (-7437.726) (-7438.785) (-7440.550) * [-7435.958] (-7432.230) (-7434.500) (-7431.740) -- 0:20:20 291500 -- (-7441.827) (-7441.067) [-7431.706] (-7430.175) * (-7439.282) (-7439.384) [-7429.035] (-7430.695) -- 0:20:17 292000 -- [-7440.057] (-7430.156) (-7435.627) (-7426.704) * (-7431.881) (-7436.258) (-7433.238) [-7425.232] -- 0:20:17 292500 -- [-7427.771] (-7422.729) (-7434.972) (-7434.090) * (-7435.380) [-7423.143] (-7442.310) (-7429.956) -- 0:20:16 293000 -- [-7438.298] (-7431.194) (-7434.013) (-7447.974) * (-7435.598) (-7430.823) (-7429.407) [-7428.181] -- 0:20:16 293500 -- [-7438.659] (-7430.203) (-7452.107) (-7436.102) * (-7436.491) [-7436.711] (-7437.253) (-7430.492) -- 0:20:15 294000 -- [-7437.480] (-7424.454) (-7442.091) (-7433.319) * (-7441.545) (-7431.419) [-7424.487] (-7426.554) -- 0:20:15 294500 -- (-7438.242) [-7432.015] (-7427.084) (-7437.944) * (-7445.424) (-7427.430) (-7426.722) [-7426.255] -- 0:20:14 295000 -- (-7444.421) [-7434.982] (-7428.293) (-7428.632) * (-7435.106) (-7424.094) (-7434.676) [-7428.020] -- 0:20:11 Average standard deviation of split frequencies: 0.009462 295500 -- (-7443.185) [-7434.726] (-7431.801) (-7435.120) * [-7435.053] (-7436.092) (-7435.649) (-7427.507) -- 0:20:11 296000 -- (-7440.839) (-7429.900) (-7434.813) [-7429.289] * (-7439.432) [-7422.625] (-7440.711) (-7430.496) -- 0:20:10 296500 -- (-7443.343) (-7434.649) (-7434.132) [-7429.209] * (-7441.316) [-7424.823] (-7435.652) (-7437.394) -- 0:20:10 297000 -- (-7442.442) (-7431.960) [-7425.329] (-7436.821) * (-7439.154) [-7427.534] (-7436.058) (-7441.764) -- 0:20:09 297500 -- (-7433.166) [-7429.555] (-7425.686) (-7428.396) * (-7436.569) [-7427.643] (-7433.019) (-7440.625) -- 0:20:09 298000 -- [-7434.971] (-7435.678) (-7443.297) (-7439.433) * (-7437.609) (-7433.373) (-7427.604) [-7426.910] -- 0:20:08 298500 -- (-7436.967) (-7440.818) (-7442.340) [-7429.944] * (-7430.136) (-7438.081) [-7425.001] (-7436.619) -- 0:20:05 299000 -- (-7430.535) [-7431.282] (-7440.733) (-7432.752) * (-7440.858) (-7425.549) [-7430.623] (-7442.759) -- 0:20:05 299500 -- (-7431.744) [-7427.545] (-7435.752) (-7431.630) * (-7430.888) (-7443.475) (-7427.657) [-7432.391] -- 0:20:04 300000 -- [-7427.887] (-7425.095) (-7435.583) (-7437.317) * (-7432.929) (-7445.650) [-7429.738] (-7427.487) -- 0:20:04 Average standard deviation of split frequencies: 0.008854 300500 -- (-7429.303) [-7427.695] (-7437.236) (-7435.888) * (-7431.251) (-7442.860) [-7433.922] (-7426.898) -- 0:20:03 301000 -- [-7429.923] (-7435.871) (-7427.667) (-7435.943) * (-7432.182) (-7426.883) (-7431.811) [-7429.905] -- 0:20:02 301500 -- (-7434.318) (-7431.418) [-7436.858] (-7431.748) * (-7436.942) (-7427.981) (-7432.545) [-7433.310] -- 0:20:00 302000 -- (-7439.519) (-7439.338) (-7430.664) [-7423.388] * [-7431.422] (-7434.771) (-7428.809) (-7433.361) -- 0:19:59 302500 -- (-7431.979) (-7430.826) [-7434.845] (-7427.361) * (-7437.315) (-7438.632) [-7425.470] (-7438.598) -- 0:19:59 303000 -- (-7439.729) [-7436.266] (-7435.405) (-7432.105) * [-7440.044] (-7427.738) (-7430.834) (-7443.615) -- 0:19:58 303500 -- [-7434.302] (-7434.994) (-7436.078) (-7428.618) * (-7433.135) (-7423.415) (-7438.909) [-7427.567] -- 0:19:57 304000 -- [-7434.061] (-7437.541) (-7433.407) (-7436.251) * [-7432.205] (-7433.387) (-7429.313) (-7439.673) -- 0:19:57 304500 -- (-7430.978) (-7440.036) [-7428.371] (-7434.597) * [-7426.914] (-7427.120) (-7430.766) (-7437.254) -- 0:19:56 305000 -- (-7438.729) [-7431.880] (-7435.019) (-7423.597) * (-7430.791) [-7421.564] (-7438.338) (-7440.751) -- 0:19:54 Average standard deviation of split frequencies: 0.010149 305500 -- (-7434.529) (-7438.058) (-7432.664) [-7429.713] * (-7428.942) (-7437.357) [-7433.951] (-7448.360) -- 0:19:53 306000 -- (-7424.770) (-7429.838) [-7428.820] (-7435.308) * (-7429.136) [-7429.199] (-7439.039) (-7443.639) -- 0:19:52 306500 -- (-7441.314) (-7435.692) (-7431.288) [-7427.790] * [-7430.793] (-7433.590) (-7445.904) (-7439.998) -- 0:19:52 307000 -- (-7434.226) (-7434.853) [-7433.171] (-7428.089) * (-7430.049) (-7431.347) (-7434.972) [-7430.543] -- 0:19:51 307500 -- (-7432.039) (-7434.069) (-7438.125) [-7433.404] * (-7433.794) (-7428.465) (-7433.128) [-7429.338] -- 0:19:51 308000 -- (-7425.358) [-7438.194] (-7430.345) (-7435.179) * (-7436.437) [-7433.266] (-7439.784) (-7432.083) -- 0:19:50 308500 -- (-7431.489) (-7431.736) [-7423.591] (-7434.031) * (-7437.263) (-7433.783) (-7431.262) [-7430.610] -- 0:19:47 309000 -- (-7431.448) (-7433.559) [-7433.552] (-7434.372) * (-7445.319) [-7428.104] (-7434.156) (-7426.024) -- 0:19:47 309500 -- [-7427.097] (-7432.827) (-7429.776) (-7439.007) * (-7438.066) (-7428.804) [-7433.522] (-7435.209) -- 0:19:46 310000 -- (-7435.669) [-7434.957] (-7435.952) (-7433.379) * (-7429.402) (-7439.218) (-7428.386) [-7425.785] -- 0:19:46 Average standard deviation of split frequencies: 0.009372 310500 -- (-7428.951) (-7435.045) (-7436.574) [-7421.901] * (-7429.125) (-7433.707) [-7436.174] (-7432.248) -- 0:19:45 311000 -- (-7423.504) (-7425.673) (-7434.519) [-7432.571] * (-7434.981) (-7437.527) (-7438.059) [-7422.354] -- 0:19:45 311500 -- (-7421.685) (-7436.107) (-7433.433) [-7430.254] * (-7431.473) [-7429.910] (-7442.628) (-7437.871) -- 0:19:44 312000 -- [-7428.260] (-7427.980) (-7435.491) (-7426.439) * (-7434.193) [-7425.694] (-7436.657) (-7431.466) -- 0:19:41 312500 -- (-7431.648) (-7438.158) [-7433.757] (-7433.698) * (-7446.660) (-7431.986) (-7439.074) [-7422.874] -- 0:19:41 313000 -- [-7432.758] (-7425.101) (-7436.522) (-7432.911) * (-7438.697) (-7428.086) (-7431.748) [-7434.221] -- 0:19:40 313500 -- (-7432.762) (-7427.118) (-7437.443) [-7431.755] * (-7431.881) (-7434.357) (-7431.714) [-7430.107] -- 0:19:40 314000 -- (-7442.609) (-7437.900) [-7432.895] (-7433.791) * [-7426.435] (-7427.542) (-7445.119) (-7431.140) -- 0:19:39 314500 -- (-7437.968) [-7428.787] (-7433.086) (-7434.239) * [-7436.199] (-7427.876) (-7458.831) (-7429.181) -- 0:19:39 315000 -- (-7441.156) [-7428.909] (-7427.693) (-7427.266) * (-7432.537) (-7429.104) (-7435.459) [-7430.900] -- 0:19:38 Average standard deviation of split frequencies: 0.008424 315500 -- (-7444.787) (-7437.394) (-7435.361) [-7430.301] * [-7435.709] (-7428.082) (-7434.313) (-7431.718) -- 0:19:38 316000 -- [-7433.392] (-7439.688) (-7434.280) (-7439.109) * [-7433.414] (-7433.557) (-7431.966) (-7447.169) -- 0:19:37 316500 -- [-7438.751] (-7438.207) (-7441.410) (-7438.568) * (-7431.210) (-7426.736) (-7435.885) [-7428.618] -- 0:19:36 317000 -- [-7427.610] (-7435.783) (-7444.468) (-7439.988) * (-7435.568) (-7424.686) (-7442.910) [-7435.449] -- 0:19:36 317500 -- (-7443.809) [-7437.460] (-7437.315) (-7437.903) * [-7422.627] (-7427.935) (-7448.237) (-7428.334) -- 0:19:35 318000 -- (-7438.843) [-7429.356] (-7437.491) (-7439.276) * (-7425.652) [-7421.778] (-7449.756) (-7434.796) -- 0:19:35 318500 -- [-7439.362] (-7432.771) (-7430.016) (-7438.889) * [-7441.209] (-7433.880) (-7438.358) (-7443.195) -- 0:19:34 319000 -- (-7437.553) (-7426.144) (-7434.305) [-7439.547] * (-7435.118) (-7453.312) (-7430.763) [-7434.228] -- 0:19:34 319500 -- (-7426.324) (-7430.409) [-7426.927] (-7436.020) * (-7444.175) [-7439.336] (-7431.543) (-7436.269) -- 0:19:31 320000 -- (-7439.208) (-7424.796) [-7426.877] (-7439.847) * (-7440.755) [-7423.969] (-7436.333) (-7432.983) -- 0:19:30 Average standard deviation of split frequencies: 0.007869 320500 -- [-7433.236] (-7435.758) (-7430.190) (-7440.731) * (-7435.911) [-7428.093] (-7435.049) (-7425.885) -- 0:19:30 321000 -- (-7441.580) (-7434.610) [-7428.910] (-7430.212) * (-7442.000) (-7428.893) (-7428.243) [-7429.060] -- 0:19:29 321500 -- (-7427.423) [-7431.475] (-7425.657) (-7427.819) * (-7437.978) (-7428.239) (-7428.098) [-7429.160] -- 0:19:29 322000 -- (-7435.162) (-7431.987) [-7430.836] (-7439.865) * (-7441.629) [-7433.123] (-7437.584) (-7425.938) -- 0:19:28 322500 -- (-7437.789) [-7430.276] (-7433.910) (-7456.597) * [-7436.931] (-7434.225) (-7432.791) (-7436.834) -- 0:19:28 323000 -- (-7432.184) [-7430.877] (-7436.396) (-7441.907) * [-7436.935] (-7441.870) (-7434.232) (-7441.933) -- 0:19:25 323500 -- (-7440.267) (-7434.379) [-7436.381] (-7436.519) * (-7436.169) (-7424.919) [-7431.032] (-7438.886) -- 0:19:24 324000 -- (-7439.514) (-7431.020) (-7431.597) [-7429.860] * (-7429.900) [-7425.535] (-7428.230) (-7442.031) -- 0:19:24 324500 -- (-7436.237) [-7435.907] (-7428.682) (-7430.797) * [-7427.871] (-7426.966) (-7430.293) (-7433.985) -- 0:19:23 325000 -- [-7436.751] (-7431.240) (-7434.325) (-7430.536) * [-7423.684] (-7426.131) (-7440.636) (-7427.800) -- 0:19:23 Average standard deviation of split frequencies: 0.008166 325500 -- (-7437.090) [-7427.907] (-7429.732) (-7436.013) * (-7426.558) [-7430.177] (-7450.346) (-7435.738) -- 0:19:22 326000 -- (-7439.586) [-7422.652] (-7436.677) (-7430.002) * [-7427.697] (-7433.892) (-7448.591) (-7450.097) -- 0:19:19 326500 -- (-7440.376) [-7422.237] (-7432.816) (-7436.092) * [-7436.746] (-7432.385) (-7440.148) (-7430.959) -- 0:19:19 327000 -- (-7444.136) (-7433.529) (-7439.936) [-7422.604] * (-7431.940) [-7433.230] (-7433.374) (-7425.914) -- 0:19:18 327500 -- (-7448.166) (-7437.574) (-7445.410) [-7430.922] * (-7422.744) (-7438.278) [-7427.115] (-7429.350) -- 0:19:18 328000 -- [-7431.102] (-7438.534) (-7442.169) (-7435.109) * (-7429.505) (-7432.971) [-7430.607] (-7428.990) -- 0:19:17 328500 -- (-7430.879) [-7432.445] (-7431.568) (-7435.416) * (-7432.329) [-7433.068] (-7431.694) (-7427.769) -- 0:19:16 329000 -- [-7425.533] (-7433.774) (-7439.662) (-7436.457) * (-7426.745) (-7435.474) (-7438.733) [-7426.415] -- 0:19:16 329500 -- (-7430.229) (-7447.452) [-7431.572] (-7440.155) * (-7447.018) [-7426.256] (-7436.655) (-7437.594) -- 0:19:13 330000 -- (-7428.931) (-7437.644) [-7424.477] (-7453.756) * (-7446.991) (-7427.259) (-7443.141) [-7427.674] -- 0:19:13 Average standard deviation of split frequencies: 0.009141 330500 -- (-7428.816) (-7427.255) (-7423.403) [-7433.034] * (-7440.172) [-7431.151] (-7436.462) (-7426.486) -- 0:19:12 331000 -- (-7424.417) (-7437.358) (-7426.693) [-7434.295] * (-7430.362) (-7430.647) [-7428.630] (-7429.356) -- 0:19:12 331500 -- (-7435.730) (-7424.525) [-7429.170] (-7429.099) * (-7441.639) [-7430.185] (-7438.600) (-7432.337) -- 0:19:11 332000 -- (-7434.638) (-7425.984) [-7422.479] (-7431.749) * (-7432.012) (-7434.043) [-7432.457] (-7438.487) -- 0:19:10 332500 -- (-7446.326) [-7429.357] (-7435.422) (-7446.170) * (-7441.019) (-7452.594) [-7432.623] (-7434.019) -- 0:19:10 333000 -- (-7432.753) (-7431.936) (-7434.058) [-7432.687] * [-7446.237] (-7439.246) (-7444.652) (-7437.828) -- 0:19:07 333500 -- (-7439.718) (-7436.293) (-7440.067) [-7429.087] * (-7441.972) (-7437.485) [-7436.118] (-7440.120) -- 0:19:07 334000 -- (-7435.064) [-7425.051] (-7430.110) (-7422.266) * (-7432.897) (-7438.811) [-7437.850] (-7437.747) -- 0:19:06 334500 -- (-7442.352) [-7429.557] (-7430.684) (-7433.971) * (-7436.626) [-7434.547] (-7454.964) (-7434.984) -- 0:19:05 335000 -- (-7450.158) (-7431.860) [-7429.873] (-7443.962) * (-7436.029) (-7438.026) (-7452.231) [-7434.327] -- 0:19:05 Average standard deviation of split frequencies: 0.009243 335500 -- (-7425.456) [-7430.876] (-7439.991) (-7430.709) * (-7430.665) (-7441.764) (-7436.720) [-7430.007] -- 0:19:04 336000 -- (-7427.348) (-7440.194) (-7447.905) [-7432.200] * (-7426.607) (-7437.831) (-7429.881) [-7426.356] -- 0:19:02 336500 -- (-7445.613) [-7435.435] (-7443.435) (-7421.904) * (-7431.490) (-7435.568) (-7437.808) [-7420.804] -- 0:19:01 337000 -- (-7441.970) (-7439.411) (-7438.611) [-7427.749] * (-7429.723) (-7432.856) (-7439.567) [-7430.972] -- 0:19:01 337500 -- (-7447.189) (-7445.187) [-7430.922] (-7426.152) * (-7434.327) (-7427.323) (-7434.115) [-7427.772] -- 0:19:00 338000 -- (-7437.597) (-7445.530) [-7443.739] (-7426.406) * (-7439.341) [-7429.960] (-7445.911) (-7430.757) -- 0:18:59 338500 -- (-7435.660) (-7442.474) [-7426.970] (-7439.155) * [-7428.731] (-7436.449) (-7434.416) (-7439.519) -- 0:18:59 339000 -- [-7429.639] (-7432.622) (-7431.090) (-7437.423) * [-7431.413] (-7432.106) (-7433.235) (-7435.918) -- 0:18:58 339500 -- (-7429.330) (-7431.288) [-7436.131] (-7435.158) * (-7424.919) [-7430.384] (-7450.809) (-7433.739) -- 0:18:56 340000 -- [-7424.656] (-7428.686) (-7435.651) (-7434.204) * (-7438.858) (-7430.727) (-7441.625) [-7432.611] -- 0:18:55 Average standard deviation of split frequencies: 0.008872 340500 -- (-7435.458) [-7424.158] (-7438.040) (-7432.743) * (-7435.373) (-7427.828) (-7427.896) [-7431.180] -- 0:18:54 341000 -- (-7454.145) [-7423.175] (-7423.701) (-7431.329) * (-7436.437) (-7427.148) (-7439.233) [-7434.575] -- 0:18:54 341500 -- (-7436.884) (-7431.881) [-7431.746] (-7443.030) * [-7430.757] (-7435.767) (-7430.136) (-7431.089) -- 0:18:53 342000 -- (-7434.448) (-7434.399) [-7432.988] (-7439.783) * (-7424.678) (-7436.343) (-7439.846) [-7429.594] -- 0:18:53 342500 -- (-7432.373) [-7433.345] (-7432.383) (-7427.415) * (-7437.321) (-7438.337) (-7439.153) [-7434.483] -- 0:18:50 343000 -- (-7427.776) (-7441.836) (-7427.292) [-7433.796] * [-7434.328] (-7432.682) (-7440.339) (-7427.507) -- 0:18:50 343500 -- [-7431.066] (-7442.756) (-7430.922) (-7433.860) * (-7440.213) (-7436.172) [-7430.631] (-7428.082) -- 0:18:49 344000 -- (-7428.410) (-7434.629) (-7428.378) [-7429.183] * (-7434.988) [-7424.627] (-7432.329) (-7431.908) -- 0:18:48 344500 -- [-7425.439] (-7431.019) (-7434.106) (-7433.263) * (-7434.880) (-7425.955) [-7437.254] (-7455.407) -- 0:18:48 345000 -- (-7437.326) (-7442.834) [-7434.379] (-7431.652) * (-7431.412) [-7423.941] (-7435.892) (-7438.379) -- 0:18:47 Average standard deviation of split frequencies: 0.009056 345500 -- (-7439.944) [-7427.510] (-7430.553) (-7435.605) * [-7427.069] (-7419.951) (-7428.751) (-7432.933) -- 0:18:47 346000 -- (-7430.908) (-7432.345) (-7433.657) [-7431.112] * [-7426.363] (-7425.770) (-7428.724) (-7447.415) -- 0:18:44 346500 -- [-7428.231] (-7432.910) (-7434.045) (-7436.961) * (-7424.227) [-7435.519] (-7430.613) (-7440.440) -- 0:18:44 347000 -- (-7435.341) (-7452.335) [-7438.256] (-7436.770) * (-7434.199) [-7430.337] (-7436.677) (-7441.187) -- 0:18:43 347500 -- (-7434.678) [-7428.445] (-7445.094) (-7433.932) * (-7444.298) [-7426.904] (-7434.444) (-7432.438) -- 0:18:42 348000 -- [-7431.453] (-7438.190) (-7433.458) (-7441.411) * (-7440.854) [-7428.879] (-7439.411) (-7431.586) -- 0:18:42 348500 -- [-7423.087] (-7436.193) (-7431.526) (-7443.086) * (-7443.990) [-7434.805] (-7428.726) (-7437.277) -- 0:18:41 349000 -- (-7425.619) (-7433.823) [-7423.709] (-7445.447) * (-7447.052) (-7432.520) [-7431.709] (-7427.702) -- 0:18:41 349500 -- (-7432.322) (-7437.842) [-7433.673] (-7442.107) * (-7436.825) [-7429.274] (-7441.685) (-7426.687) -- 0:18:38 350000 -- (-7443.231) (-7434.077) (-7437.450) [-7431.939] * (-7434.840) (-7441.006) (-7429.203) [-7432.571] -- 0:18:38 Average standard deviation of split frequencies: 0.009173 350500 -- (-7441.165) (-7426.520) (-7430.270) [-7431.490] * [-7423.310] (-7437.879) (-7435.889) (-7434.108) -- 0:18:37 351000 -- [-7429.876] (-7431.028) (-7436.694) (-7429.189) * [-7424.400] (-7434.340) (-7432.255) (-7427.257) -- 0:18:36 351500 -- (-7432.436) (-7431.608) (-7434.192) [-7438.913] * (-7429.812) (-7435.239) [-7424.910] (-7450.966) -- 0:18:36 352000 -- (-7427.409) [-7427.076] (-7436.353) (-7437.951) * [-7431.903] (-7442.831) (-7426.030) (-7436.742) -- 0:18:35 352500 -- [-7424.833] (-7446.040) (-7440.735) (-7437.788) * (-7435.025) (-7438.204) [-7431.017] (-7437.000) -- 0:18:34 353000 -- [-7429.196] (-7462.551) (-7440.714) (-7429.297) * (-7429.384) (-7437.946) [-7424.701] (-7430.207) -- 0:18:32 353500 -- (-7431.282) (-7437.173) (-7433.407) [-7428.857] * (-7434.288) [-7435.603] (-7428.854) (-7441.610) -- 0:18:31 354000 -- (-7442.701) (-7439.597) (-7429.745) [-7420.991] * [-7432.721] (-7431.004) (-7426.623) (-7445.047) -- 0:18:31 354500 -- (-7431.535) (-7428.500) (-7432.168) [-7420.045] * (-7429.516) [-7427.783] (-7432.658) (-7433.934) -- 0:18:30 355000 -- (-7431.175) [-7429.121] (-7440.652) (-7435.635) * (-7435.099) (-7436.076) (-7430.438) [-7426.172] -- 0:18:30 Average standard deviation of split frequencies: 0.009970 355500 -- (-7437.957) [-7425.204] (-7435.229) (-7435.647) * (-7435.419) (-7443.272) [-7434.113] (-7429.660) -- 0:18:29 356000 -- (-7436.557) (-7431.600) (-7438.625) [-7426.519] * (-7430.930) (-7447.476) (-7438.944) [-7422.767] -- 0:18:28 356500 -- [-7431.026] (-7426.415) (-7442.247) (-7434.468) * [-7440.304] (-7431.579) (-7437.579) (-7428.069) -- 0:18:26 357000 -- [-7431.633] (-7427.070) (-7429.579) (-7433.750) * (-7436.246) (-7430.161) [-7430.090] (-7433.284) -- 0:18:25 357500 -- (-7433.568) [-7421.435] (-7437.768) (-7436.098) * (-7429.649) [-7437.704] (-7428.140) (-7435.225) -- 0:18:25 358000 -- [-7425.371] (-7424.050) (-7424.641) (-7439.627) * [-7433.426] (-7428.335) (-7441.929) (-7431.843) -- 0:18:24 358500 -- (-7437.001) [-7434.239] (-7432.412) (-7439.786) * (-7424.521) (-7429.070) (-7444.431) [-7429.502] -- 0:18:24 359000 -- (-7435.755) (-7443.698) [-7427.321] (-7437.706) * [-7427.558] (-7437.914) (-7437.976) (-7433.356) -- 0:18:23 359500 -- (-7439.497) (-7440.231) [-7437.461] (-7424.303) * [-7437.226] (-7436.637) (-7433.990) (-7431.663) -- 0:18:22 360000 -- (-7430.749) (-7438.909) (-7435.398) [-7423.981] * (-7433.671) (-7428.908) (-7445.365) [-7436.607] -- 0:18:20 Average standard deviation of split frequencies: 0.011071 360500 -- (-7432.733) (-7442.279) (-7440.398) [-7422.240] * (-7439.192) [-7428.924] (-7440.210) (-7423.571) -- 0:18:19 361000 -- (-7437.932) (-7441.022) (-7433.045) [-7431.126] * (-7435.753) (-7438.766) [-7433.651] (-7433.857) -- 0:18:19 361500 -- (-7428.927) [-7430.584] (-7422.086) (-7431.272) * (-7440.999) (-7446.579) (-7437.414) [-7436.245] -- 0:18:18 362000 -- [-7427.870] (-7443.381) (-7428.052) (-7427.934) * [-7425.528] (-7439.253) (-7422.664) (-7433.226) -- 0:18:17 362500 -- (-7428.128) (-7446.959) [-7432.313] (-7429.658) * (-7421.102) [-7431.280] (-7438.792) (-7425.707) -- 0:18:17 363000 -- (-7422.135) (-7434.033) (-7430.062) [-7436.121] * (-7431.955) (-7429.328) [-7438.700] (-7424.743) -- 0:18:16 363500 -- [-7430.511] (-7436.083) (-7428.359) (-7447.691) * (-7439.878) (-7434.468) (-7430.512) [-7427.811] -- 0:18:14 364000 -- (-7431.947) (-7436.111) [-7431.995] (-7434.634) * (-7433.350) (-7431.219) [-7440.908] (-7430.873) -- 0:18:13 364500 -- (-7433.112) (-7433.019) (-7442.553) [-7430.309] * (-7430.528) [-7429.176] (-7440.196) (-7434.902) -- 0:18:13 365000 -- (-7435.779) [-7428.382] (-7436.350) (-7443.562) * (-7424.398) [-7423.488] (-7445.589) (-7433.545) -- 0:18:12 Average standard deviation of split frequencies: 0.010152 365500 -- (-7438.060) (-7424.622) [-7425.114] (-7437.302) * (-7430.505) [-7436.775] (-7445.553) (-7429.766) -- 0:18:11 366000 -- (-7431.575) (-7446.340) [-7425.528] (-7442.581) * (-7433.678) (-7430.384) (-7452.418) [-7422.580] -- 0:18:11 366500 -- (-7431.172) (-7437.215) [-7426.685] (-7428.870) * (-7428.440) [-7433.058] (-7454.190) (-7420.895) -- 0:18:10 367000 -- (-7427.006) [-7432.758] (-7443.690) (-7431.714) * [-7433.358] (-7434.699) (-7437.262) (-7425.485) -- 0:18:08 367500 -- (-7432.596) (-7440.908) (-7442.264) [-7429.958] * (-7436.726) (-7429.190) [-7425.988] (-7439.959) -- 0:18:07 368000 -- [-7432.576] (-7442.370) (-7434.193) (-7428.928) * (-7439.901) (-7437.033) [-7431.615] (-7429.555) -- 0:18:07 368500 -- (-7433.904) (-7433.616) (-7430.336) [-7424.573] * (-7433.336) (-7440.970) (-7435.937) [-7429.600] -- 0:18:06 369000 -- (-7429.140) [-7427.999] (-7434.770) (-7433.812) * [-7433.448] (-7429.223) (-7436.299) (-7439.360) -- 0:18:05 369500 -- (-7433.615) [-7426.215] (-7428.831) (-7439.831) * (-7437.122) (-7432.722) [-7433.638] (-7438.376) -- 0:18:05 370000 -- [-7428.952] (-7426.987) (-7434.033) (-7439.368) * (-7441.542) (-7428.053) (-7434.508) [-7429.526] -- 0:18:02 Average standard deviation of split frequencies: 0.010922 370500 -- [-7432.223] (-7431.872) (-7439.991) (-7442.314) * [-7426.631] (-7436.846) (-7433.715) (-7440.281) -- 0:18:02 371000 -- (-7439.439) (-7434.259) [-7438.094] (-7435.835) * (-7425.570) [-7433.458] (-7431.583) (-7435.351) -- 0:18:01 371500 -- (-7433.037) [-7427.363] (-7438.137) (-7443.091) * [-7428.629] (-7427.037) (-7433.144) (-7438.941) -- 0:18:01 372000 -- (-7442.577) (-7428.426) [-7430.359] (-7443.310) * (-7437.628) (-7426.013) (-7433.781) [-7425.233] -- 0:18:00 372500 -- (-7438.880) (-7428.931) [-7426.187] (-7429.231) * [-7427.893] (-7435.648) (-7431.726) (-7428.116) -- 0:17:59 373000 -- (-7434.568) (-7428.571) (-7438.330) [-7434.709] * (-7440.157) (-7448.113) (-7427.175) [-7428.011] -- 0:17:59 373500 -- (-7430.515) (-7427.320) (-7428.961) [-7434.210] * (-7432.261) (-7434.869) (-7431.923) [-7426.583] -- 0:17:56 374000 -- [-7441.520] (-7437.765) (-7435.917) (-7434.227) * (-7433.408) [-7442.386] (-7437.537) (-7426.923) -- 0:17:56 374500 -- (-7438.852) [-7434.220] (-7451.055) (-7444.615) * (-7438.297) (-7433.494) (-7434.034) [-7438.203] -- 0:17:55 375000 -- (-7433.503) (-7431.337) [-7431.989] (-7436.502) * (-7435.083) (-7430.280) [-7434.611] (-7426.459) -- 0:17:55 Average standard deviation of split frequencies: 0.010104 375500 -- (-7437.054) (-7444.015) [-7431.252] (-7439.528) * [-7423.148] (-7440.456) (-7439.284) (-7434.652) -- 0:17:54 376000 -- (-7426.132) (-7435.897) [-7436.798] (-7435.020) * (-7431.149) (-7432.855) (-7435.772) [-7438.770] -- 0:17:53 376500 -- (-7432.094) (-7432.635) [-7428.234] (-7436.508) * (-7429.280) (-7443.195) [-7433.913] (-7439.173) -- 0:17:53 377000 -- [-7418.947] (-7430.263) (-7428.723) (-7433.747) * (-7441.581) (-7435.146) (-7440.366) [-7433.943] -- 0:17:50 377500 -- (-7429.284) [-7431.016] (-7436.140) (-7436.410) * (-7434.448) [-7431.372] (-7437.032) (-7429.588) -- 0:17:50 378000 -- (-7431.284) [-7422.964] (-7436.927) (-7428.212) * [-7425.514] (-7427.732) (-7440.666) (-7436.179) -- 0:17:49 378500 -- (-7436.294) [-7423.990] (-7439.104) (-7429.588) * [-7431.010] (-7428.829) (-7431.207) (-7432.743) -- 0:17:48 379000 -- (-7424.381) (-7423.624) [-7435.785] (-7439.284) * (-7429.326) (-7430.391) [-7421.971] (-7431.688) -- 0:17:48 379500 -- (-7433.503) (-7428.086) (-7435.564) [-7431.310] * [-7426.964] (-7432.286) (-7437.393) (-7440.631) -- 0:17:47 380000 -- (-7433.711) (-7432.076) (-7427.632) [-7428.535] * [-7429.759] (-7438.297) (-7436.399) (-7432.737) -- 0:17:45 Average standard deviation of split frequencies: 0.009907 380500 -- (-7426.991) (-7435.904) [-7432.944] (-7428.413) * (-7436.266) (-7439.131) [-7430.260] (-7428.807) -- 0:17:44 381000 -- [-7430.594] (-7433.885) (-7441.207) (-7435.603) * [-7441.519] (-7436.401) (-7425.585) (-7427.762) -- 0:17:44 381500 -- [-7425.364] (-7437.350) (-7437.574) (-7438.012) * [-7437.065] (-7444.329) (-7429.409) (-7441.766) -- 0:17:43 382000 -- (-7441.288) (-7448.814) [-7431.545] (-7441.066) * [-7429.103] (-7449.788) (-7431.489) (-7436.457) -- 0:17:42 382500 -- [-7430.347] (-7441.607) (-7446.139) (-7437.707) * (-7431.865) (-7428.420) [-7431.475] (-7430.884) -- 0:17:42 383000 -- [-7446.190] (-7443.092) (-7439.022) (-7425.209) * (-7443.720) [-7429.357] (-7436.284) (-7428.750) -- 0:17:41 383500 -- (-7429.418) (-7424.923) [-7432.202] (-7426.705) * [-7423.906] (-7430.193) (-7431.783) (-7438.449) -- 0:17:39 384000 -- (-7441.212) [-7431.407] (-7434.296) (-7433.324) * (-7435.873) (-7441.429) [-7441.319] (-7431.601) -- 0:17:38 384500 -- (-7438.825) (-7440.603) (-7434.231) [-7432.303] * (-7436.899) (-7440.034) [-7433.613] (-7431.930) -- 0:17:38 385000 -- (-7448.746) (-7442.818) (-7437.331) [-7424.036] * (-7434.255) [-7426.126] (-7431.676) (-7436.332) -- 0:17:37 Average standard deviation of split frequencies: 0.011063 385500 -- (-7440.911) [-7429.020] (-7430.846) (-7438.391) * (-7429.431) [-7426.170] (-7429.739) (-7440.770) -- 0:17:36 386000 -- (-7435.978) [-7431.572] (-7436.345) (-7438.801) * (-7436.704) (-7448.059) [-7437.439] (-7432.542) -- 0:17:36 386500 -- [-7433.482] (-7430.899) (-7444.012) (-7430.304) * (-7423.509) (-7445.388) [-7429.389] (-7425.971) -- 0:17:35 387000 -- (-7432.240) [-7436.181] (-7441.996) (-7428.886) * [-7426.683] (-7434.977) (-7433.080) (-7438.257) -- 0:17:33 387500 -- [-7429.258] (-7439.848) (-7440.316) (-7441.411) * [-7427.709] (-7436.618) (-7435.536) (-7436.064) -- 0:17:32 388000 -- [-7430.941] (-7433.508) (-7428.130) (-7434.700) * [-7424.997] (-7440.280) (-7432.060) (-7435.826) -- 0:17:32 388500 -- (-7439.552) (-7429.470) [-7433.826] (-7435.543) * [-7422.889] (-7439.635) (-7440.074) (-7431.388) -- 0:17:31 389000 -- (-7434.056) [-7424.032] (-7435.233) (-7431.612) * [-7425.824] (-7434.191) (-7435.101) (-7424.843) -- 0:17:30 389500 -- (-7456.705) [-7426.890] (-7432.644) (-7432.373) * (-7429.171) (-7435.423) [-7426.042] (-7430.834) -- 0:17:30 390000 -- (-7436.202) [-7431.959] (-7424.569) (-7437.009) * [-7429.303] (-7438.524) (-7428.421) (-7435.941) -- 0:17:27 Average standard deviation of split frequencies: 0.010647 390500 -- [-7422.405] (-7435.844) (-7430.949) (-7426.464) * [-7429.123] (-7433.759) (-7429.370) (-7427.849) -- 0:17:27 391000 -- (-7436.997) (-7433.501) [-7428.040] (-7436.587) * (-7438.892) (-7428.113) (-7430.306) [-7434.431] -- 0:17:26 391500 -- [-7434.868] (-7437.090) (-7426.119) (-7435.317) * (-7433.136) [-7440.578] (-7429.369) (-7441.152) -- 0:17:26 392000 -- (-7427.599) (-7436.750) [-7428.130] (-7437.256) * [-7432.787] (-7428.783) (-7426.030) (-7431.233) -- 0:17:25 392500 -- [-7428.674] (-7437.063) (-7443.752) (-7434.979) * (-7435.591) [-7429.722] (-7429.670) (-7432.391) -- 0:17:24 393000 -- (-7431.501) (-7436.715) (-7437.466) [-7429.279] * [-7426.707] (-7434.847) (-7433.016) (-7434.678) -- 0:17:24 393500 -- (-7442.378) (-7427.735) (-7444.716) [-7429.984] * (-7421.013) [-7434.326] (-7439.084) (-7447.668) -- 0:17:21 394000 -- [-7432.921] (-7444.713) (-7448.369) (-7431.081) * (-7426.894) (-7432.297) [-7426.536] (-7440.300) -- 0:17:21 394500 -- (-7437.066) (-7440.048) [-7429.457] (-7431.427) * (-7425.254) (-7437.253) [-7431.900] (-7437.042) -- 0:17:20 395000 -- (-7435.109) (-7431.476) [-7430.718] (-7432.370) * (-7429.533) (-7438.362) [-7431.155] (-7436.098) -- 0:17:19 Average standard deviation of split frequencies: 0.010294 395500 -- (-7433.047) [-7429.122] (-7434.179) (-7430.095) * [-7425.997] (-7422.668) (-7432.368) (-7437.827) -- 0:17:19 396000 -- (-7449.455) (-7437.072) (-7436.773) [-7426.475] * (-7426.301) [-7427.451] (-7432.877) (-7430.843) -- 0:17:18 396500 -- (-7429.833) (-7434.284) (-7442.803) [-7426.657] * [-7425.962] (-7428.520) (-7426.478) (-7431.064) -- 0:17:18 397000 -- (-7425.515) [-7432.269] (-7440.897) (-7435.047) * (-7429.480) [-7433.909] (-7433.776) (-7434.061) -- 0:17:15 397500 -- (-7432.970) (-7441.658) (-7448.028) [-7429.884] * [-7424.026] (-7432.500) (-7439.490) (-7430.762) -- 0:17:15 398000 -- [-7426.957] (-7439.185) (-7437.535) (-7437.468) * (-7430.862) (-7426.851) (-7424.709) [-7430.808] -- 0:17:14 398500 -- [-7423.956] (-7440.088) (-7432.658) (-7429.630) * (-7424.391) (-7436.659) [-7419.861] (-7435.208) -- 0:17:13 399000 -- (-7434.083) (-7447.892) [-7431.677] (-7440.920) * (-7428.973) [-7425.287] (-7424.213) (-7431.869) -- 0:17:13 399500 -- (-7428.732) [-7424.190] (-7429.450) (-7438.589) * [-7423.204] (-7430.705) (-7428.480) (-7429.755) -- 0:17:12 400000 -- (-7431.820) [-7431.546] (-7434.562) (-7443.733) * (-7431.835) [-7426.895] (-7429.848) (-7437.319) -- 0:17:12 Average standard deviation of split frequencies: 0.009897 400500 -- [-7428.102] (-7437.597) (-7438.245) (-7446.493) * (-7432.137) (-7425.379) [-7426.511] (-7439.762) -- 0:17:09 401000 -- (-7437.333) [-7431.860] (-7433.287) (-7443.358) * (-7442.103) (-7429.435) (-7430.781) [-7428.912] -- 0:17:09 401500 -- (-7429.104) (-7429.948) (-7441.196) [-7425.144] * (-7434.301) (-7428.027) [-7423.922] (-7435.810) -- 0:17:08 402000 -- (-7443.159) (-7433.714) (-7434.581) [-7427.423] * (-7452.425) (-7429.372) [-7437.147] (-7434.781) -- 0:17:07 402500 -- (-7439.795) (-7433.074) (-7444.641) [-7431.744] * (-7431.703) [-7425.027] (-7442.972) (-7426.423) -- 0:17:07 403000 -- (-7434.374) (-7433.887) (-7439.778) [-7424.588] * (-7428.420) [-7425.970] (-7430.895) (-7436.195) -- 0:17:06 403500 -- (-7439.596) (-7442.894) (-7441.426) [-7429.905] * [-7427.387] (-7426.716) (-7429.825) (-7429.612) -- 0:17:05 404000 -- [-7431.417] (-7435.879) (-7427.293) (-7434.486) * (-7434.135) (-7427.506) (-7440.688) [-7430.243] -- 0:17:03 404500 -- (-7431.106) [-7431.303] (-7440.548) (-7423.078) * (-7429.367) (-7434.184) [-7431.732] (-7441.321) -- 0:17:03 405000 -- (-7431.460) (-7439.001) (-7442.670) [-7428.815] * (-7435.235) (-7437.360) [-7428.473] (-7437.326) -- 0:17:02 Average standard deviation of split frequencies: 0.010177 405500 -- [-7436.666] (-7433.155) (-7430.089) (-7424.992) * (-7430.261) (-7427.493) [-7434.202] (-7446.705) -- 0:17:01 406000 -- (-7436.064) [-7433.608] (-7431.600) (-7438.391) * [-7428.318] (-7436.748) (-7429.772) (-7437.345) -- 0:17:01 406500 -- [-7424.020] (-7433.599) (-7424.369) (-7446.177) * [-7430.319] (-7429.195) (-7434.109) (-7439.838) -- 0:17:00 407000 -- (-7430.967) [-7425.758] (-7433.165) (-7429.805) * (-7432.638) (-7425.762) [-7428.417] (-7444.640) -- 0:16:59 407500 -- (-7436.114) (-7434.712) (-7440.151) [-7434.112] * (-7439.817) (-7436.541) [-7431.209] (-7450.863) -- 0:16:59 408000 -- (-7432.339) (-7437.406) (-7434.099) [-7430.964] * (-7437.148) (-7432.433) (-7433.043) [-7435.651] -- 0:16:58 408500 -- (-7451.888) (-7433.973) [-7430.876] (-7426.664) * (-7443.693) (-7433.938) (-7434.217) [-7428.489] -- 0:16:56 409000 -- (-7427.075) [-7430.084] (-7432.887) (-7432.851) * (-7433.251) (-7439.276) [-7425.802] (-7435.987) -- 0:16:55 409500 -- [-7428.963] (-7445.159) (-7430.429) (-7432.713) * [-7432.987] (-7432.230) (-7436.039) (-7434.691) -- 0:16:55 410000 -- (-7427.951) (-7444.425) [-7439.721] (-7435.759) * (-7442.777) (-7442.357) (-7428.021) [-7438.018] -- 0:16:54 Average standard deviation of split frequencies: 0.010196 410500 -- [-7428.451] (-7433.774) (-7427.938) (-7431.781) * (-7449.261) (-7436.890) [-7429.753] (-7432.122) -- 0:16:53 411000 -- (-7438.587) (-7440.336) [-7428.866] (-7430.342) * (-7444.340) (-7430.197) [-7430.040] (-7432.315) -- 0:16:53 411500 -- (-7435.328) (-7439.088) [-7427.452] (-7429.668) * (-7429.296) (-7428.960) (-7440.760) [-7432.020] -- 0:16:51 412000 -- (-7429.930) (-7438.389) (-7443.671) [-7421.967] * (-7440.092) (-7442.021) (-7437.737) [-7426.324] -- 0:16:50 412500 -- (-7438.333) [-7422.806] (-7432.801) (-7431.568) * [-7435.313] (-7438.335) (-7439.012) (-7430.165) -- 0:16:49 413000 -- (-7437.262) (-7431.236) [-7430.696] (-7428.396) * (-7434.521) [-7424.451] (-7433.777) (-7431.034) -- 0:16:49 413500 -- (-7424.152) (-7433.285) [-7427.971] (-7446.345) * [-7428.416] (-7430.148) (-7425.906) (-7440.161) -- 0:16:48 414000 -- (-7430.328) (-7444.317) [-7428.438] (-7432.262) * (-7426.997) [-7425.078] (-7441.188) (-7438.385) -- 0:16:47 414500 -- (-7436.776) (-7442.232) [-7425.079] (-7430.890) * [-7432.577] (-7435.660) (-7444.201) (-7438.167) -- 0:16:45 415000 -- (-7436.495) (-7433.513) [-7425.969] (-7432.810) * (-7430.080) (-7439.739) [-7427.536] (-7433.307) -- 0:16:45 Average standard deviation of split frequencies: 0.009332 415500 -- (-7433.407) (-7437.080) [-7425.681] (-7429.892) * (-7437.487) (-7445.922) (-7425.529) [-7432.533] -- 0:16:44 416000 -- (-7440.068) (-7434.164) [-7424.194] (-7430.935) * (-7438.374) [-7433.258] (-7436.046) (-7430.403) -- 0:16:43 416500 -- (-7444.004) (-7438.423) [-7426.966] (-7441.038) * (-7443.549) [-7440.249] (-7433.253) (-7430.650) -- 0:16:43 417000 -- (-7439.653) (-7432.150) [-7423.921] (-7434.601) * (-7435.086) [-7424.062] (-7433.212) (-7436.008) -- 0:16:42 417500 -- (-7436.773) (-7431.198) [-7432.291] (-7434.019) * (-7439.558) (-7436.221) [-7428.442] (-7427.245) -- 0:16:41 418000 -- (-7431.931) [-7435.024] (-7435.391) (-7431.518) * (-7434.436) (-7435.770) (-7434.288) [-7422.397] -- 0:16:39 418500 -- [-7427.066] (-7441.834) (-7433.965) (-7433.272) * (-7432.856) (-7435.571) [-7441.336] (-7427.270) -- 0:16:39 419000 -- [-7432.249] (-7437.077) (-7437.198) (-7429.894) * [-7427.315] (-7429.169) (-7429.791) (-7441.798) -- 0:16:38 419500 -- [-7425.983] (-7455.007) (-7446.233) (-7436.831) * (-7431.779) (-7430.919) [-7423.688] (-7438.252) -- 0:16:37 420000 -- (-7439.117) (-7430.984) (-7444.629) [-7440.703] * (-7436.530) [-7429.187] (-7436.185) (-7438.605) -- 0:16:37 Average standard deviation of split frequencies: 0.009229 420500 -- [-7430.220] (-7429.329) (-7434.270) (-7438.532) * [-7439.669] (-7443.588) (-7430.461) (-7434.031) -- 0:16:36 421000 -- (-7433.294) (-7427.476) [-7437.733] (-7439.063) * (-7435.529) (-7445.356) [-7432.894] (-7443.763) -- 0:16:34 421500 -- [-7433.688] (-7424.190) (-7433.587) (-7433.552) * (-7431.007) [-7434.708] (-7433.652) (-7442.639) -- 0:16:33 422000 -- (-7430.763) (-7434.915) (-7433.429) [-7430.666] * [-7428.811] (-7437.324) (-7437.853) (-7431.591) -- 0:16:33 422500 -- [-7427.591] (-7427.669) (-7434.022) (-7434.951) * (-7447.136) (-7433.318) (-7431.306) [-7422.892] -- 0:16:32 423000 -- (-7431.835) (-7430.686) (-7427.317) [-7426.672] * (-7441.673) (-7442.931) (-7431.395) [-7429.591] -- 0:16:31 423500 -- (-7437.360) [-7426.750] (-7427.123) (-7426.523) * (-7442.460) (-7447.784) [-7429.116] (-7432.499) -- 0:16:31 424000 -- (-7444.066) [-7427.631] (-7432.119) (-7431.878) * (-7444.132) (-7430.428) (-7428.408) [-7426.623] -- 0:16:28 424500 -- (-7443.350) [-7433.905] (-7428.828) (-7426.369) * (-7428.749) (-7442.881) [-7428.053] (-7426.892) -- 0:16:28 425000 -- (-7427.179) [-7429.805] (-7431.001) (-7433.216) * (-7440.722) (-7436.925) [-7426.866] (-7439.244) -- 0:16:27 Average standard deviation of split frequencies: 0.009373 425500 -- [-7430.569] (-7443.433) (-7437.398) (-7430.688) * (-7431.450) (-7433.935) [-7420.497] (-7431.674) -- 0:16:26 426000 -- (-7428.728) (-7439.786) (-7433.361) [-7424.260] * [-7431.110] (-7428.339) (-7431.812) (-7438.043) -- 0:16:26 426500 -- [-7431.862] (-7438.499) (-7431.919) (-7430.908) * (-7441.907) (-7430.850) (-7426.264) [-7437.793] -- 0:16:25 427000 -- (-7437.018) (-7435.048) (-7428.619) [-7425.570] * (-7441.227) [-7428.624] (-7438.649) (-7435.438) -- 0:16:24 427500 -- (-7442.604) (-7436.662) [-7423.748] (-7432.942) * (-7441.099) (-7431.962) (-7432.259) [-7428.543] -- 0:16:22 428000 -- (-7437.571) (-7441.298) [-7433.183] (-7434.156) * (-7434.262) (-7434.882) [-7426.098] (-7435.736) -- 0:16:22 428500 -- (-7447.776) [-7437.890] (-7430.514) (-7444.227) * [-7423.056] (-7436.089) (-7436.205) (-7441.885) -- 0:16:21 429000 -- (-7439.050) (-7434.466) (-7436.871) [-7437.387] * [-7423.510] (-7434.016) (-7433.203) (-7442.262) -- 0:16:20 429500 -- (-7434.573) (-7445.013) (-7437.971) [-7434.537] * (-7426.952) (-7439.928) [-7435.313] (-7437.149) -- 0:16:20 430000 -- (-7427.329) [-7427.325] (-7428.396) (-7437.386) * (-7428.788) (-7437.851) (-7437.074) [-7430.723] -- 0:16:19 Average standard deviation of split frequencies: 0.009207 430500 -- (-7434.481) (-7439.589) [-7432.592] (-7440.306) * [-7428.474] (-7437.223) (-7435.787) (-7431.446) -- 0:16:17 431000 -- (-7447.377) (-7428.652) (-7446.351) [-7425.650] * (-7432.110) [-7429.375] (-7435.349) (-7440.372) -- 0:16:16 431500 -- (-7436.803) (-7430.010) (-7435.653) [-7424.352] * (-7437.365) (-7429.865) [-7428.777] (-7438.180) -- 0:16:16 432000 -- [-7426.247] (-7444.196) (-7447.872) (-7426.470) * (-7428.677) [-7432.257] (-7427.041) (-7431.228) -- 0:16:15 432500 -- [-7426.016] (-7440.283) (-7445.210) (-7432.151) * (-7425.172) (-7432.319) [-7423.684] (-7435.939) -- 0:16:14 433000 -- (-7431.155) (-7434.435) (-7440.599) [-7442.533] * (-7427.196) (-7432.760) [-7430.594] (-7435.969) -- 0:16:14 433500 -- [-7437.625] (-7442.083) (-7436.547) (-7448.350) * [-7423.903] (-7431.038) (-7443.387) (-7439.424) -- 0:16:12 434000 -- [-7436.441] (-7436.154) (-7429.865) (-7444.023) * [-7427.716] (-7457.566) (-7449.090) (-7430.621) -- 0:16:11 434500 -- (-7426.548) [-7428.316] (-7435.883) (-7437.935) * [-7435.145] (-7440.610) (-7445.441) (-7438.508) -- 0:16:10 435000 -- (-7427.096) [-7426.922] (-7435.718) (-7434.845) * (-7432.337) (-7441.711) (-7439.794) [-7430.026] -- 0:16:10 Average standard deviation of split frequencies: 0.010112 435500 -- (-7428.257) (-7432.650) (-7434.374) [-7427.179] * [-7427.588] (-7436.959) (-7430.971) (-7455.170) -- 0:16:09 436000 -- (-7428.526) [-7432.273] (-7440.566) (-7421.570) * [-7432.086] (-7437.715) (-7435.611) (-7430.048) -- 0:16:08 436500 -- (-7435.538) [-7428.226] (-7437.959) (-7428.853) * (-7436.202) [-7425.130] (-7429.408) (-7443.195) -- 0:16:06 437000 -- (-7446.728) [-7443.929] (-7436.569) (-7429.247) * (-7441.822) [-7423.507] (-7432.361) (-7443.738) -- 0:16:06 437500 -- [-7429.967] (-7453.209) (-7442.073) (-7431.196) * (-7441.861) [-7424.384] (-7433.484) (-7430.852) -- 0:16:05 438000 -- (-7433.677) (-7449.287) (-7437.551) [-7434.071] * (-7427.930) [-7426.701] (-7440.812) (-7451.607) -- 0:16:04 438500 -- [-7431.619] (-7456.248) (-7435.574) (-7434.933) * (-7438.659) (-7432.692) [-7431.107] (-7432.519) -- 0:16:04 439000 -- (-7430.477) (-7438.133) [-7433.028] (-7430.979) * (-7431.813) (-7430.959) (-7440.045) [-7424.625] -- 0:16:03 439500 -- (-7436.841) (-7435.572) (-7445.047) [-7433.437] * (-7435.150) (-7428.073) (-7434.025) [-7429.456] -- 0:16:02 440000 -- (-7440.372) (-7428.038) [-7428.728] (-7437.148) * (-7435.912) [-7433.352] (-7429.382) (-7431.630) -- 0:16:00 Average standard deviation of split frequencies: 0.009628 440500 -- (-7436.630) (-7431.163) [-7429.687] (-7444.287) * (-7433.754) (-7441.270) [-7425.210] (-7427.554) -- 0:16:00 441000 -- (-7439.326) (-7426.848) (-7431.453) [-7426.000] * (-7434.538) (-7447.135) (-7430.612) [-7426.792] -- 0:15:59 441500 -- (-7446.392) [-7427.172] (-7433.994) (-7442.856) * [-7429.236] (-7442.166) (-7439.470) (-7428.511) -- 0:15:58 442000 -- (-7444.940) (-7432.413) [-7430.043] (-7439.638) * (-7434.425) (-7436.458) (-7429.085) [-7422.090] -- 0:15:58 442500 -- (-7431.288) [-7441.692] (-7445.834) (-7438.311) * [-7437.297] (-7434.825) (-7437.254) (-7430.404) -- 0:15:57 443000 -- [-7430.625] (-7430.959) (-7436.791) (-7432.721) * (-7435.777) (-7436.334) (-7434.574) [-7424.536] -- 0:15:56 443500 -- [-7427.593] (-7432.657) (-7425.349) (-7430.358) * (-7446.769) (-7435.802) [-7434.419] (-7432.772) -- 0:15:54 444000 -- (-7433.349) (-7433.561) (-7426.893) [-7431.211] * (-7440.658) (-7439.637) [-7436.891] (-7434.120) -- 0:15:54 444500 -- (-7436.237) (-7448.713) [-7425.904] (-7440.334) * [-7427.288] (-7429.055) (-7442.018) (-7431.026) -- 0:15:53 445000 -- (-7439.109) (-7446.148) [-7433.599] (-7439.419) * (-7435.369) [-7429.040] (-7437.986) (-7430.386) -- 0:15:52 Average standard deviation of split frequencies: 0.009077 445500 -- (-7431.775) (-7433.372) [-7431.043] (-7434.689) * (-7439.653) (-7427.591) (-7432.065) [-7436.233] -- 0:15:52 446000 -- (-7438.463) (-7442.156) [-7432.901] (-7428.085) * [-7435.248] (-7431.916) (-7439.017) (-7436.952) -- 0:15:51 446500 -- (-7437.667) (-7436.117) (-7430.650) [-7430.668] * (-7424.255) (-7436.607) (-7434.103) [-7439.399] -- 0:15:49 447000 -- (-7450.062) (-7427.494) [-7422.717] (-7431.141) * [-7434.749] (-7431.383) (-7434.568) (-7431.323) -- 0:15:48 447500 -- [-7429.746] (-7437.934) (-7434.058) (-7435.345) * (-7444.064) [-7421.748] (-7434.347) (-7440.577) -- 0:15:48 448000 -- (-7436.492) [-7432.800] (-7430.646) (-7431.943) * (-7441.319) [-7425.715] (-7436.395) (-7448.214) -- 0:15:47 448500 -- (-7431.688) (-7429.222) (-7433.893) [-7434.596] * (-7434.585) (-7428.177) [-7440.241] (-7440.833) -- 0:15:46 449000 -- (-7425.620) [-7431.473] (-7438.537) (-7434.490) * (-7435.505) (-7429.823) (-7433.305) [-7427.231] -- 0:15:46 449500 -- (-7432.351) [-7437.119] (-7438.067) (-7438.216) * (-7425.027) [-7433.429] (-7435.840) (-7425.632) -- 0:15:45 450000 -- (-7429.125) (-7430.352) (-7433.789) [-7428.608] * (-7436.377) (-7432.156) [-7429.494] (-7436.217) -- 0:15:43 Average standard deviation of split frequencies: 0.009414 450500 -- (-7435.122) [-7434.541] (-7434.888) (-7434.959) * (-7428.052) (-7426.210) (-7439.575) [-7429.281] -- 0:15:42 451000 -- [-7433.313] (-7426.280) (-7433.659) (-7427.507) * (-7435.984) (-7442.333) [-7432.459] (-7430.108) -- 0:15:42 451500 -- [-7432.882] (-7427.404) (-7426.127) (-7436.266) * (-7431.427) (-7432.424) (-7434.918) [-7424.920] -- 0:15:41 452000 -- (-7430.459) (-7425.257) [-7423.685] (-7440.975) * (-7436.426) [-7425.283] (-7427.961) (-7429.171) -- 0:15:40 452500 -- (-7433.920) (-7430.067) [-7428.208] (-7431.190) * (-7438.575) (-7436.980) [-7433.096] (-7432.138) -- 0:15:40 453000 -- (-7443.225) (-7432.074) (-7441.197) [-7429.134] * (-7426.030) (-7445.500) (-7432.462) [-7432.308] -- 0:15:38 453500 -- (-7444.534) (-7432.601) (-7436.838) [-7422.306] * [-7419.894] (-7435.072) (-7440.118) (-7435.659) -- 0:15:37 454000 -- (-7437.342) (-7440.165) [-7427.554] (-7434.774) * [-7428.607] (-7433.193) (-7436.630) (-7435.468) -- 0:15:36 454500 -- [-7425.774] (-7426.287) (-7440.052) (-7430.716) * [-7427.867] (-7434.397) (-7432.290) (-7433.288) -- 0:15:36 455000 -- [-7426.477] (-7429.821) (-7435.566) (-7428.398) * [-7422.365] (-7437.315) (-7447.034) (-7424.157) -- 0:15:35 Average standard deviation of split frequencies: 0.009912 455500 -- (-7433.789) (-7436.248) (-7439.450) [-7432.179] * [-7439.741] (-7436.583) (-7438.280) (-7424.675) -- 0:15:34 456000 -- (-7438.745) (-7429.540) (-7437.854) [-7430.494] * (-7432.814) (-7440.481) (-7434.175) [-7432.756] -- 0:15:34 456500 -- (-7434.956) [-7426.998] (-7430.015) (-7438.751) * [-7429.849] (-7438.107) (-7422.773) (-7427.689) -- 0:15:32 457000 -- [-7436.285] (-7438.727) (-7432.230) (-7434.843) * [-7425.484] (-7427.941) (-7432.205) (-7449.068) -- 0:15:31 457500 -- [-7441.692] (-7430.628) (-7433.551) (-7454.059) * (-7425.335) (-7431.129) [-7425.881] (-7435.348) -- 0:15:30 458000 -- (-7446.519) (-7440.811) (-7438.395) [-7438.030] * (-7429.140) [-7425.214] (-7428.071) (-7430.861) -- 0:15:30 458500 -- (-7435.386) [-7426.720] (-7430.171) (-7444.396) * (-7431.960) [-7427.606] (-7436.797) (-7429.634) -- 0:15:29 459000 -- [-7431.164] (-7428.025) (-7433.652) (-7443.426) * (-7428.302) (-7435.165) (-7434.680) [-7427.813] -- 0:15:28 459500 -- (-7436.980) (-7432.538) [-7433.759] (-7429.917) * (-7425.028) (-7434.774) (-7438.959) [-7423.691] -- 0:15:26 460000 -- (-7442.021) (-7436.145) (-7437.987) [-7437.743] * (-7436.235) (-7435.308) [-7426.853] (-7424.184) -- 0:15:26 Average standard deviation of split frequencies: 0.009691 460500 -- (-7433.658) (-7438.007) (-7430.881) [-7439.579] * (-7425.366) (-7432.230) [-7429.974] (-7432.051) -- 0:15:25 461000 -- (-7431.607) (-7442.718) (-7437.216) [-7427.142] * (-7426.469) (-7441.510) [-7440.321] (-7436.905) -- 0:15:24 461500 -- (-7429.849) (-7433.187) [-7429.847] (-7430.645) * [-7434.159] (-7435.951) (-7431.200) (-7436.314) -- 0:15:24 462000 -- (-7431.020) (-7445.476) [-7430.450] (-7430.792) * (-7423.526) (-7429.484) (-7437.943) [-7426.997] -- 0:15:23 462500 -- (-7435.960) (-7445.756) (-7434.575) [-7436.780] * (-7433.650) [-7432.188] (-7432.559) (-7423.968) -- 0:15:22 463000 -- (-7451.871) (-7440.125) (-7436.719) [-7432.285] * (-7441.057) (-7435.016) (-7439.701) [-7426.082] -- 0:15:20 463500 -- (-7436.906) [-7434.990] (-7433.891) (-7437.773) * (-7431.516) (-7431.318) [-7427.249] (-7434.536) -- 0:15:20 464000 -- (-7436.644) (-7432.348) (-7439.832) [-7423.949] * (-7436.344) (-7433.524) [-7426.374] (-7438.692) -- 0:15:19 464500 -- (-7437.789) (-7436.120) [-7434.807] (-7436.846) * (-7435.908) (-7444.141) [-7431.519] (-7430.594) -- 0:15:18 465000 -- [-7431.919] (-7434.554) (-7443.658) (-7433.171) * [-7436.000] (-7442.112) (-7435.691) (-7430.163) -- 0:15:18 Average standard deviation of split frequencies: 0.007914 465500 -- (-7437.806) [-7433.485] (-7427.517) (-7435.840) * [-7432.627] (-7431.648) (-7436.876) (-7435.716) -- 0:15:17 466000 -- (-7432.069) [-7433.669] (-7438.741) (-7428.120) * (-7438.367) (-7429.359) [-7439.411] (-7434.634) -- 0:15:15 466500 -- (-7426.902) (-7431.703) [-7438.186] (-7442.057) * (-7443.823) (-7426.448) [-7430.219] (-7426.449) -- 0:15:14 467000 -- [-7428.538] (-7433.614) (-7434.550) (-7430.062) * (-7439.579) (-7432.749) [-7433.939] (-7434.233) -- 0:15:14 467500 -- [-7427.778] (-7438.139) (-7434.599) (-7439.445) * (-7433.395) (-7430.389) (-7431.776) [-7430.337] -- 0:15:13 468000 -- [-7429.523] (-7449.922) (-7433.150) (-7431.264) * (-7438.812) (-7428.821) (-7433.747) [-7433.446] -- 0:15:12 468500 -- [-7435.653] (-7436.481) (-7431.598) (-7429.658) * (-7432.451) (-7429.154) (-7437.963) [-7431.264] -- 0:15:12 469000 -- (-7426.006) (-7432.039) (-7439.087) [-7434.617] * (-7434.032) (-7436.942) (-7447.710) [-7432.619] -- 0:15:11 469500 -- (-7438.274) (-7434.740) [-7429.905] (-7436.457) * [-7432.810] (-7435.802) (-7444.226) (-7430.093) -- 0:15:09 470000 -- (-7434.534) (-7444.056) [-7437.235] (-7434.912) * (-7428.445) (-7438.707) [-7435.701] (-7428.082) -- 0:15:08 Average standard deviation of split frequencies: 0.007836 470500 -- (-7435.124) (-7440.592) [-7427.855] (-7435.835) * [-7431.607] (-7436.230) (-7435.054) (-7432.258) -- 0:15:08 471000 -- (-7441.774) (-7441.100) (-7432.703) [-7435.322] * (-7436.077) (-7427.141) [-7431.132] (-7434.408) -- 0:15:07 471500 -- (-7437.587) (-7431.767) [-7430.776] (-7446.123) * (-7434.354) [-7436.302] (-7435.968) (-7433.714) -- 0:15:06 472000 -- (-7436.775) (-7429.131) [-7434.008] (-7442.639) * [-7422.082] (-7424.406) (-7427.918) (-7432.604) -- 0:15:06 472500 -- (-7438.598) (-7431.806) (-7444.896) [-7429.442] * (-7432.366) [-7427.716] (-7431.884) (-7433.611) -- 0:15:04 473000 -- (-7434.106) [-7427.017] (-7439.330) (-7424.011) * (-7431.141) (-7437.765) [-7427.428] (-7452.532) -- 0:15:03 473500 -- [-7422.615] (-7433.283) (-7429.054) (-7426.152) * (-7428.055) [-7427.459] (-7431.378) (-7444.032) -- 0:15:02 474000 -- (-7428.232) [-7429.120] (-7432.744) (-7425.320) * (-7429.738) (-7431.670) [-7426.979] (-7443.200) -- 0:15:02 474500 -- (-7429.098) (-7432.785) [-7427.639] (-7427.452) * [-7429.800] (-7432.380) (-7434.055) (-7435.837) -- 0:15:01 475000 -- [-7429.204] (-7434.637) (-7431.967) (-7427.243) * [-7421.100] (-7443.702) (-7436.585) (-7436.181) -- 0:15:00 Average standard deviation of split frequencies: 0.007282 475500 -- [-7420.615] (-7434.358) (-7429.755) (-7429.356) * (-7430.955) (-7445.172) [-7431.539] (-7435.862) -- 0:15:00 476000 -- (-7428.675) [-7432.560] (-7437.454) (-7432.428) * [-7429.423] (-7430.350) (-7437.566) (-7432.929) -- 0:14:58 476500 -- (-7428.036) [-7422.549] (-7431.765) (-7432.961) * [-7427.602] (-7431.302) (-7436.492) (-7449.566) -- 0:14:57 477000 -- (-7429.958) (-7433.185) (-7433.913) [-7432.305] * (-7432.893) [-7435.222] (-7435.873) (-7430.882) -- 0:14:56 477500 -- (-7436.889) (-7427.380) (-7444.152) [-7427.156] * (-7443.234) (-7432.997) [-7433.381] (-7432.158) -- 0:14:56 478000 -- (-7440.435) (-7430.986) [-7434.168] (-7428.559) * (-7432.285) (-7430.748) (-7436.566) [-7438.021] -- 0:14:55 478500 -- (-7439.037) (-7435.686) (-7430.440) [-7430.370] * [-7425.140] (-7429.671) (-7450.836) (-7437.324) -- 0:14:54 479000 -- [-7428.272] (-7442.265) (-7442.936) (-7428.158) * [-7425.030] (-7452.040) (-7441.556) (-7434.436) -- 0:14:52 479500 -- (-7436.261) [-7426.130] (-7435.289) (-7433.741) * (-7427.021) [-7439.213] (-7442.883) (-7426.543) -- 0:14:52 480000 -- [-7434.312] (-7436.265) (-7435.768) (-7456.200) * (-7424.422) [-7431.516] (-7424.778) (-7436.537) -- 0:14:51 Average standard deviation of split frequencies: 0.008077 480500 -- (-7440.103) (-7429.078) (-7425.236) [-7427.695] * (-7431.964) (-7431.928) [-7430.225] (-7438.380) -- 0:14:50 481000 -- [-7427.310] (-7432.878) (-7426.924) (-7430.008) * (-7442.353) (-7441.774) [-7429.115] (-7436.433) -- 0:14:50 481500 -- (-7432.233) (-7435.401) [-7425.220] (-7431.091) * (-7428.068) (-7428.788) (-7437.525) [-7428.718] -- 0:14:49 482000 -- [-7426.195] (-7429.960) (-7438.996) (-7428.118) * (-7429.989) (-7430.045) [-7425.957] (-7436.151) -- 0:14:48 482500 -- (-7431.565) [-7438.652] (-7441.658) (-7438.167) * (-7437.900) (-7431.355) (-7432.606) [-7429.541] -- 0:14:46 483000 -- (-7439.676) (-7436.586) [-7432.064] (-7429.836) * [-7433.587] (-7437.418) (-7425.342) (-7437.017) -- 0:14:46 483500 -- [-7433.979] (-7429.187) (-7448.224) (-7436.114) * [-7436.696] (-7431.165) (-7434.588) (-7449.047) -- 0:14:45 484000 -- [-7435.326] (-7430.041) (-7433.784) (-7441.741) * (-7423.456) [-7432.186] (-7439.775) (-7432.860) -- 0:14:44 484500 -- (-7438.435) (-7435.187) (-7435.024) [-7435.030] * [-7427.621] (-7443.021) (-7427.854) (-7443.317) -- 0:14:44 485000 -- (-7430.769) (-7427.777) (-7439.661) [-7429.327] * [-7434.240] (-7443.402) (-7428.223) (-7432.857) -- 0:14:43 Average standard deviation of split frequencies: 0.007760 485500 -- (-7440.676) (-7435.557) [-7432.013] (-7430.306) * (-7435.974) (-7448.916) [-7432.034] (-7439.271) -- 0:14:42 486000 -- (-7435.297) (-7448.058) [-7428.456] (-7429.814) * (-7428.338) (-7433.258) [-7434.967] (-7440.353) -- 0:14:40 486500 -- [-7431.051] (-7443.953) (-7433.907) (-7436.628) * (-7433.957) [-7430.261] (-7431.070) (-7439.496) -- 0:14:40 487000 -- [-7426.712] (-7442.441) (-7429.477) (-7443.295) * (-7433.207) (-7433.012) [-7421.559] (-7430.665) -- 0:14:39 487500 -- (-7437.896) (-7427.934) [-7430.616] (-7440.325) * (-7433.502) (-7431.441) [-7424.122] (-7437.294) -- 0:14:38 488000 -- (-7446.295) (-7432.259) (-7431.907) [-7435.606] * (-7452.823) (-7435.927) [-7425.144] (-7437.600) -- 0:14:38 488500 -- (-7436.035) (-7431.102) [-7425.653] (-7431.354) * (-7446.359) (-7435.259) [-7432.439] (-7449.525) -- 0:14:37 489000 -- [-7438.483] (-7428.891) (-7430.835) (-7428.279) * (-7440.384) (-7437.877) (-7428.275) [-7432.757] -- 0:14:35 489500 -- (-7434.652) [-7434.054] (-7432.824) (-7431.796) * (-7438.571) (-7440.141) (-7434.746) [-7429.815] -- 0:14:34 490000 -- (-7433.969) (-7441.484) [-7422.285] (-7426.979) * (-7435.046) (-7439.004) [-7431.233] (-7432.015) -- 0:14:34 Average standard deviation of split frequencies: 0.008082 490500 -- (-7433.429) [-7430.563] (-7431.618) (-7435.603) * (-7433.352) (-7441.537) (-7433.351) [-7435.258] -- 0:14:33 491000 -- (-7431.085) [-7435.722] (-7424.738) (-7437.181) * [-7429.362] (-7432.563) (-7440.487) (-7430.239) -- 0:14:32 491500 -- (-7430.774) (-7432.962) [-7429.820] (-7440.567) * (-7432.818) (-7446.923) [-7423.434] (-7427.020) -- 0:14:32 492000 -- (-7435.071) (-7437.940) [-7428.019] (-7440.491) * (-7431.836) (-7443.305) (-7438.615) [-7431.393] -- 0:14:30 492500 -- [-7428.922] (-7434.917) (-7445.154) (-7432.278) * (-7430.097) (-7439.303) (-7443.053) [-7430.770] -- 0:14:29 493000 -- (-7436.930) [-7431.963] (-7431.349) (-7442.847) * [-7431.350] (-7431.793) (-7441.684) (-7434.722) -- 0:14:28 493500 -- (-7434.447) (-7436.078) (-7423.811) [-7429.182] * (-7431.583) (-7433.774) (-7431.888) [-7426.875] -- 0:14:28 494000 -- [-7432.603] (-7448.251) (-7431.471) (-7428.244) * (-7431.651) (-7429.021) (-7427.117) [-7429.841] -- 0:14:27 494500 -- [-7425.787] (-7434.799) (-7448.671) (-7426.842) * (-7433.083) [-7428.194] (-7436.070) (-7427.384) -- 0:14:26 495000 -- (-7438.201) (-7452.203) (-7433.690) [-7421.155] * (-7433.087) [-7433.293] (-7441.235) (-7431.666) -- 0:14:26 Average standard deviation of split frequencies: 0.008051 495500 -- (-7433.498) (-7436.110) [-7426.063] (-7432.895) * (-7420.425) (-7435.035) (-7434.880) [-7434.511] -- 0:14:24 496000 -- (-7434.411) (-7434.557) (-7438.957) [-7428.756] * (-7429.354) (-7434.318) [-7429.768] (-7435.596) -- 0:14:23 496500 -- [-7432.510] (-7428.909) (-7444.910) (-7434.283) * (-7438.057) (-7430.897) [-7432.345] (-7436.960) -- 0:14:22 497000 -- (-7438.861) [-7432.590] (-7437.733) (-7431.886) * [-7428.475] (-7428.268) (-7430.844) (-7442.456) -- 0:14:22 497500 -- [-7426.777] (-7434.880) (-7435.738) (-7437.762) * (-7434.640) (-7438.239) [-7423.185] (-7446.277) -- 0:14:21 498000 -- (-7441.680) [-7425.655] (-7430.126) (-7430.384) * [-7429.237] (-7434.898) (-7423.389) (-7437.357) -- 0:14:20 498500 -- (-7428.977) [-7426.541] (-7437.328) (-7432.602) * (-7431.153) [-7433.395] (-7443.687) (-7436.818) -- 0:14:20 499000 -- (-7448.987) (-7432.436) (-7429.176) [-7435.293] * [-7426.764] (-7440.203) (-7433.332) (-7432.738) -- 0:14:18 499500 -- (-7433.451) (-7438.515) [-7427.809] (-7424.950) * (-7424.454) [-7424.770] (-7433.295) (-7431.142) -- 0:14:17 500000 -- (-7434.924) (-7441.036) (-7432.541) [-7426.794] * (-7432.092) [-7432.811] (-7432.269) (-7429.069) -- 0:14:17 Average standard deviation of split frequencies: 0.007754 500500 -- (-7430.079) [-7440.459] (-7432.662) (-7433.346) * (-7434.269) (-7426.765) (-7437.423) [-7431.920] -- 0:14:16 501000 -- (-7424.135) (-7437.059) [-7427.300] (-7431.190) * (-7422.093) [-7424.493] (-7433.502) (-7426.441) -- 0:14:15 501500 -- [-7427.436] (-7435.724) (-7436.128) (-7440.470) * [-7432.185] (-7429.021) (-7430.882) (-7433.492) -- 0:14:14 502000 -- (-7436.929) (-7431.447) [-7428.850] (-7452.043) * (-7428.198) (-7431.025) (-7434.885) [-7426.068] -- 0:14:13 502500 -- (-7443.366) [-7427.991] (-7434.391) (-7440.427) * (-7433.353) (-7436.591) [-7432.596] (-7423.265) -- 0:14:12 503000 -- (-7451.599) [-7424.326] (-7443.799) (-7431.563) * (-7426.125) (-7441.397) (-7443.594) [-7423.616] -- 0:14:11 503500 -- (-7444.983) [-7436.857] (-7441.338) (-7435.705) * (-7432.701) [-7432.856] (-7453.161) (-7426.889) -- 0:14:11 504000 -- (-7436.993) [-7428.237] (-7433.089) (-7437.331) * (-7428.807) (-7434.888) (-7435.275) [-7427.239] -- 0:14:10 504500 -- [-7429.374] (-7437.625) (-7433.198) (-7435.468) * (-7439.671) [-7430.835] (-7430.421) (-7437.215) -- 0:14:09 505000 -- [-7427.437] (-7433.704) (-7430.892) (-7433.034) * (-7439.686) [-7434.016] (-7434.700) (-7438.893) -- 0:14:07 Average standard deviation of split frequencies: 0.007343 505500 -- (-7430.959) [-7426.005] (-7430.609) (-7426.891) * (-7431.382) (-7443.981) (-7443.866) [-7430.419] -- 0:14:07 506000 -- [-7432.191] (-7427.490) (-7435.787) (-7430.655) * (-7439.995) (-7428.268) (-7436.429) [-7432.411] -- 0:14:06 506500 -- (-7432.519) (-7429.271) (-7437.240) [-7428.698] * (-7435.663) (-7431.415) (-7426.357) [-7431.536] -- 0:14:05 507000 -- (-7437.979) (-7436.658) [-7432.006] (-7427.731) * [-7429.275] (-7429.901) (-7433.944) (-7433.629) -- 0:14:05 507500 -- (-7439.818) (-7436.207) [-7430.952] (-7434.249) * [-7422.006] (-7431.046) (-7433.017) (-7434.738) -- 0:14:04 508000 -- [-7425.405] (-7440.150) (-7441.509) (-7434.381) * (-7437.087) (-7429.225) (-7436.753) [-7435.928] -- 0:14:03 508500 -- [-7432.464] (-7439.470) (-7447.367) (-7448.172) * [-7428.412] (-7427.435) (-7439.893) (-7430.817) -- 0:14:01 509000 -- (-7423.693) [-7428.536] (-7447.715) (-7429.651) * (-7434.323) (-7445.538) (-7433.129) [-7431.064] -- 0:14:01 509500 -- (-7437.330) (-7433.088) (-7432.804) [-7427.932] * (-7438.870) (-7435.824) [-7437.390] (-7433.666) -- 0:14:00 510000 -- (-7435.587) (-7431.120) (-7428.837) [-7428.700] * (-7436.847) (-7440.664) (-7435.614) [-7425.284] -- 0:13:59 Average standard deviation of split frequencies: 0.007222 510500 -- (-7430.367) (-7435.210) (-7436.765) [-7425.315] * [-7432.292] (-7427.785) (-7432.549) (-7437.257) -- 0:13:59 511000 -- (-7430.469) [-7427.753] (-7437.487) (-7434.066) * (-7429.937) [-7427.868] (-7429.128) (-7448.613) -- 0:13:58 511500 -- [-7428.026] (-7443.614) (-7450.093) (-7429.905) * (-7426.965) [-7431.813] (-7434.375) (-7440.717) -- 0:13:57 512000 -- (-7436.984) [-7425.855] (-7433.180) (-7425.360) * (-7432.247) (-7430.336) (-7431.052) [-7432.119] -- 0:13:55 512500 -- [-7439.996] (-7431.217) (-7442.802) (-7432.302) * [-7423.818] (-7435.908) (-7436.840) (-7436.090) -- 0:13:55 513000 -- [-7434.620] (-7440.096) (-7450.595) (-7433.036) * (-7426.586) (-7428.493) (-7441.483) [-7432.384] -- 0:13:54 513500 -- (-7437.523) (-7435.100) (-7438.737) [-7429.067] * (-7440.545) (-7435.984) (-7444.757) [-7437.718] -- 0:13:53 514000 -- (-7438.423) (-7434.249) (-7433.930) [-7435.974] * (-7443.812) (-7427.895) (-7434.823) [-7431.572] -- 0:13:53 514500 -- (-7443.071) (-7442.421) (-7432.113) [-7428.389] * (-7438.815) (-7422.871) (-7435.313) [-7435.565] -- 0:13:52 515000 -- (-7444.104) [-7427.037] (-7431.316) (-7436.030) * (-7430.524) [-7433.773] (-7434.265) (-7435.808) -- 0:13:50 Average standard deviation of split frequencies: 0.007524 515500 -- (-7443.956) (-7429.518) [-7435.629] (-7432.497) * (-7432.460) [-7434.778] (-7444.543) (-7433.246) -- 0:13:49 516000 -- (-7444.057) [-7430.108] (-7433.852) (-7436.627) * (-7444.906) [-7425.383] (-7442.360) (-7440.636) -- 0:13:49 516500 -- (-7437.873) (-7426.953) [-7431.795] (-7444.716) * (-7435.785) [-7429.194] (-7438.585) (-7436.826) -- 0:13:48 517000 -- (-7433.479) (-7436.557) [-7426.896] (-7444.156) * (-7427.827) (-7432.723) [-7443.401] (-7443.154) -- 0:13:47 517500 -- (-7437.717) [-7431.927] (-7430.475) (-7427.946) * [-7428.566] (-7440.017) (-7432.811) (-7432.768) -- 0:13:47 518000 -- (-7422.352) (-7433.553) [-7420.178] (-7432.658) * (-7428.287) (-7441.688) (-7432.846) [-7435.234] -- 0:13:45 518500 -- (-7424.507) (-7434.057) (-7426.201) [-7432.267] * [-7425.581] (-7442.433) (-7428.154) (-7443.447) -- 0:13:44 519000 -- (-7433.623) (-7437.838) [-7430.447] (-7426.807) * (-7431.851) (-7447.564) [-7429.310] (-7429.790) -- 0:13:43 519500 -- (-7444.367) [-7433.329] (-7425.774) (-7438.098) * (-7430.738) (-7440.643) (-7430.718) [-7421.281] -- 0:13:43 520000 -- (-7429.050) (-7432.038) [-7431.035] (-7436.032) * (-7430.350) (-7443.031) (-7443.089) [-7428.014] -- 0:13:42 Average standard deviation of split frequencies: 0.007030 520500 -- (-7444.440) (-7441.193) [-7434.282] (-7437.764) * [-7429.004] (-7431.197) (-7440.623) (-7426.388) -- 0:13:41 521000 -- [-7433.177] (-7434.514) (-7426.285) (-7433.379) * [-7430.679] (-7435.326) (-7429.860) (-7432.995) -- 0:13:41 521500 -- [-7428.299] (-7433.043) (-7426.904) (-7438.358) * (-7431.190) (-7431.389) (-7427.924) [-7423.207] -- 0:13:39 522000 -- (-7429.390) (-7436.711) [-7422.528] (-7434.696) * (-7427.661) (-7441.737) (-7426.014) [-7428.470] -- 0:13:38 522500 -- (-7433.074) (-7429.006) [-7431.405] (-7439.990) * [-7423.183] (-7437.284) (-7432.269) (-7427.368) -- 0:13:37 523000 -- [-7433.543] (-7429.410) (-7427.015) (-7434.202) * (-7433.314) (-7434.818) [-7428.158] (-7438.447) -- 0:13:37 523500 -- (-7437.508) [-7435.970] (-7428.444) (-7429.592) * [-7424.830] (-7428.653) (-7427.430) (-7434.914) -- 0:13:36 524000 -- (-7428.397) (-7439.394) [-7422.603] (-7431.259) * (-7425.001) (-7425.533) [-7429.739] (-7436.516) -- 0:13:35 524500 -- (-7436.085) (-7429.822) [-7428.018] (-7431.256) * (-7437.863) (-7428.340) [-7426.020] (-7441.039) -- 0:13:34 525000 -- (-7434.267) (-7434.844) [-7428.810] (-7433.887) * (-7437.733) [-7426.023] (-7440.536) (-7431.127) -- 0:13:33 Average standard deviation of split frequencies: 0.006695 525500 -- (-7439.557) (-7435.273) [-7426.638] (-7436.273) * (-7434.053) (-7431.803) [-7434.835] (-7438.902) -- 0:13:32 526000 -- (-7438.363) (-7432.551) (-7445.530) [-7425.919] * (-7433.768) (-7433.151) (-7438.674) [-7426.477] -- 0:13:31 526500 -- (-7440.959) (-7437.632) [-7433.219] (-7441.276) * (-7439.563) (-7421.504) (-7440.497) [-7427.278] -- 0:13:31 527000 -- [-7424.738] (-7431.423) (-7428.060) (-7434.917) * (-7448.402) (-7432.042) (-7431.026) [-7427.203] -- 0:13:30 527500 -- [-7423.781] (-7440.476) (-7430.326) (-7429.736) * [-7438.346] (-7439.546) (-7431.632) (-7427.658) -- 0:13:29 528000 -- (-7431.445) (-7429.373) (-7425.863) [-7434.458] * (-7440.230) (-7431.194) (-7437.665) [-7422.390] -- 0:13:28 528500 -- [-7428.802] (-7429.331) (-7435.062) (-7435.331) * (-7431.129) (-7435.950) (-7441.781) [-7427.112] -- 0:13:27 529000 -- (-7429.336) (-7430.291) (-7442.737) [-7430.864] * (-7430.234) [-7429.070] (-7430.367) (-7434.880) -- 0:13:26 529500 -- (-7426.890) (-7430.988) [-7431.811] (-7433.337) * (-7437.260) (-7440.827) [-7428.277] (-7425.086) -- 0:13:25 530000 -- (-7434.730) [-7423.277] (-7429.460) (-7443.861) * (-7430.510) (-7432.124) (-7435.263) [-7435.650] -- 0:13:25 Average standard deviation of split frequencies: 0.006793 530500 -- (-7439.816) (-7435.605) [-7436.584] (-7443.771) * (-7435.324) (-7429.755) (-7431.953) [-7431.447] -- 0:13:24 531000 -- (-7445.554) [-7425.558] (-7431.163) (-7434.655) * (-7434.411) (-7435.922) (-7438.108) [-7428.321] -- 0:13:22 531500 -- (-7431.621) (-7433.248) [-7422.836] (-7432.574) * (-7445.455) (-7439.784) (-7431.425) [-7429.005] -- 0:13:22 532000 -- (-7450.874) [-7428.960] (-7431.732) (-7431.669) * (-7446.401) (-7440.539) (-7428.269) [-7427.174] -- 0:13:21 532500 -- (-7440.755) [-7432.303] (-7432.322) (-7427.279) * (-7437.044) [-7427.266] (-7431.275) (-7431.662) -- 0:13:20 533000 -- (-7439.267) (-7431.299) [-7432.856] (-7440.319) * (-7427.882) (-7436.674) [-7428.039] (-7433.081) -- 0:13:19 533500 -- (-7435.551) (-7427.685) [-7425.080] (-7453.036) * (-7423.401) (-7436.452) (-7434.455) [-7424.486] -- 0:13:19 534000 -- (-7446.540) (-7433.552) [-7432.233] (-7447.379) * (-7433.608) [-7429.852] (-7434.299) (-7426.655) -- 0:13:17 534500 -- (-7426.523) [-7421.796] (-7433.395) (-7437.390) * [-7433.977] (-7426.159) (-7434.116) (-7434.696) -- 0:13:16 535000 -- [-7434.563] (-7427.693) (-7433.390) (-7437.305) * [-7431.471] (-7430.924) (-7439.822) (-7435.713) -- 0:13:16 Average standard deviation of split frequencies: 0.006725 535500 -- (-7436.118) (-7425.467) (-7441.922) [-7428.141] * (-7433.049) (-7429.846) [-7429.780] (-7432.346) -- 0:13:15 536000 -- (-7429.997) (-7429.049) (-7450.443) [-7438.707] * [-7432.745] (-7426.760) (-7434.163) (-7439.377) -- 0:13:14 536500 -- (-7432.899) [-7428.268] (-7433.296) (-7430.508) * [-7431.647] (-7431.027) (-7437.189) (-7450.706) -- 0:13:13 537000 -- [-7437.150] (-7431.598) (-7434.909) (-7432.061) * (-7428.912) [-7436.914] (-7434.313) (-7432.907) -- 0:13:13 537500 -- (-7432.496) [-7434.139] (-7444.112) (-7432.696) * [-7426.926] (-7453.347) (-7424.977) (-7438.191) -- 0:13:11 538000 -- (-7433.981) (-7429.998) [-7432.868] (-7451.504) * (-7428.597) [-7432.366] (-7429.396) (-7437.727) -- 0:13:10 538500 -- (-7428.146) (-7434.154) [-7429.530] (-7434.644) * (-7427.137) [-7429.316] (-7431.582) (-7431.287) -- 0:13:10 539000 -- (-7433.848) (-7430.153) [-7428.773] (-7434.328) * [-7421.489] (-7434.194) (-7432.848) (-7445.243) -- 0:13:09 539500 -- (-7424.010) (-7434.601) [-7426.012] (-7436.051) * (-7427.321) (-7431.091) (-7429.308) [-7433.141] -- 0:13:08 540000 -- (-7428.670) (-7445.372) (-7429.651) [-7434.108] * (-7424.785) (-7433.321) (-7429.566) [-7432.843] -- 0:13:07 Average standard deviation of split frequencies: 0.006924 540500 -- (-7436.677) (-7440.808) [-7429.886] (-7441.478) * [-7428.717] (-7432.273) (-7432.038) (-7425.772) -- 0:13:07 541000 -- (-7428.697) (-7445.447) [-7435.952] (-7435.740) * (-7440.890) (-7427.894) [-7429.992] (-7431.214) -- 0:13:05 541500 -- [-7426.202] (-7444.508) (-7447.759) (-7424.550) * (-7441.516) [-7426.360] (-7431.759) (-7436.023) -- 0:13:04 542000 -- (-7432.784) (-7441.861) (-7449.556) [-7426.757] * (-7429.402) (-7431.109) (-7445.128) [-7425.402] -- 0:13:04 542500 -- (-7429.072) (-7437.461) [-7436.010] (-7437.010) * (-7431.753) [-7426.069] (-7430.935) (-7439.096) -- 0:13:03 543000 -- (-7431.350) (-7438.272) (-7447.830) [-7428.872] * [-7429.189] (-7438.220) (-7437.746) (-7437.505) -- 0:13:02 543500 -- (-7426.064) (-7437.846) (-7436.056) [-7421.915] * (-7434.874) [-7432.799] (-7443.597) (-7441.421) -- 0:13:01 544000 -- (-7429.955) (-7440.687) (-7440.368) [-7429.323] * (-7430.154) (-7428.066) (-7438.091) [-7434.422] -- 0:13:01 544500 -- (-7438.134) (-7447.313) (-7439.387) [-7436.556] * (-7424.641) (-7436.705) [-7428.247] (-7426.224) -- 0:12:59 545000 -- (-7430.318) (-7430.165) (-7431.933) [-7434.678] * [-7429.845] (-7429.414) (-7442.920) (-7428.416) -- 0:12:58 Average standard deviation of split frequencies: 0.007770 545500 -- (-7432.620) [-7427.091] (-7434.752) (-7439.825) * [-7431.950] (-7435.041) (-7436.759) (-7437.882) -- 0:12:58 546000 -- (-7423.349) (-7436.100) [-7433.860] (-7436.996) * (-7434.209) [-7421.542] (-7443.534) (-7436.646) -- 0:12:57 546500 -- (-7437.714) (-7430.993) (-7441.199) [-7428.248] * [-7422.950] (-7435.885) (-7436.614) (-7434.252) -- 0:12:56 547000 -- (-7435.761) (-7430.526) (-7435.976) [-7422.370] * [-7427.071] (-7439.890) (-7424.669) (-7430.069) -- 0:12:55 547500 -- (-7434.646) [-7435.906] (-7428.441) (-7433.358) * [-7434.603] (-7431.088) (-7430.242) (-7435.961) -- 0:12:55 548000 -- [-7426.428] (-7445.600) (-7439.062) (-7433.305) * [-7438.075] (-7434.916) (-7435.037) (-7431.634) -- 0:12:53 548500 -- [-7423.259] (-7442.211) (-7432.457) (-7434.153) * [-7439.024] (-7427.843) (-7427.169) (-7426.263) -- 0:12:52 549000 -- [-7423.201] (-7436.188) (-7444.325) (-7437.924) * (-7433.861) [-7430.934] (-7435.564) (-7433.444) -- 0:12:52 549500 -- [-7421.790] (-7438.715) (-7439.969) (-7432.574) * (-7432.294) (-7448.387) [-7428.632] (-7442.018) -- 0:12:51 550000 -- (-7429.559) (-7447.510) (-7432.652) [-7426.772] * (-7440.638) [-7434.243] (-7433.318) (-7437.809) -- 0:12:50 Average standard deviation of split frequencies: 0.007503 550500 -- (-7437.472) [-7437.384] (-7436.230) (-7430.030) * [-7431.579] (-7434.517) (-7438.007) (-7424.375) -- 0:12:49 551000 -- (-7437.094) (-7439.076) [-7431.598] (-7432.293) * (-7434.323) (-7432.528) [-7425.446] (-7436.646) -- 0:12:48 551500 -- (-7439.117) [-7443.827] (-7439.744) (-7438.348) * (-7429.881) [-7438.943] (-7435.556) (-7426.114) -- 0:12:47 552000 -- (-7430.386) (-7436.911) [-7440.051] (-7435.558) * [-7427.115] (-7437.686) (-7432.105) (-7430.819) -- 0:12:46 552500 -- (-7431.326) (-7440.705) (-7427.601) [-7433.176] * [-7428.631] (-7436.415) (-7430.176) (-7428.825) -- 0:12:46 553000 -- (-7435.849) [-7436.169] (-7430.745) (-7441.495) * (-7430.595) (-7431.830) (-7429.771) [-7427.752] -- 0:12:45 553500 -- (-7438.624) (-7440.924) (-7438.277) [-7428.529] * [-7428.562] (-7430.778) (-7426.127) (-7423.931) -- 0:12:44 554000 -- [-7431.861] (-7437.192) (-7437.137) (-7435.109) * (-7433.134) (-7435.756) (-7429.240) [-7428.754] -- 0:12:43 554500 -- [-7429.356] (-7440.323) (-7431.304) (-7433.886) * (-7425.106) [-7434.605] (-7427.252) (-7438.046) -- 0:12:42 555000 -- [-7434.860] (-7438.431) (-7430.062) (-7432.248) * (-7427.452) (-7423.393) (-7430.374) [-7436.513] -- 0:12:41 Average standard deviation of split frequencies: 0.007531 555500 -- (-7426.932) [-7436.390] (-7429.154) (-7428.431) * [-7433.063] (-7438.435) (-7432.438) (-7440.859) -- 0:12:40 556000 -- (-7432.736) (-7430.894) [-7422.616] (-7440.283) * (-7433.398) [-7423.342] (-7428.380) (-7434.275) -- 0:12:40 556500 -- (-7431.371) (-7442.644) (-7430.505) [-7428.311] * (-7440.431) (-7437.540) [-7418.775] (-7441.601) -- 0:12:39 557000 -- (-7428.895) (-7428.174) [-7427.533] (-7445.542) * (-7432.491) (-7437.746) (-7428.263) [-7438.627] -- 0:12:38 557500 -- (-7429.852) (-7431.984) [-7424.732] (-7442.479) * (-7437.415) (-7433.004) [-7424.655] (-7440.818) -- 0:12:38 558000 -- (-7434.743) (-7438.218) [-7431.986] (-7437.144) * (-7435.881) (-7436.072) [-7428.133] (-7441.155) -- 0:12:36 558500 -- [-7432.563] (-7433.510) (-7432.642) (-7440.705) * (-7436.823) (-7432.230) [-7432.769] (-7434.863) -- 0:12:35 559000 -- (-7424.794) [-7431.361] (-7438.790) (-7432.719) * (-7427.261) (-7440.440) [-7429.093] (-7451.155) -- 0:12:34 559500 -- [-7424.344] (-7437.410) (-7432.699) (-7431.900) * [-7435.737] (-7425.373) (-7434.565) (-7438.474) -- 0:12:34 560000 -- [-7428.412] (-7433.471) (-7436.565) (-7437.367) * (-7435.039) (-7438.389) (-7442.087) [-7432.500] -- 0:12:33 Average standard deviation of split frequencies: 0.007567 560500 -- (-7441.699) [-7424.697] (-7437.056) (-7434.987) * (-7430.771) (-7437.852) (-7434.511) [-7439.010] -- 0:12:32 561000 -- [-7426.344] (-7435.319) (-7437.511) (-7440.117) * (-7428.204) (-7438.391) (-7441.669) [-7424.843] -- 0:12:31 561500 -- [-7430.736] (-7440.059) (-7427.229) (-7444.472) * (-7436.375) [-7432.901] (-7441.792) (-7442.706) -- 0:12:30 562000 -- [-7422.351] (-7430.742) (-7439.993) (-7434.875) * [-7432.150] (-7433.257) (-7433.803) (-7432.389) -- 0:12:29 562500 -- (-7423.798) (-7430.337) [-7440.111] (-7440.915) * [-7423.480] (-7439.516) (-7443.825) (-7434.348) -- 0:12:29 563000 -- (-7434.094) [-7435.919] (-7436.333) (-7444.081) * (-7434.402) (-7440.717) (-7431.548) [-7442.644] -- 0:12:28 563500 -- (-7428.598) [-7436.764] (-7432.929) (-7439.872) * [-7437.908] (-7432.085) (-7423.265) (-7439.150) -- 0:12:27 564000 -- (-7434.485) (-7430.132) [-7431.116] (-7438.242) * (-7430.791) (-7448.704) [-7422.814] (-7433.847) -- 0:12:25 564500 -- [-7432.988] (-7432.539) (-7429.597) (-7435.843) * (-7436.369) (-7444.656) [-7436.732] (-7429.897) -- 0:12:25 565000 -- (-7438.587) (-7430.561) (-7431.817) [-7431.219] * (-7435.097) [-7428.576] (-7442.488) (-7430.004) -- 0:12:24 Average standard deviation of split frequencies: 0.007104 565500 -- (-7440.978) [-7433.386] (-7433.415) (-7440.923) * (-7437.846) [-7427.549] (-7434.623) (-7427.805) -- 0:12:23 566000 -- (-7441.546) (-7433.557) (-7431.659) [-7432.517] * (-7439.443) (-7433.911) (-7447.199) [-7428.258] -- 0:12:23 566500 -- [-7428.137] (-7430.352) (-7439.866) (-7435.625) * (-7433.023) (-7443.206) [-7432.778] (-7432.087) -- 0:12:22 567000 -- (-7436.972) (-7432.879) [-7433.508] (-7426.953) * [-7427.043] (-7449.761) (-7425.334) (-7425.727) -- 0:12:21 567500 -- [-7431.133] (-7440.455) (-7428.966) (-7427.300) * [-7424.332] (-7437.032) (-7426.421) (-7429.680) -- 0:12:20 568000 -- (-7437.478) (-7454.139) [-7428.624] (-7437.061) * (-7432.705) [-7423.053] (-7431.028) (-7431.369) -- 0:12:19 568500 -- (-7437.794) (-7449.131) [-7442.712] (-7437.546) * (-7432.078) [-7424.190] (-7431.955) (-7434.678) -- 0:12:18 569000 -- [-7429.257] (-7446.861) (-7440.765) (-7435.088) * (-7427.199) (-7431.213) [-7430.779] (-7438.767) -- 0:12:17 569500 -- (-7431.345) (-7442.432) (-7447.038) [-7441.994] * (-7431.570) (-7431.986) [-7428.014] (-7448.221) -- 0:12:17 570000 -- [-7427.795] (-7443.774) (-7434.604) (-7432.855) * (-7429.131) [-7432.944] (-7428.618) (-7440.406) -- 0:12:16 Average standard deviation of split frequencies: 0.007240 570500 -- (-7425.281) [-7431.074] (-7443.717) (-7436.177) * (-7444.039) (-7431.346) [-7426.230] (-7445.018) -- 0:12:14 571000 -- [-7426.963] (-7424.018) (-7442.925) (-7442.066) * (-7433.333) (-7430.335) [-7428.700] (-7432.410) -- 0:12:14 571500 -- (-7431.780) [-7426.471] (-7446.671) (-7452.562) * (-7430.070) (-7431.745) (-7440.004) [-7432.730] -- 0:12:13 572000 -- (-7429.780) [-7431.464] (-7436.401) (-7447.841) * (-7426.158) (-7432.278) (-7433.260) [-7431.523] -- 0:12:12 572500 -- [-7428.773] (-7430.469) (-7438.013) (-7440.007) * (-7442.528) [-7428.378] (-7437.934) (-7432.135) -- 0:12:11 573000 -- (-7433.580) (-7430.018) [-7432.215] (-7431.653) * (-7430.335) [-7432.372] (-7440.836) (-7445.474) -- 0:12:11 573500 -- (-7439.265) (-7424.840) [-7445.462] (-7436.390) * (-7426.521) [-7433.099] (-7447.109) (-7436.242) -- 0:12:11 574000 -- (-7436.134) (-7423.527) (-7437.090) [-7426.918] * (-7420.716) [-7426.893] (-7444.122) (-7450.329) -- 0:12:10 574500 -- (-7438.527) (-7427.679) [-7430.212] (-7440.794) * (-7428.670) [-7423.995] (-7436.700) (-7431.918) -- 0:12:09 575000 -- (-7436.735) (-7429.541) [-7427.920] (-7431.663) * (-7431.850) [-7429.099] (-7437.209) (-7434.247) -- 0:12:08 Average standard deviation of split frequencies: 0.007125 575500 -- (-7432.681) (-7435.317) (-7436.078) [-7431.612] * (-7424.304) [-7438.329] (-7429.591) (-7430.400) -- 0:12:07 576000 -- [-7440.220] (-7431.830) (-7430.781) (-7430.913) * (-7424.786) [-7424.060] (-7436.371) (-7429.669) -- 0:12:06 576500 -- (-7435.594) [-7433.638] (-7441.504) (-7436.261) * (-7429.879) (-7440.030) (-7438.133) [-7427.856] -- 0:12:05 577000 -- (-7431.653) (-7440.972) [-7429.304] (-7446.633) * (-7433.647) (-7435.440) (-7429.206) [-7423.771] -- 0:12:05 577500 -- (-7429.755) (-7435.077) [-7424.883] (-7436.549) * (-7448.392) [-7432.161] (-7430.085) (-7438.982) -- 0:12:04 578000 -- [-7421.939] (-7433.387) (-7431.208) (-7441.986) * (-7433.419) (-7430.931) [-7435.213] (-7433.167) -- 0:12:03 578500 -- (-7426.882) (-7437.889) (-7436.343) [-7427.111] * (-7432.246) [-7431.071] (-7429.239) (-7423.518) -- 0:12:02 579000 -- [-7423.564] (-7437.346) (-7434.882) (-7429.964) * (-7435.046) [-7422.658] (-7428.093) (-7431.407) -- 0:12:01 579500 -- (-7426.207) (-7438.454) [-7439.276] (-7429.413) * (-7432.681) [-7432.858] (-7431.253) (-7434.457) -- 0:12:00 580000 -- [-7429.165] (-7437.494) (-7431.946) (-7431.939) * [-7438.353] (-7443.737) (-7431.097) (-7436.695) -- 0:11:59 Average standard deviation of split frequencies: 0.006877 580500 -- (-7430.464) (-7438.114) (-7434.022) [-7436.594] * (-7433.086) (-7439.116) (-7425.801) [-7440.283] -- 0:11:59 581000 -- (-7436.157) (-7430.750) [-7423.942] (-7437.410) * (-7435.899) (-7445.570) [-7427.770] (-7439.133) -- 0:11:58 581500 -- (-7433.352) [-7427.756] (-7434.036) (-7427.778) * (-7426.985) (-7432.051) [-7428.215] (-7430.591) -- 0:11:56 582000 -- (-7438.927) [-7421.960] (-7433.152) (-7432.245) * [-7429.801] (-7433.315) (-7433.799) (-7433.869) -- 0:11:56 582500 -- (-7437.169) (-7430.128) [-7424.991] (-7431.481) * (-7427.418) (-7437.809) (-7428.839) [-7428.264] -- 0:11:55 583000 -- (-7440.884) (-7429.538) (-7429.346) [-7430.777] * (-7434.800) (-7433.739) (-7434.984) [-7433.160] -- 0:11:54 583500 -- (-7430.087) [-7423.479] (-7425.105) (-7430.200) * [-7430.442] (-7432.014) (-7436.150) (-7430.587) -- 0:11:53 584000 -- [-7431.347] (-7427.248) (-7425.570) (-7437.021) * [-7437.042] (-7436.783) (-7427.681) (-7434.094) -- 0:11:53 584500 -- (-7439.430) (-7431.232) [-7423.102] (-7446.212) * (-7435.887) (-7437.947) (-7434.272) [-7437.548] -- 0:11:51 585000 -- [-7430.592] (-7437.809) (-7432.704) (-7425.034) * (-7440.200) (-7441.103) [-7433.415] (-7433.908) -- 0:11:50 Average standard deviation of split frequencies: 0.007003 585500 -- [-7427.305] (-7425.386) (-7432.627) (-7430.134) * (-7444.405) [-7438.502] (-7442.076) (-7431.484) -- 0:11:50 586000 -- (-7441.515) (-7424.520) [-7438.479] (-7431.777) * (-7447.201) (-7433.301) [-7426.001] (-7436.331) -- 0:11:49 586500 -- (-7425.387) [-7427.021] (-7438.832) (-7434.963) * (-7432.238) (-7437.561) [-7428.303] (-7443.002) -- 0:11:48 587000 -- (-7431.604) (-7427.940) [-7442.914] (-7451.193) * (-7435.451) (-7436.596) (-7428.004) [-7431.471] -- 0:11:47 587500 -- (-7441.840) (-7441.507) (-7438.114) [-7434.878] * (-7432.375) (-7430.825) (-7434.319) [-7431.255] -- 0:11:47 588000 -- (-7436.414) (-7430.298) (-7431.729) [-7435.537] * (-7426.031) [-7431.927] (-7433.165) (-7431.383) -- 0:11:45 588500 -- [-7431.261] (-7438.763) (-7430.280) (-7445.466) * (-7440.006) [-7435.693] (-7439.035) (-7435.267) -- 0:11:44 589000 -- (-7427.800) [-7428.845] (-7448.650) (-7425.430) * (-7431.225) (-7438.584) (-7456.667) [-7429.875] -- 0:11:44 589500 -- [-7426.570] (-7437.870) (-7433.451) (-7433.233) * (-7437.731) (-7442.692) [-7430.859] (-7432.814) -- 0:11:43 590000 -- [-7436.213] (-7431.859) (-7432.528) (-7434.195) * [-7431.623] (-7451.698) (-7432.799) (-7436.119) -- 0:11:42 Average standard deviation of split frequencies: 0.006807 590500 -- (-7436.768) (-7432.188) (-7441.942) [-7433.532] * (-7432.597) (-7454.075) (-7434.261) [-7438.180] -- 0:11:41 591000 -- (-7436.202) (-7431.360) (-7429.818) [-7434.436] * (-7430.010) (-7432.325) (-7430.249) [-7428.341] -- 0:11:40 591500 -- [-7431.507] (-7434.218) (-7434.062) (-7435.445) * (-7429.015) (-7433.787) (-7425.410) [-7424.927] -- 0:11:39 592000 -- (-7443.482) [-7431.700] (-7430.797) (-7437.615) * (-7431.253) (-7431.225) [-7427.854] (-7431.353) -- 0:11:38 592500 -- (-7449.728) (-7442.434) [-7427.880] (-7425.988) * [-7432.589] (-7445.519) (-7428.568) (-7435.021) -- 0:11:38 593000 -- (-7449.970) (-7431.228) (-7433.430) [-7426.815] * (-7447.646) [-7440.999] (-7447.079) (-7433.693) -- 0:11:37 593500 -- (-7434.864) [-7435.758] (-7438.714) (-7433.170) * (-7442.711) [-7432.521] (-7433.516) (-7441.894) -- 0:11:36 594000 -- (-7437.589) (-7439.623) (-7432.254) [-7431.004] * (-7439.353) [-7431.063] (-7429.502) (-7434.205) -- 0:11:35 594500 -- (-7439.668) [-7427.551] (-7433.097) (-7432.064) * [-7435.209] (-7442.112) (-7429.403) (-7434.694) -- 0:11:34 595000 -- (-7444.342) (-7427.620) [-7428.206] (-7441.040) * (-7425.470) (-7425.158) (-7431.085) [-7444.938] -- 0:11:33 Average standard deviation of split frequencies: 0.007258 595500 -- (-7427.179) [-7432.276] (-7423.884) (-7437.372) * (-7433.127) [-7426.137] (-7431.727) (-7439.461) -- 0:11:32 596000 -- (-7427.763) [-7433.083] (-7434.089) (-7435.905) * (-7428.086) [-7429.716] (-7436.844) (-7432.646) -- 0:11:32 596500 -- (-7431.160) (-7439.651) [-7426.914] (-7449.916) * (-7437.479) (-7426.783) (-7440.923) [-7436.474] -- 0:11:31 597000 -- (-7432.430) (-7441.828) [-7425.794] (-7431.601) * [-7430.464] (-7423.629) (-7429.148) (-7430.700) -- 0:11:30 597500 -- (-7425.526) (-7434.079) [-7428.455] (-7429.359) * [-7425.153] (-7431.294) (-7434.073) (-7445.266) -- 0:11:29 598000 -- (-7429.966) (-7429.262) (-7432.759) [-7425.030] * (-7437.663) (-7426.763) (-7431.815) [-7435.396] -- 0:11:28 598500 -- (-7439.341) (-7439.359) (-7435.483) [-7426.289] * (-7436.102) [-7425.346] (-7430.625) (-7436.272) -- 0:11:27 599000 -- (-7435.395) (-7434.425) (-7430.787) [-7434.596] * (-7443.526) [-7433.135] (-7431.297) (-7442.684) -- 0:11:26 599500 -- [-7430.580] (-7450.972) (-7436.220) (-7438.807) * (-7430.510) (-7441.253) (-7430.273) [-7427.948] -- 0:11:26 600000 -- [-7435.370] (-7434.698) (-7426.127) (-7442.391) * (-7439.693) (-7438.614) (-7432.433) [-7428.541] -- 0:11:25 Average standard deviation of split frequencies: 0.007894 600500 -- (-7437.266) (-7426.825) [-7428.997] (-7437.107) * (-7432.210) (-7437.830) [-7423.536] (-7438.852) -- 0:11:24 601000 -- (-7438.758) (-7431.620) (-7432.858) [-7430.590] * (-7447.091) (-7425.126) (-7430.593) [-7424.925] -- 0:11:23 601500 -- [-7431.857] (-7429.033) (-7433.855) (-7440.610) * (-7434.003) (-7431.771) [-7419.101] (-7426.836) -- 0:11:22 602000 -- (-7431.718) [-7426.262] (-7441.741) (-7433.681) * [-7429.375] (-7440.553) (-7431.429) (-7437.940) -- 0:11:21 602500 -- (-7428.096) [-7431.469] (-7444.547) (-7429.116) * [-7433.469] (-7433.612) (-7438.540) (-7436.771) -- 0:11:20 603000 -- (-7445.502) (-7433.581) (-7439.212) [-7433.162] * (-7432.832) (-7434.987) (-7435.318) [-7426.283] -- 0:11:20 603500 -- (-7432.985) (-7440.492) [-7443.349] (-7428.551) * (-7433.086) (-7428.083) [-7429.417] (-7430.076) -- 0:11:19 604000 -- [-7427.025] (-7436.140) (-7439.377) (-7425.984) * (-7446.552) (-7434.366) [-7429.825] (-7429.680) -- 0:11:18 604500 -- (-7436.647) (-7436.219) (-7429.864) [-7423.170] * (-7455.098) (-7432.270) [-7435.149] (-7436.275) -- 0:11:17 605000 -- (-7440.129) (-7445.461) (-7437.883) [-7423.888] * [-7434.378] (-7434.634) (-7432.589) (-7430.919) -- 0:11:16 Average standard deviation of split frequencies: 0.007550 605500 -- (-7452.966) (-7431.321) (-7427.527) [-7430.908] * (-7429.105) (-7433.802) [-7425.337] (-7443.867) -- 0:11:15 606000 -- (-7449.819) [-7430.093] (-7427.175) (-7432.302) * (-7425.531) (-7433.328) [-7432.975] (-7441.504) -- 0:11:14 606500 -- (-7445.537) (-7430.162) [-7430.756] (-7435.642) * (-7431.835) [-7428.383] (-7434.685) (-7434.124) -- 0:11:14 607000 -- (-7431.571) [-7427.012] (-7431.601) (-7429.329) * (-7438.978) (-7438.798) (-7446.859) [-7429.611] -- 0:11:13 607500 -- (-7449.219) [-7426.571] (-7434.153) (-7431.747) * (-7435.886) (-7444.735) (-7440.127) [-7428.388] -- 0:11:11 608000 -- (-7431.545) (-7432.225) (-7441.389) [-7432.566] * [-7427.542] (-7437.766) (-7442.199) (-7435.518) -- 0:11:11 608500 -- [-7432.255] (-7426.562) (-7437.724) (-7450.533) * (-7431.583) (-7431.687) (-7430.596) [-7427.024] -- 0:11:10 609000 -- (-7430.994) (-7441.233) (-7434.882) [-7428.319] * (-7434.377) (-7426.475) [-7427.496] (-7437.950) -- 0:11:09 609500 -- (-7444.318) (-7440.255) [-7432.131] (-7432.150) * (-7428.021) (-7433.226) [-7423.247] (-7428.924) -- 0:11:08 610000 -- (-7440.218) (-7438.679) (-7430.661) [-7429.054] * (-7434.816) (-7440.922) [-7430.855] (-7427.872) -- 0:11:08 Average standard deviation of split frequencies: 0.007447 610500 -- (-7437.452) (-7440.587) [-7427.917] (-7432.167) * (-7427.728) (-7439.501) [-7429.028] (-7437.475) -- 0:11:06 611000 -- (-7432.239) (-7435.585) (-7434.531) [-7430.573] * [-7429.947] (-7444.833) (-7432.177) (-7432.170) -- 0:11:05 611500 -- [-7424.752] (-7430.608) (-7426.346) (-7432.718) * (-7435.886) [-7422.896] (-7438.692) (-7420.932) -- 0:11:05 612000 -- (-7427.870) (-7430.499) (-7425.817) [-7420.186] * (-7435.865) [-7430.759] (-7433.818) (-7425.483) -- 0:11:04 612500 -- (-7431.655) (-7429.216) [-7433.893] (-7427.752) * (-7437.515) (-7430.724) (-7439.380) [-7429.450] -- 0:11:03 613000 -- (-7424.110) (-7436.106) [-7432.256] (-7433.825) * (-7440.011) (-7434.029) [-7437.303] (-7433.153) -- 0:11:02 613500 -- (-7422.233) (-7442.062) [-7433.799] (-7432.597) * (-7445.334) (-7428.717) [-7434.223] (-7426.064) -- 0:11:02 614000 -- (-7434.099) [-7433.876] (-7441.549) (-7449.186) * (-7440.367) (-7422.617) [-7429.338] (-7427.630) -- 0:11:00 614500 -- (-7428.169) [-7432.740] (-7444.040) (-7439.128) * (-7427.759) [-7425.925] (-7429.149) (-7435.982) -- 0:10:59 615000 -- [-7433.902] (-7432.530) (-7441.253) (-7433.078) * (-7432.483) [-7429.816] (-7425.544) (-7442.208) -- 0:10:59 Average standard deviation of split frequencies: 0.007653 615500 -- (-7436.859) (-7438.250) [-7430.138] (-7433.040) * (-7443.952) (-7436.579) (-7425.830) [-7430.277] -- 0:10:58 616000 -- (-7446.697) (-7435.211) [-7430.347] (-7434.585) * (-7434.341) (-7438.666) (-7445.224) [-7436.100] -- 0:10:57 616500 -- (-7434.450) (-7434.014) (-7438.635) [-7433.964] * [-7432.297] (-7432.929) (-7441.930) (-7426.999) -- 0:10:56 617000 -- (-7436.014) [-7423.485] (-7442.416) (-7432.969) * (-7423.289) [-7431.287] (-7438.546) (-7443.988) -- 0:10:55 617500 -- [-7430.561] (-7429.648) (-7446.883) (-7431.508) * (-7433.799) [-7428.613] (-7441.395) (-7438.490) -- 0:10:54 618000 -- [-7425.344] (-7432.251) (-7458.160) (-7441.257) * (-7431.582) (-7428.722) [-7433.179] (-7442.751) -- 0:10:53 618500 -- [-7429.986] (-7437.211) (-7439.725) (-7431.843) * [-7434.464] (-7431.090) (-7440.360) (-7430.539) -- 0:10:53 619000 -- (-7433.737) (-7448.389) [-7424.804] (-7434.093) * (-7433.232) (-7428.483) (-7439.725) [-7430.581] -- 0:10:52 619500 -- (-7430.825) (-7449.392) (-7432.577) [-7430.950] * (-7434.110) (-7445.172) (-7434.527) [-7432.116] -- 0:10:51 620000 -- (-7441.789) (-7435.872) (-7431.624) [-7425.553] * (-7441.780) (-7428.975) [-7435.969] (-7442.299) -- 0:10:50 Average standard deviation of split frequencies: 0.007729 620500 -- (-7432.370) [-7424.073] (-7435.493) (-7442.375) * [-7423.349] (-7425.409) (-7434.525) (-7439.521) -- 0:10:49 621000 -- (-7436.121) [-7429.251] (-7435.423) (-7439.461) * [-7436.038] (-7422.607) (-7425.646) (-7433.589) -- 0:10:48 621500 -- (-7449.538) [-7422.363] (-7434.420) (-7427.698) * [-7431.192] (-7429.328) (-7442.827) (-7435.442) -- 0:10:47 622000 -- (-7432.674) [-7419.949] (-7432.829) (-7429.666) * (-7437.957) [-7427.859] (-7437.420) (-7431.942) -- 0:10:47 622500 -- (-7436.085) [-7433.569] (-7433.621) (-7434.472) * (-7431.472) [-7420.597] (-7430.497) (-7433.125) -- 0:10:46 623000 -- (-7436.628) (-7429.746) [-7434.601] (-7441.261) * (-7439.081) (-7433.658) (-7442.229) [-7428.940] -- 0:10:45 623500 -- (-7432.043) (-7436.756) [-7427.276] (-7429.489) * (-7430.576) (-7429.855) [-7424.533] (-7430.322) -- 0:10:44 624000 -- (-7443.549) (-7432.768) [-7427.268] (-7435.179) * (-7431.288) (-7429.188) (-7424.082) [-7430.744] -- 0:10:43 624500 -- (-7437.152) (-7435.181) [-7426.761] (-7433.164) * (-7444.815) [-7427.050] (-7433.321) (-7433.222) -- 0:10:42 625000 -- (-7429.347) (-7428.500) (-7440.502) [-7439.480] * (-7437.625) [-7422.202] (-7439.436) (-7437.367) -- 0:10:42 Average standard deviation of split frequencies: 0.007398 625500 -- (-7435.304) (-7432.462) [-7437.357] (-7426.305) * (-7449.010) [-7428.425] (-7435.732) (-7443.506) -- 0:10:41 626000 -- (-7433.554) [-7428.832] (-7428.307) (-7432.159) * (-7442.162) [-7426.971] (-7434.873) (-7434.139) -- 0:10:40 626500 -- [-7432.620] (-7427.148) (-7434.227) (-7438.748) * (-7444.872) [-7419.384] (-7433.640) (-7439.597) -- 0:10:39 627000 -- [-7432.634] (-7439.169) (-7434.341) (-7441.853) * (-7436.654) (-7436.092) [-7429.163] (-7434.848) -- 0:10:38 627500 -- [-7421.545] (-7439.078) (-7431.380) (-7433.284) * (-7446.689) (-7430.477) (-7436.193) [-7430.043] -- 0:10:37 628000 -- (-7426.554) [-7433.682] (-7427.933) (-7444.506) * (-7443.783) (-7443.509) (-7441.282) [-7423.665] -- 0:10:36 628500 -- (-7430.981) (-7433.030) [-7426.561] (-7436.272) * (-7438.132) (-7434.700) (-7438.860) [-7428.297] -- 0:10:36 629000 -- [-7424.407] (-7442.333) (-7426.429) (-7431.496) * (-7430.880) (-7432.000) (-7437.514) [-7425.687] -- 0:10:35 629500 -- [-7421.396] (-7431.743) (-7433.515) (-7437.088) * (-7433.905) (-7427.806) [-7435.804] (-7449.134) -- 0:10:34 630000 -- (-7428.165) [-7433.697] (-7426.190) (-7443.483) * [-7432.989] (-7426.028) (-7434.273) (-7436.637) -- 0:10:33 Average standard deviation of split frequencies: 0.007563 630500 -- (-7439.383) [-7435.535] (-7435.020) (-7445.082) * (-7434.264) (-7437.046) (-7439.665) [-7432.137] -- 0:10:32 631000 -- (-7424.784) (-7430.037) (-7433.525) [-7428.950] * (-7426.856) (-7429.049) [-7434.514] (-7441.088) -- 0:10:31 631500 -- [-7428.193] (-7436.567) (-7434.893) (-7428.508) * (-7429.543) (-7430.981) (-7432.994) [-7430.668] -- 0:10:30 632000 -- (-7432.955) [-7424.543] (-7430.951) (-7428.298) * (-7438.057) (-7427.337) [-7438.098] (-7435.149) -- 0:10:30 632500 -- (-7444.790) (-7429.889) [-7428.176] (-7433.723) * [-7441.286] (-7430.850) (-7430.211) (-7433.153) -- 0:10:29 633000 -- [-7438.017] (-7433.327) (-7431.370) (-7428.085) * (-7434.732) (-7439.656) (-7433.423) [-7433.656] -- 0:10:28 633500 -- (-7432.180) (-7436.507) (-7431.537) [-7427.300] * [-7425.118] (-7440.861) (-7430.878) (-7443.647) -- 0:10:27 634000 -- (-7439.192) (-7428.678) (-7429.406) [-7424.844] * (-7433.884) (-7443.430) (-7438.634) [-7431.093] -- 0:10:26 634500 -- (-7436.188) (-7438.304) (-7439.748) [-7430.453] * (-7437.456) (-7443.421) [-7434.063] (-7441.150) -- 0:10:25 635000 -- (-7436.332) (-7447.721) (-7442.492) [-7428.281] * (-7434.346) (-7435.562) (-7439.244) [-7436.858] -- 0:10:24 Average standard deviation of split frequencies: 0.007020 635500 -- (-7431.356) [-7427.164] (-7434.191) (-7431.927) * (-7432.661) (-7435.279) (-7433.560) [-7427.421] -- 0:10:24 636000 -- (-7425.912) (-7437.085) (-7442.869) [-7434.712] * [-7433.123] (-7427.849) (-7437.168) (-7448.020) -- 0:10:23 636500 -- [-7421.592] (-7431.876) (-7450.975) (-7443.903) * (-7435.189) (-7428.545) [-7431.965] (-7439.644) -- 0:10:21 637000 -- (-7429.489) (-7451.352) (-7437.075) [-7428.024] * [-7427.354] (-7429.367) (-7434.982) (-7430.254) -- 0:10:21 637500 -- (-7430.035) [-7436.818] (-7432.750) (-7432.580) * (-7425.697) (-7430.441) [-7429.840] (-7440.202) -- 0:10:20 638000 -- (-7444.121) (-7433.615) (-7425.581) [-7430.979] * [-7425.108] (-7432.602) (-7435.608) (-7435.297) -- 0:10:19 638500 -- [-7434.439] (-7435.840) (-7435.291) (-7427.313) * (-7438.989) (-7444.644) [-7424.638] (-7433.701) -- 0:10:18 639000 -- [-7431.445] (-7432.753) (-7436.614) (-7437.232) * (-7429.993) (-7435.811) [-7426.153] (-7441.088) -- 0:10:18 639500 -- (-7449.190) (-7444.775) (-7430.831) [-7424.360] * (-7444.828) (-7429.277) [-7430.232] (-7434.238) -- 0:10:17 640000 -- (-7444.797) (-7434.682) [-7429.371] (-7437.087) * (-7448.465) [-7428.723] (-7435.564) (-7424.334) -- 0:10:15 Average standard deviation of split frequencies: 0.007315 640500 -- (-7440.096) [-7444.328] (-7434.734) (-7427.577) * (-7435.057) [-7434.207] (-7437.473) (-7435.079) -- 0:10:15 641000 -- [-7430.557] (-7428.123) (-7427.741) (-7444.066) * [-7430.650] (-7442.547) (-7425.192) (-7440.808) -- 0:10:14 641500 -- (-7429.712) (-7435.816) [-7422.040] (-7429.877) * (-7432.228) [-7428.143] (-7428.503) (-7432.949) -- 0:10:13 642000 -- [-7433.188] (-7434.141) (-7428.821) (-7429.085) * (-7432.283) (-7428.958) [-7422.226] (-7430.308) -- 0:10:12 642500 -- (-7430.147) (-7446.872) [-7425.539] (-7429.668) * [-7441.390] (-7438.995) (-7425.571) (-7436.572) -- 0:10:12 643000 -- (-7433.023) (-7450.337) (-7431.158) [-7429.520] * (-7431.859) [-7430.219] (-7440.925) (-7438.062) -- 0:10:10 643500 -- (-7431.793) [-7429.309] (-7438.330) (-7428.778) * [-7433.738] (-7429.982) (-7434.454) (-7438.844) -- 0:10:09 644000 -- (-7431.182) (-7431.706) [-7432.861] (-7429.837) * [-7430.403] (-7430.861) (-7436.507) (-7436.122) -- 0:10:09 644500 -- (-7429.412) (-7428.080) [-7427.396] (-7435.805) * (-7439.557) (-7427.105) [-7425.215] (-7436.928) -- 0:10:08 645000 -- (-7430.905) (-7433.572) (-7427.440) [-7425.384] * (-7438.397) (-7430.045) [-7428.186] (-7429.054) -- 0:10:07 Average standard deviation of split frequencies: 0.007598 645500 -- (-7433.297) (-7426.300) [-7428.162] (-7426.824) * [-7439.576] (-7441.115) (-7425.147) (-7434.076) -- 0:10:06 646000 -- (-7427.953) (-7437.468) [-7425.775] (-7440.780) * (-7434.259) (-7436.971) (-7437.701) [-7422.489] -- 0:10:06 646500 -- (-7430.404) (-7433.722) [-7425.891] (-7440.801) * (-7434.523) (-7452.689) [-7429.257] (-7431.373) -- 0:10:04 647000 -- (-7434.256) (-7440.509) [-7427.362] (-7441.243) * (-7432.573) (-7442.025) [-7431.241] (-7436.267) -- 0:10:03 647500 -- (-7427.470) [-7427.145] (-7432.344) (-7429.488) * (-7436.309) (-7442.308) [-7434.583] (-7433.167) -- 0:10:03 648000 -- (-7430.196) (-7430.532) (-7440.306) [-7430.387] * [-7431.474] (-7443.863) (-7448.918) (-7428.240) -- 0:10:02 648500 -- (-7441.881) (-7439.243) (-7424.838) [-7424.349] * (-7434.709) [-7432.704] (-7440.321) (-7453.598) -- 0:10:01 649000 -- (-7440.096) (-7432.365) (-7445.165) [-7428.433] * (-7431.599) (-7426.340) [-7430.599] (-7449.293) -- 0:10:00 649500 -- (-7448.194) [-7431.723] (-7433.054) (-7424.536) * (-7427.464) [-7429.274] (-7429.136) (-7434.414) -- 0:10:00 650000 -- (-7451.058) [-7427.540] (-7441.490) (-7429.693) * (-7438.409) (-7443.870) [-7430.218] (-7435.073) -- 0:09:58 Average standard deviation of split frequencies: 0.007160 650500 -- (-7449.853) (-7438.703) (-7434.198) [-7430.969] * (-7431.923) (-7440.356) (-7432.185) [-7431.122] -- 0:09:57 651000 -- (-7431.205) (-7435.654) [-7427.718] (-7436.891) * [-7428.927] (-7436.505) (-7445.893) (-7431.846) -- 0:09:57 651500 -- (-7433.387) (-7437.322) [-7431.226] (-7431.887) * (-7432.987) (-7432.368) (-7437.610) [-7439.016] -- 0:09:56 652000 -- (-7432.508) [-7425.892] (-7436.791) (-7445.550) * (-7426.016) (-7436.703) (-7443.708) [-7433.458] -- 0:09:55 652500 -- [-7429.261] (-7432.340) (-7436.260) (-7444.857) * (-7438.700) (-7434.987) (-7435.398) [-7431.193] -- 0:09:54 653000 -- (-7427.626) [-7430.525] (-7439.357) (-7446.117) * (-7437.532) (-7430.330) [-7441.601] (-7431.525) -- 0:09:53 653500 -- (-7433.641) (-7441.126) [-7429.984] (-7432.776) * [-7430.459] (-7440.612) (-7432.195) (-7431.358) -- 0:09:52 654000 -- (-7433.779) (-7437.338) [-7421.348] (-7444.579) * (-7435.518) (-7434.401) [-7436.448] (-7455.515) -- 0:09:52 654500 -- (-7439.674) (-7432.037) (-7431.193) [-7434.780] * [-7428.182] (-7436.125) (-7426.667) (-7436.428) -- 0:09:51 655000 -- (-7435.701) [-7436.105] (-7436.644) (-7444.083) * (-7426.665) (-7433.982) [-7435.987] (-7436.381) -- 0:09:50 Average standard deviation of split frequencies: 0.006637 655500 -- (-7433.342) [-7451.455] (-7431.133) (-7436.910) * (-7434.930) (-7435.695) (-7426.370) [-7432.591] -- 0:09:49 656000 -- (-7436.780) (-7432.360) (-7432.161) [-7430.844] * (-7434.633) (-7430.993) [-7436.527] (-7430.757) -- 0:09:48 656500 -- (-7429.479) (-7436.777) [-7428.644] (-7435.664) * [-7430.452] (-7435.473) (-7425.905) (-7425.029) -- 0:09:47 657000 -- [-7425.173] (-7425.523) (-7440.020) (-7429.044) * (-7431.236) (-7431.810) (-7431.884) [-7434.475] -- 0:09:46 657500 -- [-7426.218] (-7427.023) (-7431.149) (-7429.669) * (-7438.283) [-7428.331] (-7428.578) (-7431.780) -- 0:09:46 658000 -- (-7432.295) (-7453.006) [-7425.662] (-7428.209) * (-7443.837) (-7425.001) [-7424.847] (-7429.739) -- 0:09:45 658500 -- [-7427.320] (-7431.195) (-7436.627) (-7443.077) * (-7433.065) (-7434.657) (-7427.339) [-7427.207] -- 0:09:44 659000 -- (-7433.700) (-7436.601) [-7430.795] (-7442.636) * (-7436.765) (-7429.064) [-7435.603] (-7431.545) -- 0:09:43 659500 -- [-7431.005] (-7437.095) (-7433.928) (-7443.707) * [-7426.123] (-7432.529) (-7425.851) (-7427.025) -- 0:09:42 660000 -- (-7438.866) (-7436.217) [-7429.790] (-7438.188) * (-7431.369) (-7431.627) (-7447.717) [-7424.533] -- 0:09:41 Average standard deviation of split frequencies: 0.006632 660500 -- [-7430.204] (-7435.350) (-7432.280) (-7430.689) * [-7426.125] (-7432.956) (-7440.887) (-7442.309) -- 0:09:40 661000 -- (-7439.891) [-7429.496] (-7440.042) (-7434.805) * [-7437.242] (-7436.459) (-7435.877) (-7439.576) -- 0:09:40 661500 -- (-7438.280) (-7440.144) (-7440.083) [-7434.811] * [-7427.033] (-7438.712) (-7431.693) (-7441.034) -- 0:09:39 662000 -- [-7434.016] (-7447.291) (-7442.068) (-7429.273) * (-7429.707) (-7432.611) (-7435.169) [-7431.755] -- 0:09:38 662500 -- (-7432.124) [-7430.425] (-7440.133) (-7435.463) * [-7432.552] (-7439.607) (-7426.513) (-7436.469) -- 0:09:37 663000 -- (-7432.579) [-7432.200] (-7436.427) (-7423.751) * (-7432.517) [-7427.008] (-7433.965) (-7441.988) -- 0:09:36 663500 -- (-7434.492) [-7434.025] (-7429.480) (-7429.233) * (-7440.251) (-7435.032) (-7431.194) [-7435.355] -- 0:09:35 664000 -- (-7439.119) (-7431.133) [-7427.954] (-7442.122) * (-7443.309) (-7443.998) [-7422.711] (-7437.762) -- 0:09:34 664500 -- [-7419.843] (-7426.774) (-7432.819) (-7435.735) * (-7444.704) (-7438.605) [-7427.426] (-7429.524) -- 0:09:34 665000 -- (-7430.185) (-7428.236) [-7426.270] (-7444.500) * (-7452.751) [-7432.337] (-7429.275) (-7433.879) -- 0:09:33 Average standard deviation of split frequencies: 0.005871 665500 -- (-7435.189) (-7428.815) [-7428.802] (-7442.680) * (-7432.786) (-7431.215) (-7422.590) [-7443.911] -- 0:09:31 666000 -- (-7425.186) (-7436.573) (-7429.809) [-7437.577] * (-7434.995) (-7426.520) [-7435.441] (-7431.072) -- 0:09:31 666500 -- (-7433.805) (-7447.802) [-7435.439] (-7426.228) * [-7430.463] (-7428.038) (-7424.285) (-7452.210) -- 0:09:30 667000 -- (-7436.438) (-7440.508) (-7436.782) [-7423.633] * (-7434.796) (-7433.212) [-7433.080] (-7435.966) -- 0:09:29 667500 -- (-7436.664) [-7439.942] (-7434.026) (-7433.761) * (-7433.117) (-7432.551) [-7435.904] (-7434.752) -- 0:09:28 668000 -- (-7426.068) (-7426.558) [-7431.385] (-7430.115) * (-7438.995) [-7427.194] (-7426.550) (-7445.732) -- 0:09:28 668500 -- [-7424.420] (-7432.027) (-7435.447) (-7438.231) * [-7432.068] (-7435.195) (-7428.372) (-7448.807) -- 0:09:27 669000 -- (-7436.998) [-7429.609] (-7434.243) (-7432.743) * [-7430.808] (-7446.540) (-7434.570) (-7436.719) -- 0:09:26 669500 -- [-7428.900] (-7428.895) (-7436.090) (-7437.978) * (-7434.471) [-7424.682] (-7427.250) (-7428.405) -- 0:09:25 670000 -- (-7432.837) [-7423.809] (-7441.143) (-7434.954) * [-7430.259] (-7437.284) (-7428.968) (-7427.247) -- 0:09:24 Average standard deviation of split frequencies: 0.006078 670500 -- [-7430.292] (-7431.232) (-7428.963) (-7438.048) * [-7434.894] (-7429.846) (-7433.920) (-7441.890) -- 0:09:23 671000 -- (-7438.140) [-7429.755] (-7428.116) (-7436.360) * (-7435.130) [-7428.790] (-7436.620) (-7446.009) -- 0:09:22 671500 -- (-7445.907) (-7438.786) [-7429.448] (-7449.128) * (-7436.971) (-7429.427) (-7434.638) [-7435.111] -- 0:09:22 672000 -- (-7439.794) (-7422.961) [-7426.056] (-7437.546) * (-7443.260) (-7432.993) (-7437.310) [-7431.887] -- 0:09:20 672500 -- (-7435.020) [-7423.090] (-7436.555) (-7433.803) * (-7446.452) [-7432.259] (-7431.607) (-7438.488) -- 0:09:20 673000 -- (-7448.833) (-7426.477) (-7442.370) [-7431.508] * (-7440.830) (-7439.364) (-7424.612) [-7433.251] -- 0:09:19 673500 -- (-7447.158) (-7430.048) (-7447.599) [-7425.117] * (-7441.281) [-7423.097] (-7433.951) (-7428.366) -- 0:09:18 674000 -- (-7439.684) (-7430.656) [-7429.375] (-7427.422) * (-7434.592) (-7430.409) (-7435.223) [-7427.785] -- 0:09:17 674500 -- (-7434.468) [-7426.024] (-7429.139) (-7429.191) * (-7439.159) (-7428.343) [-7431.709] (-7434.435) -- 0:09:16 675000 -- (-7431.450) (-7437.641) [-7424.129] (-7431.041) * [-7427.940] (-7435.939) (-7434.158) (-7428.829) -- 0:09:16 Average standard deviation of split frequencies: 0.006153 675500 -- (-7427.888) (-7434.309) [-7431.975] (-7431.602) * (-7428.250) (-7434.899) [-7436.660] (-7428.183) -- 0:09:14 676000 -- (-7441.003) [-7432.583] (-7432.479) (-7439.952) * (-7436.290) [-7442.944] (-7436.338) (-7426.637) -- 0:09:14 676500 -- (-7434.085) [-7429.952] (-7436.793) (-7454.041) * (-7432.654) [-7430.735] (-7436.943) (-7431.208) -- 0:09:13 677000 -- (-7443.284) [-7430.702] (-7431.141) (-7452.597) * (-7440.299) [-7431.913] (-7431.929) (-7435.140) -- 0:09:12 677500 -- (-7438.783) (-7427.032) (-7442.070) [-7427.395] * [-7435.113] (-7434.575) (-7449.064) (-7431.615) -- 0:09:11 678000 -- (-7429.263) (-7432.624) (-7437.956) [-7425.818] * (-7437.709) (-7426.681) [-7436.917] (-7432.203) -- 0:09:10 678500 -- (-7439.070) [-7431.499] (-7429.114) (-7437.881) * (-7435.823) (-7432.922) (-7442.097) [-7433.627] -- 0:09:10 679000 -- (-7430.214) [-7425.035] (-7435.783) (-7425.001) * [-7437.489] (-7438.018) (-7432.487) (-7446.371) -- 0:09:08 679500 -- [-7434.131] (-7439.681) (-7435.738) (-7434.168) * (-7441.123) [-7423.271] (-7438.997) (-7446.460) -- 0:09:08 680000 -- (-7437.509) (-7436.488) [-7425.214] (-7438.309) * (-7437.112) (-7431.174) (-7434.232) [-7434.211] -- 0:09:07 Average standard deviation of split frequencies: 0.006233 680500 -- [-7425.682] (-7430.344) (-7427.497) (-7436.008) * (-7427.600) (-7436.900) (-7436.915) [-7433.613] -- 0:09:06 681000 -- (-7433.349) [-7429.946] (-7423.711) (-7442.471) * (-7438.493) (-7442.193) [-7432.487] (-7444.199) -- 0:09:05 681500 -- (-7443.802) (-7428.040) (-7427.027) [-7426.074] * [-7434.442] (-7432.079) (-7437.243) (-7429.440) -- 0:09:04 682000 -- (-7441.814) [-7426.197] (-7425.828) (-7435.258) * (-7429.113) [-7429.131] (-7435.806) (-7426.610) -- 0:09:03 682500 -- [-7433.503] (-7429.825) (-7438.314) (-7440.183) * (-7440.198) (-7432.804) [-7433.095] (-7421.697) -- 0:09:02 683000 -- (-7439.925) (-7431.606) [-7433.868] (-7427.692) * (-7430.170) (-7459.298) (-7435.090) [-7423.499] -- 0:09:02 683500 -- [-7431.164] (-7430.485) (-7451.701) (-7436.886) * (-7444.250) (-7431.658) [-7429.492] (-7430.318) -- 0:09:01 684000 -- (-7443.056) [-7435.586] (-7435.809) (-7440.746) * [-7432.301] (-7432.831) (-7449.611) (-7429.293) -- 0:09:00 684500 -- (-7447.122) (-7437.148) [-7433.812] (-7435.934) * (-7434.052) (-7435.671) (-7430.395) [-7424.620] -- 0:08:59 685000 -- (-7438.412) (-7430.905) [-7434.530] (-7439.853) * [-7434.050] (-7434.114) (-7429.573) (-7430.444) -- 0:08:58 Average standard deviation of split frequencies: 0.006427 685500 -- (-7427.809) (-7444.262) (-7445.065) [-7429.510] * (-7438.616) (-7439.304) [-7428.092] (-7436.089) -- 0:08:57 686000 -- (-7433.647) [-7428.949] (-7448.213) (-7437.540) * [-7436.922] (-7424.643) (-7435.377) (-7435.143) -- 0:08:56 686500 -- [-7427.303] (-7436.207) (-7447.848) (-7434.167) * [-7444.008] (-7422.285) (-7443.334) (-7441.331) -- 0:08:56 687000 -- (-7430.626) [-7429.297] (-7438.864) (-7448.170) * (-7430.073) [-7424.521] (-7436.787) (-7436.640) -- 0:08:55 687500 -- (-7437.646) [-7423.506] (-7439.722) (-7437.332) * [-7438.235] (-7428.669) (-7435.942) (-7430.056) -- 0:08:54 688000 -- (-7435.064) [-7422.142] (-7442.581) (-7431.684) * (-7432.350) (-7440.431) (-7430.751) [-7426.436] -- 0:08:53 688500 -- [-7436.683] (-7427.750) (-7440.764) (-7432.031) * (-7431.585) [-7429.460] (-7439.262) (-7436.305) -- 0:08:52 689000 -- (-7430.597) (-7427.309) (-7441.110) [-7435.418] * [-7443.149] (-7436.707) (-7429.482) (-7428.674) -- 0:08:51 689500 -- (-7436.772) (-7430.135) [-7425.624] (-7433.980) * (-7431.179) (-7440.549) [-7431.057] (-7430.111) -- 0:08:50 690000 -- (-7438.279) (-7429.411) (-7433.718) [-7426.863] * [-7425.793] (-7429.064) (-7427.494) (-7429.805) -- 0:08:50 Average standard deviation of split frequencies: 0.007187 690500 -- (-7436.028) (-7440.964) [-7430.989] (-7433.530) * (-7434.123) [-7430.873] (-7429.672) (-7427.427) -- 0:08:49 691000 -- (-7428.287) [-7424.719] (-7441.655) (-7441.368) * (-7441.101) (-7431.793) [-7430.848] (-7431.696) -- 0:08:48 691500 -- (-7433.735) (-7439.241) [-7428.281] (-7426.423) * (-7428.275) (-7431.444) (-7428.119) [-7429.090] -- 0:08:47 692000 -- (-7428.154) (-7442.246) (-7433.185) [-7428.135] * [-7436.177] (-7440.159) (-7432.380) (-7434.592) -- 0:08:46 692500 -- (-7429.047) [-7428.984] (-7430.675) (-7432.939) * (-7435.447) (-7421.348) [-7424.231] (-7435.049) -- 0:08:45 693000 -- (-7431.471) (-7432.089) (-7431.083) [-7433.251] * (-7444.712) (-7426.466) (-7437.808) [-7430.788] -- 0:08:44 693500 -- (-7436.306) (-7432.827) [-7431.585] (-7435.635) * (-7436.550) (-7426.827) (-7435.478) [-7432.780] -- 0:08:44 694000 -- (-7430.677) (-7441.963) (-7431.265) [-7425.366] * (-7437.627) [-7427.267] (-7431.362) (-7428.151) -- 0:08:43 694500 -- (-7425.427) (-7437.217) [-7428.609] (-7426.608) * [-7429.411] (-7423.677) (-7438.715) (-7429.666) -- 0:08:42 695000 -- [-7431.801] (-7432.540) (-7438.370) (-7431.973) * (-7435.513) (-7422.566) (-7437.381) [-7427.996] -- 0:08:41 Average standard deviation of split frequencies: 0.006932 695500 -- (-7435.385) [-7432.325] (-7441.086) (-7429.723) * [-7430.436] (-7437.064) (-7434.135) (-7428.260) -- 0:08:40 696000 -- (-7432.249) (-7435.785) (-7431.983) [-7425.777] * (-7427.694) (-7429.188) (-7434.853) [-7432.467] -- 0:08:39 696500 -- (-7430.504) (-7444.576) (-7439.866) [-7429.556] * [-7425.678] (-7433.562) (-7430.453) (-7429.341) -- 0:08:38 697000 -- [-7426.550] (-7440.705) (-7432.166) (-7440.593) * (-7427.026) [-7431.901] (-7431.792) (-7424.005) -- 0:08:38 697500 -- (-7435.433) [-7434.674] (-7440.516) (-7441.395) * (-7431.712) [-7436.181] (-7435.097) (-7432.044) -- 0:08:37 698000 -- [-7433.061] (-7443.236) (-7434.743) (-7432.181) * (-7432.887) (-7441.545) [-7432.322] (-7435.416) -- 0:08:36 698500 -- (-7430.630) [-7433.813] (-7444.402) (-7429.466) * [-7424.610] (-7428.055) (-7435.774) (-7442.842) -- 0:08:35 699000 -- (-7436.411) (-7446.595) [-7435.724] (-7441.573) * (-7426.844) (-7436.702) [-7429.580] (-7427.600) -- 0:08:34 699500 -- (-7439.074) (-7442.520) [-7428.451] (-7440.526) * (-7426.700) [-7434.574] (-7445.466) (-7426.785) -- 0:08:33 700000 -- (-7437.843) (-7427.415) (-7430.686) [-7430.301] * (-7428.183) (-7435.212) [-7433.276] (-7425.579) -- 0:08:33 Average standard deviation of split frequencies: 0.007005 700500 -- [-7431.885] (-7429.991) (-7426.490) (-7433.207) * (-7430.721) (-7433.559) (-7439.040) [-7422.782] -- 0:08:32 701000 -- (-7431.730) (-7451.249) [-7421.602] (-7432.093) * (-7446.020) (-7437.292) (-7438.064) [-7419.572] -- 0:08:31 701500 -- (-7436.981) (-7441.575) (-7436.904) [-7437.309] * (-7432.909) (-7435.321) [-7434.222] (-7425.446) -- 0:08:30 702000 -- (-7426.859) (-7455.918) [-7432.231] (-7430.498) * (-7426.964) [-7434.199] (-7448.137) (-7440.514) -- 0:08:29 702500 -- (-7448.317) [-7433.239] (-7426.826) (-7434.885) * (-7446.270) (-7434.851) (-7433.248) [-7429.137] -- 0:08:28 703000 -- (-7444.057) (-7434.166) [-7428.700] (-7430.588) * (-7447.130) (-7424.465) (-7439.163) [-7435.285] -- 0:08:27 703500 -- (-7433.621) [-7426.128] (-7428.362) (-7430.000) * [-7432.277] (-7423.420) (-7441.774) (-7431.300) -- 0:08:27 704000 -- (-7439.126) (-7427.957) (-7435.883) [-7430.607] * (-7433.503) [-7424.294] (-7459.660) (-7436.166) -- 0:08:26 704500 -- (-7440.550) (-7438.438) (-7431.839) [-7432.269] * (-7451.430) (-7436.901) (-7443.801) [-7427.668] -- 0:08:25 705000 -- (-7445.901) [-7441.126] (-7434.210) (-7431.148) * [-7423.366] (-7433.262) (-7438.279) (-7430.971) -- 0:08:24 Average standard deviation of split frequencies: 0.006756 705500 -- (-7438.547) (-7439.950) (-7432.897) [-7431.683] * (-7432.693) [-7425.515] (-7435.132) (-7436.544) -- 0:08:23 706000 -- (-7437.510) (-7432.155) [-7429.633] (-7434.216) * (-7430.996) [-7427.295] (-7434.169) (-7436.965) -- 0:08:22 706500 -- [-7430.922] (-7430.844) (-7437.340) (-7433.055) * (-7438.595) (-7425.555) [-7434.809] (-7431.255) -- 0:08:21 707000 -- (-7431.291) [-7433.051] (-7432.795) (-7431.045) * (-7439.585) (-7433.362) [-7428.249] (-7430.242) -- 0:08:21 707500 -- (-7425.760) (-7433.374) (-7446.662) [-7432.874] * [-7426.319] (-7433.942) (-7437.991) (-7435.787) -- 0:08:19 708000 -- [-7426.588] (-7435.399) (-7442.503) (-7436.182) * [-7435.956] (-7427.808) (-7430.353) (-7435.190) -- 0:08:19 708500 -- [-7432.185] (-7443.535) (-7438.473) (-7448.392) * [-7429.291] (-7436.621) (-7421.824) (-7444.085) -- 0:08:18 709000 -- (-7436.711) (-7458.378) (-7430.521) [-7428.862] * (-7433.133) [-7426.807] (-7430.512) (-7436.903) -- 0:08:17 709500 -- [-7436.952] (-7446.351) (-7428.878) (-7439.859) * (-7427.973) (-7429.882) (-7428.384) [-7434.166] -- 0:08:16 710000 -- (-7431.764) [-7431.276] (-7427.315) (-7445.389) * (-7440.036) (-7427.645) [-7432.996] (-7432.437) -- 0:08:15 Average standard deviation of split frequencies: 0.006672 710500 -- [-7427.231] (-7431.288) (-7428.968) (-7439.374) * [-7425.858] (-7436.833) (-7430.461) (-7425.992) -- 0:08:15 711000 -- (-7431.207) [-7431.572] (-7432.869) (-7444.585) * (-7435.536) (-7440.363) (-7434.824) [-7429.245] -- 0:08:13 711500 -- (-7427.383) (-7423.850) [-7425.979] (-7442.173) * (-7433.374) [-7424.471] (-7444.848) (-7424.641) -- 0:08:13 712000 -- [-7427.096] (-7432.086) (-7432.944) (-7437.289) * [-7422.181] (-7426.949) (-7441.056) (-7431.102) -- 0:08:12 712500 -- (-7427.004) [-7429.872] (-7446.379) (-7441.486) * (-7433.416) [-7430.962] (-7448.915) (-7438.154) -- 0:08:11 713000 -- (-7436.320) (-7442.013) [-7432.128] (-7441.686) * [-7430.030] (-7435.760) (-7442.633) (-7442.967) -- 0:08:10 713500 -- [-7430.711] (-7440.065) (-7434.740) (-7434.746) * (-7433.918) (-7433.632) (-7435.892) [-7430.312] -- 0:08:09 714000 -- (-7431.142) (-7446.854) (-7429.164) [-7437.640] * [-7437.006] (-7430.906) (-7440.546) (-7435.445) -- 0:08:09 714500 -- [-7432.123] (-7436.281) (-7424.639) (-7436.057) * (-7434.318) [-7427.862] (-7440.493) (-7442.350) -- 0:08:07 715000 -- [-7421.237] (-7428.073) (-7425.075) (-7447.556) * (-7443.821) (-7440.521) [-7437.489] (-7450.834) -- 0:08:07 Average standard deviation of split frequencies: 0.006816 715500 -- [-7422.341] (-7441.766) (-7436.779) (-7432.454) * (-7435.195) [-7427.920] (-7448.037) (-7438.831) -- 0:08:06 716000 -- (-7445.647) (-7437.941) (-7433.789) [-7428.513] * (-7422.285) [-7427.711] (-7433.621) (-7433.583) -- 0:08:05 716500 -- (-7432.378) (-7441.447) (-7430.404) [-7430.321] * [-7430.278] (-7431.183) (-7431.267) (-7434.702) -- 0:08:04 717000 -- [-7424.565] (-7446.802) (-7429.688) (-7434.193) * (-7443.570) (-7436.325) [-7436.898] (-7441.456) -- 0:08:03 717500 -- (-7433.185) (-7439.009) (-7434.583) [-7427.566] * (-7433.298) [-7429.585] (-7434.450) (-7430.339) -- 0:08:02 718000 -- (-7428.277) (-7429.488) (-7441.041) [-7431.911] * [-7425.376] (-7438.030) (-7433.132) (-7429.970) -- 0:08:01 718500 -- (-7428.253) (-7440.252) (-7444.051) [-7434.755] * [-7430.185] (-7435.819) (-7442.558) (-7429.316) -- 0:08:01 719000 -- (-7426.519) (-7456.042) (-7430.744) [-7435.864] * [-7426.375] (-7441.656) (-7437.496) (-7432.792) -- 0:08:00 719500 -- (-7434.799) [-7438.410] (-7434.668) (-7443.457) * [-7429.844] (-7433.853) (-7429.817) (-7427.727) -- 0:07:59 720000 -- (-7442.419) [-7427.257] (-7427.975) (-7447.579) * [-7434.862] (-7450.965) (-7430.570) (-7442.005) -- 0:07:58 Average standard deviation of split frequencies: 0.006888 720500 -- (-7434.125) [-7427.624] (-7432.157) (-7445.895) * [-7431.114] (-7436.497) (-7439.398) (-7432.355) -- 0:07:57 721000 -- (-7440.112) (-7426.580) (-7429.460) [-7436.779] * (-7436.661) [-7428.435] (-7441.019) (-7436.069) -- 0:07:56 721500 -- (-7436.169) [-7427.038] (-7429.780) (-7446.525) * (-7432.463) [-7431.292] (-7439.113) (-7425.756) -- 0:07:55 722000 -- (-7437.404) [-7430.223] (-7442.031) (-7436.072) * (-7442.220) [-7425.000] (-7432.122) (-7426.199) -- 0:07:55 722500 -- (-7433.082) [-7436.293] (-7434.173) (-7431.672) * (-7445.118) [-7425.014] (-7436.667) (-7426.333) -- 0:07:54 723000 -- (-7437.413) [-7431.005] (-7436.559) (-7434.417) * (-7433.618) (-7439.222) [-7434.314] (-7429.776) -- 0:07:53 723500 -- [-7431.533] (-7430.437) (-7439.140) (-7440.608) * (-7427.417) [-7429.833] (-7433.492) (-7439.077) -- 0:07:52 724000 -- (-7429.638) [-7436.333] (-7436.348) (-7437.621) * [-7436.958] (-7437.924) (-7431.911) (-7430.263) -- 0:07:51 724500 -- (-7433.727) (-7432.902) (-7437.891) [-7427.723] * (-7429.248) (-7432.467) (-7428.529) [-7425.390] -- 0:07:50 725000 -- (-7434.117) [-7426.787] (-7436.522) (-7431.212) * (-7440.431) [-7431.470] (-7431.234) (-7431.642) -- 0:07:49 Average standard deviation of split frequencies: 0.006646 725500 -- (-7429.418) [-7428.542] (-7440.145) (-7429.321) * (-7429.833) [-7428.959] (-7432.968) (-7436.883) -- 0:07:49 726000 -- (-7432.410) [-7430.874] (-7441.099) (-7433.513) * (-7441.225) [-7437.095] (-7422.342) (-7427.048) -- 0:07:48 726500 -- (-7431.695) (-7426.454) (-7437.721) [-7424.226] * [-7432.386] (-7442.533) (-7435.616) (-7441.298) -- 0:07:47 727000 -- (-7437.957) (-7434.205) (-7435.111) [-7428.173] * [-7428.020] (-7438.410) (-7435.165) (-7424.882) -- 0:07:46 727500 -- (-7432.345) (-7434.004) (-7433.449) [-7434.036] * (-7429.362) [-7429.132] (-7441.022) (-7426.982) -- 0:07:45 728000 -- (-7430.884) [-7430.896] (-7436.456) (-7434.515) * (-7434.114) (-7438.854) [-7437.303] (-7442.827) -- 0:07:44 728500 -- [-7425.839] (-7429.419) (-7439.817) (-7445.201) * (-7430.457) (-7432.199) [-7437.287] (-7437.899) -- 0:07:43 729000 -- (-7425.232) [-7435.416] (-7434.659) (-7433.022) * (-7439.443) (-7435.267) [-7432.666] (-7433.987) -- 0:07:43 729500 -- [-7425.305] (-7438.834) (-7429.256) (-7434.771) * (-7433.764) (-7435.806) (-7426.772) [-7435.375] -- 0:07:42 730000 -- (-7426.745) (-7432.616) [-7429.882] (-7439.904) * (-7435.961) [-7425.630] (-7432.517) (-7434.873) -- 0:07:41 Average standard deviation of split frequencies: 0.006490 730500 -- (-7429.880) (-7423.444) [-7430.436] (-7440.559) * (-7435.822) (-7433.520) (-7434.871) [-7430.675] -- 0:07:40 731000 -- (-7432.205) (-7433.396) [-7428.262] (-7433.827) * (-7431.011) [-7432.830] (-7427.723) (-7440.740) -- 0:07:39 731500 -- (-7433.597) (-7425.017) (-7445.899) [-7430.396] * (-7429.814) (-7428.294) [-7434.510] (-7445.219) -- 0:07:38 732000 -- (-7440.862) [-7436.524] (-7433.490) (-7436.709) * (-7424.451) [-7430.960] (-7435.124) (-7447.671) -- 0:07:38 732500 -- (-7430.305) [-7429.394] (-7429.683) (-7439.561) * [-7430.072] (-7434.530) (-7434.976) (-7447.072) -- 0:07:37 733000 -- (-7441.803) (-7429.661) (-7431.308) [-7429.954] * (-7438.256) (-7448.062) [-7430.982] (-7434.178) -- 0:07:36 733500 -- [-7432.746] (-7431.363) (-7428.364) (-7438.483) * (-7439.094) (-7442.516) [-7425.568] (-7430.360) -- 0:07:35 734000 -- [-7431.540] (-7432.866) (-7434.403) (-7429.531) * (-7432.016) (-7435.424) [-7428.470] (-7437.760) -- 0:07:34 734500 -- (-7439.761) (-7430.879) (-7431.837) [-7437.119] * (-7435.928) [-7426.762] (-7433.494) (-7435.573) -- 0:07:33 735000 -- (-7430.772) (-7437.554) (-7433.078) [-7428.696] * [-7425.046] (-7435.552) (-7433.545) (-7433.479) -- 0:07:32 Average standard deviation of split frequencies: 0.006669 735500 -- (-7429.089) (-7448.424) [-7433.720] (-7429.724) * (-7432.981) (-7430.156) (-7439.242) [-7429.819] -- 0:07:32 736000 -- [-7435.230] (-7431.678) (-7434.787) (-7444.279) * (-7448.734) [-7433.706] (-7430.571) (-7443.211) -- 0:07:31 736500 -- (-7434.729) [-7430.942] (-7422.533) (-7434.224) * (-7433.305) (-7421.652) (-7428.527) [-7429.667] -- 0:07:30 737000 -- (-7427.698) (-7433.173) [-7433.254] (-7443.348) * (-7435.683) [-7423.506] (-7429.188) (-7435.810) -- 0:07:29 737500 -- (-7431.316) [-7429.445] (-7439.612) (-7434.944) * (-7425.827) (-7426.353) [-7426.879] (-7432.644) -- 0:07:28 738000 -- [-7424.241] (-7436.238) (-7433.790) (-7430.546) * (-7433.467) (-7429.182) (-7443.105) [-7440.336] -- 0:07:27 738500 -- [-7434.840] (-7435.874) (-7440.136) (-7428.069) * (-7426.575) [-7428.003] (-7440.777) (-7440.851) -- 0:07:26 739000 -- (-7436.042) (-7430.808) [-7431.776] (-7436.659) * [-7435.108] (-7443.373) (-7441.676) (-7433.744) -- 0:07:26 739500 -- [-7436.729] (-7444.179) (-7446.314) (-7433.470) * (-7431.351) [-7441.207] (-7448.985) (-7432.108) -- 0:07:25 740000 -- [-7431.194] (-7432.659) (-7435.244) (-7447.691) * (-7431.815) (-7429.801) (-7443.251) [-7425.980] -- 0:07:24 Average standard deviation of split frequencies: 0.006702 740500 -- [-7429.745] (-7437.330) (-7449.863) (-7441.176) * (-7445.515) [-7429.983] (-7440.769) (-7429.425) -- 0:07:23 741000 -- [-7433.129] (-7437.017) (-7433.227) (-7428.500) * (-7429.774) (-7434.062) (-7434.760) [-7433.962] -- 0:07:22 741500 -- (-7441.206) (-7431.313) [-7427.044] (-7426.432) * [-7428.320] (-7429.354) (-7437.999) (-7432.661) -- 0:07:21 742000 -- [-7429.251] (-7434.013) (-7439.901) (-7448.326) * [-7429.666] (-7439.595) (-7434.823) (-7428.017) -- 0:07:20 742500 -- (-7442.247) (-7437.467) (-7438.289) [-7443.179] * [-7433.294] (-7440.285) (-7439.730) (-7434.273) -- 0:07:20 743000 -- [-7424.654] (-7435.738) (-7436.280) (-7434.528) * (-7434.478) (-7443.678) (-7428.764) [-7422.312] -- 0:07:19 743500 -- (-7436.768) (-7429.252) (-7435.966) [-7429.377] * (-7433.783) (-7429.841) (-7426.287) [-7424.208] -- 0:07:18 744000 -- (-7442.140) (-7431.542) (-7436.452) [-7428.192] * (-7438.503) (-7430.884) [-7432.209] (-7435.833) -- 0:07:17 744500 -- (-7445.137) [-7427.649] (-7432.589) (-7432.364) * (-7436.731) [-7427.992] (-7436.428) (-7429.222) -- 0:07:16 745000 -- (-7431.243) (-7440.332) (-7435.187) [-7431.092] * (-7437.777) [-7432.461] (-7432.604) (-7430.819) -- 0:07:15 Average standard deviation of split frequencies: 0.007211 745500 -- [-7423.889] (-7448.668) (-7437.897) (-7427.054) * (-7427.712) [-7430.125] (-7434.852) (-7438.877) -- 0:07:14 746000 -- [-7425.063] (-7438.732) (-7432.554) (-7422.764) * [-7428.501] (-7440.973) (-7430.426) (-7447.046) -- 0:07:14 746500 -- (-7431.599) [-7429.642] (-7428.342) (-7453.357) * [-7438.002] (-7438.096) (-7433.740) (-7431.601) -- 0:07:12 747000 -- (-7426.786) (-7438.393) [-7430.446] (-7434.855) * (-7436.889) [-7430.790] (-7427.637) (-7439.580) -- 0:07:12 747500 -- [-7427.374] (-7439.179) (-7437.052) (-7440.254) * (-7437.828) (-7436.528) (-7430.200) [-7425.673] -- 0:07:11 748000 -- (-7431.915) (-7437.324) [-7433.984] (-7431.889) * (-7434.268) (-7451.470) (-7437.709) [-7430.488] -- 0:07:10 748500 -- (-7432.369) (-7432.125) (-7431.180) [-7426.362] * (-7436.300) (-7427.178) [-7432.986] (-7432.162) -- 0:07:09 749000 -- (-7443.590) [-7428.574] (-7429.716) (-7432.858) * (-7430.265) (-7424.450) (-7433.795) [-7426.233] -- 0:07:08 749500 -- (-7442.144) (-7434.264) [-7428.672] (-7428.265) * [-7434.938] (-7429.768) (-7430.765) (-7426.846) -- 0:07:08 750000 -- (-7437.990) (-7439.197) (-7431.378) [-7423.558] * [-7440.570] (-7447.265) (-7428.495) (-7426.643) -- 0:07:07 Average standard deviation of split frequencies: 0.007203 750500 -- [-7433.502] (-7438.506) (-7437.132) (-7433.686) * (-7438.491) [-7432.012] (-7431.756) (-7440.912) -- 0:07:06 751000 -- [-7431.263] (-7457.085) (-7443.738) (-7439.208) * (-7428.652) [-7430.638] (-7432.392) (-7427.085) -- 0:07:05 751500 -- (-7429.337) (-7434.845) [-7432.122] (-7427.157) * (-7430.152) (-7445.673) (-7431.544) [-7435.948] -- 0:07:04 752000 -- (-7436.761) (-7433.674) (-7429.306) [-7437.898] * (-7426.064) (-7441.011) (-7433.276) [-7430.305] -- 0:07:03 752500 -- (-7437.611) (-7432.484) (-7422.660) [-7425.142] * [-7424.373] (-7443.124) (-7440.920) (-7433.535) -- 0:07:02 753000 -- (-7438.775) (-7431.287) (-7429.691) [-7428.439] * (-7428.518) [-7432.653] (-7436.080) (-7430.756) -- 0:07:02 753500 -- (-7434.596) (-7440.791) [-7433.790] (-7423.547) * [-7421.941] (-7440.700) (-7431.910) (-7427.340) -- 0:07:01 754000 -- (-7431.593) (-7428.892) (-7427.938) [-7423.375] * (-7433.576) [-7438.883] (-7438.933) (-7428.719) -- 0:07:00 754500 -- [-7433.665] (-7442.405) (-7434.481) (-7422.999) * (-7435.764) [-7429.303] (-7432.833) (-7425.975) -- 0:06:59 755000 -- (-7429.208) [-7434.154] (-7430.097) (-7426.930) * [-7431.260] (-7428.824) (-7436.329) (-7433.979) -- 0:06:58 Average standard deviation of split frequencies: 0.006749 755500 -- (-7427.623) (-7423.184) [-7429.912] (-7430.837) * [-7424.820] (-7433.991) (-7434.754) (-7431.770) -- 0:06:57 756000 -- [-7433.286] (-7424.209) (-7441.386) (-7438.335) * (-7431.665) [-7430.115] (-7432.471) (-7433.596) -- 0:06:56 756500 -- [-7429.937] (-7433.969) (-7432.443) (-7433.761) * [-7428.850] (-7436.973) (-7432.813) (-7429.863) -- 0:06:55 757000 -- [-7422.778] (-7428.198) (-7429.193) (-7431.505) * [-7428.737] (-7432.715) (-7432.002) (-7430.377) -- 0:06:55 757500 -- (-7428.934) [-7427.558] (-7441.677) (-7433.729) * (-7430.119) (-7437.594) (-7449.959) [-7431.744] -- 0:06:54 758000 -- (-7430.340) (-7429.037) [-7434.965] (-7435.083) * (-7439.179) [-7430.466] (-7437.199) (-7428.806) -- 0:06:53 758500 -- (-7435.174) (-7439.202) [-7427.263] (-7431.744) * (-7434.512) (-7425.665) (-7440.606) [-7426.550] -- 0:06:52 759000 -- (-7433.158) (-7446.819) (-7428.564) [-7427.176] * (-7437.005) (-7425.632) [-7441.522] (-7426.020) -- 0:06:51 759500 -- [-7427.345] (-7439.176) (-7432.140) (-7430.985) * (-7439.839) [-7428.809] (-7440.402) (-7431.518) -- 0:06:51 760000 -- (-7431.404) (-7433.936) [-7431.916] (-7437.614) * (-7434.903) [-7426.594] (-7438.971) (-7434.663) -- 0:06:49 Average standard deviation of split frequencies: 0.007072 760500 -- (-7432.922) (-7438.861) (-7441.315) [-7430.623] * (-7440.411) [-7424.435] (-7441.710) (-7430.360) -- 0:06:49 761000 -- (-7429.693) (-7433.494) [-7423.443] (-7424.268) * (-7434.774) (-7424.596) (-7445.408) [-7427.541] -- 0:06:48 761500 -- [-7435.960] (-7429.354) (-7438.203) (-7430.771) * (-7430.764) [-7422.162] (-7439.076) (-7432.848) -- 0:06:47 762000 -- (-7430.594) (-7439.140) (-7435.650) [-7432.344] * (-7439.126) [-7430.385] (-7436.813) (-7434.242) -- 0:06:46 762500 -- (-7424.827) (-7438.244) [-7433.579] (-7435.029) * [-7443.689] (-7438.853) (-7433.508) (-7426.623) -- 0:06:45 763000 -- [-7429.443] (-7439.474) (-7432.857) (-7434.100) * (-7435.848) (-7439.226) [-7436.923] (-7442.530) -- 0:06:44 763500 -- [-7427.991] (-7433.471) (-7439.957) (-7430.104) * (-7439.699) [-7432.509] (-7444.043) (-7440.823) -- 0:06:43 764000 -- (-7430.526) [-7423.883] (-7435.406) (-7434.752) * (-7452.151) (-7440.201) [-7428.949] (-7429.833) -- 0:06:43 764500 -- (-7435.276) (-7445.713) [-7434.932] (-7434.483) * (-7441.423) (-7439.918) (-7437.416) [-7426.159] -- 0:06:42 765000 -- (-7433.385) (-7439.418) [-7436.011] (-7435.150) * (-7450.305) [-7422.882] (-7437.016) (-7435.003) -- 0:06:41 Average standard deviation of split frequencies: 0.007095 765500 -- (-7433.462) (-7442.324) [-7423.881] (-7428.894) * [-7436.085] (-7433.570) (-7443.766) (-7435.599) -- 0:06:40 766000 -- (-7446.559) (-7437.413) (-7436.300) [-7432.420] * (-7436.692) (-7436.346) (-7447.033) [-7431.827] -- 0:06:39 766500 -- (-7437.229) (-7429.170) (-7436.065) [-7426.055] * (-7438.342) (-7429.165) (-7427.665) [-7427.818] -- 0:06:38 767000 -- (-7439.115) (-7427.908) (-7428.588) [-7431.188] * (-7443.017) (-7431.929) (-7439.197) [-7437.206] -- 0:06:37 767500 -- (-7434.321) (-7433.179) (-7437.322) [-7429.560] * (-7432.511) (-7435.702) [-7430.423] (-7434.547) -- 0:06:37 768000 -- (-7442.262) [-7439.741] (-7437.027) (-7430.296) * (-7433.264) (-7432.115) [-7437.532] (-7424.639) -- 0:06:36 768500 -- (-7437.273) [-7430.108] (-7426.606) (-7426.449) * (-7437.391) [-7435.054] (-7432.952) (-7438.960) -- 0:06:35 769000 -- (-7430.780) [-7430.857] (-7434.027) (-7441.597) * (-7440.043) (-7426.653) (-7433.230) [-7434.669] -- 0:06:34 769500 -- (-7436.562) [-7429.541] (-7429.246) (-7431.039) * (-7431.766) [-7436.770] (-7427.030) (-7445.651) -- 0:06:33 770000 -- [-7429.918] (-7431.196) (-7435.793) (-7447.201) * (-7429.965) (-7442.522) [-7435.831] (-7442.532) -- 0:06:32 Average standard deviation of split frequencies: 0.007376 770500 -- (-7435.438) (-7429.825) [-7434.960] (-7440.921) * (-7436.178) (-7444.197) (-7432.775) [-7437.418] -- 0:06:31 771000 -- (-7441.202) (-7432.316) [-7435.097] (-7430.698) * (-7433.029) (-7431.971) [-7424.321] (-7439.103) -- 0:06:31 771500 -- [-7425.710] (-7427.385) (-7437.292) (-7434.722) * [-7427.255] (-7434.485) (-7423.594) (-7434.332) -- 0:06:30 772000 -- [-7429.544] (-7439.435) (-7439.021) (-7424.569) * [-7426.004] (-7433.998) (-7428.340) (-7439.772) -- 0:06:29 772500 -- (-7429.446) (-7435.526) [-7425.041] (-7433.380) * (-7436.537) [-7427.624] (-7427.615) (-7434.172) -- 0:06:28 773000 -- (-7430.505) (-7433.685) [-7428.617] (-7426.921) * (-7438.229) (-7434.403) [-7426.948] (-7441.892) -- 0:06:27 773500 -- (-7427.251) (-7442.847) [-7430.097] (-7436.471) * (-7438.713) (-7436.229) (-7425.258) [-7431.302] -- 0:06:26 774000 -- (-7427.141) (-7429.233) [-7435.861] (-7431.697) * (-7439.434) (-7428.050) (-7433.374) [-7428.628] -- 0:06:26 774500 -- (-7428.024) (-7433.333) (-7436.631) [-7430.870] * (-7452.373) (-7434.036) (-7434.694) [-7431.661] -- 0:06:25 775000 -- (-7426.362) (-7431.672) (-7438.714) [-7430.683] * (-7449.365) [-7428.286] (-7435.195) (-7444.662) -- 0:06:24 Average standard deviation of split frequencies: 0.007254 775500 -- (-7427.805) [-7442.111] (-7433.266) (-7432.073) * (-7446.631) (-7428.851) [-7422.534] (-7442.776) -- 0:06:23 776000 -- [-7429.774] (-7431.790) (-7428.369) (-7429.632) * (-7446.288) (-7442.439) [-7425.849] (-7443.655) -- 0:06:22 776500 -- [-7428.657] (-7431.737) (-7424.977) (-7431.584) * (-7441.208) (-7437.136) [-7426.611] (-7435.396) -- 0:06:21 777000 -- [-7423.479] (-7428.770) (-7438.780) (-7436.560) * (-7441.205) (-7427.381) [-7430.163] (-7429.216) -- 0:06:20 777500 -- [-7436.429] (-7430.047) (-7435.247) (-7427.795) * (-7452.939) (-7441.496) [-7429.697] (-7431.721) -- 0:06:20 778000 -- (-7426.519) [-7433.403] (-7432.794) (-7436.927) * (-7432.888) (-7438.297) (-7433.695) [-7422.821] -- 0:06:19 778500 -- (-7431.190) (-7432.877) (-7438.047) [-7436.900] * (-7431.522) (-7432.109) (-7426.308) [-7423.284] -- 0:06:18 779000 -- (-7442.090) (-7428.975) (-7444.493) [-7434.288] * (-7442.321) (-7436.840) (-7428.268) [-7426.926] -- 0:06:17 779500 -- (-7434.295) [-7433.931] (-7437.069) (-7438.138) * (-7436.239) (-7434.343) [-7428.097] (-7434.899) -- 0:06:16 780000 -- (-7435.352) [-7431.618] (-7430.733) (-7433.540) * (-7429.270) [-7429.737] (-7426.387) (-7426.613) -- 0:06:15 Average standard deviation of split frequencies: 0.006820 780500 -- (-7437.192) [-7433.929] (-7436.101) (-7436.290) * (-7432.077) (-7435.621) (-7435.937) [-7428.224] -- 0:06:14 781000 -- (-7436.952) (-7433.833) [-7427.044] (-7436.316) * (-7434.785) (-7436.167) (-7430.523) [-7425.934] -- 0:06:14 781500 -- (-7435.245) (-7430.658) [-7433.983] (-7429.135) * [-7431.928] (-7437.224) (-7426.264) (-7435.154) -- 0:06:13 782000 -- (-7432.937) [-7422.333] (-7439.416) (-7433.872) * (-7432.900) (-7441.617) [-7437.620] (-7425.173) -- 0:06:12 782500 -- (-7436.760) [-7431.663] (-7435.170) (-7432.065) * (-7425.921) (-7434.089) (-7431.404) [-7427.561] -- 0:06:11 783000 -- (-7435.553) [-7430.256] (-7430.903) (-7436.590) * [-7428.261] (-7423.492) (-7436.159) (-7422.758) -- 0:06:10 783500 -- (-7430.038) (-7433.258) [-7430.314] (-7439.266) * (-7453.696) (-7428.910) (-7434.517) [-7432.122] -- 0:06:09 784000 -- (-7432.208) [-7432.098] (-7425.623) (-7428.882) * (-7437.523) (-7432.105) [-7428.597] (-7430.353) -- 0:06:08 784500 -- (-7427.176) [-7427.942] (-7427.612) (-7437.693) * [-7436.311] (-7440.787) (-7434.320) (-7447.661) -- 0:06:08 785000 -- (-7422.091) [-7426.206] (-7438.891) (-7442.092) * [-7430.165] (-7426.206) (-7430.876) (-7440.209) -- 0:06:07 Average standard deviation of split frequencies: 0.006491 785500 -- [-7424.329] (-7436.804) (-7423.337) (-7432.727) * (-7437.266) [-7427.656] (-7427.272) (-7439.549) -- 0:06:06 786000 -- (-7427.157) (-7433.742) [-7426.718] (-7438.642) * (-7434.501) (-7436.882) (-7437.207) [-7431.586] -- 0:06:05 786500 -- [-7427.815] (-7432.121) (-7428.479) (-7439.518) * (-7438.397) (-7448.850) [-7434.521] (-7436.150) -- 0:06:04 787000 -- (-7428.369) [-7443.267] (-7429.170) (-7436.104) * (-7441.820) (-7429.431) [-7435.956] (-7442.752) -- 0:06:03 787500 -- [-7435.194] (-7441.774) (-7431.566) (-7424.892) * (-7454.126) (-7439.032) (-7445.339) [-7432.895] -- 0:06:02 788000 -- (-7431.006) [-7430.116] (-7433.258) (-7438.307) * (-7431.103) (-7443.026) (-7431.449) [-7429.000] -- 0:06:02 788500 -- [-7429.628] (-7447.484) (-7433.166) (-7434.239) * [-7427.313] (-7433.526) (-7432.102) (-7441.402) -- 0:06:01 789000 -- (-7429.842) (-7430.607) (-7437.964) [-7428.803] * [-7429.848] (-7435.683) (-7429.376) (-7439.323) -- 0:06:00 789500 -- (-7435.935) [-7431.169] (-7428.163) (-7428.450) * (-7431.270) (-7426.270) [-7435.589] (-7432.790) -- 0:05:59 790000 -- [-7424.063] (-7430.622) (-7432.362) (-7438.326) * (-7430.876) [-7430.060] (-7430.535) (-7438.733) -- 0:05:58 Average standard deviation of split frequencies: 0.006521 790500 -- [-7434.994] (-7432.522) (-7432.488) (-7433.078) * (-7432.493) [-7426.419] (-7437.289) (-7439.339) -- 0:05:57 791000 -- (-7437.469) (-7445.392) [-7424.467] (-7433.683) * (-7425.483) [-7423.675] (-7426.947) (-7440.460) -- 0:05:56 791500 -- (-7430.410) (-7447.548) (-7429.724) [-7426.645] * (-7434.799) (-7428.469) [-7428.191] (-7439.089) -- 0:05:56 792000 -- [-7426.945] (-7430.790) (-7428.454) (-7441.500) * (-7433.292) (-7440.239) (-7431.414) [-7430.872] -- 0:05:55 792500 -- (-7445.270) [-7421.202] (-7433.848) (-7428.486) * [-7419.259] (-7435.356) (-7441.507) (-7439.932) -- 0:05:54 793000 -- [-7430.907] (-7431.457) (-7430.201) (-7428.580) * (-7427.930) [-7429.524] (-7440.592) (-7438.642) -- 0:05:53 793500 -- (-7436.244) (-7431.079) (-7423.879) [-7428.117] * (-7430.298) (-7430.101) [-7439.959] (-7432.041) -- 0:05:52 794000 -- (-7439.601) [-7430.203] (-7437.583) (-7431.684) * [-7432.473] (-7432.069) (-7439.458) (-7435.127) -- 0:05:51 794500 -- (-7432.045) (-7434.150) [-7436.755] (-7433.731) * [-7427.096] (-7434.569) (-7426.357) (-7437.723) -- 0:05:50 795000 -- [-7429.287] (-7442.137) (-7435.021) (-7426.241) * [-7430.165] (-7431.175) (-7433.332) (-7436.343) -- 0:05:50 Average standard deviation of split frequencies: 0.006144 795500 -- (-7430.535) (-7435.288) (-7431.688) [-7429.520] * (-7429.262) (-7435.276) (-7441.797) [-7433.001] -- 0:05:49 796000 -- (-7430.522) (-7431.179) (-7435.291) [-7433.277] * (-7429.888) [-7431.020] (-7437.639) (-7435.946) -- 0:05:48 796500 -- [-7426.945] (-7430.372) (-7446.366) (-7424.771) * (-7428.622) (-7431.307) (-7446.382) [-7427.908] -- 0:05:47 797000 -- (-7434.108) (-7432.653) (-7444.577) [-7433.893] * [-7435.879] (-7436.415) (-7438.052) (-7426.159) -- 0:05:46 797500 -- (-7435.319) (-7436.428) [-7427.915] (-7423.878) * [-7434.316] (-7430.026) (-7444.249) (-7433.741) -- 0:05:45 798000 -- (-7442.636) (-7441.351) [-7425.570] (-7430.779) * [-7425.753] (-7430.361) (-7433.153) (-7437.477) -- 0:05:45 798500 -- (-7433.303) [-7429.648] (-7437.041) (-7424.980) * (-7441.849) [-7427.638] (-7432.821) (-7443.313) -- 0:05:44 799000 -- (-7432.278) [-7425.992] (-7431.205) (-7433.777) * (-7433.372) (-7433.753) (-7438.889) [-7430.301] -- 0:05:43 799500 -- (-7430.431) (-7426.714) (-7430.488) [-7430.600] * (-7432.949) (-7433.386) [-7427.550] (-7428.260) -- 0:05:42 800000 -- (-7432.071) [-7421.710] (-7439.412) (-7430.330) * (-7434.629) (-7430.567) [-7421.581] (-7436.483) -- 0:05:41 Average standard deviation of split frequencies: 0.006440 800500 -- (-7430.007) (-7432.808) [-7436.899] (-7433.210) * (-7442.046) [-7437.348] (-7426.356) (-7433.384) -- 0:05:40 801000 -- [-7424.416] (-7426.512) (-7435.757) (-7435.045) * (-7446.605) [-7429.985] (-7429.321) (-7441.582) -- 0:05:39 801500 -- (-7426.062) [-7427.665] (-7440.545) (-7430.519) * (-7433.736) [-7427.865] (-7426.274) (-7436.108) -- 0:05:39 802000 -- (-7443.510) [-7424.791] (-7439.897) (-7434.113) * (-7434.345) (-7432.943) [-7424.115] (-7433.695) -- 0:05:38 802500 -- (-7439.845) (-7424.863) [-7429.627] (-7440.404) * (-7428.010) (-7441.954) [-7425.536] (-7434.627) -- 0:05:37 803000 -- (-7433.305) (-7424.529) (-7431.158) [-7427.844] * (-7430.260) (-7433.338) [-7420.540] (-7435.191) -- 0:05:36 803500 -- (-7428.659) (-7428.152) (-7426.312) [-7435.056] * (-7431.565) (-7430.116) [-7421.196] (-7435.148) -- 0:05:35 804000 -- (-7433.501) (-7441.470) (-7433.656) [-7429.057] * (-7431.413) (-7430.440) [-7426.110] (-7435.517) -- 0:05:34 804500 -- (-7434.054) (-7429.546) (-7439.389) [-7424.021] * (-7435.735) [-7429.469] (-7429.036) (-7439.314) -- 0:05:33 805000 -- (-7439.573) (-7429.997) (-7437.014) [-7425.786] * (-7432.351) (-7437.185) [-7428.336] (-7436.430) -- 0:05:33 Average standard deviation of split frequencies: 0.006178 805500 -- (-7437.783) [-7429.662] (-7431.332) (-7443.758) * (-7436.381) (-7437.789) (-7423.607) [-7430.449] -- 0:05:32 806000 -- [-7432.706] (-7430.606) (-7434.342) (-7441.473) * [-7435.667] (-7437.650) (-7427.487) (-7443.899) -- 0:05:31 806500 -- (-7438.643) [-7430.934] (-7433.530) (-7437.397) * (-7423.726) (-7445.922) [-7434.818] (-7432.233) -- 0:05:30 807000 -- (-7440.304) (-7428.889) [-7438.804] (-7434.360) * (-7431.113) (-7436.578) (-7441.847) [-7429.850] -- 0:05:29 807500 -- (-7432.174) (-7428.168) [-7427.648] (-7437.362) * (-7435.225) [-7430.591] (-7443.951) (-7440.070) -- 0:05:28 808000 -- [-7432.098] (-7433.572) (-7432.025) (-7440.550) * (-7435.154) [-7431.797] (-7430.732) (-7436.982) -- 0:05:27 808500 -- (-7430.781) (-7425.188) [-7432.399] (-7441.481) * (-7434.416) (-7432.977) (-7440.909) [-7427.992] -- 0:05:27 809000 -- (-7429.375) [-7423.000] (-7436.269) (-7435.302) * [-7430.393] (-7429.870) (-7453.648) (-7424.631) -- 0:05:26 809500 -- (-7436.164) (-7438.013) [-7429.750] (-7438.552) * [-7438.137] (-7437.309) (-7430.675) (-7430.161) -- 0:05:25 810000 -- (-7447.615) (-7440.086) [-7429.614] (-7432.699) * (-7436.323) [-7427.742] (-7443.172) (-7427.105) -- 0:05:24 Average standard deviation of split frequencies: 0.005633 810500 -- (-7458.131) (-7439.950) [-7433.662] (-7433.065) * (-7432.662) [-7432.410] (-7437.938) (-7435.366) -- 0:05:23 811000 -- (-7436.277) (-7439.915) (-7443.538) [-7438.276] * (-7436.547) (-7436.338) (-7428.544) [-7425.033] -- 0:05:22 811500 -- (-7438.376) (-7452.756) (-7457.534) [-7429.167] * (-7446.237) (-7431.419) [-7425.325] (-7423.950) -- 0:05:21 812000 -- (-7449.162) (-7445.414) [-7432.417] (-7434.210) * (-7445.744) [-7431.673] (-7434.427) (-7435.909) -- 0:05:21 812500 -- [-7429.726] (-7435.190) (-7446.617) (-7424.277) * (-7440.534) (-7434.271) [-7430.365] (-7433.695) -- 0:05:20 813000 -- (-7425.899) (-7433.295) (-7445.211) [-7430.892] * (-7446.132) [-7434.248] (-7432.352) (-7432.181) -- 0:05:19 813500 -- (-7435.422) (-7433.013) [-7428.856] (-7426.215) * (-7437.170) (-7437.848) [-7437.907] (-7434.420) -- 0:05:18 814000 -- [-7425.845] (-7431.283) (-7437.488) (-7437.090) * [-7433.119] (-7434.251) (-7438.309) (-7436.104) -- 0:05:17 814500 -- (-7422.799) (-7444.677) (-7435.202) [-7430.644] * (-7430.935) (-7438.987) (-7438.788) [-7424.606] -- 0:05:16 815000 -- [-7425.255] (-7434.668) (-7432.469) (-7430.479) * (-7441.682) (-7442.487) (-7443.404) [-7422.264] -- 0:05:15 Average standard deviation of split frequencies: 0.005452 815500 -- (-7435.110) (-7433.647) [-7434.094] (-7433.788) * (-7432.166) (-7434.169) (-7438.121) [-7427.400] -- 0:05:14 816000 -- [-7429.425] (-7428.091) (-7434.011) (-7433.607) * (-7437.038) (-7434.390) (-7435.881) [-7429.216] -- 0:05:14 816500 -- (-7436.165) [-7423.756] (-7434.089) (-7435.696) * (-7426.654) (-7432.823) [-7429.095] (-7430.465) -- 0:05:13 817000 -- (-7439.876) [-7433.240] (-7433.563) (-7429.893) * [-7421.465] (-7432.587) (-7428.610) (-7432.143) -- 0:05:12 817500 -- (-7443.260) [-7428.262] (-7422.250) (-7431.265) * (-7426.825) (-7445.823) (-7437.870) [-7435.953] -- 0:05:11 818000 -- (-7439.761) (-7428.700) (-7430.427) [-7429.221] * (-7434.743) (-7440.636) [-7426.155] (-7426.290) -- 0:05:10 818500 -- (-7433.570) (-7439.496) [-7427.148] (-7436.238) * (-7442.782) (-7434.574) [-7426.602] (-7435.718) -- 0:05:10 819000 -- (-7437.557) [-7436.029] (-7430.071) (-7438.061) * (-7429.385) (-7434.372) (-7442.095) [-7426.300] -- 0:05:08 819500 -- (-7441.244) [-7431.917] (-7431.306) (-7444.542) * (-7436.429) (-7430.678) (-7431.334) [-7425.149] -- 0:05:08 820000 -- (-7439.730) (-7431.884) [-7429.371] (-7438.332) * (-7427.617) (-7444.758) (-7434.344) [-7424.783] -- 0:05:07 Average standard deviation of split frequencies: 0.005601 820500 -- (-7437.003) [-7432.244] (-7439.485) (-7440.866) * (-7437.582) (-7436.981) (-7428.162) [-7425.134] -- 0:05:06 821000 -- [-7431.738] (-7437.005) (-7434.682) (-7438.983) * (-7430.137) (-7430.722) [-7433.075] (-7435.823) -- 0:05:05 821500 -- [-7424.988] (-7431.745) (-7443.793) (-7430.835) * (-7426.803) (-7430.292) [-7431.173] (-7438.153) -- 0:05:04 822000 -- (-7435.307) [-7428.268] (-7437.634) (-7442.189) * (-7433.091) [-7426.006] (-7433.952) (-7437.329) -- 0:05:03 822500 -- (-7435.810) (-7431.497) (-7440.851) [-7437.094] * (-7427.112) [-7425.243] (-7439.479) (-7446.390) -- 0:05:02 823000 -- [-7436.475] (-7436.099) (-7434.154) (-7430.306) * (-7427.082) (-7439.207) (-7438.527) [-7425.396] -- 0:05:02 823500 -- (-7435.308) (-7426.671) (-7427.363) [-7431.817] * [-7433.957] (-7435.009) (-7433.642) (-7430.185) -- 0:05:01 824000 -- (-7426.156) [-7421.855] (-7442.899) (-7437.916) * (-7428.536) [-7426.450] (-7431.856) (-7430.935) -- 0:05:00 824500 -- [-7427.284] (-7428.487) (-7433.955) (-7426.537) * [-7427.290] (-7431.641) (-7436.507) (-7428.085) -- 0:04:59 825000 -- [-7428.653] (-7430.223) (-7442.116) (-7433.878) * [-7423.717] (-7433.991) (-7440.578) (-7429.793) -- 0:04:58 Average standard deviation of split frequencies: 0.005564 825500 -- (-7434.348) [-7426.020] (-7446.837) (-7437.438) * (-7444.337) [-7432.173] (-7441.019) (-7429.591) -- 0:04:57 826000 -- (-7435.499) (-7437.455) (-7451.482) [-7427.503] * (-7438.651) [-7434.935] (-7424.201) (-7438.757) -- 0:04:57 826500 -- (-7435.115) (-7427.922) [-7434.558] (-7434.608) * [-7425.987] (-7433.153) (-7433.901) (-7442.675) -- 0:04:56 827000 -- (-7439.099) [-7434.544] (-7441.960) (-7431.079) * (-7437.131) (-7430.255) [-7430.776] (-7435.922) -- 0:04:55 827500 -- [-7426.237] (-7445.684) (-7433.346) (-7444.503) * (-7442.765) [-7428.724] (-7433.336) (-7432.508) -- 0:04:54 828000 -- (-7437.431) (-7437.003) (-7426.963) [-7425.641] * (-7426.036) [-7426.772] (-7425.484) (-7437.094) -- 0:04:53 828500 -- (-7436.036) [-7436.145] (-7444.499) (-7432.390) * (-7431.525) (-7441.517) (-7433.455) [-7427.530] -- 0:04:52 829000 -- (-7430.650) (-7438.424) (-7432.234) [-7429.945] * (-7440.436) [-7432.360] (-7432.086) (-7440.627) -- 0:04:51 829500 -- (-7449.295) (-7429.160) (-7436.759) [-7437.250] * [-7440.473] (-7438.004) (-7428.357) (-7438.167) -- 0:04:51 830000 -- (-7440.676) (-7433.497) (-7432.641) [-7428.268] * (-7432.502) (-7434.538) [-7428.495] (-7429.909) -- 0:04:50 Average standard deviation of split frequencies: 0.005746 830500 -- (-7432.003) (-7448.539) [-7433.981] (-7425.029) * [-7447.791] (-7435.068) (-7427.529) (-7435.768) -- 0:04:49 831000 -- (-7437.392) (-7434.579) (-7427.660) [-7424.884] * (-7431.805) (-7434.483) [-7428.427] (-7438.831) -- 0:04:48 831500 -- (-7442.492) (-7430.471) [-7431.350] (-7439.678) * (-7435.781) [-7431.575] (-7430.757) (-7436.596) -- 0:04:47 832000 -- [-7442.179] (-7435.586) (-7444.701) (-7432.949) * (-7426.982) (-7441.154) (-7435.756) [-7428.028] -- 0:04:46 832500 -- (-7431.109) [-7428.944] (-7437.184) (-7426.558) * [-7429.713] (-7445.112) (-7438.305) (-7434.721) -- 0:04:45 833000 -- [-7429.520] (-7438.641) (-7444.101) (-7436.450) * (-7433.232) (-7435.026) (-7438.644) [-7423.955] -- 0:04:45 833500 -- [-7430.870] (-7432.017) (-7444.548) (-7438.055) * (-7428.371) [-7436.815] (-7445.775) (-7436.136) -- 0:04:44 834000 -- [-7435.555] (-7443.269) (-7434.841) (-7431.262) * (-7427.753) (-7427.226) (-7436.486) [-7426.762] -- 0:04:43 834500 -- (-7424.790) (-7424.188) (-7429.458) [-7431.746] * (-7430.877) (-7442.197) (-7439.844) [-7425.923] -- 0:04:42 835000 -- [-7432.625] (-7422.036) (-7435.774) (-7439.353) * [-7431.193] (-7441.020) (-7442.693) (-7443.230) -- 0:04:41 Average standard deviation of split frequencies: 0.005921 835500 -- (-7449.752) (-7429.923) [-7424.832] (-7437.898) * (-7427.721) [-7437.799] (-7447.418) (-7435.053) -- 0:04:40 836000 -- (-7436.687) [-7432.012] (-7433.197) (-7436.130) * [-7430.926] (-7431.804) (-7444.786) (-7436.274) -- 0:04:39 836500 -- (-7436.933) (-7431.199) [-7424.473] (-7430.629) * (-7430.985) [-7428.803] (-7435.930) (-7432.057) -- 0:04:39 837000 -- (-7439.963) (-7435.597) (-7422.925) [-7436.471] * [-7426.533] (-7423.585) (-7433.022) (-7432.999) -- 0:04:38 837500 -- (-7445.460) (-7435.906) (-7428.089) [-7427.147] * (-7431.898) [-7424.073] (-7427.290) (-7433.777) -- 0:04:37 838000 -- (-7445.351) (-7435.510) [-7431.664] (-7428.019) * (-7427.105) [-7422.019] (-7438.180) (-7427.771) -- 0:04:36 838500 -- (-7448.032) (-7434.298) [-7425.286] (-7437.336) * (-7440.098) (-7429.899) (-7432.227) [-7428.931] -- 0:04:35 839000 -- (-7434.620) (-7438.154) (-7429.100) [-7433.314] * (-7435.857) (-7430.254) (-7430.995) [-7427.427] -- 0:04:34 839500 -- (-7437.924) (-7436.361) (-7448.114) [-7432.049] * [-7444.224] (-7429.639) (-7438.537) (-7425.653) -- 0:04:33 840000 -- (-7433.313) (-7434.931) (-7433.231) [-7426.720] * (-7436.153) (-7433.800) (-7424.585) [-7423.049] -- 0:04:33 Average standard deviation of split frequencies: 0.005713 840500 -- (-7430.577) (-7429.047) [-7429.829] (-7433.302) * (-7434.054) (-7437.097) [-7421.647] (-7427.953) -- 0:04:32 841000 -- (-7428.639) [-7434.574] (-7428.767) (-7434.985) * [-7425.351] (-7423.764) (-7435.391) (-7424.708) -- 0:04:31 841500 -- (-7426.558) (-7427.888) (-7430.265) [-7423.044] * (-7430.206) (-7427.858) [-7426.506] (-7432.549) -- 0:04:30 842000 -- [-7427.927] (-7430.313) (-7426.249) (-7434.505) * [-7433.526] (-7430.716) (-7435.430) (-7434.711) -- 0:04:29 842500 -- (-7432.874) [-7431.347] (-7433.793) (-7433.996) * (-7432.373) [-7431.956] (-7438.521) (-7422.102) -- 0:04:28 843000 -- (-7438.536) (-7430.958) (-7433.288) [-7435.891] * [-7433.490] (-7434.351) (-7434.397) (-7430.462) -- 0:04:27 843500 -- (-7436.031) (-7436.729) [-7433.356] (-7440.610) * (-7436.173) [-7430.926] (-7426.303) (-7426.514) -- 0:04:27 844000 -- (-7428.130) (-7437.300) [-7428.742] (-7440.451) * (-7439.385) (-7440.475) (-7433.873) [-7439.609] -- 0:04:26 844500 -- (-7430.234) (-7430.933) (-7430.728) [-7434.013] * (-7436.904) (-7437.810) [-7436.575] (-7431.306) -- 0:04:25 845000 -- (-7436.689) [-7428.453] (-7428.045) (-7441.452) * (-7436.254) [-7424.013] (-7422.059) (-7433.032) -- 0:04:24 Average standard deviation of split frequencies: 0.005224 845500 -- (-7451.431) [-7420.232] (-7433.181) (-7432.728) * (-7430.850) [-7426.620] (-7432.791) (-7427.204) -- 0:04:23 846000 -- (-7439.201) (-7429.494) [-7425.762] (-7431.244) * (-7433.200) (-7441.082) (-7436.703) [-7429.280] -- 0:04:22 846500 -- (-7445.197) (-7425.029) (-7430.383) [-7429.544] * (-7430.823) (-7430.024) [-7428.075] (-7431.854) -- 0:04:22 847000 -- (-7445.774) [-7436.602] (-7430.864) (-7430.726) * (-7428.735) [-7431.683] (-7429.970) (-7434.102) -- 0:04:21 847500 -- (-7435.991) (-7436.480) [-7435.522] (-7430.048) * (-7433.558) (-7427.751) (-7439.290) [-7434.352] -- 0:04:20 848000 -- (-7434.494) (-7436.792) [-7428.606] (-7437.022) * (-7434.761) (-7425.157) (-7440.980) [-7434.805] -- 0:04:19 848500 -- (-7459.665) (-7434.749) [-7434.691] (-7430.613) * (-7443.308) (-7432.327) (-7440.630) [-7428.705] -- 0:04:18 849000 -- (-7438.388) [-7424.962] (-7437.331) (-7428.170) * (-7441.440) (-7433.010) (-7439.768) [-7423.996] -- 0:04:17 849500 -- (-7438.311) (-7433.695) [-7434.225] (-7427.209) * (-7434.520) (-7435.203) [-7426.886] (-7434.904) -- 0:04:16 850000 -- (-7447.934) [-7424.983] (-7432.516) (-7427.130) * (-7437.312) [-7431.576] (-7436.675) (-7432.959) -- 0:04:16 Average standard deviation of split frequencies: 0.005161 850500 -- [-7432.996] (-7437.073) (-7428.835) (-7423.598) * (-7429.331) [-7427.207] (-7435.934) (-7430.791) -- 0:04:15 851000 -- (-7430.044) [-7436.485] (-7425.985) (-7431.911) * (-7425.899) [-7426.787] (-7433.755) (-7433.248) -- 0:04:14 851500 -- (-7437.027) (-7450.596) [-7429.784] (-7429.663) * (-7432.314) (-7452.651) (-7433.937) [-7441.329] -- 0:04:13 852000 -- (-7436.690) (-7442.851) (-7434.855) [-7431.229] * [-7432.269] (-7433.709) (-7429.135) (-7439.327) -- 0:04:12 852500 -- (-7435.188) (-7425.333) (-7429.448) [-7438.197] * (-7444.204) (-7445.687) [-7426.030] (-7444.561) -- 0:04:11 853000 -- [-7429.122] (-7433.522) (-7436.136) (-7428.589) * (-7433.440) [-7425.594] (-7446.798) (-7442.181) -- 0:04:10 853500 -- (-7436.075) (-7441.438) (-7432.935) [-7429.042] * (-7433.426) [-7425.226] (-7445.579) (-7437.933) -- 0:04:10 854000 -- (-7437.830) (-7429.599) [-7429.595] (-7430.983) * (-7444.764) (-7434.320) [-7436.301] (-7429.613) -- 0:04:09 854500 -- [-7429.856] (-7430.373) (-7433.457) (-7431.474) * [-7434.742] (-7437.495) (-7450.938) (-7435.986) -- 0:04:08 855000 -- (-7429.299) (-7424.413) [-7427.741] (-7434.841) * [-7435.372] (-7436.290) (-7448.525) (-7435.768) -- 0:04:07 Average standard deviation of split frequencies: 0.004543 855500 -- [-7434.923] (-7433.880) (-7432.201) (-7439.163) * [-7433.024] (-7428.027) (-7444.841) (-7431.982) -- 0:04:06 856000 -- (-7443.095) (-7435.920) (-7444.356) [-7438.902] * (-7432.071) (-7427.666) (-7442.941) [-7430.669] -- 0:04:05 856500 -- (-7424.967) (-7436.892) (-7426.537) [-7438.012] * (-7431.962) (-7443.067) [-7448.289] (-7438.354) -- 0:04:04 857000 -- (-7437.061) (-7424.423) (-7429.436) [-7427.447] * (-7426.827) [-7433.908] (-7438.416) (-7445.951) -- 0:04:04 857500 -- (-7438.041) [-7428.511] (-7431.587) (-7431.961) * [-7432.497] (-7436.305) (-7427.893) (-7434.784) -- 0:04:03 858000 -- (-7446.036) (-7424.057) (-7435.889) [-7434.186] * [-7438.045] (-7445.026) (-7429.894) (-7434.981) -- 0:04:02 858500 -- [-7428.645] (-7435.486) (-7429.283) (-7431.353) * (-7434.477) (-7450.524) (-7433.455) [-7429.093] -- 0:04:01 859000 -- [-7428.814] (-7438.293) (-7423.729) (-7427.923) * (-7431.721) (-7438.556) [-7426.414] (-7431.391) -- 0:04:00 859500 -- [-7432.241] (-7430.229) (-7429.705) (-7427.166) * (-7432.801) (-7435.018) [-7432.385] (-7444.900) -- 0:03:59 860000 -- (-7442.653) (-7437.271) [-7440.465] (-7436.177) * (-7427.721) (-7428.462) [-7440.095] (-7447.613) -- 0:03:58 Average standard deviation of split frequencies: 0.004519 860500 -- [-7432.171] (-7429.647) (-7447.643) (-7435.466) * [-7426.733] (-7435.946) (-7439.185) (-7435.272) -- 0:03:58 861000 -- (-7432.795) [-7424.815] (-7434.659) (-7440.709) * (-7424.143) (-7433.165) [-7436.465] (-7433.183) -- 0:03:57 861500 -- (-7430.933) (-7425.049) (-7426.759) [-7440.285] * (-7431.691) [-7436.829] (-7429.842) (-7424.536) -- 0:03:56 862000 -- (-7442.531) [-7432.714] (-7430.694) (-7445.771) * (-7423.559) (-7453.103) [-7430.255] (-7426.378) -- 0:03:55 862500 -- (-7433.710) (-7439.702) (-7426.161) [-7426.987] * (-7424.810) (-7442.027) (-7439.965) [-7434.731] -- 0:03:54 863000 -- (-7429.870) (-7440.803) [-7431.154] (-7440.050) * (-7432.574) [-7429.499] (-7449.453) (-7443.698) -- 0:03:53 863500 -- (-7439.241) (-7432.091) (-7436.056) [-7435.710] * [-7426.123] (-7424.535) (-7441.115) (-7446.027) -- 0:03:53 864000 -- (-7434.438) [-7432.919] (-7430.135) (-7433.343) * [-7427.638] (-7428.996) (-7442.190) (-7437.167) -- 0:03:52 864500 -- [-7427.132] (-7433.351) (-7424.523) (-7441.399) * [-7425.482] (-7442.190) (-7437.792) (-7446.424) -- 0:03:51 865000 -- (-7434.189) (-7434.152) [-7428.131] (-7435.126) * (-7432.281) [-7436.164] (-7436.562) (-7443.233) -- 0:03:50 Average standard deviation of split frequencies: 0.004797 865500 -- (-7439.031) (-7434.011) (-7434.744) [-7430.863] * (-7443.654) (-7435.050) (-7433.583) [-7430.368] -- 0:03:49 866000 -- (-7434.973) (-7431.820) [-7432.688] (-7438.201) * (-7431.633) (-7431.976) [-7430.295] (-7432.822) -- 0:03:48 866500 -- (-7433.536) (-7428.395) (-7430.317) [-7435.853] * [-7423.350] (-7434.490) (-7435.446) (-7435.245) -- 0:03:47 867000 -- [-7426.055] (-7429.250) (-7431.882) (-7435.691) * (-7441.464) (-7438.785) (-7430.130) [-7431.894] -- 0:03:47 867500 -- (-7427.172) (-7429.945) (-7430.499) [-7439.188] * (-7434.283) (-7429.985) [-7438.427] (-7437.955) -- 0:03:46 868000 -- (-7433.920) (-7430.176) [-7430.535] (-7429.486) * (-7434.158) (-7440.211) (-7426.885) [-7430.822] -- 0:03:45 868500 -- (-7430.641) [-7430.732] (-7434.945) (-7437.710) * (-7431.635) [-7436.825] (-7436.391) (-7443.818) -- 0:03:44 869000 -- [-7435.561] (-7433.514) (-7425.736) (-7438.873) * (-7434.831) (-7447.166) (-7434.473) [-7428.560] -- 0:03:43 869500 -- (-7427.906) [-7428.113] (-7432.511) (-7431.843) * (-7426.070) (-7431.900) (-7446.562) [-7422.270] -- 0:03:42 870000 -- [-7431.893] (-7429.199) (-7435.668) (-7430.083) * (-7430.935) (-7433.749) [-7437.498] (-7431.890) -- 0:03:41 Average standard deviation of split frequencies: 0.004738 870500 -- [-7428.156] (-7429.085) (-7436.427) (-7439.419) * (-7433.548) (-7435.148) (-7435.961) [-7431.869] -- 0:03:41 871000 -- (-7438.101) (-7439.542) [-7433.806] (-7430.508) * (-7433.919) [-7428.693] (-7439.069) (-7429.250) -- 0:03:40 871500 -- (-7436.137) (-7431.704) [-7432.596] (-7434.193) * (-7444.417) (-7430.688) (-7438.684) [-7425.028] -- 0:03:39 872000 -- (-7438.868) [-7427.440] (-7438.078) (-7433.008) * (-7432.469) (-7431.135) (-7444.470) [-7429.537] -- 0:03:38 872500 -- (-7437.866) (-7426.570) [-7431.476] (-7433.516) * (-7435.180) (-7437.707) (-7432.299) [-7431.382] -- 0:03:37 873000 -- (-7430.769) (-7433.089) (-7429.546) [-7436.975] * (-7431.316) (-7431.318) (-7441.577) [-7428.316] -- 0:03:36 873500 -- (-7435.246) [-7429.579] (-7432.315) (-7434.728) * (-7427.690) [-7439.567] (-7451.259) (-7436.507) -- 0:03:35 874000 -- (-7437.911) [-7432.743] (-7430.915) (-7431.048) * (-7434.166) (-7428.584) (-7451.964) [-7437.462] -- 0:03:35 874500 -- (-7444.638) (-7433.942) [-7435.801] (-7446.889) * (-7430.477) [-7436.693] (-7443.769) (-7427.633) -- 0:03:34 875000 -- (-7442.369) (-7434.623) (-7431.774) [-7430.668] * (-7434.751) (-7442.407) [-7433.547] (-7440.132) -- 0:03:33 Average standard deviation of split frequencies: 0.004137 875500 -- (-7435.864) [-7433.175] (-7430.151) (-7438.459) * [-7431.588] (-7431.701) (-7437.421) (-7433.204) -- 0:03:32 876000 -- (-7436.041) (-7429.108) [-7426.146] (-7434.572) * (-7432.138) [-7431.133] (-7432.988) (-7433.119) -- 0:03:31 876500 -- [-7435.347] (-7442.462) (-7431.533) (-7432.316) * [-7425.777] (-7431.780) (-7433.312) (-7423.893) -- 0:03:30 877000 -- [-7426.614] (-7448.735) (-7437.782) (-7440.106) * [-7427.642] (-7436.667) (-7435.747) (-7434.035) -- 0:03:29 877500 -- (-7430.942) (-7439.994) (-7429.272) [-7430.508] * (-7430.401) (-7435.473) (-7432.707) [-7429.669] -- 0:03:29 878000 -- (-7442.518) (-7441.563) [-7429.331] (-7428.160) * (-7432.401) [-7437.530] (-7437.067) (-7433.110) -- 0:03:28 878500 -- [-7427.950] (-7429.634) (-7437.818) (-7426.241) * (-7433.628) (-7440.443) [-7429.217] (-7429.688) -- 0:03:27 879000 -- (-7430.094) (-7430.555) (-7433.398) [-7427.253] * (-7434.063) (-7431.500) (-7446.559) [-7430.493] -- 0:03:26 879500 -- [-7437.535] (-7439.598) (-7440.340) (-7426.090) * (-7430.729) (-7430.965) [-7428.729] (-7439.153) -- 0:03:25 880000 -- (-7432.776) (-7437.967) [-7425.790] (-7431.365) * (-7439.302) (-7433.990) [-7427.216] (-7441.715) -- 0:03:24 Average standard deviation of split frequencies: 0.003814 880500 -- [-7426.915] (-7430.743) (-7426.308) (-7432.426) * (-7434.798) [-7430.026] (-7424.231) (-7430.818) -- 0:03:23 881000 -- (-7429.987) (-7440.132) [-7427.472] (-7419.406) * (-7427.947) (-7448.107) (-7426.039) [-7427.472] -- 0:03:23 881500 -- (-7444.257) (-7432.624) (-7436.131) [-7418.774] * [-7428.012] (-7447.798) (-7429.946) (-7441.919) -- 0:03:22 882000 -- [-7425.560] (-7440.781) (-7439.745) (-7435.049) * (-7431.726) (-7432.413) [-7430.644] (-7429.881) -- 0:03:21 882500 -- (-7429.891) (-7432.464) [-7433.434] (-7428.861) * (-7430.331) (-7436.798) [-7423.176] (-7433.482) -- 0:03:20 883000 -- (-7433.696) [-7427.529] (-7441.018) (-7430.368) * (-7442.366) [-7431.246] (-7432.738) (-7439.647) -- 0:03:19 883500 -- [-7430.205] (-7428.922) (-7432.996) (-7433.927) * [-7428.119] (-7429.589) (-7451.733) (-7437.516) -- 0:03:18 884000 -- (-7435.265) (-7430.795) [-7432.625] (-7430.730) * [-7429.299] (-7432.102) (-7424.862) (-7438.229) -- 0:03:18 884500 -- (-7435.341) (-7433.063) (-7437.582) [-7433.324] * (-7444.624) [-7428.329] (-7431.418) (-7432.941) -- 0:03:17 885000 -- (-7438.911) (-7434.920) [-7435.690] (-7430.161) * (-7438.837) (-7436.074) (-7432.764) [-7433.387] -- 0:03:16 Average standard deviation of split frequencies: 0.004389 885500 -- (-7434.460) [-7434.390] (-7445.217) (-7439.187) * (-7434.683) (-7444.821) [-7428.124] (-7435.578) -- 0:03:15 886000 -- (-7431.177) (-7426.185) (-7428.645) [-7426.680] * (-7431.401) (-7441.097) (-7436.771) [-7430.401] -- 0:03:14 886500 -- (-7434.771) (-7429.516) [-7427.684] (-7421.921) * [-7432.860] (-7437.607) (-7436.158) (-7424.243) -- 0:03:13 887000 -- (-7426.267) (-7440.464) [-7427.244] (-7432.887) * (-7434.972) (-7442.244) (-7435.998) [-7433.638] -- 0:03:13 887500 -- (-7435.375) (-7425.829) (-7432.396) [-7430.611] * [-7430.055] (-7440.899) (-7427.822) (-7437.405) -- 0:03:12 888000 -- (-7436.347) (-7427.724) (-7431.563) [-7434.945] * (-7443.583) [-7431.869] (-7426.873) (-7434.757) -- 0:03:11 888500 -- (-7436.054) [-7424.352] (-7445.398) (-7435.589) * (-7444.512) (-7438.034) [-7426.459] (-7428.974) -- 0:03:10 889000 -- (-7439.925) [-7422.505] (-7438.942) (-7432.638) * (-7435.898) [-7423.960] (-7437.075) (-7428.703) -- 0:03:09 889500 -- (-7441.504) [-7424.335] (-7437.924) (-7428.373) * (-7429.816) (-7434.469) [-7432.578] (-7431.603) -- 0:03:08 890000 -- (-7427.238) [-7427.601] (-7441.606) (-7431.772) * [-7426.886] (-7438.091) (-7435.854) (-7435.072) -- 0:03:07 Average standard deviation of split frequencies: 0.004400 890500 -- [-7435.092] (-7434.210) (-7438.371) (-7430.615) * (-7435.698) (-7435.995) (-7428.532) [-7432.833] -- 0:03:07 891000 -- [-7420.564] (-7433.422) (-7433.272) (-7432.509) * (-7435.020) (-7430.238) (-7444.658) [-7435.120] -- 0:03:06 891500 -- (-7435.767) (-7435.937) (-7430.994) [-7424.945] * (-7429.010) (-7425.378) (-7437.378) [-7431.896] -- 0:03:05 892000 -- (-7429.867) (-7435.111) (-7440.366) [-7435.459] * (-7435.556) (-7437.390) (-7441.899) [-7428.004] -- 0:03:04 892500 -- (-7434.392) (-7438.770) [-7430.950] (-7432.705) * [-7424.420] (-7433.666) (-7432.384) (-7435.573) -- 0:03:03 893000 -- (-7432.485) (-7442.764) [-7424.617] (-7436.867) * (-7429.013) (-7435.374) (-7431.640) [-7422.247] -- 0:03:02 893500 -- (-7430.256) (-7441.654) (-7423.343) [-7433.498] * (-7440.282) (-7429.965) [-7429.921] (-7439.648) -- 0:03:01 894000 -- [-7422.790] (-7428.104) (-7437.323) (-7457.155) * [-7432.332] (-7425.885) (-7431.831) (-7433.966) -- 0:03:01 894500 -- (-7431.340) (-7433.636) [-7428.433] (-7441.923) * (-7439.513) [-7424.969] (-7435.099) (-7436.079) -- 0:03:00 895000 -- (-7446.885) [-7428.975] (-7434.803) (-7430.363) * (-7444.146) (-7435.452) [-7430.914] (-7431.420) -- 0:02:59 Average standard deviation of split frequencies: 0.004439 895500 -- (-7431.577) (-7441.215) (-7436.306) [-7432.886] * (-7441.115) [-7427.865] (-7425.298) (-7433.833) -- 0:02:58 896000 -- (-7439.816) [-7428.597] (-7429.810) (-7437.430) * (-7430.731) (-7429.542) (-7440.130) [-7427.186] -- 0:02:57 896500 -- (-7431.940) [-7427.767] (-7436.113) (-7432.162) * (-7423.781) (-7446.524) (-7436.285) [-7425.593] -- 0:02:56 897000 -- (-7441.809) (-7432.867) [-7432.510] (-7429.802) * [-7428.553] (-7445.636) (-7432.107) (-7426.377) -- 0:02:55 897500 -- (-7437.316) (-7440.162) (-7436.100) [-7427.512] * (-7437.236) (-7432.650) (-7443.958) [-7425.809] -- 0:02:55 898000 -- (-7432.911) (-7444.707) [-7427.430] (-7429.379) * (-7432.689) (-7432.481) [-7433.713] (-7442.020) -- 0:02:54 898500 -- (-7427.488) (-7436.612) (-7432.597) [-7422.301] * (-7428.953) [-7421.391] (-7429.079) (-7427.992) -- 0:02:53 899000 -- (-7429.809) (-7441.258) [-7431.038] (-7426.539) * (-7432.871) (-7433.444) (-7434.835) [-7434.316] -- 0:02:52 899500 -- [-7422.811] (-7435.518) (-7436.496) (-7438.096) * [-7425.176] (-7429.031) (-7434.314) (-7425.529) -- 0:02:51 900000 -- (-7427.359) [-7430.980] (-7439.619) (-7437.652) * (-7430.482) [-7427.088] (-7426.965) (-7432.923) -- 0:02:50 Average standard deviation of split frequencies: 0.004449 900500 -- (-7431.096) (-7430.727) [-7441.634] (-7449.744) * (-7437.238) (-7430.109) (-7437.056) [-7428.944] -- 0:02:49 901000 -- (-7427.808) [-7429.796] (-7450.607) (-7436.579) * (-7437.846) (-7434.103) [-7437.363] (-7433.240) -- 0:02:49 901500 -- (-7429.459) (-7437.215) (-7443.276) [-7431.659] * (-7438.110) (-7438.742) [-7426.557] (-7432.470) -- 0:02:48 902000 -- (-7433.418) [-7427.702] (-7435.980) (-7447.807) * (-7433.503) (-7450.407) [-7429.113] (-7423.933) -- 0:02:47 902500 -- (-7434.003) (-7430.712) [-7435.137] (-7439.007) * (-7436.541) (-7442.861) [-7436.393] (-7438.560) -- 0:02:46 903000 -- (-7434.917) (-7430.301) [-7432.606] (-7435.133) * (-7429.195) (-7437.128) [-7438.468] (-7436.906) -- 0:02:45 903500 -- (-7443.183) (-7437.318) (-7434.586) [-7421.856] * (-7428.415) (-7425.071) (-7442.851) [-7429.059] -- 0:02:44 904000 -- [-7428.590] (-7441.622) (-7426.864) (-7434.802) * (-7431.641) [-7429.979] (-7439.507) (-7431.020) -- 0:02:43 904500 -- (-7446.770) (-7437.972) [-7427.423] (-7439.543) * (-7441.850) (-7437.458) (-7434.836) [-7431.576] -- 0:02:43 905000 -- (-7433.119) (-7426.709) [-7428.129] (-7441.997) * (-7431.818) (-7429.838) [-7428.639] (-7441.246) -- 0:02:42 Average standard deviation of split frequencies: 0.004878 905500 -- [-7429.008] (-7437.955) (-7429.251) (-7443.153) * (-7430.986) (-7435.845) (-7426.411) [-7434.040] -- 0:02:41 906000 -- (-7440.709) (-7442.779) (-7426.479) [-7442.675] * (-7433.067) [-7435.625] (-7427.850) (-7429.887) -- 0:02:40 906500 -- (-7438.834) (-7438.543) (-7432.827) [-7424.017] * (-7450.277) (-7444.112) [-7426.763] (-7436.737) -- 0:02:39 907000 -- [-7433.201] (-7439.096) (-7442.736) (-7435.283) * (-7432.179) (-7429.717) [-7422.891] (-7435.602) -- 0:02:38 907500 -- (-7430.900) (-7437.529) [-7430.700] (-7433.397) * (-7429.311) [-7433.277] (-7436.226) (-7447.001) -- 0:02:37 908000 -- (-7430.821) [-7428.229] (-7427.757) (-7434.783) * (-7434.021) (-7419.278) [-7428.583] (-7440.385) -- 0:02:37 908500 -- (-7433.834) (-7434.615) [-7430.423] (-7428.624) * (-7443.720) (-7434.187) [-7432.970] (-7430.146) -- 0:02:36 909000 -- (-7431.848) (-7446.307) (-7429.529) [-7432.709] * [-7440.737] (-7432.638) (-7437.185) (-7432.931) -- 0:02:35 909500 -- (-7431.249) [-7434.460] (-7430.302) (-7436.858) * (-7440.172) (-7442.579) [-7432.556] (-7432.394) -- 0:02:34 910000 -- (-7431.859) (-7433.354) (-7429.970) [-7429.719] * (-7432.228) (-7439.846) (-7434.674) [-7430.617] -- 0:02:33 Average standard deviation of split frequencies: 0.004821 910500 -- (-7434.290) (-7429.214) (-7432.150) [-7424.404] * (-7432.959) (-7437.272) (-7430.719) [-7424.097] -- 0:02:32 911000 -- (-7431.377) (-7436.499) [-7425.386] (-7438.082) * (-7433.372) [-7424.088] (-7437.821) (-7426.044) -- 0:02:32 911500 -- [-7433.200] (-7429.823) (-7434.181) (-7429.248) * (-7431.903) [-7428.834] (-7432.679) (-7432.276) -- 0:02:31 912000 -- (-7428.626) (-7438.046) (-7430.940) [-7433.986] * (-7428.360) (-7437.398) [-7438.685] (-7428.401) -- 0:02:30 912500 -- (-7431.409) (-7444.277) [-7429.559] (-7434.822) * (-7427.878) [-7427.087] (-7431.450) (-7445.143) -- 0:02:29 913000 -- (-7442.877) (-7439.138) [-7430.553] (-7439.870) * (-7436.723) (-7431.618) [-7426.376] (-7430.075) -- 0:02:28 913500 -- (-7438.639) (-7435.054) [-7424.219] (-7437.353) * (-7431.030) (-7441.475) (-7427.222) [-7430.285] -- 0:02:27 914000 -- (-7433.961) (-7444.703) (-7441.302) [-7429.859] * [-7431.487] (-7427.000) (-7434.163) (-7425.866) -- 0:02:26 914500 -- [-7435.911] (-7437.203) (-7435.444) (-7429.544) * (-7434.955) [-7427.859] (-7434.663) (-7435.989) -- 0:02:26 915000 -- (-7438.570) (-7431.060) [-7428.366] (-7431.560) * (-7443.461) [-7437.896] (-7426.376) (-7424.364) -- 0:02:25 Average standard deviation of split frequencies: 0.004439 915500 -- (-7440.642) [-7431.580] (-7425.568) (-7434.171) * (-7434.536) (-7428.228) [-7421.961] (-7430.729) -- 0:02:24 916000 -- [-7435.161] (-7431.725) (-7434.699) (-7434.940) * (-7443.818) (-7439.414) [-7423.457] (-7429.148) -- 0:02:23 916500 -- [-7432.515] (-7427.247) (-7430.164) (-7432.092) * (-7439.865) (-7438.643) (-7432.844) [-7431.258] -- 0:02:22 917000 -- [-7431.630] (-7431.282) (-7438.533) (-7441.763) * (-7434.833) (-7437.122) (-7426.635) [-7425.053] -- 0:02:21 917500 -- [-7432.971] (-7426.166) (-7430.809) (-7433.765) * (-7437.751) (-7437.021) (-7433.212) [-7427.407] -- 0:02:20 918000 -- (-7434.324) [-7428.593] (-7431.190) (-7440.235) * (-7440.767) (-7426.182) (-7436.348) [-7428.466] -- 0:02:20 918500 -- (-7430.969) (-7443.199) [-7432.751] (-7436.766) * (-7442.390) [-7427.239] (-7436.077) (-7430.949) -- 0:02:19 919000 -- [-7434.006] (-7436.913) (-7429.426) (-7433.546) * (-7428.873) [-7434.596] (-7440.299) (-7435.161) -- 0:02:18 919500 -- (-7440.746) [-7429.579] (-7431.525) (-7437.530) * (-7433.190) (-7434.506) (-7432.382) [-7426.880] -- 0:02:17 920000 -- (-7437.821) (-7432.386) (-7437.301) [-7437.140] * (-7430.906) (-7437.324) [-7427.715] (-7430.941) -- 0:02:16 Average standard deviation of split frequencies: 0.004608 920500 -- (-7436.864) [-7428.909] (-7433.022) (-7437.231) * [-7427.240] (-7429.773) (-7425.602) (-7432.540) -- 0:02:15 921000 -- (-7437.601) (-7428.456) (-7438.936) [-7441.267] * (-7434.549) (-7440.713) (-7433.287) [-7426.183] -- 0:02:14 921500 -- (-7429.010) [-7429.233] (-7430.457) (-7444.680) * [-7431.824] (-7434.694) (-7436.815) (-7438.731) -- 0:02:14 922000 -- (-7429.213) [-7433.323] (-7429.938) (-7435.678) * [-7431.123] (-7437.225) (-7433.119) (-7441.214) -- 0:02:13 922500 -- (-7436.759) (-7442.383) [-7424.607] (-7445.059) * (-7433.812) (-7445.374) [-7428.104] (-7439.311) -- 0:02:12 923000 -- (-7435.293) (-7434.181) [-7426.048] (-7452.430) * [-7429.735] (-7437.781) (-7441.407) (-7437.464) -- 0:02:11 923500 -- [-7438.385] (-7441.456) (-7434.500) (-7450.699) * (-7426.250) (-7432.339) [-7432.940] (-7422.912) -- 0:02:10 924000 -- (-7424.570) (-7450.107) [-7436.200] (-7427.445) * (-7431.469) [-7426.858] (-7435.608) (-7440.142) -- 0:02:09 924500 -- (-7433.301) [-7436.895] (-7439.075) (-7433.368) * (-7429.860) [-7425.224] (-7427.861) (-7430.639) -- 0:02:08 925000 -- [-7430.472] (-7430.373) (-7433.222) (-7429.467) * (-7431.691) (-7436.073) (-7436.455) [-7431.284] -- 0:02:08 Average standard deviation of split frequencies: 0.004009 925500 -- (-7430.139) (-7433.466) [-7433.191] (-7429.091) * (-7437.327) (-7427.224) (-7432.639) [-7435.145] -- 0:02:07 926000 -- (-7429.288) (-7429.057) [-7427.891] (-7428.823) * (-7434.136) (-7442.099) [-7434.665] (-7441.022) -- 0:02:06 926500 -- [-7425.873] (-7428.844) (-7435.356) (-7431.671) * [-7426.912] (-7431.258) (-7430.273) (-7438.083) -- 0:02:05 927000 -- (-7442.956) (-7430.165) [-7432.771] (-7434.454) * (-7440.461) (-7433.657) [-7429.617] (-7434.845) -- 0:02:04 927500 -- (-7439.247) (-7428.933) [-7424.150] (-7435.353) * (-7432.122) (-7439.799) [-7431.634] (-7435.407) -- 0:02:03 928000 -- (-7433.224) (-7430.682) (-7442.351) [-7425.586] * [-7428.095] (-7437.684) (-7434.733) (-7437.507) -- 0:02:03 928500 -- [-7426.719] (-7432.633) (-7425.924) (-7427.685) * (-7429.226) [-7433.822] (-7435.428) (-7427.220) -- 0:02:02 929000 -- (-7435.989) (-7435.669) [-7428.813] (-7426.247) * (-7432.568) (-7439.408) [-7436.593] (-7427.695) -- 0:02:01 929500 -- (-7438.427) [-7426.216] (-7437.812) (-7437.476) * (-7436.515) (-7443.116) (-7436.043) [-7422.952] -- 0:02:00 930000 -- [-7428.268] (-7429.929) (-7433.420) (-7439.538) * (-7444.520) (-7443.479) [-7443.220] (-7434.500) -- 0:01:59 Average standard deviation of split frequencies: 0.003641 930500 -- (-7430.566) (-7436.034) [-7425.635] (-7443.474) * (-7446.735) (-7458.672) [-7441.474] (-7430.978) -- 0:01:58 931000 -- (-7439.427) [-7427.576] (-7438.950) (-7431.908) * (-7434.629) (-7458.896) [-7430.437] (-7432.678) -- 0:01:57 931500 -- [-7427.487] (-7432.074) (-7429.567) (-7433.185) * (-7435.915) (-7437.776) (-7433.852) [-7433.716] -- 0:01:57 932000 -- (-7426.816) (-7435.818) (-7428.731) [-7430.020] * (-7435.576) (-7437.080) [-7434.903] (-7432.041) -- 0:01:56 932500 -- [-7422.450] (-7427.575) (-7435.976) (-7435.623) * [-7435.501] (-7433.674) (-7444.080) (-7434.140) -- 0:01:55 933000 -- (-7432.337) [-7424.064] (-7446.101) (-7434.874) * (-7447.767) [-7424.069] (-7436.407) (-7425.028) -- 0:01:54 933500 -- [-7426.811] (-7429.500) (-7438.305) (-7437.603) * (-7436.934) [-7425.992] (-7437.292) (-7430.913) -- 0:01:53 934000 -- [-7432.907] (-7440.045) (-7432.152) (-7434.366) * (-7449.838) [-7435.261] (-7435.429) (-7427.218) -- 0:01:52 934500 -- (-7443.484) [-7426.890] (-7429.860) (-7439.736) * (-7442.280) [-7433.067] (-7438.944) (-7435.265) -- 0:01:52 935000 -- (-7442.413) [-7425.829] (-7440.536) (-7438.730) * [-7435.601] (-7426.161) (-7440.156) (-7434.169) -- 0:01:51 Average standard deviation of split frequencies: 0.003714 935500 -- (-7432.540) [-7435.455] (-7441.218) (-7439.716) * (-7439.982) (-7426.209) (-7434.203) [-7423.421] -- 0:01:50 936000 -- (-7438.850) [-7430.414] (-7439.371) (-7438.894) * (-7434.187) (-7444.118) [-7431.883] (-7432.511) -- 0:01:49 936500 -- (-7433.206) (-7441.735) (-7448.760) [-7439.549] * (-7428.980) (-7437.193) [-7429.643] (-7431.771) -- 0:01:48 937000 -- (-7431.770) [-7426.293] (-7439.351) (-7435.271) * (-7430.643) (-7444.699) [-7435.006] (-7452.678) -- 0:01:47 937500 -- [-7424.724] (-7426.996) (-7439.908) (-7429.582) * [-7433.870] (-7442.345) (-7426.170) (-7435.219) -- 0:01:46 938000 -- (-7431.008) (-7438.945) [-7435.343] (-7443.090) * [-7440.931] (-7438.840) (-7425.145) (-7437.331) -- 0:01:46 938500 -- (-7435.526) [-7435.167] (-7434.049) (-7444.897) * (-7438.581) (-7442.112) [-7428.745] (-7423.127) -- 0:01:45 939000 -- (-7435.409) (-7422.910) [-7425.413] (-7444.976) * (-7436.433) [-7433.309] (-7436.583) (-7429.656) -- 0:01:44 939500 -- (-7434.509) (-7435.076) [-7431.234] (-7444.268) * (-7431.530) [-7427.367] (-7438.365) (-7433.079) -- 0:01:43 940000 -- [-7428.455] (-7432.718) (-7428.031) (-7430.044) * (-7437.960) [-7429.993] (-7436.568) (-7425.295) -- 0:01:42 Average standard deviation of split frequencies: 0.003821 940500 -- (-7436.459) (-7433.637) [-7427.444] (-7437.946) * [-7437.075] (-7429.533) (-7436.580) (-7427.901) -- 0:01:41 941000 -- (-7453.431) [-7421.377] (-7435.854) (-7437.242) * (-7439.904) (-7428.501) (-7439.270) [-7428.217] -- 0:01:40 941500 -- (-7440.839) (-7424.642) [-7428.325] (-7426.898) * (-7434.753) (-7439.237) [-7430.842] (-7440.827) -- 0:01:40 942000 -- (-7445.628) [-7431.376] (-7425.604) (-7432.534) * [-7440.802] (-7456.968) (-7426.099) (-7427.536) -- 0:01:39 942500 -- (-7436.026) [-7429.405] (-7440.514) (-7430.978) * (-7427.557) (-7434.961) (-7435.759) [-7430.522] -- 0:01:38 943000 -- (-7445.819) (-7427.776) [-7425.515] (-7425.214) * (-7425.405) (-7428.193) (-7434.507) [-7434.359] -- 0:01:37 943500 -- [-7442.345] (-7435.492) (-7423.015) (-7434.257) * (-7446.967) [-7427.381] (-7438.579) (-7428.896) -- 0:01:36 944000 -- (-7426.650) (-7442.405) (-7423.416) [-7427.422] * (-7430.244) [-7437.727] (-7444.509) (-7428.037) -- 0:01:35 944500 -- (-7437.734) [-7434.876] (-7420.489) (-7440.376) * (-7424.725) (-7435.028) (-7447.398) [-7428.495] -- 0:01:34 945000 -- [-7427.894] (-7428.141) (-7440.165) (-7433.169) * (-7424.412) [-7428.009] (-7443.637) (-7434.421) -- 0:01:34 Average standard deviation of split frequencies: 0.003893 945500 -- (-7418.079) [-7429.196] (-7434.872) (-7430.621) * (-7425.559) (-7427.914) (-7433.306) [-7427.732] -- 0:01:33 946000 -- (-7436.604) (-7437.210) [-7422.204] (-7429.452) * (-7443.133) (-7430.168) (-7432.254) [-7426.303] -- 0:01:32 946500 -- (-7432.050) (-7431.898) [-7426.784] (-7433.428) * (-7443.087) (-7435.319) (-7437.293) [-7421.377] -- 0:01:31 947000 -- (-7437.068) (-7427.513) [-7428.586] (-7443.262) * (-7437.635) (-7432.138) [-7427.810] (-7437.634) -- 0:01:30 947500 -- (-7429.082) (-7426.304) (-7424.433) [-7429.559] * (-7429.650) (-7436.617) [-7430.255] (-7432.592) -- 0:01:29 948000 -- (-7435.981) (-7431.746) (-7422.980) [-7425.341] * (-7433.503) [-7433.306] (-7431.928) (-7428.848) -- 0:01:28 948500 -- [-7425.056] (-7424.969) (-7423.067) (-7432.616) * (-7443.139) [-7429.709] (-7425.487) (-7428.818) -- 0:01:28 949000 -- (-7428.613) [-7430.514] (-7437.910) (-7431.273) * (-7434.375) (-7433.357) (-7429.937) [-7426.218] -- 0:01:27 949500 -- [-7432.815] (-7429.666) (-7433.371) (-7434.201) * (-7430.362) (-7436.959) (-7435.728) [-7423.920] -- 0:01:26 950000 -- [-7430.567] (-7434.508) (-7428.336) (-7433.014) * (-7438.148) (-7432.031) [-7430.889] (-7436.365) -- 0:01:25 Average standard deviation of split frequencies: 0.003905 950500 -- (-7434.310) (-7438.746) [-7427.692] (-7426.795) * [-7431.650] (-7437.271) (-7426.899) (-7430.944) -- 0:01:24 951000 -- (-7440.697) (-7438.783) (-7432.081) [-7428.718] * [-7431.011] (-7427.944) (-7432.947) (-7440.021) -- 0:01:23 951500 -- (-7435.350) (-7434.986) (-7429.169) [-7431.180] * (-7437.498) (-7448.327) (-7440.092) [-7431.323] -- 0:01:22 952000 -- (-7437.068) (-7433.356) (-7442.092) [-7430.936] * (-7440.370) [-7441.102] (-7441.415) (-7433.309) -- 0:01:22 952500 -- [-7427.344] (-7457.443) (-7432.813) (-7430.305) * (-7432.741) (-7436.701) [-7421.778] (-7434.343) -- 0:01:21 953000 -- (-7435.839) (-7434.333) (-7425.948) [-7425.798] * (-7435.691) (-7435.613) [-7426.391] (-7450.574) -- 0:01:20 953500 -- (-7432.377) (-7434.036) (-7432.937) [-7426.566] * (-7428.243) [-7433.299] (-7425.945) (-7441.232) -- 0:01:19 954000 -- [-7421.595] (-7430.063) (-7430.839) (-7427.472) * (-7436.073) (-7435.293) [-7430.317] (-7433.656) -- 0:01:18 954500 -- (-7432.640) [-7432.805] (-7430.585) (-7434.599) * (-7444.430) (-7437.648) (-7430.675) [-7445.911] -- 0:01:17 955000 -- (-7424.365) (-7428.819) [-7428.910] (-7428.711) * (-7433.550) (-7435.665) (-7430.021) [-7436.047] -- 0:01:16 Average standard deviation of split frequencies: 0.003852 955500 -- [-7428.801] (-7432.563) (-7430.425) (-7431.412) * (-7428.450) [-7432.872] (-7430.751) (-7437.790) -- 0:01:16 956000 -- (-7440.117) (-7433.369) [-7427.211] (-7431.024) * (-7433.718) (-7434.864) [-7425.550] (-7429.971) -- 0:01:15 956500 -- (-7441.940) [-7425.911] (-7429.977) (-7432.034) * (-7428.608) [-7427.008] (-7422.328) (-7428.963) -- 0:01:14 957000 -- (-7437.709) (-7427.560) [-7426.860] (-7444.311) * (-7427.115) (-7437.202) (-7431.064) [-7424.499] -- 0:01:13 957500 -- (-7432.535) [-7423.873] (-7432.201) (-7438.705) * (-7438.154) (-7447.177) (-7430.901) [-7427.171] -- 0:01:12 958000 -- (-7433.582) [-7434.685] (-7427.250) (-7436.183) * (-7431.832) (-7432.003) [-7430.067] (-7434.127) -- 0:01:11 958500 -- (-7437.974) (-7429.967) (-7433.788) [-7442.340] * (-7427.527) (-7434.599) (-7435.529) [-7420.892] -- 0:01:10 959000 -- (-7432.071) (-7431.326) [-7434.319] (-7452.635) * (-7431.974) [-7429.968] (-7445.801) (-7429.307) -- 0:01:10 959500 -- (-7430.555) [-7429.747] (-7434.224) (-7438.014) * (-7436.951) [-7421.759] (-7451.729) (-7443.341) -- 0:01:09 960000 -- [-7428.979] (-7429.617) (-7439.920) (-7429.804) * (-7442.451) (-7431.637) [-7431.798] (-7424.411) -- 0:01:08 Average standard deviation of split frequencies: 0.003588 960500 -- (-7430.794) [-7431.948] (-7444.244) (-7437.183) * [-7433.903] (-7443.345) (-7432.787) (-7438.259) -- 0:01:07 961000 -- [-7429.085] (-7435.754) (-7437.537) (-7430.236) * [-7426.546] (-7432.970) (-7430.834) (-7438.588) -- 0:01:06 961500 -- (-7423.722) (-7429.645) [-7427.330] (-7428.294) * (-7436.455) [-7426.421] (-7430.545) (-7433.130) -- 0:01:05 962000 -- (-7427.932) (-7441.356) [-7436.162] (-7436.553) * [-7426.121] (-7432.407) (-7429.566) (-7445.663) -- 0:01:04 962500 -- (-7430.855) [-7435.912] (-7429.281) (-7435.470) * (-7428.586) [-7427.683] (-7437.614) (-7441.422) -- 0:01:04 963000 -- (-7443.610) [-7430.919] (-7426.185) (-7442.118) * (-7444.382) (-7433.431) (-7440.206) [-7427.117] -- 0:01:03 963500 -- (-7432.212) (-7432.059) [-7420.317] (-7431.771) * (-7439.863) (-7426.833) [-7425.917] (-7434.299) -- 0:01:02 964000 -- (-7434.247) (-7434.946) [-7427.646] (-7438.455) * (-7438.617) [-7435.248] (-7440.406) (-7430.279) -- 0:01:01 964500 -- [-7432.118] (-7438.872) (-7426.364) (-7430.908) * (-7436.300) [-7439.681] (-7441.507) (-7427.307) -- 0:01:00 965000 -- (-7437.485) (-7436.837) (-7431.446) [-7429.979] * (-7436.588) [-7438.398] (-7426.141) (-7437.693) -- 0:00:59 Average standard deviation of split frequencies: 0.003660 965500 -- (-7427.771) (-7433.719) (-7448.604) [-7426.232] * [-7429.330] (-7438.644) (-7427.011) (-7435.593) -- 0:00:58 966000 -- (-7441.128) (-7448.223) (-7435.469) [-7429.213] * [-7428.493] (-7432.635) (-7430.280) (-7435.063) -- 0:00:58 966500 -- (-7433.940) [-7425.987] (-7443.047) (-7432.271) * (-7426.953) [-7422.439] (-7427.798) (-7446.157) -- 0:00:57 967000 -- (-7431.257) (-7427.465) [-7428.999] (-7441.196) * (-7431.029) (-7431.781) (-7438.254) [-7432.930] -- 0:00:56 967500 -- (-7433.465) (-7429.345) [-7431.862] (-7430.985) * [-7431.918] (-7428.920) (-7432.371) (-7444.981) -- 0:00:55 968000 -- (-7440.466) (-7454.499) (-7429.225) [-7433.246] * (-7440.786) [-7424.219] (-7439.343) (-7437.651) -- 0:00:54 968500 -- (-7439.312) (-7444.177) [-7428.918] (-7430.966) * [-7424.499] (-7426.059) (-7432.445) (-7432.724) -- 0:00:53 969000 -- (-7433.545) (-7444.052) (-7445.620) [-7430.345] * (-7436.328) (-7433.351) [-7431.522] (-7432.043) -- 0:00:53 969500 -- [-7426.657] (-7437.546) (-7442.212) (-7432.067) * [-7434.146] (-7428.772) (-7431.840) (-7437.802) -- 0:00:52 970000 -- (-7442.055) (-7441.226) [-7441.704] (-7434.368) * (-7436.315) (-7434.694) [-7427.995] (-7431.828) -- 0:00:51 Average standard deviation of split frequencies: 0.003703 970500 -- [-7431.214] (-7444.533) (-7440.881) (-7426.707) * (-7447.594) [-7429.846] (-7430.855) (-7435.991) -- 0:00:50 971000 -- (-7426.909) (-7448.760) (-7430.093) [-7424.098] * [-7427.492] (-7442.075) (-7429.724) (-7446.262) -- 0:00:49 971500 -- (-7429.548) [-7431.075] (-7446.689) (-7428.305) * [-7429.153] (-7436.657) (-7436.250) (-7440.925) -- 0:00:48 972000 -- (-7426.130) (-7427.636) (-7437.835) [-7429.347] * (-7443.558) [-7432.626] (-7440.153) (-7442.720) -- 0:00:47 972500 -- (-7428.798) [-7432.785] (-7441.170) (-7436.998) * [-7437.095] (-7428.768) (-7441.117) (-7444.861) -- 0:00:47 973000 -- (-7443.823) (-7426.818) (-7435.284) [-7427.691] * (-7431.661) (-7432.353) (-7436.037) [-7442.321] -- 0:00:46 973500 -- (-7439.190) [-7427.692] (-7428.016) (-7445.788) * [-7439.802] (-7440.163) (-7444.356) (-7429.315) -- 0:00:45 974000 -- (-7437.494) (-7430.233) (-7434.288) [-7423.585] * (-7435.208) (-7440.638) [-7439.239] (-7435.896) -- 0:00:44 974500 -- (-7433.309) (-7429.748) (-7435.054) [-7428.832] * (-7448.458) (-7436.078) (-7434.835) [-7425.616] -- 0:00:43 975000 -- (-7430.987) (-7435.649) (-7429.440) [-7429.795] * (-7444.815) [-7430.735] (-7432.273) (-7428.082) -- 0:00:42 Average standard deviation of split frequencies: 0.003713 975500 -- [-7434.265] (-7447.267) (-7427.896) (-7425.244) * (-7446.801) (-7430.647) [-7430.503] (-7431.954) -- 0:00:41 976000 -- (-7443.627) (-7433.941) (-7437.167) [-7428.049] * (-7436.910) [-7426.697] (-7431.886) (-7432.855) -- 0:00:41 976500 -- (-7432.974) (-7440.754) [-7434.545] (-7433.890) * (-7435.918) (-7427.824) (-7434.447) [-7432.601] -- 0:00:40 977000 -- (-7429.549) (-7441.880) (-7437.405) [-7427.871] * (-7445.578) [-7426.669] (-7438.162) (-7437.643) -- 0:00:39 977500 -- [-7424.471] (-7432.989) (-7435.914) (-7428.989) * [-7440.951] (-7437.282) (-7434.178) (-7446.708) -- 0:00:38 978000 -- [-7422.148] (-7438.775) (-7427.300) (-7441.952) * (-7429.179) (-7444.216) [-7432.351] (-7434.378) -- 0:00:37 978500 -- [-7426.129] (-7421.916) (-7424.746) (-7429.155) * [-7435.169] (-7443.279) (-7436.316) (-7438.455) -- 0:00:36 979000 -- (-7436.331) (-7429.334) [-7427.427] (-7435.266) * [-7426.327] (-7439.225) (-7434.529) (-7447.292) -- 0:00:35 979500 -- [-7443.127] (-7429.993) (-7428.635) (-7437.525) * (-7428.980) [-7426.226] (-7442.079) (-7440.205) -- 0:00:35 980000 -- (-7442.674) [-7424.270] (-7428.242) (-7439.671) * (-7429.141) [-7437.345] (-7438.035) (-7434.252) -- 0:00:34 Average standard deviation of split frequencies: 0.003245 980500 -- (-7436.344) [-7429.607] (-7430.338) (-7448.485) * (-7433.010) [-7429.562] (-7437.462) (-7430.589) -- 0:00:33 981000 -- [-7425.398] (-7423.950) (-7439.957) (-7431.503) * (-7435.641) (-7426.314) [-7430.477] (-7431.095) -- 0:00:32 981500 -- [-7430.914] (-7439.614) (-7440.560) (-7431.871) * [-7429.247] (-7433.389) (-7429.896) (-7436.227) -- 0:00:31 982000 -- (-7434.596) [-7442.804] (-7432.473) (-7431.121) * (-7429.292) (-7429.557) [-7429.312] (-7427.064) -- 0:00:30 982500 -- (-7442.348) [-7425.901] (-7430.894) (-7425.515) * (-7434.221) (-7426.802) (-7432.369) [-7428.669] -- 0:00:29 983000 -- (-7447.478) [-7427.087] (-7430.368) (-7436.739) * [-7435.134] (-7436.920) (-7428.315) (-7431.065) -- 0:00:29 983500 -- (-7432.436) [-7430.527] (-7431.694) (-7429.631) * [-7427.791] (-7427.964) (-7426.447) (-7435.017) -- 0:00:28 984000 -- (-7428.055) (-7434.094) (-7431.891) [-7432.197] * (-7430.325) [-7430.520] (-7438.598) (-7434.313) -- 0:00:27 984500 -- [-7428.338] (-7431.907) (-7428.404) (-7426.806) * [-7429.243] (-7445.485) (-7435.452) (-7425.958) -- 0:00:26 985000 -- (-7438.352) [-7422.218] (-7431.317) (-7439.555) * (-7427.168) [-7431.434] (-7435.704) (-7433.995) -- 0:00:25 Average standard deviation of split frequencies: 0.003526 985500 -- (-7435.650) (-7425.814) (-7435.788) [-7430.238] * (-7425.737) (-7427.806) [-7432.707] (-7441.109) -- 0:00:24 986000 -- (-7427.594) (-7433.444) [-7439.146] (-7442.852) * (-7430.327) [-7432.313] (-7439.140) (-7436.514) -- 0:00:23 986500 -- (-7447.890) (-7447.951) (-7434.191) [-7435.095] * (-7436.219) [-7425.644] (-7432.217) (-7436.780) -- 0:00:23 987000 -- [-7425.286] (-7439.950) (-7431.856) (-7426.704) * (-7432.460) (-7438.047) [-7428.871] (-7440.379) -- 0:00:22 987500 -- (-7427.825) [-7432.688] (-7434.663) (-7433.931) * (-7448.661) [-7424.967] (-7421.317) (-7438.725) -- 0:00:21 988000 -- (-7434.053) (-7434.731) (-7429.168) [-7426.224] * (-7433.417) [-7427.594] (-7431.556) (-7433.942) -- 0:00:20 988500 -- (-7434.388) (-7433.238) [-7426.491] (-7428.570) * [-7441.961] (-7447.360) (-7431.192) (-7431.683) -- 0:00:19 989000 -- (-7450.985) (-7437.021) [-7428.057] (-7435.303) * (-7439.410) (-7446.255) (-7434.636) [-7429.961] -- 0:00:18 989500 -- (-7433.235) [-7432.376] (-7438.789) (-7427.428) * (-7423.003) (-7439.132) [-7439.150] (-7430.875) -- 0:00:17 990000 -- (-7432.738) [-7431.670] (-7443.086) (-7434.897) * [-7424.173] (-7435.251) (-7439.419) (-7438.861) -- 0:00:17 Average standard deviation of split frequencies: 0.003390 990500 -- (-7430.226) (-7436.395) (-7430.491) [-7429.942] * (-7434.855) [-7436.287] (-7438.100) (-7444.697) -- 0:00:16 991000 -- (-7429.014) [-7427.379] (-7443.476) (-7437.414) * (-7434.968) [-7432.281] (-7427.294) (-7438.752) -- 0:00:15 991500 -- (-7420.893) [-7429.577] (-7429.903) (-7432.374) * (-7429.251) (-7430.242) [-7428.578] (-7439.011) -- 0:00:14 992000 -- [-7425.774] (-7433.737) (-7435.764) (-7430.328) * (-7437.247) [-7425.409] (-7424.094) (-7451.381) -- 0:00:13 992500 -- (-7433.040) (-7430.556) [-7432.375] (-7436.262) * (-7433.480) [-7427.024] (-7440.952) (-7445.960) -- 0:00:12 993000 -- (-7435.341) (-7436.271) (-7439.383) [-7432.885] * (-7430.803) [-7423.512] (-7448.171) (-7445.694) -- 0:00:11 993500 -- (-7431.227) [-7425.397] (-7435.532) (-7432.302) * (-7430.158) [-7434.905] (-7439.640) (-7446.659) -- 0:00:11 994000 -- (-7440.432) (-7426.740) [-7430.393] (-7436.931) * [-7424.420] (-7441.351) (-7435.255) (-7429.601) -- 0:00:10 994500 -- (-7441.830) (-7424.516) (-7434.031) [-7433.572] * (-7440.235) (-7431.274) [-7431.165] (-7428.560) -- 0:00:09 995000 -- (-7435.007) [-7425.195] (-7433.581) (-7434.803) * (-7430.525) (-7446.711) (-7441.113) [-7431.256] -- 0:00:08 Average standard deviation of split frequencies: 0.003579 995500 -- (-7437.953) (-7429.046) (-7435.053) [-7435.179] * (-7433.503) (-7434.027) (-7426.939) [-7426.729] -- 0:00:07 996000 -- (-7434.225) [-7432.610] (-7447.895) (-7435.514) * (-7435.524) [-7425.741] (-7423.075) (-7428.830) -- 0:00:06 996500 -- [-7422.011] (-7434.862) (-7443.320) (-7436.954) * (-7442.680) (-7421.768) [-7427.445] (-7428.006) -- 0:00:05 997000 -- [-7428.289] (-7432.847) (-7439.371) (-7443.395) * (-7425.570) (-7429.512) (-7429.707) [-7431.758] -- 0:00:05 997500 -- (-7440.857) [-7424.414] (-7439.903) (-7431.811) * (-7430.257) (-7441.578) (-7437.573) [-7436.933] -- 0:00:04 998000 -- [-7427.743] (-7437.088) (-7433.072) (-7440.199) * (-7436.638) (-7436.769) [-7431.536] (-7437.329) -- 0:00:03 998500 -- (-7442.176) [-7429.522] (-7439.694) (-7428.465) * [-7429.105] (-7431.280) (-7447.588) (-7433.473) -- 0:00:02 999000 -- (-7425.812) [-7436.760] (-7433.142) (-7429.389) * (-7432.000) [-7437.462] (-7446.212) (-7433.717) -- 0:00:01 999500 -- [-7438.146] (-7437.138) (-7446.544) (-7431.590) * [-7434.151] (-7443.234) (-7438.319) (-7435.178) -- 0:00:00 1000000 -- (-7437.632) (-7433.460) (-7433.681) [-7435.389] * (-7441.367) [-7431.520] (-7434.161) (-7434.374) -- 0:00:00 Average standard deviation of split frequencies: 0.003268 Final log likelihoods and log prior probs for run 1 (stored and calculated): Chain 1 -- -7437.632050 -- 21.037939 Chain 1 -- -7437.632044 -- 21.037939 Chain 2 -- -7433.459655 -- 22.788642 Chain 2 -- -7433.459711 -- 22.788642 Chain 3 -- -7433.681375 -- 22.774701 Chain 3 -- -7433.681347 -- 22.774701 Chain 4 -- -7435.388945 -- 19.585721 Chain 4 -- -7435.388963 -- 19.585721 Final log likelihoods and log prior probs for run 2 (stored and calculated): Chain 1 -- -7441.366842 -- 20.818160 Chain 1 -- -7441.366910 -- 20.818160 Chain 2 -- -7431.520123 -- 22.583328 Chain 2 -- -7431.520105 -- 22.583328 Chain 3 -- -7434.160993 -- 23.767586 Chain 3 -- -7434.161007 -- 23.767586 Chain 4 -- -7434.374306 -- 25.042356 Chain 4 -- -7434.374306 -- 25.042356 Analysis completed in 28 mins 30 seconds Analysis used 1710.38 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -7416.44 Likelihood of best state for "cold" chain of run 2 was -7416.91 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 24.9 % ( 28 %) Dirichlet(Revmat{all}) 35.9 % ( 25 %) Slider(Revmat{all}) 19.4 % ( 22 %) Dirichlet(Pi{all}) 25.0 % ( 24 %) Slider(Pi{all}) 28.8 % ( 25 %) Multiplier(Alpha{1,2}) 35.2 % ( 21 %) Multiplier(Alpha{3}) 45.7 % ( 28 %) Slider(Pinvar{all}) 5.0 % ( 5 %) ExtSPR(Tau{all},V{all}) 1.1 % ( 1 %) ExtTBR(Tau{all},V{all}) 7.5 % ( 9 %) NNI(Tau{all},V{all}) 2.6 % ( 7 %) ParsSPR(Tau{all},V{all}) 25.8 % ( 23 %) Multiplier(V{all}) 25.0 % ( 27 %) Nodeslider(V{all}) 23.0 % ( 20 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 24.4 % ( 23 %) Dirichlet(Revmat{all}) 36.1 % ( 31 %) Slider(Revmat{all}) 19.3 % ( 26 %) Dirichlet(Pi{all}) 24.4 % ( 23 %) Slider(Pi{all}) 28.1 % ( 25 %) Multiplier(Alpha{1,2}) 34.9 % ( 27 %) Multiplier(Alpha{3}) 46.1 % ( 26 %) Slider(Pinvar{all}) 4.7 % ( 5 %) ExtSPR(Tau{all},V{all}) 1.2 % ( 2 %) ExtTBR(Tau{all},V{all}) 7.4 % ( 10 %) NNI(Tau{all},V{all}) 2.5 % ( 5 %) ParsSPR(Tau{all},V{all}) 25.8 % ( 20 %) Multiplier(V{all}) 24.9 % ( 24 %) Nodeslider(V{all}) 23.0 % ( 23 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.74 0.53 0.36 2 | 166271 0.76 0.55 3 | 167374 166794 0.78 4 | 167045 166474 166042 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.74 0.53 0.36 2 | 166809 0.76 0.56 3 | 166780 166199 0.78 4 | 166817 166301 167094 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /opt/ADOPS1/revmuscle/S5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS1/revmuscle/S5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /opt/ADOPS1/revmuscle/S5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -7428.10 | 1 2 2 1 | | 2 2 2 21 | | 2 1 2 1 1 2 2 | |1 1 1 1 21 1 | | 2 211 21 1 11 2 1 11 | | *2 11 22 11 1 211 2 2 1 | | * 2 2 * 1 1| | * 2 2 22 1 2 | | 1 1 211 2 1 * 1 1*2 1 2 1 2 22| | 1 22 22 1112 21 1 2 2 | |2 2 2 1 2 | | 1 2 1 | | 2 2 1 1 | | 1 2 | | 2 1 2 2 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -7432.69 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS1/revmuscle/S5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/revmuscle/S5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS1/revmuscle/S5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -7424.07 -7444.15 2 -7424.04 -7441.68 -------------------------------------- TOTAL -7424.05 -7443.54 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS1/revmuscle/S5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/revmuscle/S5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS1/revmuscle/S5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 1.426375 0.003662 1.306126 1.543630 1.423657 1383.30 1414.01 1.000 r(A<->C){all} 0.107254 0.000134 0.084813 0.129427 0.107064 980.02 1043.24 1.000 r(A<->G){all} 0.323886 0.000373 0.287849 0.363455 0.323110 604.51 637.98 1.000 r(A<->T){all} 0.078767 0.000061 0.063585 0.093697 0.078639 1035.32 1037.82 1.000 r(C<->G){all} 0.138346 0.000213 0.110366 0.167488 0.137772 984.30 1054.38 1.000 r(C<->T){all} 0.270755 0.000301 0.236655 0.304718 0.270668 880.28 918.88 1.001 r(G<->T){all} 0.080992 0.000084 0.063736 0.098878 0.080549 1102.07 1132.03 1.000 pi(A){all} 0.292442 0.000112 0.271284 0.312944 0.292706 1043.16 1198.88 1.000 pi(C){all} 0.174849 0.000078 0.158255 0.192544 0.174745 980.85 1078.25 1.000 pi(G){all} 0.195289 0.000081 0.178568 0.213335 0.195274 991.53 1051.25 1.000 pi(T){all} 0.337420 0.000127 0.316082 0.359862 0.337484 1115.48 1172.99 1.000 alpha{1,2} 0.883018 0.025913 0.611356 1.205751 0.855502 935.91 1093.07 1.000 alpha{3} 1.509877 0.160454 0.867752 2.316765 1.435413 903.97 1051.19 1.000 pinvar{all} 0.060048 0.001930 0.000026 0.142941 0.051618 1027.63 1084.58 1.001 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/opt/ADOPS1/revmuscle/S5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS1/revmuscle/S5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /opt/ADOPS1/revmuscle/S5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/opt/ADOPS1/revmuscle/S5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 7 -- C7 8 -- C8 9 -- C9 10 -- C10 11 -- C11 12 -- C12 13 -- C13 14 -- C14 15 -- C15 16 -- C16 Key to taxon bipartitions (saved to file "/opt/ADOPS1/revmuscle/S5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ---------------------- 1 -- .*************** 2 -- .*.............. 3 -- ..*............. 4 -- ...*............ 5 -- ....*........... 6 -- .....*.......... 7 -- ......*......... 8 -- .......*........ 9 -- ........*....... 10 -- .........*...... 11 -- ..........*..... 12 -- ...........*.... 13 -- ............*... 14 -- .............*.. 15 -- ..............*. 16 -- ...............* 17 -- .***.*********** 18 -- ......*.......*. 19 -- ...........***.. 20 -- ......*....****. 21 -- .....**.******** 22 -- .....**.**.****. 23 -- ...........*.*.. 24 -- .....*..**...... 25 -- .**............. 26 -- .***.**.******** 27 -- .....*..*....... 28 -- .....**.**.***** 29 -- .***............ 30 -- ...*.**.******** 31 -- ..........*....* 32 -- .**....*........ ---------------------- Summary statistics for informative taxon bipartitions (saved to file "/opt/ADOPS1/revmuscle/S5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 17 3002 1.000000 0.000000 1.000000 1.000000 2 18 3002 1.000000 0.000000 1.000000 1.000000 2 19 3002 1.000000 0.000000 1.000000 1.000000 2 20 3002 1.000000 0.000000 1.000000 1.000000 2 21 2996 0.998001 0.000000 0.998001 0.998001 2 22 2980 0.992672 0.001884 0.991339 0.994004 2 23 2973 0.990340 0.003298 0.988008 0.992672 2 24 2971 0.989674 0.002355 0.988008 0.991339 2 25 2749 0.915723 0.008951 0.909394 0.922052 2 26 2673 0.890406 0.003298 0.888075 0.892738 2 27 2456 0.818121 0.005653 0.814124 0.822119 2 28 2028 0.675550 0.008480 0.669554 0.681546 2 29 1880 0.626249 0.002827 0.624250 0.628248 2 30 945 0.314790 0.005182 0.311126 0.318454 2 31 741 0.246835 0.007066 0.241839 0.251832 2 32 327 0.108927 0.003298 0.106596 0.111259 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/opt/ADOPS1/revmuscle/S5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.088598 0.000151 0.065741 0.112542 0.088064 1.000 2 length{all}[2] 0.065833 0.000120 0.046084 0.088838 0.065561 1.000 2 length{all}[3] 0.057798 0.000085 0.041470 0.076959 0.057377 1.000 2 length{all}[4] 0.063033 0.000081 0.045038 0.079651 0.062366 1.000 2 length{all}[5] 0.035741 0.000057 0.021107 0.051032 0.035409 1.000 2 length{all}[6] 0.073116 0.000126 0.051242 0.094387 0.072646 1.000 2 length{all}[7] 0.070838 0.000101 0.051891 0.091820 0.070560 1.000 2 length{all}[8] 0.065283 0.000104 0.045463 0.084557 0.064835 1.001 2 length{all}[9] 0.083403 0.000157 0.058471 0.107290 0.083118 1.000 2 length{all}[10] 0.099552 0.000161 0.076644 0.125231 0.099077 1.001 2 length{all}[11] 0.093061 0.000126 0.071378 0.114670 0.092551 1.000 2 length{all}[12] 0.050375 0.000061 0.035276 0.065559 0.049981 1.000 2 length{all}[13] 0.072334 0.000091 0.054494 0.091674 0.072056 1.000 2 length{all}[14] 0.047463 0.000062 0.032347 0.062964 0.046991 1.000 2 length{all}[15] 0.095369 0.000165 0.070995 0.120876 0.094681 1.000 2 length{all}[16] 0.114788 0.000197 0.089955 0.143607 0.114269 1.000 2 length{all}[17] 0.045282 0.000088 0.027268 0.063019 0.044567 1.000 2 length{all}[18] 0.043930 0.000076 0.027055 0.061202 0.043639 1.000 2 length{all}[19] 0.033317 0.000046 0.021132 0.047467 0.032884 1.000 2 length{all}[20] 0.023016 0.000032 0.012233 0.034438 0.022511 1.000 2 length{all}[21] 0.013772 0.000025 0.004538 0.023912 0.013385 1.000 2 length{all}[22] 0.012040 0.000020 0.003452 0.020757 0.011701 1.000 2 length{all}[23] 0.010130 0.000019 0.001934 0.018405 0.009748 1.001 2 length{all}[24] 0.009104 0.000019 0.001806 0.017808 0.008530 1.000 2 length{all}[25] 0.016575 0.000037 0.005184 0.028738 0.016302 1.000 2 length{all}[26] 0.020429 0.000044 0.007960 0.033907 0.019962 1.000 2 length{all}[27] 0.008288 0.000025 0.000192 0.017638 0.007487 1.000 2 length{all}[28] 0.006413 0.000013 0.000404 0.013376 0.005995 1.001 2 length{all}[29] 0.010721 0.000022 0.002574 0.019838 0.010277 1.000 2 length{all}[30] 0.008106 0.000015 0.002053 0.016325 0.007692 0.999 2 length{all}[31] 0.007754 0.000024 0.000009 0.016398 0.007010 0.999 2 length{all}[32] 0.014653 0.000032 0.003811 0.025315 0.014114 0.997 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.003268 Maximum standard deviation of split frequencies = 0.008951 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.001 Clade credibility values: /---------------------------------------------------------------------- C1 (1) | |---------------------------------------------------------------------- C5 (5) | | /-------- C2 (2) | /---92--+ | | \-------- C3 (3) | /------------------63-----------------+ | | \---------------- C4 (4) | | | | /-------- C6 (6) | | /---82--+ + | | \-------- C9 (9) | | /------99------+ | | | \---------------- C10 (10) | | | | /---89--+ | /-------- C7 (7) | | | /---99--+ /------100-----+ | | | | | | \-------- C15 (15) | | | | | | | | | | \--100--+ /-------- C12 (12) | | | | | /---99--+ | | | /---68--+ | | \-------- C14 (14) \--100--+ | | | \--100-+ | | | | \---------------- C13 (13) | \--100-+ | | | \--------------------------------------- C16 (16) | | | \----------------------------------------------- C11 (11) | \-------------------------------------------------------------- C8 (8) Phylogram (based on average branch lengths): /------------------------ C1 (1) | |---------- C5 (5) | | /------------------ C2 (2) | /----+ | | \---------------- C3 (3) | /-+ | | \----------------- C4 (4) | | | | /-------------------- C6 (6) | | /-+ + | | \----------------------- C9 (9) | | /-+ | | | \--------------------------- C10 (10) | | | | /-----+ | /------------------- C7 (7) | | | /--+ /-----------+ | | | | | | \-------------------------- C15 (15) | | | | | | | | | | \-----+ /-------------- C12 (12) | | | | | /--+ | | | /-+ | | \------------- C14 (14) \-----------+ | | | \--------+ | | | | \-------------------- C13 (13) | \--+ | | | \------------------------------- C16 (16) | | | \-------------------------- C11 (11) | \------------------ C8 (8) |------------| 0.050 expected changes per site Calculating tree probabilities... Credible sets of trees (110 trees sampled): 50 % credible set contains 3 trees 90 % credible set contains 17 trees 95 % credible set contains 30 trees 99 % credible set contains 80 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.8, March 2014 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8 seq file is not paml/phylip format. Trying nexus format. ns = 16 ls = 1836 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Reading seq # 7: C7 Reading seq # 8: C8 Reading seq # 9: C9 Reading seq #10: C10 Reading seq #11: C11 Reading seq #12: C12 Reading seq #13: C13 Reading seq #14: C14 Reading seq #15: C15 Reading seq #16: C16 Sites with gaps or missing data are removed. 981 ambiguity characters in seq. 1 1092 ambiguity characters in seq. 2 741 ambiguity characters in seq. 3 780 ambiguity characters in seq. 4 636 ambiguity characters in seq. 5 996 ambiguity characters in seq. 6 621 ambiguity characters in seq. 7 912 ambiguity characters in seq. 8 1086 ambiguity characters in seq. 9 945 ambiguity characters in seq. 10 654 ambiguity characters in seq. 11 666 ambiguity characters in seq. 12 741 ambiguity characters in seq. 13 825 ambiguity characters in seq. 14 897 ambiguity characters in seq. 15 954 ambiguity characters in seq. 16 436 sites are removed. 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 137 138 139 140 141 165 167 168 201 202 244 245 246 247 248 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 Sequences read.. Counting site patterns.. 0:00 169 patterns at 176 / 176 sites (100.0%), 0:00 Counting codons.. NG distances for seqs.: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 960 bytes for distance 164944 bytes for conP 22984 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 5, ((((2, 3), 4), (((((6, 9), 10), ((7, 15), ((12, 14), 13))), 16), 11)), 8)); MP score: 559 1 0.890299 2 0.876514 3 0.874093 4 0.873520 5 0.873463 6 0.873449 7 0.873448 8 0.873448 1154608 bytes for conP, adjusted 0.154389 0.084699 0.097404 0.012387 0.053265 0.042655 0.138816 0.152115 0.164957 0.012873 0.037503 0.020432 0.014729 0.000000 0.121668 0.189155 0.204531 0.084968 0.097228 0.110661 0.208247 0.052104 0.010768 0.098512 0.096192 0.131305 0.190336 0.150031 0.172289 0.300000 1.300000 ntime & nrate & np: 29 2 31 Bounds (np=31): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 31 lnL0 = -4136.485756 Iterating by ming2 Initial: fx= 4136.485756 x= 0.15439 0.08470 0.09740 0.01239 0.05326 0.04265 0.13882 0.15212 0.16496 0.01287 0.03750 0.02043 0.01473 0.00000 0.12167 0.18916 0.20453 0.08497 0.09723 0.11066 0.20825 0.05210 0.01077 0.09851 0.09619 0.13130 0.19034 0.15003 0.17229 0.30000 1.30000 1 h-m-p 0.0000 0.0002 1274.8698 ++ 4037.483386 m 0.0002 36 | 1/31 2 h-m-p 0.0001 0.0004 755.8268 ++ 3921.420603 m 0.0004 70 | 1/31 3 h-m-p 0.0000 0.0002 808.7390 ++ 3887.728404 m 0.0002 104 | 1/31 4 h-m-p 0.0001 0.0007 160.7796 +YYCCC 3882.176211 4 0.0004 145 | 1/31 5 h-m-p 0.0001 0.0004 243.7936 +YYYCC 3877.438411 4 0.0003 185 | 1/31 6 h-m-p 0.0002 0.0010 325.8916 +CYCC 3864.896231 3 0.0008 225 | 1/31 7 h-m-p 0.0002 0.0008 839.7112 YCYCCC 3846.998048 5 0.0004 267 | 1/31 8 h-m-p 0.0001 0.0005 649.8902 CYCCC 3841.978636 4 0.0002 308 | 1/31 9 h-m-p 0.0006 0.0030 47.1977 YCC 3841.648955 2 0.0004 345 | 1/31 10 h-m-p 0.0009 0.0114 18.8741 YC 3841.566352 1 0.0005 380 | 1/31 11 h-m-p 0.0010 0.0097 8.7253 CCC 3841.504476 2 0.0008 418 | 1/31 12 h-m-p 0.0006 0.0226 11.4839 YC 3841.334596 1 0.0012 453 | 1/31 13 h-m-p 0.0012 0.0165 11.9362 YC 3840.493335 1 0.0026 488 | 1/31 14 h-m-p 0.0008 0.0053 38.0928 YCCC 3837.107769 3 0.0019 527 | 1/31 15 h-m-p 0.0003 0.0014 77.7248 ++ 3827.990808 m 0.0014 561 | 1/31 16 h-m-p 0.0000 0.0000 92.2359 h-m-p: 6.53266231e-21 3.26633115e-20 9.22358654e+01 3827.990808 .. | 1/31 17 h-m-p 0.0000 0.0010 435.0450 +++YCCC 3813.758873 3 0.0004 634 | 1/31 18 h-m-p 0.0001 0.0006 257.7129 ++ 3790.955475 m 0.0006 668 | 1/31 19 h-m-p 0.0004 0.0019 379.9024 +YCCC 3769.692221 3 0.0010 708 | 1/31 20 h-m-p 0.0001 0.0006 213.8263 +YYYCC 3763.616106 4 0.0004 748 | 1/31 21 h-m-p 0.0001 0.0003 451.6958 +YYYC 3758.274751 3 0.0002 786 | 1/31 22 h-m-p 0.0001 0.0008 900.5191 YCCC 3751.058945 3 0.0002 825 | 1/31 23 h-m-p 0.0003 0.0014 223.0235 YCCC 3745.557832 3 0.0007 864 | 1/31 24 h-m-p 0.0003 0.0015 125.2494 YCCCC 3743.067505 4 0.0007 905 | 0/31 25 h-m-p 0.0008 0.0038 87.9594 -YCCC 3742.945383 3 0.0001 945 | 0/31 26 h-m-p 0.0001 0.0014 51.6273 +CCC 3742.501186 2 0.0006 984 | 0/31 27 h-m-p 0.0019 0.0094 13.2228 YC 3742.410071 1 0.0011 1019 | 0/31 28 h-m-p 0.0013 0.0067 8.8920 YC 3742.385078 1 0.0006 1054 | 0/31 29 h-m-p 0.0011 0.0708 5.1181 CC 3742.353437 1 0.0014 1090 | 0/31 30 h-m-p 0.0011 0.0189 6.6334 YC 3742.255766 1 0.0022 1125 | 0/31 31 h-m-p 0.0021 0.0256 6.8859 YCCC 3741.770190 3 0.0048 1164 | 0/31 32 h-m-p 0.0016 0.0177 21.0611 +CCCC 3737.422484 3 0.0080 1205 | 0/31 33 h-m-p 0.0005 0.0025 85.4112 +YCCC 3731.395792 3 0.0022 1245 | 0/31 34 h-m-p 0.0003 0.0013 41.1389 ++ 3730.518309 m 0.0013 1279 | 0/31 35 h-m-p 0.0050 0.0250 9.0835 YC 3730.478619 1 0.0010 1314 | 0/31 36 h-m-p 0.0016 0.0081 2.9101 CC 3730.462854 1 0.0023 1350 | 0/31 37 h-m-p 0.0082 0.4103 0.8280 +YC 3730.337361 1 0.0231 1386 | 0/31 38 h-m-p 0.0034 0.0705 5.5681 +YC 3729.605575 1 0.0089 1453 | 0/31 39 h-m-p 0.0026 0.0200 18.8710 CCC 3728.594234 2 0.0035 1491 | 0/31 40 h-m-p 0.0073 0.0528 8.9880 YC 3728.546185 1 0.0012 1526 | 0/31 41 h-m-p 0.0054 0.1137 2.0433 CC 3728.540400 1 0.0021 1562 | 0/31 42 h-m-p 0.0082 1.0359 0.5119 YC 3728.517078 1 0.0179 1597 | 0/31 43 h-m-p 0.0038 0.1159 2.3872 +CCC 3728.216510 2 0.0215 1667 | 0/31 44 h-m-p 0.0023 0.0113 17.8847 CYC 3728.012633 2 0.0021 1704 | 0/31 45 h-m-p 0.0161 0.1447 2.3505 -CC 3728.008850 1 0.0014 1741 | 0/31 46 h-m-p 0.0096 1.6200 0.3335 YC 3728.007967 1 0.0051 1776 | 0/31 47 h-m-p 0.0065 1.1783 0.2607 +CC 3727.998151 1 0.0236 1844 | 0/31 48 h-m-p 0.0029 0.1875 2.0890 +CC 3727.890636 1 0.0181 1912 | 0/31 49 h-m-p 0.0159 0.1248 2.3812 -CC 3727.886573 1 0.0016 1949 | 0/31 50 h-m-p 0.0097 1.0480 0.3809 C 3727.886334 0 0.0024 1983 | 0/31 51 h-m-p 0.0262 8.0000 0.0353 ++YC 3727.854548 1 0.7815 2051 | 0/31 52 h-m-p 0.0055 0.0796 4.9977 CC 3727.845553 1 0.0018 2118 | 0/31 53 h-m-p 0.7201 8.0000 0.0124 YC 3727.833938 1 1.1852 2153 | 0/31 54 h-m-p 1.6000 8.0000 0.0036 YC 3727.832418 1 1.2750 2219 | 0/31 55 h-m-p 1.6000 8.0000 0.0007 C 3727.832083 0 1.3272 2284 | 0/31 56 h-m-p 1.6000 8.0000 0.0002 Y 3727.832062 0 0.9234 2349 | 0/31 57 h-m-p 1.6000 8.0000 0.0000 Y 3727.832062 0 0.9003 2414 | 0/31 58 h-m-p 1.6000 8.0000 0.0000 Y 3727.832062 0 1.2658 2479 | 0/31 59 h-m-p 1.6000 8.0000 0.0000 Y 3727.832062 0 1.2712 2544 | 0/31 60 h-m-p 1.6000 8.0000 0.0000 Y 3727.832062 0 0.7460 2609 | 0/31 61 h-m-p 1.2665 8.0000 0.0000 ------Y 3727.832062 0 0.0001 2680 Out.. lnL = -3727.832062 2681 lfun, 2681 eigenQcodon, 77749 P(t) Time used: 0:25 Model 1: NearlyNeutral TREE # 1 (1, 5, ((((2, 3), 4), (((((6, 9), 10), ((7, 15), ((12, 14), 13))), 16), 11)), 8)); MP score: 559 1 0.762524 2 0.443066 3 0.383075 4 0.366688 5 0.366621 6 0.366609 7 0.366609 8 0.366609 0.184677 0.099157 0.084761 0.024001 0.024305 0.023506 0.154944 0.168193 0.175842 0.024662 0.038647 0.010830 0.006854 0.000000 0.140527 0.202095 0.219067 0.107049 0.098505 0.126241 0.225072 0.048739 0.030171 0.129058 0.131965 0.138138 0.211852 0.164282 0.170175 2.514536 0.509127 0.131251 ntime & nrate & np: 29 2 32 Bounds (np=32): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 6.076611 np = 32 lnL0 = -3673.620708 Iterating by ming2 Initial: fx= 3673.620708 x= 0.18468 0.09916 0.08476 0.02400 0.02430 0.02351 0.15494 0.16819 0.17584 0.02466 0.03865 0.01083 0.00685 0.00000 0.14053 0.20209 0.21907 0.10705 0.09850 0.12624 0.22507 0.04874 0.03017 0.12906 0.13197 0.13814 0.21185 0.16428 0.17017 2.51454 0.50913 0.13125 1 h-m-p 0.0000 0.0006 378.7266 ++YYCCC 3664.228690 4 0.0002 45 | 0/32 2 h-m-p 0.0000 0.0002 176.4985 ++ 3660.631866 m 0.0002 80 | 0/32 3 h-m-p 0.0001 0.0003 472.2855 +CCC 3656.542208 2 0.0002 120 | 0/32 4 h-m-p 0.0006 0.0041 140.2424 CYCCC 3654.241450 4 0.0005 162 | 0/32 5 h-m-p 0.0004 0.0022 61.8502 CCC 3653.520590 2 0.0005 201 | 0/32 6 h-m-p 0.0006 0.0030 30.4493 YCC 3653.356912 2 0.0005 239 | 0/32 7 h-m-p 0.0005 0.0025 24.0063 CC 3653.265005 1 0.0005 276 | 0/32 8 h-m-p 0.0008 0.0039 12.1146 YC 3653.245914 1 0.0004 312 | 0/32 9 h-m-p 0.0006 0.0468 6.9598 YC 3653.227777 1 0.0010 348 | 0/32 10 h-m-p 0.0010 0.0112 7.2330 CC 3653.208739 1 0.0013 385 | 0/32 11 h-m-p 0.0011 0.0192 8.6673 YC 3653.180000 1 0.0018 421 | 0/32 12 h-m-p 0.0008 0.0180 18.9927 YC 3653.136556 1 0.0013 457 | 0/32 13 h-m-p 0.0016 0.0231 16.1959 CC 3653.087733 1 0.0018 494 | 0/32 14 h-m-p 0.0011 0.0062 27.3163 CC 3653.047920 1 0.0009 531 | 0/32 15 h-m-p 0.0011 0.0122 21.8960 CC 3652.995210 1 0.0014 568 | 0/32 16 h-m-p 0.0013 0.0258 24.1835 CC 3652.939882 1 0.0014 605 | 0/32 17 h-m-p 0.0027 0.0136 4.5705 YC 3652.927727 1 0.0016 641 | 0/32 18 h-m-p 0.0020 0.0586 3.6267 YC 3652.915834 1 0.0016 677 | 0/32 19 h-m-p 0.0051 0.1393 1.1192 +YC 3652.803010 1 0.0151 714 | 0/32 20 h-m-p 0.0042 0.0365 3.9947 +CYC 3651.376373 2 0.0160 753 | 0/32 21 h-m-p 0.0003 0.0016 20.1601 ++ 3650.100188 m 0.0016 788 | 0/32 22 h-m-p -0.0000 -0.0000 12.9335 h-m-p: -9.93925705e-20 -4.96962853e-19 1.29335282e+01 3650.100188 .. | 0/32 23 h-m-p 0.0000 0.0002 53.0740 ++YCYC 3649.881050 3 0.0001 861 | 0/32 24 h-m-p 0.0003 0.0033 26.3388 YC 3649.706229 1 0.0006 897 | 0/32 25 h-m-p 0.0001 0.0005 39.1080 ++ 3649.544978 m 0.0005 932 | 1/32 26 h-m-p 0.0003 0.0014 19.7274 CYC 3649.517487 2 0.0003 970 | 1/32 27 h-m-p 0.0008 0.0284 6.4672 YC 3649.506883 1 0.0006 1006 | 1/32 28 h-m-p 0.0009 0.0149 4.8838 YC 3649.502489 1 0.0006 1042 | 1/32 29 h-m-p 0.0008 0.0337 3.3766 YC 3649.500440 1 0.0006 1078 | 1/32 30 h-m-p 0.0008 0.0799 2.6354 YC 3649.499345 1 0.0006 1114 | 1/32 31 h-m-p 0.0004 0.0319 3.5126 C 3649.498250 0 0.0005 1149 | 1/32 32 h-m-p 0.0009 0.1547 2.1361 CC 3649.497199 1 0.0011 1186 | 1/32 33 h-m-p 0.0010 0.0632 2.3707 C 3649.496315 0 0.0010 1221 | 1/32 34 h-m-p 0.0010 0.3392 2.3607 YC 3649.494951 1 0.0018 1257 | 1/32 35 h-m-p 0.0021 0.2527 2.1027 C 3649.493742 0 0.0021 1292 | 1/32 36 h-m-p 0.0009 0.0978 4.8210 YC 3649.491669 1 0.0017 1328 | 1/32 37 h-m-p 0.0034 0.1683 2.3281 YC 3649.490848 1 0.0015 1364 | 1/32 38 h-m-p 0.0017 0.1589 2.0822 YC 3649.490513 1 0.0008 1400 | 1/32 39 h-m-p 0.0032 0.6882 0.4961 Y 3649.490409 0 0.0014 1435 | 1/32 40 h-m-p 0.0087 3.5500 0.0821 C 3649.490389 0 0.0033 1501 | 1/32 41 h-m-p 0.0134 6.7069 0.0380 C 3649.490314 0 0.0126 1567 | 1/32 42 h-m-p 0.0057 0.3396 0.0845 YC 3649.489638 1 0.0141 1634 | 1/32 43 h-m-p 0.0029 0.0564 0.4074 CC 3649.488364 1 0.0038 1702 | 1/32 44 h-m-p 0.0037 0.1460 0.4223 YC 3649.488174 1 0.0019 1769 | 1/32 45 h-m-p 0.0093 1.6857 0.0843 Y 3649.488167 0 0.0018 1835 | 1/32 46 h-m-p 0.0160 8.0000 0.0209 -Y 3649.488167 0 0.0017 1902 | 1/32 47 h-m-p 0.0160 8.0000 0.0030 C 3649.488165 0 0.0253 1968 | 1/32 48 h-m-p 0.0160 8.0000 0.0098 Y 3649.488132 0 0.0288 2034 | 1/32 49 h-m-p 0.0070 3.5038 0.0861 C 3649.488120 0 0.0021 2100 | 1/32 50 h-m-p 0.0160 8.0000 0.0433 -Y 3649.488118 0 0.0016 2167 | 1/32 51 h-m-p 0.0160 8.0000 0.0068 -C 3649.488118 0 0.0015 2234 | 1/32 52 h-m-p 0.0160 8.0000 0.0015 -Y 3649.488118 0 0.0016 2301 | 1/32 53 h-m-p 0.0160 8.0000 0.0002 Y 3649.488118 0 0.0065 2367 | 1/32 54 h-m-p 0.0160 8.0000 0.0002 C 3649.488118 0 0.0160 2433 | 1/32 55 h-m-p 0.0160 8.0000 0.0003 Y 3649.488118 0 0.0314 2499 | 1/32 56 h-m-p 0.0160 8.0000 0.0011 -C 3649.488118 0 0.0011 2566 | 1/32 57 h-m-p 0.0295 8.0000 0.0000 --C 3649.488118 0 0.0005 2634 | 1/32 58 h-m-p 0.0167 8.0000 0.0000 --------C 3649.488118 0 0.0000 2708 Out.. lnL = -3649.488118 2709 lfun, 8127 eigenQcodon, 157122 P(t) Time used: 1:15 Model 2: PositiveSelection TREE # 1 (1, 5, ((((2, 3), 4), (((((6, 9), 10), ((7, 15), ((12, 14), 13))), 16), 11)), 8)); MP score: 559 1 0.718158 2 0.340100 3 0.265744 4 0.255552 5 0.254248 6 0.254017 7 0.253963 8 0.253953 9 0.253952 10 0.253952 initial w for M2:NSpselection reset. 0.192849 0.110856 0.095281 0.020659 0.038809 0.018981 0.157222 0.173612 0.171755 0.022071 0.033764 0.028788 0.016986 0.000000 0.158670 0.207141 0.232805 0.106400 0.093249 0.136650 0.217886 0.043792 0.014290 0.119890 0.133828 0.139390 0.233019 0.176977 0.170727 2.402649 0.918272 0.575665 0.255125 2.180709 ntime & nrate & np: 29 3 34 Bounds (np=34): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 4.524677 np = 34 lnL0 = -3664.742468 Iterating by ming2 Initial: fx= 3664.742468 x= 0.19285 0.11086 0.09528 0.02066 0.03881 0.01898 0.15722 0.17361 0.17176 0.02207 0.03376 0.02879 0.01699 0.00000 0.15867 0.20714 0.23281 0.10640 0.09325 0.13665 0.21789 0.04379 0.01429 0.11989 0.13383 0.13939 0.23302 0.17698 0.17073 2.40265 0.91827 0.57566 0.25513 2.18071 1 h-m-p 0.0000 0.0002 240.6449 +++ 3655.086304 m 0.0002 40 | 0/34 2 h-m-p 0.0001 0.0011 391.0115 +YCCC 3644.789490 3 0.0004 83 | 0/34 3 h-m-p 0.0000 0.0002 149.7966 ++ 3642.091791 m 0.0002 120 | 1/34 4 h-m-p 0.0001 0.0003 138.9673 ++ 3640.491854 m 0.0003 157 | 1/34 5 h-m-p 0.0006 0.0029 77.4686 YCCC 3639.912858 3 0.0004 199 | 1/34 6 h-m-p 0.0002 0.0008 66.3943 +YC 3639.361770 1 0.0005 238 | 1/34 7 h-m-p 0.0004 0.0018 45.2756 CCCC 3639.026922 3 0.0006 281 | 1/34 8 h-m-p 0.0007 0.0084 35.8724 CYC 3638.723740 2 0.0009 321 | 1/34 9 h-m-p 0.0011 0.0067 28.7596 +CYC 3637.635471 2 0.0045 362 | 1/34 10 h-m-p 0.0006 0.0029 91.2614 CCCC 3636.932248 3 0.0009 405 | 1/34 11 h-m-p 0.0004 0.0019 78.8828 +YCC 3636.228802 2 0.0013 446 | 1/34 12 h-m-p 0.0004 0.0022 45.6167 +CC 3635.811855 1 0.0016 486 | 1/34 13 h-m-p 0.0029 0.0144 20.2155 CCCC 3635.399150 3 0.0045 529 | 1/34 14 h-m-p 0.0002 0.0012 80.9185 ++ 3634.841693 m 0.0012 566 | 1/34 15 h-m-p 0.0010 0.0262 94.6907 +CCCC 3632.483086 3 0.0061 610 | 1/34 16 h-m-p 0.0025 0.0124 104.0725 CCC 3631.578774 2 0.0022 651 | 1/34 17 h-m-p 0.0035 0.0173 34.8526 CCC 3631.211360 2 0.0029 692 | 1/34 18 h-m-p 0.0039 0.0282 26.4742 +CYC 3629.916244 2 0.0150 733 | 1/34 19 h-m-p 0.0029 0.0190 137.1249 CCC 3628.157635 2 0.0040 774 | 1/34 20 h-m-p 0.0062 0.0311 37.9308 CC 3627.943268 1 0.0019 813 | 1/34 21 h-m-p 0.0021 0.0105 7.0091 CC 3627.906829 1 0.0022 852 | 1/34 22 h-m-p 0.0038 0.0188 3.2285 CC 3627.865395 1 0.0060 891 | 1/34 23 h-m-p 0.0030 0.1126 6.3655 +YC 3627.548920 1 0.0205 930 | 1/34 24 h-m-p 0.0007 0.0034 46.0253 +YC 3627.214440 1 0.0029 969 | 1/34 25 h-m-p 0.0002 0.0008 13.9990 ++ 3627.165155 m 0.0008 1006 | 1/34 26 h-m-p 0.0000 0.0000 3.4043 h-m-p: 2.35102695e-20 1.17551348e-19 3.40429439e+00 3627.165155 .. | 1/34 27 h-m-p 0.0000 0.0003 88.8216 +++ 3625.690562 m 0.0003 1078 | 1/34 28 h-m-p 0.0008 0.0042 20.8976 CC 3625.544792 1 0.0007 1117 | 1/34 29 h-m-p 0.0001 0.0003 21.3622 ++ 3625.474312 m 0.0003 1154 | 1/34 30 h-m-p 0.0003 0.0013 19.1351 +YC 3625.403942 1 0.0008 1193 | 1/34 31 h-m-p 0.0003 0.0013 22.9846 YC 3625.356465 1 0.0005 1231 | 1/34 32 h-m-p 0.0006 0.0029 12.1838 CY 3625.336131 1 0.0006 1270 | 1/34 33 h-m-p 0.0007 0.0124 10.4764 CC 3625.316398 1 0.0009 1309 | 1/34 34 h-m-p 0.0004 0.0019 15.2466 +YC 3625.282278 1 0.0012 1348 | 1/34 35 h-m-p 0.0005 0.0084 34.9842 CC 3625.244150 1 0.0006 1387 | 1/34 36 h-m-p 0.0008 0.0068 26.7978 CCC 3625.194176 2 0.0011 1428 | 1/34 37 h-m-p 0.0008 0.0298 38.5117 CC 3625.129782 1 0.0011 1467 | 1/34 38 h-m-p 0.0012 0.0059 17.3159 CC 3625.087393 1 0.0017 1506 | 1/34 39 h-m-p 0.0018 0.0204 16.0589 YC 3625.066385 1 0.0010 1544 | 1/34 40 h-m-p 0.0049 0.0441 3.1891 CC 3625.062418 1 0.0014 1583 | 1/34 41 h-m-p 0.0037 0.5064 1.1831 CC 3625.061629 1 0.0014 1622 | 1/34 42 h-m-p 0.0027 1.3717 0.8165 YC 3625.059878 1 0.0067 1660 | 1/34 43 h-m-p 0.0021 0.1801 2.6398 +CC 3625.052341 1 0.0094 1733 | 1/34 44 h-m-p 0.0038 0.2684 6.4996 YC 3625.046608 1 0.0030 1771 | 1/34 45 h-m-p 0.0092 0.4615 2.1060 C 3625.045174 0 0.0024 1808 | 1/34 46 h-m-p 0.0052 0.8151 0.9904 YC 3625.042660 1 0.0098 1846 | 1/34 47 h-m-p 0.0023 0.0650 4.3202 +CC 3625.032093 1 0.0096 1919 | 1/34 48 h-m-p 0.0042 0.0264 9.7576 YC 3625.024827 1 0.0029 1957 | 1/34 49 h-m-p 0.0210 0.1049 1.1448 -CC 3625.024311 1 0.0019 1997 | 1/34 50 h-m-p 0.0127 2.1000 0.1723 YC 3625.024067 1 0.0058 2035 | 1/34 51 h-m-p 0.0028 0.9155 0.3503 ++YC 3625.019800 1 0.0366 2108 | 1/34 52 h-m-p 0.0026 0.0170 4.9191 YC 3625.010530 1 0.0056 2179 | 1/34 53 h-m-p 0.0035 0.0174 2.2541 YC 3625.009267 1 0.0019 2217 | 1/34 54 h-m-p 0.0235 0.2871 0.1796 -C 3625.009236 0 0.0019 2255 | 1/34 55 h-m-p 0.0160 8.0000 0.0643 C 3625.009223 0 0.0055 2325 | 1/34 56 h-m-p 0.0160 8.0000 0.1175 +CC 3625.008847 1 0.1003 2398 | 1/34 57 h-m-p 0.0050 1.4833 2.3712 YC 3625.008584 1 0.0035 2469 | 1/34 58 h-m-p 0.1399 8.0000 0.0595 --C 3625.008581 0 0.0025 2508 | 1/34 59 h-m-p 0.0296 8.0000 0.0051 C 3625.008581 0 0.0068 2578 | 1/34 60 h-m-p 0.0160 8.0000 0.0025 ++Y 3625.008562 0 0.2010 2650 | 1/34 61 h-m-p 0.0084 1.4651 0.0601 C 3625.008557 0 0.0030 2720 | 1/34 62 h-m-p 0.1698 8.0000 0.0011 +Y 3625.008556 0 0.4909 2791 | 1/34 63 h-m-p 1.6000 8.0000 0.0000 Y 3625.008556 0 0.9141 2861 | 1/34 64 h-m-p 1.6000 8.0000 0.0000 Y 3625.008556 0 1.6000 2931 | 1/34 65 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 1/34 66 h-m-p 0.0069 3.4458 0.0011 ----C 3625.008556 0 0.0000 3089 | 1/34 67 h-m-p 0.0084 4.2196 0.0009 -------------.. | 1/34 68 h-m-p 0.0071 3.5539 0.0010 -----------Y 3625.008556 0 0.0000 3251 | 1/34 69 h-m-p 0.0001 0.0532 0.0673 ----------.. | 1/34 70 h-m-p 0.0071 3.5537 0.0010 ------------- | 1/34 71 h-m-p 0.0071 3.5537 0.0010 ------------- Out.. lnL = -3625.008556 3492 lfun, 13968 eigenQcodon, 303804 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal probability of data. log(fX) = -3633.404137 S = -3433.739843 -191.598939 Calculating f(w|X), posterior probabilities of site classes. did 10 / 169 patterns 2:53 did 20 / 169 patterns 2:53 did 30 / 169 patterns 2:53 did 40 / 169 patterns 2:53 did 50 / 169 patterns 2:53 did 60 / 169 patterns 2:53 did 70 / 169 patterns 2:53 did 80 / 169 patterns 2:53 did 90 / 169 patterns 2:53 did 100 / 169 patterns 2:53 did 110 / 169 patterns 2:53 did 120 / 169 patterns 2:53 did 130 / 169 patterns 2:53 did 140 / 169 patterns 2:53 did 150 / 169 patterns 2:53 did 160 / 169 patterns 2:54 did 169 / 169 patterns 2:54 Time used: 2:54 Model 3: discrete TREE # 1 (1, 5, ((((2, 3), 4), (((((6, 9), 10), ((7, 15), ((12, 14), 13))), 16), 11)), 8)); MP score: 559 1 0.856074 2 0.397235 3 0.306991 4 0.306286 5 0.306119 6 0.306089 7 0.306082 8 0.306081 9 0.306081 0.199179 0.117968 0.096517 0.007000 0.030204 0.030437 0.157679 0.172796 0.173338 0.018732 0.019939 0.010929 0.011977 0.000000 0.146723 0.204713 0.223926 0.106695 0.108375 0.123356 0.232518 0.044431 0.022375 0.114131 0.119433 0.127948 0.233009 0.185443 0.175832 2.686980 0.546757 0.928793 0.288283 0.640574 1.057509 ntime & nrate & np: 29 4 35 Bounds (np=35): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000 Qfactor_NS = 5.535207 np = 35 lnL0 = -3696.784662 Iterating by ming2 Initial: fx= 3696.784662 x= 0.19918 0.11797 0.09652 0.00700 0.03020 0.03044 0.15768 0.17280 0.17334 0.01873 0.01994 0.01093 0.01198 0.00000 0.14672 0.20471 0.22393 0.10670 0.10838 0.12336 0.23252 0.04443 0.02238 0.11413 0.11943 0.12795 0.23301 0.18544 0.17583 2.68698 0.54676 0.92879 0.28828 0.64057 1.05751 1 h-m-p 0.0000 0.0003 485.9576 +++ 3682.143631 m 0.0003 76 | 0/35 2 h-m-p 0.0001 0.0007 235.6170 ++ 3660.509593 m 0.0007 149 | 0/35 3 h-m-p 0.0000 0.0002 658.0000 ++ 3648.850973 m 0.0002 222 | 0/35 4 h-m-p 0.0000 0.0000 133.4460 h-m-p: 5.27191037e-21 2.63595519e-20 1.33446019e+02 3648.850973 .. | 0/35 5 h-m-p 0.0000 0.0005 121.1919 +++ 3643.946327 m 0.0005 366 | 0/35 6 h-m-p -0.0000 -0.0000 221.5982 h-m-p: -1.03999577e-20 -5.19997886e-20 2.21598179e+02 3643.946327 .. | 0/35 7 h-m-p 0.0000 0.0017 104.4562 ++CYC 3643.051927 2 0.0002 514 | 0/35 8 h-m-p 0.0001 0.0003 110.7178 ++ 3641.649676 m 0.0003 587 | 1/35 9 h-m-p 0.0002 0.0008 131.5172 +CYC 3639.422457 2 0.0006 664 | 1/35 10 h-m-p 0.0003 0.0015 217.3822 YC 3636.024655 1 0.0007 737 | 1/35 11 h-m-p 0.0003 0.0017 105.7761 YCCC 3634.660787 3 0.0007 814 | 1/35 12 h-m-p 0.0004 0.0019 89.8937 YCCC 3633.430845 3 0.0009 891 | 1/35 13 h-m-p 0.0003 0.0026 232.8929 YYCC 3632.087351 3 0.0005 967 | 1/35 14 h-m-p 0.0004 0.0020 238.0823 YCCC 3629.298255 3 0.0010 1044 | 1/35 15 h-m-p 0.0003 0.0015 174.1875 CCCC 3628.001295 3 0.0006 1122 | 1/35 16 h-m-p 0.0006 0.0029 76.5892 CCC 3627.325398 2 0.0008 1198 | 1/35 17 h-m-p 0.0014 0.0070 37.4250 YCC 3627.029825 2 0.0010 1273 | 1/35 18 h-m-p 0.0025 0.0207 15.2282 CCC 3626.858996 2 0.0023 1349 | 1/35 19 h-m-p 0.0025 0.0132 14.2280 YC 3626.801357 1 0.0012 1422 | 1/35 20 h-m-p 0.0013 0.0774 13.3099 +CC 3626.598377 1 0.0055 1497 | 1/35 21 h-m-p 0.0025 0.0313 29.1257 +YCC 3625.991188 2 0.0079 1573 | 1/35 22 h-m-p 0.0048 0.0301 48.5375 YC 3625.714516 1 0.0023 1646 | 1/35 23 h-m-p 0.0012 0.0059 22.3066 YCC 3625.681720 2 0.0006 1721 | 1/35 24 h-m-p 0.0028 0.1007 5.1533 CC 3625.659428 1 0.0026 1795 | 1/35 25 h-m-p 0.0039 0.3343 3.3920 +YC 3625.602876 1 0.0116 1869 | 1/35 26 h-m-p 0.0020 0.0348 19.3833 +YCC 3625.087682 2 0.0184 1945 | 1/35 27 h-m-p 0.0008 0.0041 87.2978 +YC 3624.783309 1 0.0024 2019 | 1/35 28 h-m-p 0.0019 0.0097 16.9604 CC 3624.743310 1 0.0017 2093 | 1/35 29 h-m-p 0.0148 0.1087 1.9395 CC 3624.726863 1 0.0049 2167 | 1/35 30 h-m-p 0.0049 0.3711 1.9345 +CC 3624.526030 1 0.0294 2242 | 1/35 31 h-m-p 0.0026 0.0328 22.0458 CCC 3624.199584 2 0.0040 2318 | 1/35 32 h-m-p 0.0116 0.0796 7.5269 YC 3624.151639 1 0.0021 2391 | 1/35 33 h-m-p 0.0069 0.3202 2.3053 YC 3624.064300 1 0.0117 2464 | 1/35 34 h-m-p 0.0022 0.0147 12.4735 ++ 3623.495796 m 0.0147 2536 | 1/35 35 h-m-p -0.0000 -0.0000 38.4551 h-m-p: -8.95318084e-20 -4.47659042e-19 3.84551357e+01 3623.495796 .. | 1/35 36 h-m-p 0.0000 0.0006 37.3571 ++YCCC 3623.234315 3 0.0003 2684 | 1/35 37 h-m-p 0.0001 0.0004 24.2853 ++ 3623.110001 m 0.0004 2756 | 1/35 38 h-m-p 0.0002 0.0072 48.8510 CYC 3623.034584 2 0.0002 2831 | 1/35 39 h-m-p 0.0005 0.0023 18.1101 CYC 3622.997308 2 0.0004 2906 | 1/35 40 h-m-p 0.0007 0.0160 11.0700 YC 3622.951641 1 0.0013 2979 | 1/35 41 h-m-p 0.0009 0.0065 15.6697 YC 3622.928049 1 0.0006 3052 | 1/35 42 h-m-p 0.0011 0.0190 8.2455 CC 3622.903834 1 0.0015 3126 | 1/35 43 h-m-p 0.0005 0.0116 23.6239 CC 3622.874378 1 0.0007 3200 | 1/35 44 h-m-p 0.0005 0.0119 31.1982 YC 3622.805999 1 0.0013 3273 | 1/35 45 h-m-p 0.0010 0.0051 36.2699 CC 3622.750462 1 0.0010 3347 | 1/35 46 h-m-p 0.0006 0.0073 56.8074 YC 3622.639753 1 0.0012 3420 | 1/35 47 h-m-p 0.0013 0.0118 54.0627 CYC 3622.511377 2 0.0016 3495 | 1/35 48 h-m-p 0.0009 0.0047 23.8413 YC 3622.450733 1 0.0018 3568 | 1/35 49 h-m-p 0.0036 0.0180 9.7349 C 3622.440062 0 0.0009 3640 | 1/35 50 h-m-p 0.0018 0.0474 4.6614 CC 3622.429146 1 0.0024 3714 | 1/35 51 h-m-p 0.0023 0.2142 4.9154 YC 3622.411383 1 0.0045 3787 | 1/35 52 h-m-p 0.0009 0.0158 23.9041 YC 3622.368542 1 0.0023 3860 | 1/35 53 h-m-p 0.0024 0.0796 22.6923 YC 3622.303593 1 0.0038 3933 | 1/35 54 h-m-p 0.0076 0.0680 11.4319 CC 3622.285648 1 0.0022 4007 | 1/35 55 h-m-p 0.0090 0.3677 2.7773 CC 3622.280679 1 0.0031 4081 | 1/35 56 h-m-p 0.0044 0.1742 1.9496 CC 3622.274344 1 0.0070 4155 | 1/35 57 h-m-p 0.0025 0.5198 5.4956 +YC 3622.231439 1 0.0177 4229 | 1/35 58 h-m-p 0.0033 0.0167 28.1819 CC 3622.180807 1 0.0041 4303 | 1/35 59 h-m-p 0.0075 0.0377 12.3535 CC 3622.169844 1 0.0021 4377 | 1/35 60 h-m-p 0.0151 0.5894 1.7166 YC 3622.168598 1 0.0020 4450 | 1/35 61 h-m-p 0.0109 0.3254 0.3205 YC 3622.167881 1 0.0083 4523 | 1/35 62 h-m-p 0.0022 0.1798 1.1897 +CC 3622.164213 1 0.0109 4598 | 1/35 63 h-m-p 0.0032 0.1963 4.0869 C 3622.160575 0 0.0031 4670 | 1/35 64 h-m-p 0.0137 0.0893 0.9289 C 3622.159737 0 0.0029 4742 | 1/35 65 h-m-p 0.0096 1.9895 0.2817 C 3622.158370 0 0.0097 4814 | 1/35 66 h-m-p 0.0033 0.0812 0.8153 ++YC 3622.134580 1 0.0409 4889 | 1/35 67 h-m-p 0.0028 0.0142 2.6567 C 3622.130392 0 0.0027 4961 | 1/35 68 h-m-p 0.0278 0.3710 0.2597 -C 3622.130315 0 0.0023 5034 | 1/35 69 h-m-p 0.0196 8.0000 0.0304 Y 3622.130291 0 0.0134 5106 | 1/35 70 h-m-p 0.0160 8.0000 0.1122 +YC 3622.128966 1 0.1416 5180 | 1/35 71 h-m-p 0.0092 0.8730 1.7356 C 3622.128565 0 0.0028 5252 | 1/35 72 h-m-p 0.9928 6.9067 0.0050 C 3622.128473 0 0.9659 5324 | 1/35 73 h-m-p 1.6000 8.0000 0.0003 Y 3622.128473 0 0.9452 5396 | 1/35 74 h-m-p 1.6000 8.0000 0.0000 Y 3622.128473 0 1.0666 5468 | 1/35 75 h-m-p 1.6000 8.0000 0.0000 -------------C 3622.128473 0 0.0000 5553 Out.. lnL = -3622.128473 5554 lfun, 22216 eigenQcodon, 483198 P(t) Time used: 5:27 Model 7: beta TREE # 1 (1, 5, ((((2, 3), 4), (((((6, 9), 10), ((7, 15), ((12, 14), 13))), 16), 11)), 8)); MP score: 559 1 0.832977 2 0.387666 3 0.300083 4 0.297205 5 0.297085 6 0.297079 7 0.297079 8 0.297078 0.201043 0.105873 0.101845 0.006683 0.042174 0.018087 0.162364 0.169010 0.174748 0.010343 0.023278 0.021549 0.020984 0.000000 0.143890 0.214039 0.232326 0.095290 0.097968 0.126680 0.219766 0.062190 0.009533 0.121053 0.127910 0.131232 0.225050 0.185970 0.177914 2.607062 0.268302 1.517690 ntime & nrate & np: 29 1 32 Bounds (np=32): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 11.768796 np = 32 lnL0 = -3728.810385 Iterating by ming2 Initial: fx= 3728.810385 x= 0.20104 0.10587 0.10184 0.00668 0.04217 0.01809 0.16236 0.16901 0.17475 0.01034 0.02328 0.02155 0.02098 0.00000 0.14389 0.21404 0.23233 0.09529 0.09797 0.12668 0.21977 0.06219 0.00953 0.12105 0.12791 0.13123 0.22505 0.18597 0.17791 2.60706 0.26830 1.51769 1 h-m-p 0.0000 0.0002 437.1048 +++ 3708.298270 m 0.0002 70 | 0/32 2 h-m-p 0.0001 0.0006 423.9805 +YYCCC 3689.145961 4 0.0004 144 | 0/32 3 h-m-p 0.0000 0.0002 365.7995 +YYCC 3685.721776 3 0.0001 216 | 0/32 4 h-m-p 0.0001 0.0003 191.0719 +CC 3682.954727 1 0.0003 286 | 0/32 5 h-m-p 0.0000 0.0001 132.8869 ++ 3681.671796 m 0.0001 353 | 0/32 6 h-m-p 0.0000 0.0002 261.7294 +YCYC 3680.540958 3 0.0001 425 | 0/32 7 h-m-p 0.0001 0.0007 308.8524 YCCC 3678.886346 3 0.0002 497 | 0/32 8 h-m-p 0.0004 0.0018 77.5948 YCCC 3677.814445 3 0.0007 569 | 0/32 9 h-m-p 0.0001 0.0004 166.7206 ++ 3675.952399 m 0.0004 636 | 1/32 10 h-m-p 0.0002 0.0014 306.4930 +CCC 3671.579921 2 0.0008 708 | 1/32 11 h-m-p 0.0004 0.0021 451.7159 +YCYCCC 3659.477317 5 0.0013 783 | 1/32 12 h-m-p 0.0004 0.0018 274.2116 CCCCC 3657.498605 4 0.0004 857 | 1/32 13 h-m-p 0.0006 0.0028 40.9827 CCCC 3657.013973 3 0.0009 929 | 1/32 14 h-m-p 0.0023 0.0117 10.8206 YCC 3656.884242 2 0.0017 998 | 1/32 15 h-m-p 0.0032 0.0324 5.7358 YC 3656.820199 1 0.0026 1065 | 1/32 16 h-m-p 0.0017 0.0672 8.5607 +YC 3656.649726 1 0.0046 1133 | 1/32 17 h-m-p 0.0016 0.0617 25.1557 +YC 3656.168099 1 0.0042 1201 | 1/32 18 h-m-p 0.0028 0.0369 37.7056 YC 3655.853459 1 0.0017 1268 | 1/32 19 h-m-p 0.0048 0.0553 13.8120 YC 3655.705785 1 0.0020 1335 | 1/32 20 h-m-p 0.0042 0.0604 6.5727 CC 3655.528665 1 0.0034 1403 | 1/32 21 h-m-p 0.0026 0.0230 8.7810 YC 3654.911158 1 0.0055 1470 | 1/32 22 h-m-p 0.0015 0.0078 32.4889 +YYCC 3652.226198 3 0.0051 1541 | 1/32 23 h-m-p 0.0005 0.0024 56.4993 +YC 3650.438836 1 0.0021 1609 | 1/32 24 h-m-p 0.0028 0.0138 19.8055 YC 3650.193006 1 0.0015 1676 | 0/32 25 h-m-p 0.0017 0.0083 12.2421 CCC 3650.175053 2 0.0003 1746 | 0/32 26 h-m-p 0.0003 0.0017 8.2398 +YC 3650.153353 1 0.0009 1815 | 0/32 27 h-m-p 0.0022 0.0111 1.8425 C 3650.146081 0 0.0023 1882 | 0/32 28 h-m-p 0.0078 0.4946 0.5374 +CC 3650.005691 1 0.0400 1952 | 0/32 29 h-m-p 0.0010 0.0051 4.1695 ++ 3649.501589 m 0.0051 2019 | 1/32 30 h-m-p 0.0019 0.0194 11.0078 CC 3649.392851 1 0.0016 2088 | 1/32 31 h-m-p 0.0074 0.1035 2.3587 CC 3649.383942 1 0.0024 2156 | 1/32 32 h-m-p 0.0193 0.5654 0.2939 +YC 3649.305314 1 0.0616 2224 | 0/32 33 h-m-p 0.0037 0.0237 4.8519 YC 3649.023368 1 0.0085 2291 | 0/32 34 h-m-p 0.0075 0.0374 3.3277 C 3649.011427 0 0.0019 2358 | 0/32 35 h-m-p 0.0002 0.0009 1.8992 YC 3649.010827 1 0.0003 2426 | 0/32 36 h-m-p 0.0020 1.0090 0.3275 ++YC 3648.993781 1 0.0255 2496 | 0/32 37 h-m-p 0.0112 0.0562 0.6622 +CC 3648.726405 1 0.0401 2566 | 0/32 38 h-m-p 0.0020 0.0101 2.4009 CC 3648.721316 1 0.0017 2635 | 0/32 39 h-m-p 0.1344 0.6720 0.0118 ++ 3648.632586 m 0.6720 2702 | 1/32 40 h-m-p 0.8712 6.2895 0.0091 YC 3648.578418 1 1.3927 2770 | 0/32 41 h-m-p 0.0155 0.5450 0.8161 --C 3648.578344 0 0.0002 2838 | 0/32 42 h-m-p 0.0669 8.0000 0.0027 ++CC 3648.568868 1 1.6710 2909 | 0/32 43 h-m-p 1.6000 8.0000 0.0014 C 3648.567771 0 1.6467 2976 | 0/32 44 h-m-p 1.6000 8.0000 0.0003 C 3648.567582 0 1.9964 3043 | 0/32 45 h-m-p 1.6000 8.0000 0.0003 C 3648.567504 0 2.4777 3110 | 0/32 46 h-m-p 1.6000 8.0000 0.0002 C 3648.567484 0 1.4985 3177 | 0/32 47 h-m-p 1.6000 8.0000 0.0001 C 3648.567481 0 1.7667 3244 | 0/32 48 h-m-p 1.6000 8.0000 0.0001 Y 3648.567479 0 3.0895 3311 | 0/32 49 h-m-p 1.6000 8.0000 0.0000 C 3648.567478 0 1.4999 3378 | 0/32 50 h-m-p 1.6000 8.0000 0.0000 C 3648.567478 0 1.8720 3445 | 0/32 51 h-m-p 1.6000 8.0000 0.0000 Y 3648.567478 0 2.7692 3512 | 0/32 52 h-m-p 1.6000 8.0000 0.0000 C 3648.567478 0 1.6000 3579 | 0/32 53 h-m-p 1.6000 8.0000 0.0000 Y 3648.567478 0 1.2636 3646 | 0/32 54 h-m-p 1.6000 8.0000 0.0000 ---------------Y 3648.567478 0 0.0000 3728 Out.. lnL = -3648.567478 3729 lfun, 41019 eigenQcodon, 1081410 P(t) Time used: 11:13 Model 8: beta&w>1 TREE # 1 (1, 5, ((((2, 3), 4), (((((6, 9), 10), ((7, 15), ((12, 14), 13))), 16), 11)), 8)); MP score: 559 1 0.635381 2 0.305808 3 0.300575 4 0.300285 5 0.300273 6 0.300270 7 0.300270 initial w for M8:NSbetaw>1 reset. 0.191838 0.110504 0.100376 0.024390 0.045480 0.014808 0.160053 0.167602 0.170734 0.017883 0.029875 0.022587 0.026001 0.000000 0.144579 0.192302 0.223568 0.096321 0.109060 0.118424 0.216518 0.045713 0.012852 0.128014 0.123299 0.134077 0.216685 0.182853 0.166049 2.359750 0.900000 1.125786 1.102699 2.329271 ntime & nrate & np: 29 2 34 Bounds (np=34): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 5.444040 np = 34 lnL0 = -3653.168368 Iterating by ming2 Initial: fx= 3653.168368 x= 0.19184 0.11050 0.10038 0.02439 0.04548 0.01481 0.16005 0.16760 0.17073 0.01788 0.02987 0.02259 0.02600 0.00000 0.14458 0.19230 0.22357 0.09632 0.10906 0.11842 0.21652 0.04571 0.01285 0.12801 0.12330 0.13408 0.21668 0.18285 0.16605 2.35975 0.90000 1.12579 1.10270 2.32927 1 h-m-p 0.0000 0.0003 239.9585 +++ 3642.751330 m 0.0003 74 | 0/34 2 h-m-p 0.0002 0.0008 188.7586 +YYCCC 3636.663260 4 0.0005 152 | 0/34 3 h-m-p 0.0000 0.0001 198.1498 ++ 3635.695747 m 0.0001 223 | 1/34 4 h-m-p 0.0000 0.0003 275.4345 +CYCCC 3633.453001 4 0.0002 302 | 1/34 5 h-m-p 0.0003 0.0013 98.4164 CCC 3632.485121 2 0.0004 376 | 1/34 6 h-m-p 0.0005 0.0024 43.9364 CCC 3631.968800 2 0.0008 450 | 1/34 7 h-m-p 0.0004 0.0032 89.0593 +YCCC 3630.683594 3 0.0010 526 | 1/34 8 h-m-p 0.0008 0.0040 75.4322 CCCC 3629.511537 3 0.0013 602 | 1/34 9 h-m-p 0.0003 0.0016 133.4598 CCCC 3628.626638 3 0.0006 678 | 1/34 10 h-m-p 0.0002 0.0008 124.9125 YC 3628.168827 1 0.0003 749 | 1/34 11 h-m-p 0.0011 0.0062 38.6432 YC 3627.988723 1 0.0006 820 | 1/34 12 h-m-p 0.0013 0.0121 16.6454 CC 3627.852853 1 0.0013 892 | 1/34 13 h-m-p 0.0011 0.0056 11.6925 CCC 3627.773889 2 0.0012 966 | 1/34 14 h-m-p 0.0005 0.0349 27.1543 +CYC 3627.417349 2 0.0026 1040 | 1/34 15 h-m-p 0.0009 0.0046 60.9800 YCCCC 3626.821439 4 0.0018 1117 | 1/34 16 h-m-p 0.0006 0.0031 159.1078 YC 3625.793749 1 0.0013 1188 | 1/34 17 h-m-p 0.0076 0.0382 20.1316 CC 3625.617063 1 0.0023 1260 | 1/34 18 h-m-p 0.0054 0.0268 7.1138 CCC 3625.483391 2 0.0074 1334 | 1/34 19 h-m-p 0.0019 0.0313 28.0689 +YCCCC 3624.214432 4 0.0169 1412 | 1/34 20 h-m-p 0.0007 0.0033 116.8254 YCCC 3623.704783 3 0.0017 1487 | 1/34 21 h-m-p 0.0010 0.0052 8.4656 YC 3623.662884 1 0.0021 1558 | 1/34 22 h-m-p 0.0074 0.3410 2.4462 YC 3623.557592 1 0.0157 1629 | 1/34 23 h-m-p 0.0012 0.0062 11.6594 ++ 3623.240713 m 0.0062 1699 | 1/34 24 h-m-p -0.0000 -0.0000 37.8424 h-m-p: -1.97238124e-19 -9.86190621e-19 3.78423636e+01 3623.240713 .. | 1/34 25 h-m-p 0.0000 0.0006 125.5293 ++CYCC 3622.395499 3 0.0001 1843 | 1/34 26 h-m-p 0.0001 0.0006 42.6045 +YC 3622.089212 1 0.0004 1915 | 1/34 27 h-m-p 0.0005 0.0157 30.0732 CYC 3621.979572 2 0.0004 1988 | 1/34 28 h-m-p 0.0001 0.0005 61.9008 +YC 3621.755017 1 0.0004 2060 | 1/34 29 h-m-p 0.0001 0.0006 27.7465 YC 3621.695536 1 0.0003 2131 | 1/34 30 h-m-p 0.0008 0.0107 10.7763 CCC 3621.665941 2 0.0008 2205 | 1/34 31 h-m-p 0.0009 0.0114 9.3952 CC 3621.648141 1 0.0008 2277 | 1/34 32 h-m-p 0.0010 0.0068 7.3459 YC 3621.639573 1 0.0007 2348 | 1/34 33 h-m-p 0.0013 0.0231 3.6088 YC 3621.635429 1 0.0010 2419 | 1/34 34 h-m-p 0.0009 0.0200 4.3187 C 3621.632292 0 0.0009 2489 | 1/34 35 h-m-p 0.0016 0.0572 2.2262 YC 3621.630915 1 0.0010 2560 | 1/34 36 h-m-p 0.0006 0.0528 3.5828 YC 3621.628846 1 0.0012 2631 | 1/34 37 h-m-p 0.0034 0.0521 1.2279 YC 3621.627959 1 0.0021 2702 | 1/34 38 h-m-p 0.0013 0.1788 2.0013 +YC 3621.625884 1 0.0036 2774 | 1/34 39 h-m-p 0.0012 0.0138 5.7719 CC 3621.623422 1 0.0016 2846 | 1/34 40 h-m-p 0.0015 0.2446 6.1582 YC 3621.617998 1 0.0033 2917 | 1/34 41 h-m-p 0.0075 0.0413 2.7378 C 3621.616548 0 0.0022 2987 | 1/34 42 h-m-p 0.0084 0.8160 0.7203 CC 3621.616153 1 0.0031 3059 | 1/34 43 h-m-p 0.0025 0.7869 0.9035 +YC 3621.613276 1 0.0216 3131 | 1/34 44 h-m-p 0.0021 0.0447 9.1624 +YC 3621.605918 1 0.0055 3203 | 1/34 45 h-m-p 0.0092 0.4194 5.4848 C 3621.604107 0 0.0023 3273 | 1/34 46 h-m-p 0.0307 0.9867 0.4141 -C 3621.604026 0 0.0018 3344 | 1/34 47 h-m-p 0.0065 0.7917 0.1175 C 3621.603977 0 0.0069 3414 | 1/34 48 h-m-p 0.0038 1.9156 0.3413 YC 3621.603803 1 0.0088 3485 | 1/34 49 h-m-p 0.0039 0.8692 0.7622 C 3621.603642 0 0.0037 3555 | 1/34 50 h-m-p 0.0137 0.4243 0.2061 Y 3621.603615 0 0.0024 3625 | 1/34 51 h-m-p 0.0160 8.0000 0.0384 Y 3621.603587 0 0.0081 3695 | 1/34 52 h-m-p 0.0104 0.9229 0.0299 ++YC 3621.602038 1 0.1098 3768 | 1/34 53 h-m-p 0.0057 0.0682 0.5798 YC 3621.601445 1 0.0031 3839 | 1/34 54 h-m-p 0.0151 0.9005 0.1198 Y 3621.601430 0 0.0021 3909 | 1/34 55 h-m-p 0.0132 5.7640 0.0190 C 3621.601429 0 0.0031 3979 | 1/34 56 h-m-p 0.0160 8.0000 0.0054 Y 3621.601420 0 0.0351 4049 | 1/34 57 h-m-p 0.0119 5.9748 0.0211 +YC 3621.601289 1 0.0303 4121 | 1/34 58 h-m-p 0.0155 7.7587 0.0720 Y 3621.601282 0 0.0028 4191 | 1/34 59 h-m-p 0.0614 8.0000 0.0033 -C 3621.601281 0 0.0035 4262 | 1/34 60 h-m-p 0.0503 8.0000 0.0002 ++C 3621.601279 0 0.6892 4334 | 1/34 61 h-m-p 1.6000 8.0000 0.0000 Y 3621.601279 0 0.9808 4404 | 1/34 62 h-m-p 1.6000 8.0000 0.0000 C 3621.601279 0 1.6689 4474 | 1/34 63 h-m-p 1.6000 8.0000 0.0000 C 3621.601279 0 1.2913 4544 | 1/34 64 h-m-p 1.6000 8.0000 0.0000 -Y 3621.601279 0 0.1000 4615 Out.. lnL = -3621.601279 4616 lfun, 55392 eigenQcodon, 1472504 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal probability of data. log(fX) = -3630.515691 S = -3434.448210 -188.510677 Calculating f(w|X), posterior probabilities of site classes. did 10 / 169 patterns 19:04 did 20 / 169 patterns 19:04 did 30 / 169 patterns 19:04 did 40 / 169 patterns 19:05 did 50 / 169 patterns 19:05 did 60 / 169 patterns 19:05 did 70 / 169 patterns 19:05 did 80 / 169 patterns 19:05 did 90 / 169 patterns 19:05 did 100 / 169 patterns 19:06 did 110 / 169 patterns 19:06 did 120 / 169 patterns 19:06 did 130 / 169 patterns 19:06 did 140 / 169 patterns 19:06 did 150 / 169 patterns 19:06 did 160 / 169 patterns 19:06 did 169 / 169 patterns 19:07 Time used: 19:07 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=99, Nseq=16, Len=612 S5_SFBB1 -----------------------------KCIRKSWCTLINTPSFVAKHL S5_SFBB10 -------------------------------------------------- S5_SFBB11 ------------------------SLMRFKCIHKSWFSLINSLSFVAKHL S5_SFBB12 -----------------------------KCIRKSWCTLINSPSFVAKHL S5_SFBB13 MFEVRESKTPEDMVVEIMSKLPPKSLMRFKCIRKSWCTLINSPSFVAKHL S5_SFBB14 -----------------------KSLMRFKCTRKSWCTLINSSSFVAKHL S5_SFBB16 -----ESEAPEDRVVEILSRLPPKSLMRFKCIRKSWYTLINSPRFVAKHL S5_SFBB17 MFEVRESKTPEDMVVEIMSKLPPKSLMRFKCIRKSWCTLINSPSFVAKHL S5_SFBB18 -------------------------------------------------- S5_SFBB3 -----------------------------KCIRKSWCTLIISTSFVAKHL S5_SFBB4 MSQVRETETPEDRVVAIMSKLPPKSLMRFKCIRKSWCTLINNPSFVAKHL S5_SFBB5 -------ETPEDQVVEILSRLPPKSLMRFKCIRKSWCTIINSSSFVAKHL S5_SFBB6 MSQVHESETPEDKVVEILSRLSPKSLMRFKCVHKSWCTIINSPSFVAKHL S5_SFBB7 -------------------------------------------------- S5_SFBB8 MSQVRECETPEDRMVEILSRLPPKSLMRFKCIRKSWCTLFNSPCFVAKHL S5_SSFBB2 -----------------------KSLMRFKCIRKSWCTVINNPSFIAKHL S5_SFBB1 NNSMNNKLSSSTCILLNRCQNHVFPDRSWKPEVFWSIINLSIDSDDHNLH S5_SFBB10 -------------------------------------------------- S5_SFBB11 SNSVDNKLSSSACILLNRSQPHIFPDQSWKQEVFWCVINFSIDSDENNLH S5_SFBB12 NNSMDNELSSSTCILLNRSQAHIFPDQSWKQEVFWsTINLSIDSDEHNLH S5_SFBB13 NNSVDNKLSSSTCILLNRSQAHVFPDNSWKPEVFWSMINLSIDSNEHNLH S5_SFBB14 SNSVDNILSSSTCILLNRSQMPVFPDKSWKYEILWSMIYLSIYSDEHSYH S5_SFBB16 NNSVDNKLSSSTCILLHRSQMPIFPYDSWKREFFWSMINFSIDSDESNLH S5_SFBB17 NNSVDNKLSSSTCILLNRSQTHVFPDNSWKQEVFWSMINISIDSDEHNLH S5_SFBB18 --------------LLNRSEMPVFPDDSWKYEVLWSMINLSIDSDDHnLH S5_SFBB3 SNSLDYKHSSSTCILLNRSQFHIFPDQSWKREVLWSMINLSSDSDVHNLH S5_SFBB4 SNSVVNNFSSYTCILLNRSQVHVFPDKSWKHEVLWSMINFFNDRVSRTLY S5_SFBB5 SNSIDNKLSSSTCILLNRCQVHVFPDRNWKQDVFWSMINLSIDGDKNNLH S5_SFBB6 SNTVDNKFSSCTRILFNRCQVHVFPDRSWKRDVFWSMINLSIDSDEHNLR S5_SFBB7 -----SKLSSTACILLNRCQVHVFPDRsWKQDVFWSMINLSIDSDEHNLH S5_SFBB8 SDSVDNKLSSSTCILLNCSQAHVCSEESWKQGVLWSVINLSIDGDE--LH S5_SSFBB2 SNSVDNKFSSSTCILLHRSQMPVFPDRSWKREYFWSMINLSHDSDEHNLY S5_SFBB1 YDAEDL-NIPCPL-EGHDFVEIGGYCNGIVCVLAWKTLHWIYVILCNPAT S5_SFBB10 -------------------------CNGIVCVIAGN-----NFLLCNPAT S5_SFBB11 YDVEDL-TIPFPL-KDHDFVLIFGYCNGIVCVEAGK-----NVLLCNPAT S5_SFBB12 YDVEDL-IIPFPL-EDHDFVLIFGYCNGIICVDAGK-----NVLLCNPAT S5_SFBB13 YDVENL-NIPFPL-EGHDFVEIDGYCHGIVCVIAGKNLHLINIILCNPAT S5_SFBB14 YDVEDL-NIPFPL-EDHHPVQIHGYCNGIVCVIAGKT----VIILCNPGT S5_SFBB16 YDVEDLTNVPLLQWEDHHEVEIHGYCNGIVCVTVGE-----YFFLCNPAT S5_SFBB17 YDVEDL-NIPFPL-EDQDYVLILGYCNGIVCVSAGK-----NILLCNPTT S5_SFBB18 YNVEDL-NIPFPM-EYHHPVLIHGYCDGIFCVITGE-----NVVLCNPAI S5_SFBB3 YDVKPL-NIPFSR-DDHNPVQIHGYCNGIVCLIEGD-----NVLLCNPST S5_SFBB4 YNVEDL-NIPFPR-DDHEHILIHGYCNGIVCVISGK-----NILLCNPAT S5_SFBB5 YDVEDL-NIPFPM-EDQDNVELHGYCNGIVCVIVGK-----NVLLCNPAT S5_SFBB6 YDVEDR-NIPFPI-EVQDNVQLYGYCNGIVCVIVGE-----NVLLCNPAT S5_SFBB7 YDVEDL-NIPFPM-EDQDNMELHGYCNGIACVIVGK-----NVLLCNPAT S5_SFBB8 YGIEDLTNVPFLR-DDHHELEIHGYCDGIICVTVNE-----NFFLCNPAT S5_SSFBB2 YDVEDL-NIQFPL-EDHDNVSIHGYCNGIVCLIVGK-----NAVLYNPAT *.** *: . .* ** S5_SFBB1 GEFRQLPHSCLLQPSRS-RRKFELNTISTLLGFGYDCKAKEYKVVQVIEN S5_SFBB10 REFMQLPDSCLLLP-PA-EGKFELDTTFEALGFGYDCKGKEYKVVQIIEN S5_SFBB11 KKFRQLPDSCLLLPSPL-EGKFKLETSFQALGFGYDCNAKEYKVVRIIEN S5_SFBB12 REFRQLPNSCLLLPPP--KGKFELETTFQALGFGYDCNAKEYKVVRIIEN S5_SFBB13 GEFRQLPHSCLLLPSRP-KGKFELETIFGALGFGYDCKAKEYKVVQIIEN S5_SFBB14 GEFRQLPDSCLLVPLP--KEKFQLETIFGGLGFGYDCKAKEYKVVQIIEN S5_SFBB16 GEFSQLPNSRLLLPLPRGKGKFGLETTVKGLGFGYDCKAKEYKVVRIIEN S5_SFBB17 REFMRLPSSCLLLPSHP-KGKFELETVFRALGFGYDCKAKEYKVVQIIEN S5_SFBB18 GEFRQLPDSCLLLPAPP-ERKFELETTFRALGFGYDCKAKEYKVVRIIEN S5_SFBB3 REFRLLPNSCLLVPHP--EGKFELETTFHGMGFGYDCKANEYKVVQIVEN S5_SFBB4 REFRQLPDSFLLLPSPL-GGKFELETDFGGLGFGYDCRAKDYKVVRIIEN S5_SFBB5 EEFRQLPDSSLLLPLP--KGRFGLETVFKGLGFGYDCKAKEYKVVRIIEN S5_SFBB6 REFKQLPDSSLLLPLP--TGKFGLETLFKGLGFGYDCKTKEYKVVRIIEN S5_SFBB7 GEFRQLPNSSLLLPLP--KGRFGLETTFKGMGFGYDCKTKEYKVVRIIEN S5_SFBB8 GEFRQLPDSCLLLPLPGVKEKFGLETTLKGLGFGYDCKAKEYKVVRIIDN S5_SSFBB2 RELKQLPDSCLLLPSLP-EGKFELESTFQGMGFGYDSKAKEYKVVKIIEN :: ** * ** * :* *:: :*****.. ::****::::* S5_SFBB1 --CEYSDAEQYDYHRIALPHTAEVYTTTANSWREIKIDISSET-----YC S5_SFBB10 --CEYSDDEQTFNHCTTLPHTAEVYTTAVNSWKEIKIDISSTT-----YS S5_SFBB11 --CEYSDDERTFYNRIALPHTAELYTTPANSWKEIKIDISSTT-----YS S5_SFBB12 --GEYSDDEQTFHHRIALPHTAEVYTTAANSWKEIKIDISSQT-----YH S5_SFBB13 --CEYSDDEQYYYHRIALPHTAEVYTTAANSWREIKIDISSDT-----YH S5_SFBB14 --CEYSDDERTFYHSIPLPHTAEVYSIAANSWKEIKIDISTKT-----YP S5_SFBB16 YDCEYSDGEETYIEHAALPHTAELYTTTANSWKEIKINISSKILSFYSYP S5_SFBB17 --SEYSDDERTYYHRIPLPHTAEVYTTAANSWREIKIDISTRT-----YS S5_SFBB18 --CEYSDDEQTYNHRISLPYTAEVYTTTGNSWKEINIDVSSKA-----YP S5_SFBB3 --CEYSDDEQTYQHCIAYPYTAEVYTTAANFWKEIKIDISSST-----HP S5_SFBB4 --CEYSDDERTYYHRIPLPHTAEVYTMATNSWKEVKIDISSKT-----YP S5_SFBB5 CDCEYSEGEESYYERILLPHTAEVYTMTTNSWKEIKIDVTSDT-DPYCIP S5_SFBB6 CDCEYSDGKESYIERILLPYTAEVYTTAANSWKEIKIDTSSDT-DPYCIP S5_SFBB7 CDCEYSEDGESYYERILLPHTAEVYTTTANSWKEIKIDISIET-RWYCIP S5_SFBB8 YDCEYSDDGETYIEHIALPHTAEVYTMAANSWKEITIDILSKILSSYSEP S5_SSFBB2 --CEYSDDMRTFSHRIALPHTAEVYVTTTNSWRVIEIEISSDT-----YN ***: . . *:***:* . * *: : *: S5_SFBB1 YTCSVYLNGFCYWIATDEEDFILSFDLGDEIFHRIQLPSRRDSDFKFSNL S5_SFBB10 WSCSVYLKGFCYWYATDDEEYVLSFDLCNETFHRIQFPSRGESGFTFFYI S5_SFBB11 CSRSVFMKGFCYWYATDGEEYILSFDLGDDTFHIIQLPSRREFGFRFYYI S5_SFBB12 CSCSVYLKGFCYWFASDSEEYILSFYLGDETFHIIQLPSRRESGFTFDYI S5_SFBB13 YSFSVYLKGFCYWFATDGEKYILSFDIGDEIFHRIQLPSRKESDFEFLNI S5_SFBB14 SSCSVYLKGFCYWFASDGEEYILSFDLGDEIFHRIQLPSRRESSFKFYDL S5_SFBB16 YSCSVYLKGFCYWLSSDDEEYICSFDLGEEIFDRIELPSRRESGFKLDGI S5_SFBB17 CSCQVYLKGFCYWYATDAEEYILSFDLGDEIFHRIQLPSRRESGFKFYYI S5_SFBB18 CSCSVYLKGFCYWFATDGEEYILSFDLGDEIFSRIQLPARKESGFKFYSL S5_SFBB3 YPYSVYLKGFCYWFATDGEECILSFDLGDEIFHRIQLPSKIESGFNFCGL S5_SFBB4 CSCSVYLKGFCYWFTRDGEEFILSFDLGDERFHRIQLPSRRESSFEFYYI S5_SFBB5 YSCSVYLKGFCYWFAMDNGEYIFSFDLGDEIFHIIELPSRRDFGFKFYGI S5_SFBB6 YSCSMYLKGFCYWFANDNGEYIFSFDLGDEIFHRIELPFRRESDFKFCGL S5_SFBB7 YSCSVYLKGFCYWFAYDNGEYVFSFDLGDEIFNRIELPSRRESDFKFYGI S5_SFBB8 YSYSVYLKGFCYWLSCDVEEYIFSFDLANEISDMIELPFRGEFGFKRDGI S5_SSFBB2 CSCSVYLKEFCYWFASDGEEYILSFDLGDEIFHRIQLPYRKESGFLFYDL . .:::: **** : * . : ** : :: *::* : : .* : S5_SFBB1 FLCNKSIASFGYCCNPSDEDSTLyo----ooooooooooooooooooooo S5_SFBB10 FLRNESLASFCSRYDRSG-DSQSCEI---WVMDDYDRVKSSWTKLITVGP S5_SFBB11 FLRNESLASFCSRYERSE-DSESCEI---WVMDDYDRVKSSWTKLLTIGP S5_SFBB12 FLRDESLASFCSPYSPSE-DSKLFEI---WVMDDFDGVKSSWTKLLTVGP S5_SFBB13 FLCNTSIASFCSCCDPSDADSTLCEI---WVMDDYDGIKSSWTKLLTFGP S5_SFBB14 FLYNESITSYCSHYDPSE-ooooooo---ooooooooooooooooooooo S5_SFBB16 FLYNESITYYCTSYEE---SSRLFEI---WVMDICDGVNSSWTKHLTAGP S5_SFBB17 FLRNESLASFCSRYDRSD-KSESCoo---ooooooooooooooooooooo S5_SFBB18 FLYNESVTSYCSHYDPSE-DSKLFEI---WVMDooooooooooooooooo S5_SFBB3 FLYNESITSYCCRYDPSE-DSKLFEI---WVMDGYGGVKNSWTKLLoooo S5_SFBB4 FLCNESIASFCSLYDRSE-DSKSCEI---WVMDDYDGVKSSWTKLLVAGP S5_SFBB5 FLYNESITSYCSRYEE---DCKLFEI---WVMDDYDGVKSSWTKLLTIGP S5_SFBB6 FLYNESVASYCSCYEE---DCKLVEI---WVMDDYDGVKSSWTKLLTVGP S5_SFBB7 FLYNESVTSYCYRHEE---DCELFEI---WVMDGYDGVKSSWTKLQTIGP S5_SFBB8 FLYNESLTYYCTSYEE---PSTLFoo---ooooooooooooooooooooo S5_SSFBB2 FLYNESIASFCSHYDKSD-NSGILEILEIWVMDooooooooooooooooo ** : *:: : . S5_SFBB1 ooooooooooooooooooooooooooooooooooooooooo--------- S5_SFBB10 LQGIEKPLTFWKNDELLMLASDGRATSYNSSTRNLKYVHIPooooooooo S5_SFBB11 LQGIKKPLTFWKSDEVLMLDSDGRATSYNSNTRNLKYLHIP--------- S5_SFBB12 FKGIEYPLTLWKCDELLMLASDGRATSYNSSTGNLKYLHIP--------- S5_SFBB13 LKGIENPFTLWKTDELLMVASGGRVTSYNSSTENLNYLHIP--------- S5_SFBB14 ooooooooooooooooooooooooooooooooooooooooo--------- S5_SFBB16 FKGIEFPLTLWKHDELLMIASDGRATSYNSSTGNLKYLYIP--------- S5_SFBB17 ooooooooooooooooooooooooooooooooooooooooo--------- S5_SFBB18 ooooooooooooooooooooooooooooooooooooooooo--------- S5_SFBB3 ooooooooooooooooooooooooooooooooooooooooo--------- S5_SFBB4 FKGIEKPLTLWKCDELLMIDTDGRVISYNSGIGYLTYLHIP--------- S5_SFBB5 FKDIDYPLTLGKCDEVLMLGSYGRAAFCNSSTGNLKYLHIP--------- S5_SFBB6 FKDIESPLTFWKCDEVLILSSYGKATSYNSSoooooooooo--------- S5_SFBB7 LKDIDYPLTLWKCDEILMLGSYGRAASCNSSTGNLKYLHIP--------- S5_SFBB8 ooooooooooooooooooooooooooooooooooooooooo--------- S5_SSFBB2 ooooooooooooooooooooooooooooooooooooooooo--------- S5_SFBB1 -------------------------------------------------- S5_SFBB10 oooooooooooooooooooooooooooooooooooooooooooooooooo S5_SFBB11 -------------------------------------------------- S5_SFBB12 -------------------------------------------------- S5_SFBB13 -------------------------------------------------- S5_SFBB14 -------------------------------------------------- S5_SFBB16 -------------------------------------------------- S5_SFBB17 -------------------------------------------------- S5_SFBB18 -------------------------------------------------- S5_SFBB3 -------------------------------------------------- S5_SFBB4 -------------------------------------------------- S5_SFBB5 -------------------------------------------------- S5_SFBB6 -------------------------------------------------- S5_SFBB7 -------------------------------------------------- S5_SFBB8 -------------------------------------------------- S5_SSFBB2 -------------------------------------------------- S5_SFBB1 -------------------------------------------------- S5_SFBB10 oooooooooooooooooooooooooooooooooooooooooooooooooo S5_SFBB11 -------------------------------------------------- S5_SFBB12 -------------------------------------------------- S5_SFBB13 -------------------------------------------------- S5_SFBB14 -------------------------------------------------- S5_SFBB16 -------------------------------------------------- S5_SFBB17 -------------------------------------------------- S5_SFBB18 -------------------------------------------------- S5_SFBB3 -------------------------------------------------- S5_SFBB4 -------------------------------------------------- S5_SFBB5 -------------------------------------------------- S5_SFBB6 -------------------------------------------------- S5_SFBB7 -------------------------------------------------- S5_SFBB8 -------------------------------------------------- S5_SSFBB2 -------------------------------------------------- S5_SFBB1 -------------ooo--oooooooooooooooooooooooooooooooo S5_SFBB10 oooooooooooooooooooooooooooooooooooooooooooooooo-- S5_SFBB11 -------------PIL--KRVVDFEVLIYVKSoooooooooooooooooo S5_SFBB12 -------------PIL--NKVVDFEooooooooooooooooooooooooo S5_SFBB13 -------------PIL--NEVRDFQALIYMESIVPVKooooo-------- S5_SFBB14 -------------ooo--oooooooooooooooooooooooooooooooo S5_SFBB16 -------------IIIYRNRVID-----YAKSIVPVKRVEGKVPFSPI-- S5_SFBB17 -------------ooo--oooooooooooooooooooooooooooooo-- S5_SFBB18 -------------ooo--oooooooooooooooooooooooooooooooo S5_SFBB3 -------------ooo--oooooooooooooooooooooooooooooooo S5_SFBB4 -------------PII--NRVIDSQALIYVESIVPVKooooooooooo-- S5_SFBB5 -------------PII--NEVIDFEVLSYVESIVPIKooooooooooooo S5_SFBB6 ------------------oooooooooooooooooooooooooooooo-- S5_SFBB7 -------------PII--NWMID-----YVKSIVPVKooooooooooooo S5_SFBB8 -------------ooo--ooooooooooooooooooooooooo------- S5_SSFBB2 -------------ooo--oooooooooooooooooooooooooooooooo S5_SFBB1 oooooooooooooooooooooo---------------------------- S5_SFBB10 -------------------------------------------------- S5_SFBB11 oooooooooooooooooooooo---------------------------- S5_SFBB12 oooooooooooooooooooooooooooo---------------------- S5_SFBB13 -------------------------------------------------- S5_SFBB14 ooooooooooooooooooooo----------------------------- S5_SFBB16 -------------------------------------------------- S5_SFBB17 -------------------------------------------------- S5_SFBB18 oooooooooooooooooooooooooooooooooooooooooooooooooo S5_SFBB3 oooooooooooooooooooooooooooo---------------------- S5_SFBB4 -------------------------------------------------- S5_SFBB5 oo------------------------------------------------ S5_SFBB6 -------------------------------------------------- S5_SFBB7 oooooooooooooooooooooooooooooooooooooooooooooooooo S5_SFBB8 -------------------------------------------------- S5_SSFBB2 oooooooooooooooooo-------------------------------- S5_SFBB1 ------------ S5_SFBB10 ------------ S5_SFBB11 ------------ S5_SFBB12 ------------ S5_SFBB13 ------------ S5_SFBB14 ------------ S5_SFBB16 ------------ S5_SFBB17 ------------ S5_SFBB18 oooooooooooo S5_SFBB3 ------------ S5_SFBB4 ------------ S5_SFBB5 ------------ S5_SFBB6 ------------ S5_SFBB7 ooooo------- S5_SFBB8 ------------ S5_SSFBB2 ------------
>S5_SFBB1 -------------------------------------------------- -------------------------------------AAATGCATACGCA AGTCTTGGTGCACTCTCATCAATACTCCAAGTTTTGTTGCCAAACACCTC AACAATTCTATGAACAACAAACTATCgTCCTCCACTTGCATCCTTCTCAA CCGTTGTCAGAATCATGTTTTCCCGGATAGAAGTTGGAAACCAGAAGTTT TCTGGTCCATAATTAATCTTTCCATTGATAGCGATGATCACAACCTTCAT TATGATGCTGAGGACCTC---AATATACCGTGTCCATTG---GAAGGTCA TGATTTTGTAGAGATTGGTGGCTATTGCAATGGGATTGTCTGTGTACTAG CATGGAAAACTCTTCATTGGATATATGTTATTTTATGCAATCCTGCAACT GGGGAATTTAGGCAACTTCCCCATTCATGCCTTCTTCAACCTTCCCGTTC T---AGGAGAAAATTTGAATTGAACACGATCTCTACATTATTGGGATTTG GTTATGATTGCAAAGCTAAAGAATACAAGGTCGTGCAAGTTATTGAAAAT ------TGTGAGTATTCAGATGCTGAGCAATATGATTATCATCGTATTGC TCTTCCTCACACGGCTGAGGTATATACCACGACTGCTAACTCTTGGAGAG AGATCAAGATTGATATATCAAGTGAAACC---------------TATTGT TATACTTGTTCAGTGTACTTGAATGGATTTTGTTATTGGATTGCAACCGA TGAAGAAGATTTCATACTTTCATTTGATTTAGGTGATGAGATATTTCATA GAATACAATTGCCTTCTAGGAGAGACTCTGATTTTAAGTTTTCTAATCTC TTTCTGTGTAATAAATCGATTGCTTCTTTTGGTTATTGTTGCAATCCAAG TGATGAGGATTCTACATTatat---------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------ >S5_SFBB10 -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------TGCAATGGGATTGTATGTGTAATAG CAGGGAAC---------------AATTTTCTTTTATGCAATCCTGCAACG AGGGAATTCATGCAACTTCCCGATTCATGCCTTCTTCTACCC---CCTGC T---GAGGGAAAATTCGAATTGGATACAACCTTTGAAGCATTGGGATTTG GCTATGATTGCAAAGGCAAAGAATACAAGGTAGTGCAAATTATAGAAAAT ------TGTGAGTATTCAGATGATGAGCAAACATTTAATCATTGTACTAC TCTTCCTCACACGGCTGAGGTATACACCACGGCTGTTAACTCTTGGAAAG AGATCAAGATTGATATATCAAGTACAACC---------------TATTCT TGGTCTTGTTCAGTGTACTTGAAGGGATTTTGTTACTGGTATGCAACAGA TGACGAGGAATACGTACTTTCATTTGATTTATGTAATGAGACATTTCATA GAATACAATTCCCTTCTAGAGGAGAATCTGGCTTTACGTTTTTTTATATT TTTCTTCGTAATGAATCCCTCGCTTCTTTTTGCTCTCGTTACGATCGAAG TGGG---GATTCTCAATCGTGTGAAATA---------TGGGTAATGGACG ACTATGACAGAGTGAAGAGTTCATGGACAAAACTCATAACCGTTGGACCC TTACAAGGCATTGAGAAGCCATTGACATTTTGGAAAAATGACGAGCTTCT TATGCTTGCTTCCGATGGAAGAGCCACCTCTTATAATTCTAGTACTAGAA ATCTGAAGTATGTTCATATTCCT--------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------ >S5_SFBB11 -------------------------------------------------- ----------------------TCTCTGATGCGGTTCAAATGCATACACA AGTCTTGGTTCTCTCTCATCAATAGTCTAAGTTTTGTGGCCAAACACCTC AGCAATTCCGTGGACAACAAACTCTCATCCTCCGCTTGTATCCTTCTCAA CCGTTCTCAGCCTCACATTTTCCCAGACCAGAGTTGGAAACAAGAAGTTT TCTGGTGCGTGATTAATTTTTCCATTGATAGTGATGAGAACAACCTTCAT TATGATGTTGAGGACCTA---ACTATACCGTTTCCATTG---AAAGATCA TGACTTTGTACTGATTTTTGGTTATTGCAATGGGATTGTCTGTGTAGAAG CAGGGAAA---------------AATGTTCTTTTATGCAATCCTGCAACG AAGAAATTCAGGCAACTTCCCGATTCATGTCTTCTTCTACCTTCCCCTCT T---GAGGGAAAATTCAAATTGGAAACGAGCTTTCAAGCATTGGGATTCG GCTATGATTGCAATGCTAAAGAATACAAGGTTGTGCGAATTATAGAAAAT ------TGTGAGTATTCAGATGATGAACGAACGTTTTACAATCGTATTGC TCTTCCTCACACGGCTGAGTTATACACCACACCTGCTAACTCTTGGAAAG AAATCAAGATTGATATATCAAGTACAACC---------------TATTCT TGTTCTCGTTCAGTGTTCATGAAGGGATTTTGTTATTGGTATGCAACGGA TGGCGAGGAATACATACTTTCTTTTGATTTAGGTGATGACACATTTCATA TAATACAACTGCCTTCTAGGAGAGAATTCGGTTTCAGGTTTTATTATATT TTTCTGCGAAATGAATCCCTTGCTTCTTTTTGCTCTCGTTACGAACGGAG TGAG---GATTCTGAATCATGTGAAATA---------TGGGTAATGGACG ACTATGACAGAGTGAAAAGTTCATGGACAAAACTCTTAACCATTGGACCC TTACAAGGCATTAAGAAGCCATTGACATTTTGGAAAAGTGACGAGGTTCT TATGCTTGACTCTGATGGAAGAGCCACCTCTTATAATTCTAATACCAGAA ATCTCAAGTATCTTCATATTCCT--------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ---------------------------------------CCTATTCTC-- ----AAGAGGGTTGTAGATTTCGAAGTTCTTATTTATGTGAAAAGT---- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------ >S5_SFBB12 -------------------------------------------------- -------------------------------------AAATGCATACGCA AGTCTTGGTGCACTCTCATCAATAGTCCAAGTTTTGTAGCCAAACACCTC AACAATTCTAtGGACAACGAACTCTCATCCTCCACTTGTATCCTTCTCAA CCGTTCTCAGGCTCACATTTTCCCAGACCAGAGTTGGAAACAAGAAGTTT TCTGGtCCACGATTAATCTTTCTATTGATAGTGATGAGCATAACCTTCAT TATGATGTTGAGGACCTA---ATTATACCGTTTCCATTG---GAAGATCA TGATTTTGTACTGATTTTTGGTTATTGCAATGGGATTATCTGTGTAGATG CAGGGAAA---------------AATGTTCTTTTATGCAATCCTGCAACA AGAGAATTTAGGCAACTTCCCAATTCATGCCTTCTTCTACCCCCTCCC-- ----AAGGGAAAATTCGAGTTGGAAACGACCTTTCAAGCATTGGGATTTG GCTATGACTGCAATGCTAAAGAATACAAGGTTGTGCGAATTATAGAAAAT ------GGTGAGTATTCAGATGATGAGCAAACATTTCATCATCGTATTGC TCTTCCTCACACAGCTGAGGTATACACAACGGCTGCTAACTCTTGGAAAG AGATCAAGATTGATATATCAAGTCAAACT---------------TATCAT TGTTCTTGTTCAGTGTACTTGAAGGGATTTTGTTATTGGTTTGCAAGCGA TAGCGAGGAATACATACTTTCATTTTATTTAGGTGATGAGACGTTTCATA TTATACAATTGCCTTCTAGGAGAGAATCCGGTTTTACATTTGATTATATT TTTCTCCGAGATGAATCCCTTGCTTCTTTTTGCTCTCCCTACAGTCCAAG TGAG---GATTCTAAATTATTTGAAATA---------TGGGTAATGGATG ACTTTGATGGAGTTAAGAGTTCATGGACAAAACTCCTAACCGTTGGACCC TTTAAAGGCATCGAGTATCCATTGACACTTTGGAAATGCGACGAGCTTCT TATGCTTGCGTCCGATGGAAGAGCCACCTCTTATAATTCTAGTACCGGAA ATCTCAAATATCTTCATATTCCT--------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ---------------------------------------CCTATTCTC-- ----AATAAGGTTGTAGATTTTGAA------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------ >S5_SFBB13 ATGTTCGAGGTGCGTGAAAGTAAAACTCCTGAAGATATGGTGGTTGAAAT CATGTCTAAGTTGCCGCCCAAGTCTCTAATGCGATTCAAATGCATACGCA AGTCTTGGTGCACTCTCATCAATAGTCCAAGTTTTGTGGCCAAACACCTC AACAATTCCGTGGATAACAAACTATCATCTTCCACTTGCATCCTTCTCAA CCGTTCTCAGGCTCATGTTTTCCCAGATAACAGTTGGAAACCAGAAGTTT TCTGGTCCATGATTAATCTTTCCATCGATAGTAACGAGCACAACCTTCAT TATGACGTTGAGAACCTA---AATATACCGTTTCCATTG---GAAGGTCA TGATTTTGTAGAAATTGATGGCTATTGCCATGGGATTGTCTGTGTAATAG CAGGGAAAAATCTTCATTTGATAAATATTATTTTATGCAATCCTGCAACG GGGGAATTCAGGCAACTTCCCCATTCATGCCTTCTTTTACCTTCCCGTCC T---AAGGGAAAATTCGAATTGGAGACGATCTTCGGAGCATTGGGATTTG GTTATGATTGCAAAGCTAAAGAATACAAGGTTGTGCAAATTATAGAAAAT ------TGTGAGTATTCAGATGATGAGCAATACTACTATCATCGTATTGC TCTTCCTCACACGGCTGAGGTATATACCACGGCTGCTAACTCTTGGAGGG AGATCAAGATTGATATATCAAGTGATACC---------------TATCAT TATTCTTTTTCAGTGTACTTGAAGGGATTTTGTTATTGGTTTGCAACCGA TGGCGAGAAATACATACTTTCATTTGATATAGGTGATGAGATATTTCATA GAATACAATTGCCTTCTAGGAAAGAATCCGATTTTGAGTTTTTAAATATT TTTCTATGTAATACATCGATTGCTTCTTTTTGCTCTTGTTGCGACCCAAG TGATGCGGATTCTACATTATGTGAAATA---------TGGGTAATGGATG ATTATGATGGAATTAAGAGTTCATGGACAAAACTCCTAACCTTTGGACCC TTAAAAGGCATTGAGAATCCATTTACATTATGGAAAACTGATGAGCTTCT TATGGTTGCCTCCGGTGGAAGAGTCACCTCATATAATTCCAGTACCGAAA ATCTCAACTATCTTCATATTCCT--------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ---------------------------------------CCTATCCTC-- ----AATGAAGTTAGAGATTTCCAAGCTCTTATTTACATGGAAAGTATTG TTCCAGTCAAG--------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------ >S5_SFBB14 -------------------------------------------------- -------------------AAGTCCCTGATGCGATTCAAATGCACACGCA AGTCTTGGTGCACTCTCATCAATAGTTCAAGCTTTGTTGCCAAACACCTC AGCAACTCCGTAGACAACATACTCTCATCCTCCACTTGTATCCTGCTCAA CCGTTCTCAGATGCCGGTTTTCCCAGACAAAAGTTGGAAATATGAAATTT TATGGTCCATGATTTATCTTTCCATTTATAGTGATGAGCACAGCTATCAT TATGATGTTGAGGACCTA---AACATACCCTTTCCATTA---GAGGATCA TCATCCTGTACAGATTCACGGTTATTGCAATGGGATTGTCTGTGTAATAG CAGGGAAAACT------------GTTATTATTTTATGCAATCCTGGAACC GGGGAATTCAGGCAACTTCCCGATTCATGCCTTCTTGTACCCCTTCCC-- ----AAGGAAAAATTCCAATTGGAGACGATTTTTGGAGGATTGGGATTTG GTTATGATTGCAAAGCTAAAGAATACAAGGTTGTGCAAATTATAGAAAAT ------TGTGAGTATTCAGATGATGAGCGAACATTTTATCATAGTATTCC TCTTCCTCACACGGCTGAGGTATACTCCATAGCTGCTAACTCTTGGAAGG AGATTAAGATTGATATATCAACTAAAACC---------------TATCCC AGTTCTTGTTCAGTGTACTTGAAGGGATTTTGTTATTGGTTTGCAAGCGA TGGCGAGGAATACATACTTTCATTTGATTTAGGTGATGAGATATTTCATA GAATACAATTGCCTTCTAGGAGAGAATCCAGTTTTAAGTTTTATGATCTT TTTCTGTATAATGAATCCATCACTTCTTATTGCTCTCATTATGATCCAAg TGAG---------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------ >S5_SFBB16 ---------------GAAAGTGAAGCTCCTGAAGATAGGGTGGTCGAAAT CCTGTCCAGGTTGCCGCCCAAGTCTCTGATGCGATTCAAATGCATACGCA AGTCTTGGTACACGCTCATCAATAGTCCTCGTTTTGTGGCCAAACACCTC AACAATTCCGTGGACAACAAACTATCATCCTCCACATGTATCCTTCTCCA CCGTTCTCAGATGCCCATTTTCCCTTACGACAGTTGGAAACGAGAATTTT TCTGGTCCATGATTAATTTTTCCATTGATAGTGATGAGAGCAACCTTCAT TATGATGTTGAGGACCTTACAAATGTACCGTTATTGCAATGGGAAGACCA TCATGAAGTAGAGATTCACGGTTATTGCAATGGGATTGTCTGTGTAACAG TAGGGGAA---------------TATTTTTTTTTGTGCAATCCTGCAACG GGGGAATTCAGTCAACTTCCCAATTCACGCCTTCTTCTACCCCTCCCCAG GGGAAAAGGAAAATTTGGATTGGAAACGACCGTTAAAGGATTGGGATTTG GCTATGATTGTAAAGCTAAAGAATACAAGGTTGTGCGAATTATAGAAAAT TATGATTGTGAGTATTCAGATGGTGAAGAAACATATATTGAACATGCTGC TCTTCCTCACACGGCTGAGTTATACACAACAACTGCTAACTCTTGGAAAG AGATTAAGATAAATATATCAAGTAAAATATTGTCATTTTATAGCTATCCC TATTCATGTTCAGTGTACTTGAAGGGATTTTGTTATTGGTTGTCAAGCGA TGACGAGGAATACATATGTTCATTTGATTTAGGTGAGGAGATATTCGATA GGATAGAATTGCCTTCTAGGAGAGAATCTGGTTTTAAGCTTGATGGTATT TTTCTATATAATGAATCCATCACTTATTATTGCACTAGTTACGAAGAG-- -------AGTTCCAGATTATTTGAAATA---------TGGGTAATGGATA TCTGTGACGGAGTTAACAGTTCATGGACAAAACATCTAACAGCTGGACCC TTTAAAGGCATTGAGTTTCCATTGACACTTTGGAAACATGACGAGCTTCT TATGATTGCCTCTGATGGAAGAGCCACATCTTATAATTCTAGTACCGGAA ATCTCAAGTATCTTTATATTCCT--------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ---------------------------------------ATTATTATCTA TAGGAATAGGGTTATAGAT---------------TACGCAAAAAGTATTG TTCCAGTTAAGCGAGTTGAGGGCAAAGTTCCATTTTCTCCTATT------ -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------ >S5_SFBB17 ATGTTCGAGGTGCGTGAAAGTAAAACTCCTGAAGATATGGTGGTTGAAAT CATGTCTAAGTTGCCGCCCAAGTCTCTAATGCGATTCAAATGCATACGCA AGTCTTGGTGCACTCTCATCAATAGTCCAAGTTTTGTGGCCAAACACCTC AACAATTCCGTGGATAACAAACTATCATCTTCCACTTGCATCCTTCTCAA CCGTTCTCAGACTCATGTTTTCCCAGACAATAGTTGGAAACAAGAAGTTT TCTGGTCCATGATCAATATTTCTATTGATAGTGATGAGCACAACCTTCAT TATGATGTTGAGGACCTA---AATATACCATTTCCGCTG---GAAGATCA GGATTACGTATTGATTCTCGGTTATTGCAATGGGATTGTTTGTGTATCAG CAGGTAAA---------------AATATTCTTTTATGCAATCCTACAACG AGGGAATTCATGCGACTTCCCAGTTCATGCCTTCTTCTGCCTTCCCATCC C---AAGGGAAAATTCGAATTGGAAACGGTCTTTCGAGCATTAGGATTTG GCTATGATTGCAAAGCTAAAGAATACAAGGTAGTGCAAATTATAGAAAAT ------TCTGAGTATTCAGATGATGAGCGAACATATTATCATCGTATTCC TCTTCCTCACACGGCTGAGGTATACACAACGGCTGCTAACTCTTGGAGAG AGATCAAGATTGATATATCAACTAGAACT---------------TATTCC TGTTCTTGTCAAGTGTACTTGAAGGGATTTTGTTATTGGTATGCAACGGA TGCTGAGGAATACATACTTTCATTTGATTTAGGTGATGAGATATTTCATA GAATACAATTGCCTTCTAGAAGAGAATCCGGTTTTAAGTTTTATTATATC TTTCTTCGTAATGAATCCCTTGCTTCGTTTTGCTCTCGTTACGATCGAAG TGAT---AAGTCTGAATCATGT---------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------ >S5_SFBB18 -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------------CTTCTCAA CCGTTCTGAAATGCCCGTTTTCCCGGACGACAGTTGGAAGTATGAAGTTT TATGGTCCATGATTAATCTTTCCATTGATAGTGATGATCACaACCTTCAT TATAATGTTGAGGACCTA---AATATACCGTTTCCAATG---GAATACCA TCATCCTGTATTGATTCACGGTTATTGCGATGGTATTTTCTGTGTAATTA CAGGTGAA---------------AATGTTGTTTTATGCAATCCTGCAATT GGGGAATTCAGGCAACTTCCCGATTCATGCCTTCTTCTACCTGCTCCTCC T---GAGAGAAAATTCGAATTGGAAACGACCTTTCGGGCATTGGGATTTG GCTATGATTGCAAAGCTAAAGAATACAAGGTTGTGCGAATTATAGAAAAT ------TGTGAATATTCTGATGATGAGCAAACATATAATCATCGTATTTC TCTTCCTTACACTGCTGAGGTATACACAACGACTGGTAACTCTTGGAAAG AGATCAATATTGATGTATCAAGTAAAGCC---------------TATCCA TGTTCTTGTTCAGTGTACTTGAAGGGATTTTGTTATTGGTTTGCAACAGA TGGCGAGGAATACATACTTTCATTTGACTTAGGAGATGAGATATTTTCCA GAATACAATTGCCTGCTAGGAAAGAATCCGGTTTTAAGTTTTATAGTCTT TTTCTGTATAATGAATCAGTCACTTCTTATTGCTCTCATTACGATCCAAG CGAG---GATTCTAAATTATTTGAAATA---------TGGGTGATGGAC- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------ >S5_SFBB3 -------------------------------------------------- -------------------------------------AAATGCATACGCA AGTCTTGGTGCACTCTCATCATTAGTACAAGTTTTGTTGCCAAACACCTC AGCAATTCCTTGGACTACAAACACTCATCCTCCACTTGTATCCTTCTTAA CCGTTCTCAGTTTCACATTTTCCCGGATCAGAGTTGGAAACGTGAAGTTT TATGGTCCATGATTAATCTTTCCAGTGATAGTGATGTGCACAACCTTCAT TATGATGTTAAGCCCTTA---AATATACCGTTTTCTAGG---GATGACCA TAATCCTGTACAGATTCACGGGTATTGCAATGGGATTGTATGTCTAATAG AAGGGGAT---------------AATGTTCTTCTATGCAATCCTTCAACG AGGGAATTCAGGCTACTTCCCAATTCATGCCTTCTTGTACCCCATCCC-- ----GAGGGAAAATTCGAATTGGAAACGACCTTTCACGGAATGGGTTTTG GCTATGATTGCAAAGCTAATGAATACAAGGTTGTGCAAATTGTAGAAAAT ------TGTGAGTATTCGGATGATGAGCAAACATATCAACATTGTATTGC TTATCCTTACACGGCTGAGGTATACACCACGGCTGCTAACTTTTGGAAAG AGATCAAGATTGATATATCAAGTTCAACC---------------CATCCC TATCCCTATTCTGTGTACTTGAAGGGATTTTGTTATTGGTTTGCAACGGA TGGCGAAGAATGCATACTTTCATTTGATTTAGGTGACGAGATATTTCATA GAATACAATTGCCTTCTAAGATAGAATCCGGTTTTAACTTTTGTGGTCTT TTTCTTTATAATGAATCTATCACTTCTTATTGTTGTCGTTATGATCCAAG TGAG---GATTCTAAATTATTTGAAATA---------TGGGTAATGGATG GGTATGGCGGAGTTAAGAATTCATGGACAAAACTCCTA------------ -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------ >S5_SFBB4 ATGTCCCAGGTGCGTGAAACTGAAACTCCTGAAGATAGGGTGGTCGCAAT CATGTCCAAGTTGCCGCCCAAGTCTCTGATGCGATTCAAATGCATACGCA AGTCTTGGTGCACTCTCATCAATAATCCAAGTTTTGTGGCCAAACACCTC AGCAATTCTGTGGTCAACAATTTCTCATCCTACACTTGTATCCTCCTCAA CCGTTCTCAGGTTCACGTTTTCCCGGACAAGAGTTGGAAACATGAAGTTT TATGGTCCATGATTAATTTTTTTAATGATAGAGTTTCACGCACCCTTTAT TATAATGTTGAGGACCTA---AATATACCGTTTCCAAGG---GATGACCA TGAACATATACTGATTCATGGTTATTGCAATGGAATTGTTTGTGTAATAT CAGGGAAA---------------AATATTCTTTTATGCAATCCTGCAACG AGGGAATTCAGGCAACTTCCTGATTCATTCCTTCTCCTACCTTCCCCTCT C---GGTGGAAAATTCGAATTGGAGACCGATTTTGGAGGATTGGGATTTG GCTATGATTGCAGAGCTAAAGATTACAAGGTTGTGCGAATTATAGAAAAT ------TGTGAGTATTCAGATGATGAGCGAACATATTATCATCGTATTCC TCTGCCTCACACGGCTGAGGTATACACCATGGCTACTAACTCTTGGAAAG AGGTCAAGATTGATATATCAAGTAAAACT---------------TATCCC TGTTCTTGTTCAGTGTACTTGAAGGGATTTTGTTATTGGTTTACAAGGGA TGGTGAGGAATTCATACTTTCATTTGATTTAGGCGATGAGAGATTTCATA GAATACAATTGCCTTCTAGGAGAGAATCCAGTTTTGAGTTTTATTATATT TTTCTGTGTAATGAATCCATTGCTTCTTTTTGCTCTCTTTATGATCGAAG TGAA---GATTCTAAGTCATGTGAAATA---------TGGGTAATGGACG ACTATGATGGAGTCAAGAGTTCATGGACAAAACTCCTAGTCGCTGGACCC TTTAAAGGCATTGAGAAGCCATTGACACTTTGGAAATGTGATGAGCTTCT TATGATTGACACTGATGGAAGAGTCATCTCTTATAATTCTGGTATTGGAT ATCTCACCTATCTTCATATTCCT--------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ---------------------------------------CCGATTATC-- ----AATAGGGTCATAGATTCTCAAGCTCTTATTTATGTAGAAAGTATTG TTCCAGTCAAG--------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------ >S5_SFBB5 ---------------------GAAACTCCAGAAGATCAGGTGGTCGAAAT CCTGTCCAGGTTGCCACCCAAGTCTCTAATGAGATTCAAATGTATACGTA AGTCTTGGTGCACTATCATCAATAGTTCAAGTTTTGTGGCCAAACACCTC AGCAATTCCATAGACAACAAACTCTCATCCTCCACTTGTATCCTTCTTAA CCGTTGTCAGGTTCATGTTTTCCCGGATAGGAATTGGAAACAAGACGTTT TCTGGTCCATGATTAATCTTTCCATTGATGGTGATAAGAATAACCTTCAT TACGATGTTGAGGACCTA---AATATACCATTTCCAATG---GAAGATCA AGACAATGTAGAGCTTCACGGTTATTGCAATGGGATTGTCTGTGTAATAG TAGGGAAA---------------AATGTTCTTTTATGCAATCCTGCGACG GAAGAATTCAGGCAACTTCCTGATTCATCCCTTCTGCTACCCCTTCCC-- ----AAGGGAAGATTTGGATTGGAAACGGTCTTTAAGGGATTGGGATTTG GCTATGATTGCAAAGCTAAAGAATACAAGGTCGTGCGAATTATAGAAAAT TGTGATTGTGAGTATTCAGAAGGTGAAGAATCATATTATGAGCGTATTCT TCTTCCTCACACGGCTGAGGTATACACCATGACTACTAACTCTTGGAAAG AGATCAAGATTGATGTAACAAGTGATACT---GATCCGTATTGCATTCCT TATTCTTGTTCAGTGTACTTGAAGGGATTTTGTTATTGGTTTGCAATGGA TAACGGGGAATACATATTTTCATTTGATTTAGGTGATGAGATCTTTCATA TAATAGAATTGCCTTCTAGGAGAGATTTTGGTTTTAAGTTTTATGGTATT TTTTTGTATAATGAATCCATCACTTCTTATTGCTCTCGTTACGAAGAG-- -------GATTGTAAATTATTTGAAATA---------TGGGTAATGGACG ACTATGACGGAGTTAAGAGTTCATGGACAAAATTGCTAACCATTGGACCC TTTAAAGACATTGATTATCCATTGACACTTGGGAAATGTGATGAGGTTCT TATGCTTGGCTCGTATGGAAGAGCCGCCTTTTGTAATTCTAGTACCGGAA ATCTCAAGTATCTTCATATTCCT--------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ---------------------------------------CCTATTATC-- ----AATGAGGTTATTGATTTCGAAGTTCTTAGTTATGTGGAAAGTATTG TTCCGATCAAG--------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------ >S5_SFBB6 ATGTCCCAGGTGCATGAAAGTGAAACTCCTGAAGATAAGGTGGTCGAAAT CTTGTCAAGGTTGTCGCCCAAGTCCCTGATGAGATTCAAATGCGTACACA AATCATGGTGCACTATCATCAATAGTCCAAGTTTTGTGGCCAAACACCTC AGCAATACCGTGGACAACAAATTCTCATCCTGCACTCGCATCCTTTTCAA CCGATGTCAGGTTCATGTCTTCCCGGACAGGAGTTGGAAAAGAGATGTTT TCTGGTCTATGATTAATCTTTCCATTGATAGTGATGAGCACAACCTTCGT TATGATGTCGAGGACCGA---AATATACCCTTTCCTATA---GAAGTTCA AGACAATGTACAGCTTTACGGTTATTGCAATGGGATTGTCTGTGTAATAG TAGGGGAG---------------AATGTTCTTCTATGCAATCCTGCAACA AGAGAATTCAAGCAACTTCCCGATTCATCCCTTCTTCTACCCCTTCCC-- ----ACGGGAAAATTCGGATTGGAAACGCTCTTTAAAGGATTGGGATTTG GGTATGATTGCAAAACTAAAGAATACAAGGTTGTACGAATTATAGAAAAT TGTGATTGTGAGTACTCAGATGGTAAAGAATCATATATTGAGCGTATTCT TCTTCCTTACACGGCTGAGGTATACACCACGGCTGCTAACTCTTGGAAAG AGATCAAGATTGATACATCAAGTGATACT---GATCCGTATTGCATTCCC TATTCTTGTTCAATGTACTTGAAGGGATTTTGTTATTGGTTTGCAAACGA TAACGGGGAATACATATTTTCATTTGATTTAGGTGATGAGATATTTCATA GAATAGAATTGCCTTTTCGGAGAGAATCCGATTTTAAGTTTTGTGGTCTT TTTCTGTATAATGAATCCGTCGCTTCTTATTGCTCTTGTTACGAAGAG-- -------GATTGTAAATTGGTTGAAATA---------TGGGTAATGGATG ATTATGATGGAGTGAAGAGTTCATGGACAAAACTTCTAACCGTTGGACCC TTTAAAGACATTGAGTCTCCTTTGACATTTTGGAAATGTGACGAGGTTCT TATCCTTTCCTCATATGGAAAAGCCACCTCTTATAATTCTAGT------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------ >S5_SFBB7 -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ---------------AgCAAACTCTCATCCACCGCTTGTATCCTTCTCAA CCGTTGTCAGGtTCATGTTTTCCCGGACAGGaGTTGGAAACAAGACGTTT TCTGGTCCATGATTAATCTTTCCATTGATAGTGATGAGCACAACCTTCAT TATGATGTTGAGGACCTA---AATATACCGTTTCCAATG---GAAGATCA AGACAATATGGAGCTTCACGGTTATTGCAATGGGATTGCCTGTGTAATAG TAGGGAAA---------------AATGTTCTTTTATGCAATCCTGCAACG GGAGAATTCAGGCAACTTCCCAATTCATCTCTTCTTCTACCCCTTCCC-- ----AAAGGAAGATTCGGATTGGAAACGACCTTTAAAGGAATGGGATTTG GCTATGATTGCAAAACTAAAGAATACAAGGTTGTGCGAATTATAGAAAAT TGTGATTGTGAGTATTCAGAAGATGGAGAATCATACTATGAGCGTATTCT TCTTCCTCACACGGCTGAGGTATACACGACGACTGCTAACTCTTGGAAAG AGATTAAGATTGATATATCAATTGAAACT---CGTTGGTATTGCATTCCC TATTCTTGTTCAGTGTACTTGAAGGGATTTTGTTATTGGTTTGCATACGA TAACGGGGAGTACGTATTTTCATTTGATTTAGGTGATGAGATATTTAATA GAATAGAATTGCCTTCTAGGAGAGAATCCGATTTCAAGTTTTATGGTATT TTTCTGTATAATGAATCCGTGACTTCGTATTGCTATCGTCACGAAGAG-- -------GATTGTGAATTATTTGAAATA---------TGGGTAATGGATG GCTATGATGGAGTTAAGAGTTCATGGACAAAACTGCAAACCATTGGACCC CTTAAAGACATTGATTATCCATTGACACTTTGGAAATGTGACGAGATTCT TATGCTTGGCTCGTATGGAAGAGCGGCCTCTTGTAATTCTAGTACTGGAA ATCTCAAGTATCTTCATATTCCC--------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ---------------------------------------CCTATTATC-- ----AATTGGATGATAGAC---------------TATGTGAAAAGTATTG TTCCAGTCAAG--------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------ >S5_SFBB8 ATGTCCCAGGTGCGTGAATGTGAAACTCCTGAAGATAGGATGGTTGAAAT CTTGTCCAGGTTGCCACCTAAGTCTCTGATGCGATTCAAATGCATACGCA AATCTTGGTGCACTCTTTTCAATAGTCCATGTTTTGTGGCCAAACACCTC AGCGATTCTGTGGACAACAAACTCTCATCCTCCACTTGTATCCTTCTCAA CTGTTCTCAGGCTCACGTTTGCTCGGAAGAGAGTTGGAAACAAGGAGTTT TATGGTCCGTGATTAATCTTTCCATTGATGGTGATGAA------CTTCAT TATGGTATTGAGGACCTAACTAATGTACCGTTTCTAAGG---GATGACCA TCATGAATTAGAGATTCACGGTTATTGCGATGGGATTATTTGTGTAACAG TAAACGAA---------------AATTTCTTTTTGTGCAATCCTGCAACG GGGGAATTCAGGCAACTTCCTGATTCATGCCTTCTTCTACCCCTTCCCGG TGTAAAAGAAAAATTCGGATTGGAAACGACACTTAAAGGACTGGGATTTG GTTATGATTGCAAAGCTAAAGAATACAAGGTTGTGCGAATTATAGATAAT TATGATTGTGAGTATTCAGATGATGGAGAAACATATATCGAGCATATTGC TCTTCCTCACACTGCTGAAGTATACACCATGGCTGCTAACTCTTGGAAAG AGATCACGATTGATATATTAAGTAAAATATTATCATCATATAGCGAACCA TATTCTTATTCAGTGTATTTGAAAGGGTTTTGTTATTGGTTGTCATGCGA TGTAGAGGAATACATTTTTTCATTTGATTTAGCTAATGAAATATCTGATA TGATAGAATTGCCTTTTAGGGGAGAATTCGGTTTTAAGCGTGATGGTATT TTTCTGTATAATGAATCCCTCACTTATTATTGCACTAGTTACGAAGAG-- -------CCTTCCACATTATTT---------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------ >S5_SSFBB2 -------------------------------------------------- -------------------AAGTCTCTGATGCGGTTCAAATGTATACGCA AGTCTTGGTGCACGGTCATCAACAATCCAAGTTTTATTGCCAAACACCTC AGCAATTCCGTTGACAACAAGTTCTCATCCTCCACTTGTATCCTTCTCCA CCGTTCTCAGATGCCCGTTTTCCCGGACAGAAGTTGGAAACGAGAATATT TCTGGTCCATGATTAATCTTTCCCATGATAGTGATGAGCACAACCTTTAT TATGATGTTGAGGACCTG---AATATACAATTTCCATTA---GAAGATCA TGATAATGTATCGATTCATGGCTATTGCAATGGGATTGTCTGTCTAATAG TAGGGAAA---------------AATGCTGTTTTATACAATCCTGCAACG AGGGAACTGAAGCAACTACCTGATTCATGCCTTCTTCTACCTTCCCTTCC G---GAGGGAAAATTCGAATTGGAATCGACCTTTCAAGGAATGGGATTTG GCTATGATAGCAAAGCTAAAGAATACAAGGTTGTGAAAATTATAGAAAAT ------TGTGAGTATTCAGATGATATGCGAACATTTTCTCATCGTATTGC TCTTCCTCACACGGCTGAGGTATACGTCACAACTACTAACTCTTGGAGAG TGATCGAGATTGAAATATCAAGTGATACC---------------TATAAC TGTTCTTGTTCAGTATACTTGAAGGAATTTTGTTATTGGTTTGCAAGCGA TGgCGAGGAATACATACTTTCATTTGATTTAGGTGATGAGATATTTCATA GAATACAATTGCCTTATAGGAAAGAATCCGGTTTTTTGTTTTATGATCTT TTTCTGTATAATGAATCCATCGCTTCTTTTTGCTCTCACTATGATAAAAG TGAC---AATTCTGGAATATTGGAAATACTTGAAATATGGGTAATGGAC- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------
>S5_SFBB1 -----------------------------KCIRKSWCTLINTPSFVAKHL NNSMNNKLSSSTCILLNRCQNHVFPDRSWKPEVFWSIINLSIDSDDHNLH YDAEDL-NIPCPL-EGHDFVEIGGYCNGIVCVLAWKTLHWIYVILCNPAT GEFRQLPHSCLLQPSRS-RRKFELNTISTLLGFGYDCKAKEYKVVQVIEN --CEYSDAEQYDYHRIALPHTAEVYTTTANSWREIKIDISSET-----YC YTCSVYLNGFCYWIATDEEDFILSFDLGDEIFHRIQLPSRRDSDFKFSNL FLCNKSIASFGYCCNPSDEDSTLy-------------------------- -------------------------------------------------- -------------------------- >S5_SFBB10 -------------------------------------------------- -------------------------------------------------- -------------------------CNGIVCVIAGN-----NFLLCNPAT REFMQLPDSCLLLP-PA-EGKFELDTTFEALGFGYDCKGKEYKVVQIIEN --CEYSDDEQTFNHCTTLPHTAEVYTTAVNSWKEIKIDISSTT-----YS WSCSVYLKGFCYWYATDDEEYVLSFDLCNETFHRIQFPSRGESGFTFFYI FLRNESLASFCSRYDRSG-DSQSCEI---WVMDDYDRVKSSWTKLITVGP LQGIEKPLTFWKNDELLMLASDGRATSYNSSTRNLKYVHIP--------- -------------------------- >S5_SFBB11 ------------------------SLMRFKCIHKSWFSLINSLSFVAKHL SNSVDNKLSSSACILLNRSQPHIFPDQSWKQEVFWCVINFSIDSDENNLH YDVEDL-TIPFPL-KDHDFVLIFGYCNGIVCVEAGK-----NVLLCNPAT KKFRQLPDSCLLLPSPL-EGKFKLETSFQALGFGYDCNAKEYKVVRIIEN --CEYSDDERTFYNRIALPHTAELYTTPANSWKEIKIDISSTT-----YS CSRSVFMKGFCYWYATDGEEYILSFDLGDDTFHIIQLPSRREFGFRFYYI FLRNESLASFCSRYERSE-DSESCEI---WVMDDYDRVKSSWTKLLTIGP LQGIKKPLTFWKSDEVLMLDSDGRATSYNSNTRNLKYLHIPPIL--KRVV DFEVLIYVKS---------------- >S5_SFBB12 -----------------------------KCIRKSWCTLINSPSFVAKHL NNSMDNELSSSTCILLNRSQAHIFPDQSWKQEVFWsTINLSIDSDEHNLH YDVEDL-IIPFPL-EDHDFVLIFGYCNGIICVDAGK-----NVLLCNPAT REFRQLPNSCLLLPPP--KGKFELETTFQALGFGYDCNAKEYKVVRIIEN --GEYSDDEQTFHHRIALPHTAEVYTTAANSWKEIKIDISSQT-----YH CSCSVYLKGFCYWFASDSEEYILSFYLGDETFHIIQLPSRRESGFTFDYI FLRDESLASFCSPYSPSE-DSKLFEI---WVMDDFDGVKSSWTKLLTVGP FKGIEYPLTLWKCDELLMLASDGRATSYNSSTGNLKYLHIPPIL--NKVV DFE----------------------- >S5_SFBB13 MFEVRESKTPEDMVVEIMSKLPPKSLMRFKCIRKSWCTLINSPSFVAKHL NNSVDNKLSSSTCILLNRSQAHVFPDNSWKPEVFWSMINLSIDSNEHNLH YDVENL-NIPFPL-EGHDFVEIDGYCHGIVCVIAGKNLHLINIILCNPAT GEFRQLPHSCLLLPSRP-KGKFELETIFGALGFGYDCKAKEYKVVQIIEN --CEYSDDEQYYYHRIALPHTAEVYTTAANSWREIKIDISSDT-----YH YSFSVYLKGFCYWFATDGEKYILSFDIGDEIFHRIQLPSRKESDFEFLNI FLCNTSIASFCSCCDPSDADSTLCEI---WVMDDYDGIKSSWTKLLTFGP LKGIENPFTLWKTDELLMVASGGRVTSYNSSTENLNYLHIPPIL--NEVR DFQALIYMESIVPVK----------- >S5_SFBB14 -----------------------KSLMRFKCTRKSWCTLINSSSFVAKHL SNSVDNILSSSTCILLNRSQMPVFPDKSWKYEILWSMIYLSIYSDEHSYH YDVEDL-NIPFPL-EDHHPVQIHGYCNGIVCVIAGKT----VIILCNPGT GEFRQLPDSCLLVPLP--KEKFQLETIFGGLGFGYDCKAKEYKVVQIIEN --CEYSDDERTFYHSIPLPHTAEVYSIAANSWKEIKIDISTKT-----YP SSCSVYLKGFCYWFASDGEEYILSFDLGDEIFHRIQLPSRRESSFKFYDL FLYNESITSYCSHYDPSE-------------------------------- -------------------------------------------------- -------------------------- >S5_SFBB16 -----ESEAPEDRVVEILSRLPPKSLMRFKCIRKSWYTLINSPRFVAKHL NNSVDNKLSSSTCILLHRSQMPIFPYDSWKREFFWSMINFSIDSDESNLH YDVEDLTNVPLLQWEDHHEVEIHGYCNGIVCVTVGE-----YFFLCNPAT GEFSQLPNSRLLLPLPRGKGKFGLETTVKGLGFGYDCKAKEYKVVRIIEN YDCEYSDGEETYIEHAALPHTAELYTTTANSWKEIKINISSKILSFYSYP YSCSVYLKGFCYWLSSDDEEYICSFDLGEEIFDRIELPSRRESGFKLDGI FLYNESITYYCTSYEE---SSRLFEI---WVMDICDGVNSSWTKHLTAGP FKGIEFPLTLWKHDELLMIASDGRATSYNSSTGNLKYLYIPIIIYRNRVI D-----YAKSIVPVKRVEGKVPFSPI >S5_SFBB17 MFEVRESKTPEDMVVEIMSKLPPKSLMRFKCIRKSWCTLINSPSFVAKHL NNSVDNKLSSSTCILLNRSQTHVFPDNSWKQEVFWSMINISIDSDEHNLH YDVEDL-NIPFPL-EDQDYVLILGYCNGIVCVSAGK-----NILLCNPTT REFMRLPSSCLLLPSHP-KGKFELETVFRALGFGYDCKAKEYKVVQIIEN --SEYSDDERTYYHRIPLPHTAEVYTTAANSWREIKIDISTRT-----YS CSCQVYLKGFCYWYATDAEEYILSFDLGDEIFHRIQLPSRRESGFKFYYI FLRNESLASFCSRYDRSD-KSESC-------------------------- -------------------------------------------------- -------------------------- >S5_SFBB18 -------------------------------------------------- --------------LLNRSEMPVFPDDSWKYEVLWSMINLSIDSDDHnLH YNVEDL-NIPFPM-EYHHPVLIHGYCDGIFCVITGE-----NVVLCNPAI GEFRQLPDSCLLLPAPP-ERKFELETTFRALGFGYDCKAKEYKVVRIIEN --CEYSDDEQTYNHRISLPYTAEVYTTTGNSWKEINIDVSSKA-----YP CSCSVYLKGFCYWFATDGEEYILSFDLGDEIFSRIQLPARKESGFKFYSL FLYNESVTSYCSHYDPSE-DSKLFEI---WVMD----------------- -------------------------------------------------- -------------------------- >S5_SFBB3 -----------------------------KCIRKSWCTLIISTSFVAKHL SNSLDYKHSSSTCILLNRSQFHIFPDQSWKREVLWSMINLSSDSDVHNLH YDVKPL-NIPFSR-DDHNPVQIHGYCNGIVCLIEGD-----NVLLCNPST REFRLLPNSCLLVPHP--EGKFELETTFHGMGFGYDCKANEYKVVQIVEN --CEYSDDEQTYQHCIAYPYTAEVYTTAANFWKEIKIDISSST-----HP YPYSVYLKGFCYWFATDGEECILSFDLGDEIFHRIQLPSKIESGFNFCGL FLYNESITSYCCRYDPSE-DSKLFEI---WVMDGYGGVKNSWTKLL---- -------------------------------------------------- -------------------------- >S5_SFBB4 MSQVRETETPEDRVVAIMSKLPPKSLMRFKCIRKSWCTLINNPSFVAKHL SNSVVNNFSSYTCILLNRSQVHVFPDKSWKHEVLWSMINFFNDRVSRTLY YNVEDL-NIPFPR-DDHEHILIHGYCNGIVCVISGK-----NILLCNPAT REFRQLPDSFLLLPSPL-GGKFELETDFGGLGFGYDCRAKDYKVVRIIEN --CEYSDDERTYYHRIPLPHTAEVYTMATNSWKEVKIDISSKT-----YP CSCSVYLKGFCYWFTRDGEEFILSFDLGDERFHRIQLPSRRESSFEFYYI FLCNESIASFCSLYDRSE-DSKSCEI---WVMDDYDGVKSSWTKLLVAGP FKGIEKPLTLWKCDELLMIDTDGRVISYNSGIGYLTYLHIPPII--NRVI DSQALIYVESIVPVK----------- >S5_SFBB5 -------ETPEDQVVEILSRLPPKSLMRFKCIRKSWCTIINSSSFVAKHL SNSIDNKLSSSTCILLNRCQVHVFPDRNWKQDVFWSMINLSIDGDKNNLH YDVEDL-NIPFPM-EDQDNVELHGYCNGIVCVIVGK-----NVLLCNPAT EEFRQLPDSSLLLPLP--KGRFGLETVFKGLGFGYDCKAKEYKVVRIIEN CDCEYSEGEESYYERILLPHTAEVYTMTTNSWKEIKIDVTSDT-DPYCIP YSCSVYLKGFCYWFAMDNGEYIFSFDLGDEIFHIIELPSRRDFGFKFYGI FLYNESITSYCSRYEE---DCKLFEI---WVMDDYDGVKSSWTKLLTIGP FKDIDYPLTLGKCDEVLMLGSYGRAAFCNSSTGNLKYLHIPPII--NEVI DFEVLSYVESIVPIK----------- >S5_SFBB6 MSQVHESETPEDKVVEILSRLSPKSLMRFKCVHKSWCTIINSPSFVAKHL SNTVDNKFSSCTRILFNRCQVHVFPDRSWKRDVFWSMINLSIDSDEHNLR YDVEDR-NIPFPI-EVQDNVQLYGYCNGIVCVIVGE-----NVLLCNPAT REFKQLPDSSLLLPLP--TGKFGLETLFKGLGFGYDCKTKEYKVVRIIEN CDCEYSDGKESYIERILLPYTAEVYTTAANSWKEIKIDTSSDT-DPYCIP YSCSMYLKGFCYWFANDNGEYIFSFDLGDEIFHRIELPFRRESDFKFCGL FLYNESVASYCSCYEE---DCKLVEI---WVMDDYDGVKSSWTKLLTVGP FKDIESPLTFWKCDEVLILSSYGKATSYNSS------------------- -------------------------- >S5_SFBB7 -------------------------------------------------- -----SKLSSTACILLNRCQVHVFPDRsWKQDVFWSMINLSIDSDEHNLH YDVEDL-NIPFPM-EDQDNMELHGYCNGIACVIVGK-----NVLLCNPAT GEFRQLPNSSLLLPLP--KGRFGLETTFKGMGFGYDCKTKEYKVVRIIEN CDCEYSEDGESYYERILLPHTAEVYTTTANSWKEIKIDISIET-RWYCIP YSCSVYLKGFCYWFAYDNGEYVFSFDLGDEIFNRIELPSRRESDFKFYGI FLYNESVTSYCYRHEE---DCELFEI---WVMDGYDGVKSSWTKLQTIGP LKDIDYPLTLWKCDEILMLGSYGRAASCNSSTGNLKYLHIPPII--NWMI D-----YVKSIVPVK----------- >S5_SFBB8 MSQVRECETPEDRMVEILSRLPPKSLMRFKCIRKSWCTLFNSPCFVAKHL SDSVDNKLSSSTCILLNCSQAHVCSEESWKQGVLWSVINLSIDGDE--LH YGIEDLTNVPFLR-DDHHELEIHGYCDGIICVTVNE-----NFFLCNPAT GEFRQLPDSCLLLPLPGVKEKFGLETTLKGLGFGYDCKAKEYKVVRIIDN YDCEYSDDGETYIEHIALPHTAEVYTMAANSWKEITIDILSKILSSYSEP YSYSVYLKGFCYWLSCDVEEYIFSFDLANEISDMIELPFRGEFGFKRDGI FLYNESLTYYCTSYEE---PSTLF-------------------------- -------------------------------------------------- -------------------------- >S5_SSFBB2 -----------------------KSLMRFKCIRKSWCTVINNPSFIAKHL SNSVDNKFSSSTCILLHRSQMPVFPDRSWKREYFWSMINLSHDSDEHNLY YDVEDL-NIQFPL-EDHDNVSIHGYCNGIVCLIVGK-----NAVLYNPAT RELKQLPDSCLLLPSLP-EGKFELESTFQGMGFGYDSKAKEYKVVKIIEN --CEYSDDMRTFSHRIALPHTAEVYVTTTNSWRVIEIEISSDT-----YN CSCSVYLKEFCYWFASDGEEYILSFDLGDEIFHRIQLPYRKESGFLFYDL FLYNESIASFCSHYDKSD-NSGILEILEIWVMD----------------- -------------------------------------------------- --------------------------
#NEXUS [ID: 8380179775] begin taxa; dimensions ntax=16; taxlabels S5_SFBB1 S5_SFBB10 S5_SFBB11 S5_SFBB12 S5_SFBB13 S5_SFBB14 S5_SFBB16 S5_SFBB17 S5_SFBB18 S5_SFBB3 S5_SFBB4 S5_SFBB5 S5_SFBB6 S5_SFBB7 S5_SFBB8 S5_SSFBB2 ; end; begin trees; translate 1 S5_SFBB1, 2 S5_SFBB10, 3 S5_SFBB11, 4 S5_SFBB12, 5 S5_SFBB13, 6 S5_SFBB14, 7 S5_SFBB16, 8 S5_SFBB17, 9 S5_SFBB18, 10 S5_SFBB3, 11 S5_SFBB4, 12 S5_SFBB5, 13 S5_SFBB6, 14 S5_SFBB7, 15 S5_SFBB8, 16 S5_SSFBB2 ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.08806415,5:0.0354086,((((2:0.06556114,3:0.05737702)0.916:0.01630244,4:0.06236603)0.626:0.01027713,(((((6:0.07264646,9:0.08311787)0.818:0.007487018,10:0.09907661)0.990:0.008529768,((7:0.07056045,15:0.09468138)1.000:0.04363883,((12:0.04998089,14:0.04699075)0.990:0.009748338,13:0.07205648)1.000:0.03288421)1.000:0.02251076)0.993:0.01170141,16:0.1142694)0.676:0.005995288,11:0.09255105)0.998:0.01338518)0.890:0.01996225,8:0.06483501)1.000:0.04456672); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.08806415,5:0.0354086,((((2:0.06556114,3:0.05737702):0.01630244,4:0.06236603):0.01027713,(((((6:0.07264646,9:0.08311787):0.007487018,10:0.09907661):0.008529768,((7:0.07056045,15:0.09468138):0.04363883,((12:0.04998089,14:0.04699075):0.009748338,13:0.07205648):0.03288421):0.02251076):0.01170141,16:0.1142694):0.005995288,11:0.09255105):0.01338518):0.01996225,8:0.06483501):0.04456672); end;
Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS1/revmuscle/S5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/revmuscle/S5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS1/revmuscle/S5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -7424.07 -7444.15 2 -7424.04 -7441.68 -------------------------------------- TOTAL -7424.05 -7443.54 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS1/revmuscle/S5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/revmuscle/S5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS1/revmuscle/S5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 1.426375 0.003662 1.306126 1.543630 1.423657 1383.30 1414.01 1.000 r(A<->C){all} 0.107254 0.000134 0.084813 0.129427 0.107064 980.02 1043.24 1.000 r(A<->G){all} 0.323886 0.000373 0.287849 0.363455 0.323110 604.51 637.98 1.000 r(A<->T){all} 0.078767 0.000061 0.063585 0.093697 0.078639 1035.32 1037.82 1.000 r(C<->G){all} 0.138346 0.000213 0.110366 0.167488 0.137772 984.30 1054.38 1.000 r(C<->T){all} 0.270755 0.000301 0.236655 0.304718 0.270668 880.28 918.88 1.001 r(G<->T){all} 0.080992 0.000084 0.063736 0.098878 0.080549 1102.07 1132.03 1.000 pi(A){all} 0.292442 0.000112 0.271284 0.312944 0.292706 1043.16 1198.88 1.000 pi(C){all} 0.174849 0.000078 0.158255 0.192544 0.174745 980.85 1078.25 1.000 pi(G){all} 0.195289 0.000081 0.178568 0.213335 0.195274 991.53 1051.25 1.000 pi(T){all} 0.337420 0.000127 0.316082 0.359862 0.337484 1115.48 1172.99 1.000 alpha{1,2} 0.883018 0.025913 0.611356 1.205751 0.855502 935.91 1093.07 1.000 alpha{3} 1.509877 0.160454 0.867752 2.316765 1.435413 903.97 1051.19 1.000 pinvar{all} 0.060048 0.001930 0.000026 0.142941 0.051618 1027.63 1084.58 1.001 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS1/revmuscle/S5/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio for branches, Codon frequency model: F3x4 Site-class models: ns = 16 ls = 176 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 10 12 8 12 10 10 | Ser TCT 6 7 7 5 5 5 | Tyr TAT 10 5 7 6 7 9 | Cys TGT 7 6 5 4 5 4 TTC 1 3 6 1 3 2 | TCC 0 1 1 2 1 3 | TAC 2 6 5 5 5 4 | TGC 5 5 4 5 6 5 Leu TTA 3 2 3 2 3 2 | TCA 5 5 4 5 5 5 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 4 3 2 4 4 4 | TCG 1 0 0 0 1 0 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 2 2 2 2 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 5 7 7 7 5 6 | Pro CCT 4 4 6 3 4 4 | His CAT 3 2 1 4 5 3 | Arg CGT 2 2 3 1 2 0 CTC 1 1 0 1 0 0 | CCC 1 2 1 4 1 4 | CAC 1 1 1 1 1 1 | CGC 0 0 0 0 0 0 CTA 1 1 1 1 1 0 | CCA 1 0 0 1 1 1 | Gln CAA 5 4 3 5 4 4 | CGA 0 1 3 2 0 1 CTG 1 0 2 0 0 1 | CCG 0 0 0 0 0 0 | CAG 0 0 0 0 0 0 | CGG 0 0 1 0 0 0 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 7 4 5 6 8 8 | Thr ACT 3 2 0 1 0 2 | Asn AAT 7 7 7 6 5 4 | Ser AGT 1 1 1 2 1 3 ATC 2 1 1 2 2 1 | ACC 3 3 2 1 3 2 | AAC 2 2 1 1 1 1 | AGC 0 0 1 2 0 1 ATA 4 4 5 4 7 7 | ACA 1 5 3 5 1 1 | Lys AAA 5 4 6 4 6 5 | Arg AGA 4 2 1 2 1 2 Met ATG 0 1 1 0 0 0 | ACG 3 4 5 3 4 2 | AAG 3 3 4 4 4 6 | AGG 3 1 3 2 3 2 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 2 1 2 2 1 2 | Ala GCT 6 3 5 6 6 4 | Asp GAT 9 9 8 8 9 10 | Gly GGT 3 0 2 3 2 2 GTC 2 0 1 0 1 1 | GCC 0 0 0 0 0 0 | GAC 1 1 1 1 1 0 | GGC 0 3 2 1 1 1 GTA 2 5 1 2 2 3 | GCA 3 4 4 4 4 2 | Glu GAA 7 8 10 7 5 7 | GGA 2 4 3 3 4 5 GTG 2 2 2 2 2 2 | GCG 0 0 0 0 0 0 | GAG 5 7 4 7 8 7 | GGG 2 2 2 2 3 3 -------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 8 9 9 10 10 12 | Ser TCT 3 5 6 4 5 5 | Tyr TAT 10 9 8 10 9 9 | Cys TGT 6 4 5 7 6 4 TTC 2 2 3 2 4 1 | TCC 1 3 2 1 2 2 | TAC 5 5 6 4 3 5 | TGC 3 5 5 5 4 4 Leu TTA 2 3 2 1 2 2 | TCA 7 5 5 5 6 5 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 6 3 4 3 4 5 | TCG 0 1 0 1 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 5 8 6 7 5 5 | Pro CCT 3 5 5 3 7 5 | His CAT 1 3 2 3 2 1 | Arg CGT 0 3 1 1 1 2 CTC 0 0 0 0 1 0 | CCC 4 1 1 5 1 2 | CAC 1 1 0 1 1 1 | CGC 1 0 0 0 0 0 CTA 2 0 1 3 1 1 | CCA 0 0 2 1 0 0 | Gln CAA 1 3 3 4 2 1 | CGA 1 4 1 0 3 1 CTG 0 1 1 0 2 1 | CCG 0 0 0 0 0 0 | CAG 0 0 0 0 0 0 | CGG 0 0 1 0 0 0 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 5 5 6 4 7 6 | Thr ACT 3 2 3 1 2 4 | Asn AAT 6 5 6 7 5 5 | Ser AGT 3 1 2 1 2 1 ATC 1 2 1 2 0 3 | ACC 1 0 1 3 2 1 | AAC 1 1 1 2 1 2 | AGC 1 0 0 0 0 0 ATA 7 5 4 6 5 5 | ACA 4 3 4 1 2 1 | Lys AAA 7 4 6 3 5 4 | Arg AGA 1 5 2 1 4 2 Met ATG 0 1 0 1 1 2 | ACG 3 5 2 5 2 3 | AAG 4 5 3 4 3 6 | AGG 2 1 2 2 4 2 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 2 1 3 2 2 1 | Ala GCT 5 6 3 5 4 2 | Asp GAT 6 8 9 8 11 8 | Gly GGT 4 3 4 4 2 4 GTC 1 1 1 0 1 3 | GCC 0 0 1 0 0 0 | GAC 1 0 1 1 0 0 | GGC 1 1 2 2 2 1 GTA 2 3 3 4 2 4 | GCA 1 3 3 1 1 1 | Glu GAA 13 8 10 10 6 12 | GGA 5 3 3 3 6 5 GTG 2 2 2 2 2 2 | GCG 0 0 0 0 0 1 | GAG 7 6 6 6 8 6 | GGG 3 1 1 2 1 3 -------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------ Phe TTT 11 9 8 11 | Ser TCT 4 4 3 5 | Tyr TAT 6 9 10 8 | Cys TGT 6 4 3 5 TTC 2 3 4 1 | TCC 3 2 1 2 | TAC 7 6 4 5 | TGC 4 4 6 3 Leu TTA 1 2 2 2 | TCA 6 6 5 5 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0 TTG 4 3 5 4 | TCG 0 1 0 1 | TAG 0 0 0 0 | Trp TGG 2 2 2 2 ------------------------------------------------------------------------------------------------------ Leu CTT 7 6 5 6 | Pro CCT 3 3 4 5 | His CAT 1 0 1 2 | Arg CGT 1 2 1 1 CTC 1 0 1 0 | CCC 4 4 2 0 | CAC 0 2 1 2 | CGC 0 0 0 0 CTA 2 1 1 3 | CCA 0 0 1 0 | Gln CAA 1 1 1 3 | CGA 1 1 1 1 CTG 1 1 2 2 | CCG 0 0 0 0 | CAG 0 0 0 0 | CGG 1 0 0 0 ------------------------------------------------------------------------------------------------------ Ile ATT 6 8 7 4 | Thr ACT 2 4 3 2 | Asn AAT 5 7 5 5 | Ser AGT 1 0 2 1 ATC 1 0 2 2 | ACC 1 1 1 2 | AAC 3 2 2 2 | AGC 0 0 0 2 ATA 5 5 5 6 | ACA 2 0 3 2 | Lys AAA 6 6 8 7 | Arg AGA 3 3 0 2 Met ATG 1 1 2 2 | ACG 4 5 3 2 | AAG 5 4 2 3 | AGG 0 2 2 2 ------------------------------------------------------------------------------------------------------ Val GTT 2 2 1 2 | Ala GCT 4 2 6 5 | Asp GAT 9 7 11 10 | Gly GGT 3 2 3 2 GTC 2 0 0 2 | GCC 0 1 0 0 | GAC 0 0 0 0 | GGC 0 1 0 2 GTA 4 4 4 3 | GCA 2 2 1 2 | Glu GAA 10 11 14 10 | GGA 5 7 5 3 GTG 0 3 2 2 | GCG 0 0 0 0 | GAG 7 7 5 6 | GGG 4 3 3 2 ------------------------------------------------------------------------------------------------------ Codon position x base (3x4) table for each sequence. #1: S5_SFBB1 position 1: T:0.32386 C:0.14205 A:0.27273 G:0.26136 position 2: T:0.26705 C:0.21023 A:0.34091 G:0.18182 position 3: T:0.48295 C:0.11932 A:0.24432 G:0.15341 Average T:0.35795 C:0.15720 A:0.28598 G:0.19886 #2: S5_SFBB10 position 1: T:0.32955 C:0.14205 A:0.25000 G:0.27841 position 2: T:0.26705 C:0.22727 A:0.33523 G:0.17045 position 3: T:0.40909 C:0.16477 A:0.27841 G:0.14773 Average T:0.33523 C:0.17803 A:0.28788 G:0.19886 #3: S5_SFBB11 position 1: T:0.30682 C:0.16477 A:0.26136 G:0.26705 position 2: T:0.26705 C:0.21591 A:0.32955 G:0.18750 position 3: T:0.42045 C:0.15341 A:0.26705 G:0.15909 Average T:0.33144 C:0.17803 A:0.28598 G:0.20455 #4: S5_SFBB12 position 1: T:0.30114 C:0.17045 A:0.25568 G:0.27273 position 2: T:0.26136 C:0.22727 A:0.33523 G:0.17614 position 3: T:0.43182 C:0.15341 A:0.26705 G:0.14773 Average T:0.33144 C:0.18371 A:0.28598 G:0.19886 #5: S5_SFBB13 position 1: T:0.32386 C:0.13636 A:0.26136 G:0.27841 position 2: T:0.27841 C:0.20455 A:0.34659 G:0.17045 position 3: T:0.42614 C:0.14773 A:0.25000 G:0.17614 Average T:0.34280 C:0.16288 A:0.28598 G:0.20833 #6: S5_SFBB14 position 1: T:0.31250 C:0.14205 A:0.26705 G:0.27841 position 2: T:0.27841 C:0.19886 A:0.34659 G:0.17614 position 3: T:0.43182 C:0.14773 A:0.25568 G:0.16477 Average T:0.34091 C:0.16288 A:0.28977 G:0.20644 #7: S5_SFBB16 position 1: T:0.31250 C:0.10795 A:0.27841 G:0.30114 position 2: T:0.25568 C:0.19886 A:0.35795 G:0.18750 position 3: T:0.39773 C:0.13636 A:0.30114 G:0.16477 Average T:0.32197 C:0.14773 A:0.31250 G:0.21780 #8: S5_SFBB17 position 1: T:0.31818 C:0.16477 A:0.25568 G:0.26136 position 2: T:0.26136 C:0.22159 A:0.32955 G:0.18750 position 3: T:0.43750 C:0.12500 A:0.27841 G:0.15909 Average T:0.33902 C:0.17045 A:0.28788 G:0.20265 #9: S5_SFBB18 position 1: T:0.32386 C:0.13636 A:0.24432 G:0.29545 position 2: T:0.26136 C:0.21591 A:0.34659 G:0.17614 position 3: T:0.44318 C:0.14205 A:0.27841 G:0.13636 Average T:0.34280 C:0.16477 A:0.28977 G:0.20265 #10: S5_SFBB3 position 1: T:0.31250 C:0.15909 A:0.24432 G:0.28409 position 2: T:0.26705 C:0.20455 A:0.35795 G:0.17045 position 3: T:0.43750 C:0.15909 A:0.24432 G:0.15909 Average T:0.33902 C:0.17424 A:0.28220 G:0.20455 #11: S5_SFBB4 position 1: T:0.32386 C:0.14773 A:0.25568 G:0.27273 position 2: T:0.27841 C:0.19318 A:0.31818 G:0.21023 position 3: T:0.45455 C:0.12500 A:0.25568 G:0.16477 Average T:0.35227 C:0.15530 A:0.27652 G:0.21591 #12: S5_SFBB5 position 1: T:0.31818 C:0.11364 A:0.26705 G:0.30114 position 2: T:0.30114 C:0.18182 A:0.34091 G:0.17614 position 3: T:0.42045 C:0.14205 A:0.25000 G:0.18750 Average T:0.34659 C:0.14583 A:0.28598 G:0.22159 #13: S5_SFBB6 position 1: T:0.31818 C:0.13068 A:0.25568 G:0.29545 position 2: T:0.28409 C:0.19886 A:0.34091 G:0.17614 position 3: T:0.40341 C:0.15909 A:0.27273 G:0.16477 Average T:0.33523 C:0.16288 A:0.28977 G:0.21212 #14: S5_SFBB7 position 1: T:0.31250 C:0.11932 A:0.27273 G:0.29545 position 2: T:0.27273 C:0.19886 A:0.35227 G:0.17614 position 3: T:0.39205 C:0.14773 A:0.27841 G:0.18182 Average T:0.32576 C:0.15530 A:0.30114 G:0.21780 #15: S5_SFBB8 position 1: T:0.30114 C:0.11932 A:0.26705 G:0.31250 position 2: T:0.28977 C:0.18750 A:0.36364 G:0.15909 position 3: T:0.41477 C:0.13636 A:0.28977 G:0.15909 Average T:0.33523 C:0.14773 A:0.30682 G:0.21023 #16: S5_SSFBB2 position 1: T:0.30682 C:0.14205 A:0.26136 G:0.28977 position 2: T:0.29545 C:0.18750 A:0.35795 G:0.15909 position 3: T:0.42045 C:0.14205 A:0.27841 G:0.15909 Average T:0.34091 C:0.15720 A:0.29924 G:0.20265 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 159 | Ser S TCT 79 | Tyr Y TAT 132 | Cys C TGT 81 TTC 40 | TCC 27 | TAC 77 | TGC 73 Leu L TTA 34 | TCA 84 | *** * TAA 0 | *** * TGA 0 TTG 62 | TCG 6 | TAG 0 | Trp W TGG 34 ------------------------------------------------------------------------------ Leu L CTT 97 | Pro P CCT 68 | His H CAT 34 | Arg R CGT 23 CTC 6 | CCC 37 | CAC 16 | CGC 1 CTA 20 | CCA 8 | Gln Q CAA 45 | CGA 21 CTG 15 | CCG 0 | CAG 0 | CGG 3 ------------------------------------------------------------------------------ Ile I ATT 96 | Thr T ACT 34 | Asn N AAT 92 | Ser S AGT 23 ATC 23 | ACC 27 | AAC 25 | AGC 7 ATA 84 | ACA 38 | Lys K AAA 86 | Arg R AGA 35 Met M ATG 13 | ACG 55 | AAG 63 | AGG 33 ------------------------------------------------------------------------------ Val V GTT 28 | Ala A GCT 72 | Asp D GAT 140 | Gly G GGT 43 GTC 16 | GCC 2 | GAC 8 | GGC 20 GTA 48 | GCA 38 | Glu E GAA 148 | GGA 66 GTG 31 | GCG 1 | GAG 102 | GGG 37 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.31534 C:0.13991 A:0.26065 G:0.28409 position 2: T:0.27415 C:0.20455 A:0.34375 G:0.17756 position 3: T:0.42649 C:0.14382 A:0.26811 G:0.16158 Average T:0.33866 C:0.16276 A:0.29084 G:0.20774 Nei & Gojobori 1986. dN/dS (dN, dS) (Note: This matrix is not used in later ML. analysis. Use runmode = -2 for ML pairwise comparison.) S5_SFBB1 S5_SFBB10 0.8219 (0.1871 0.2277) S5_SFBB11 0.7757 (0.1960 0.2526) 0.4291 (0.1017 0.2371) S5_SFBB12 0.7069 (0.1823 0.2578) 0.4636 (0.1140 0.2460) 0.3434 (0.0917 0.2671) S5_SFBB13 0.6461 (0.1065 0.1648) 0.6621 (0.1401 0.2116) 0.6968 (0.1526 0.2191) 0.5136 (0.1338 0.2605) S5_SFBB14 0.8355 (0.1715 0.2053) 0.7935 (0.1381 0.1741) 0.6516 (0.1413 0.2168) 0.6246 (0.1335 0.2138) 0.8205 (0.1198 0.1460) S5_SFBB16 0.7549 (0.2259 0.2992) 0.7918 (0.1947 0.2459) 0.7779 (0.1984 0.2550) 0.7093 (0.1846 0.2602) 0.6606 (0.1926 0.2916) 0.8630 (0.1682 0.1949) S5_SFBB17 0.7159 (0.1668 0.2331) 0.6029 (0.1020 0.1691) 0.4229 (0.1025 0.2423) 0.4710 (0.1141 0.2423) 0.5029 (0.1189 0.2364) 0.5167 (0.1160 0.2245) 0.6931 (0.1946 0.2807) S5_SFBB18 0.6760 (0.1800 0.2663) 0.6372 (0.1446 0.2269) 0.5627 (0.1493 0.2654) 0.5596 (0.1370 0.2448) 0.5453 (0.1362 0.2498) 0.5074 (0.1155 0.2277) 0.5289 (0.1674 0.3165) 0.6438 (0.1447 0.2247) S5_SFBB3 0.7668 (0.2027 0.2643) 0.7246 (0.1544 0.2131) 0.6528 (0.1759 0.2695) 0.6059 (0.1617 0.2668) 0.5888 (0.1585 0.2691) 0.7911 (0.1424 0.1800) 0.7291 (0.1930 0.2647) 0.7154 (0.1646 0.2301) 0.5337 (0.1372 0.2570) S5_SFBB4 0.7084 (0.1800 0.2541) 0.5554 (0.1228 0.2211) 0.4966 (0.1220 0.2456) 0.4463 (0.1235 0.2767) 0.5582 (0.1251 0.2242) 0.6340 (0.0978 0.1542) 0.6477 (0.1912 0.2952) 0.6109 (0.1042 0.1705) 0.5038 (0.1304 0.2589) 0.6582 (0.1632 0.2480) S5_SFBB5 0.8117 (0.2007 0.2473) 1.0076 (0.1962 0.1947) 0.7196 (0.1671 0.2322) 0.8330 (0.1783 0.2140) 0.6085 (0.1663 0.2733) 0.7410 (0.1531 0.2066) 0.6781 (0.1387 0.2045) 0.6972 (0.1767 0.2534) 0.5772 (0.1612 0.2794) 0.7492 (0.1874 0.2501) 0.6424 (0.1512 0.2354) S5_SFBB6 0.7728 (0.2029 0.2625) 0.8712 (0.1873 0.2150) 0.8514 (0.1956 0.2298) 0.9400 (0.1834 0.1952) 0.6880 (0.1653 0.2402) 1.0928 (0.1701 0.1557) 0.6185 (0.1391 0.2249) 0.7424 (0.1819 0.2450) 0.6039 (0.1632 0.2703) 0.8401 (0.1740 0.2071) 0.7072 (0.1729 0.2445) 0.5162 (0.0824 0.1597) S5_SFBB7 0.7286 (0.2045 0.2807) 0.7628 (0.1881 0.2466) 0.9819 (0.1901 0.1936) 0.8017 (0.1742 0.2173) 0.7383 (0.1729 0.2342) 0.9480 (0.1625 0.1715) 0.7247 (0.1347 0.1859) 0.8279 (0.1801 0.2175) 0.5522 (0.1610 0.2915) 0.6993 (0.1771 0.2532) 0.7694 (0.1791 0.2328) 0.4006 (0.0703 0.1755) 0.5596 (0.0827 0.1478) S5_SFBB8 0.7794 (0.2844 0.3649) 0.6715 (0.2241 0.3337) 0.7847 (0.2305 0.2937) 0.6048 (0.2107 0.3484) 0.6465 (0.2292 0.3545) 0.7458 (0.1990 0.2668) 0.3711 (0.1003 0.2702) 0.6483 (0.2310 0.3564) 0.5106 (0.1938 0.3796) 0.6609 (0.2280 0.3449) 0.7493 (0.2230 0.2976) 0.5891 (0.1669 0.2833) 0.6276 (0.1719 0.2740) 0.6058 (0.1659 0.2738) S5_SSFBB2 1.0016 (0.2108 0.2105) 0.9080 (0.1726 0.1901) 0.8574 (0.1679 0.1958) 0.7608 (0.1607 0.2113) 0.8030 (0.1563 0.1947) 1.1839 (0.1440 0.1216) 0.9329 (0.2149 0.2304) 0.8452 (0.1672 0.1979) 0.7953 (0.1625 0.2044) 0.8540 (0.1748 0.2046) 0.9545 (0.1535 0.1608) 0.9594 (0.1940 0.2022) 1.0081 (0.1888 0.1873) 0.9474 (0.1983 0.2093) 0.9185 (0.2577 0.2806) Model 0: one-ratio TREE # 1: (1, 5, ((((2, 3), 4), (((((6, 9), 10), ((7, 15), ((12, 14), 13))), 16), 11)), 8)); MP score: 559 lnL(ntime: 29 np: 31): -3727.832062 +0.000000 17..1 17..5 17..18 18..19 19..20 20..21 21..2 21..3 20..4 19..22 22..23 23..24 24..25 25..26 26..6 26..9 25..10 24..27 27..28 28..7 28..15 27..29 29..30 30..12 30..14 29..13 23..16 22..11 18..8 0.257167 0.114090 0.147508 0.032894 0.033109 0.012646 0.205265 0.197541 0.233023 0.026593 0.027454 0.039493 0.005282 0.009454 0.185036 0.253764 0.299541 0.117060 0.127338 0.139832 0.276280 0.078398 0.016967 0.143667 0.138478 0.159090 0.281461 0.211630 0.200084 2.514536 0.576566 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 3.97015 (1: 0.257167, 5: 0.114090, ((((2: 0.205265, 3: 0.197541): 0.012646, 4: 0.233023): 0.033109, (((((6: 0.185036, 9: 0.253764): 0.009454, 10: 0.299541): 0.005282, ((7: 0.139832, 15: 0.276280): 0.127338, ((12: 0.143667, 14: 0.138478): 0.016967, 13: 0.159090): 0.078398): 0.117060): 0.039493, 16: 0.281461): 0.027454, 11: 0.211630): 0.026593): 0.032894, 8: 0.200084): 0.147508); (S5_SFBB1: 0.257167, S5_SFBB13: 0.114090, ((((S5_SFBB10: 0.205265, S5_SFBB11: 0.197541): 0.012646, S5_SFBB12: 0.233023): 0.033109, (((((S5_SFBB14: 0.185036, S5_SFBB18: 0.253764): 0.009454, S5_SFBB3: 0.299541): 0.005282, ((S5_SFBB16: 0.139832, S5_SFBB8: 0.276280): 0.127338, ((S5_SFBB5: 0.143667, S5_SFBB7: 0.138478): 0.016967, S5_SFBB6: 0.159090): 0.078398): 0.117060): 0.039493, S5_SSFBB2: 0.281461): 0.027454, S5_SFBB4: 0.211630): 0.026593): 0.032894, S5_SFBB17: 0.200084): 0.147508); Detailed output identifying parameters kappa (ts/tv) = 2.51454 omega (dN/dS) = 0.57657 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 17..1 0.257 415.5 112.5 0.5766 0.0741 0.1286 30.8 14.5 17..5 0.114 415.5 112.5 0.5766 0.0329 0.0570 13.7 6.4 17..18 0.148 415.5 112.5 0.5766 0.0425 0.0737 17.7 8.3 18..19 0.033 415.5 112.5 0.5766 0.0095 0.0164 3.9 1.9 19..20 0.033 415.5 112.5 0.5766 0.0095 0.0166 4.0 1.9 20..21 0.013 415.5 112.5 0.5766 0.0036 0.0063 1.5 0.7 21..2 0.205 415.5 112.5 0.5766 0.0592 0.1026 24.6 11.5 21..3 0.198 415.5 112.5 0.5766 0.0569 0.0988 23.7 11.1 20..4 0.233 415.5 112.5 0.5766 0.0672 0.1165 27.9 13.1 19..22 0.027 415.5 112.5 0.5766 0.0077 0.0133 3.2 1.5 22..23 0.027 415.5 112.5 0.5766 0.0079 0.0137 3.3 1.5 23..24 0.039 415.5 112.5 0.5766 0.0114 0.0197 4.7 2.2 24..25 0.005 415.5 112.5 0.5766 0.0015 0.0026 0.6 0.3 25..26 0.009 415.5 112.5 0.5766 0.0027 0.0047 1.1 0.5 26..6 0.185 415.5 112.5 0.5766 0.0533 0.0925 22.2 10.4 26..9 0.254 415.5 112.5 0.5766 0.0731 0.1269 30.4 14.3 25..10 0.300 415.5 112.5 0.5766 0.0863 0.1497 35.9 16.8 24..27 0.117 415.5 112.5 0.5766 0.0337 0.0585 14.0 6.6 27..28 0.127 415.5 112.5 0.5766 0.0367 0.0637 15.2 7.2 28..7 0.140 415.5 112.5 0.5766 0.0403 0.0699 16.7 7.9 28..15 0.276 415.5 112.5 0.5766 0.0796 0.1381 33.1 15.5 27..29 0.078 415.5 112.5 0.5766 0.0226 0.0392 9.4 4.4 29..30 0.017 415.5 112.5 0.5766 0.0049 0.0085 2.0 1.0 30..12 0.144 415.5 112.5 0.5766 0.0414 0.0718 17.2 8.1 30..14 0.138 415.5 112.5 0.5766 0.0399 0.0692 16.6 7.8 29..13 0.159 415.5 112.5 0.5766 0.0459 0.0795 19.1 8.9 23..16 0.281 415.5 112.5 0.5766 0.0811 0.1407 33.7 15.8 22..11 0.212 415.5 112.5 0.5766 0.0610 0.1058 25.3 11.9 18..8 0.200 415.5 112.5 0.5766 0.0577 0.1000 24.0 11.3 tree length for dN: 1.1443 tree length for dS: 1.9847 Time used: 0:25 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 5, ((((2, 3), 4), (((((6, 9), 10), ((7, 15), ((12, 14), 13))), 16), 11)), 8)); MP score: 559 lnL(ntime: 29 np: 32): -3649.488118 +0.000000 17..1 17..5 17..18 18..19 19..20 20..21 21..2 21..3 20..4 19..22 22..23 23..24 24..25 25..26 26..6 26..9 25..10 24..27 27..28 28..7 28..15 27..29 29..30 30..12 30..14 29..13 23..16 22..11 18..8 0.278758 0.120083 0.160284 0.030177 0.036281 0.009790 0.221875 0.211550 0.247509 0.028560 0.027371 0.042992 0.003567 0.000004 0.198165 0.280582 0.325935 0.129504 0.136159 0.148685 0.296592 0.077591 0.018424 0.149287 0.144517 0.167498 0.302732 0.219725 0.210856 2.402649 0.563071 0.165373 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 4.22505 (1: 0.278758, 5: 0.120083, ((((2: 0.221875, 3: 0.211550): 0.009790, 4: 0.247509): 0.036281, (((((6: 0.198165, 9: 0.280582): 0.000004, 10: 0.325935): 0.003567, ((7: 0.148685, 15: 0.296592): 0.136159, ((12: 0.149287, 14: 0.144517): 0.018424, 13: 0.167498): 0.077591): 0.129504): 0.042992, 16: 0.302732): 0.027371, 11: 0.219725): 0.028560): 0.030177, 8: 0.210856): 0.160284); (S5_SFBB1: 0.278758, S5_SFBB13: 0.120083, ((((S5_SFBB10: 0.221875, S5_SFBB11: 0.211550): 0.009790, S5_SFBB12: 0.247509): 0.036281, (((((S5_SFBB14: 0.198165, S5_SFBB18: 0.280582): 0.000004, S5_SFBB3: 0.325935): 0.003567, ((S5_SFBB16: 0.148685, S5_SFBB8: 0.296592): 0.136159, ((S5_SFBB5: 0.149287, S5_SFBB7: 0.144517): 0.018424, S5_SFBB6: 0.167498): 0.077591): 0.129504): 0.042992, S5_SSFBB2: 0.302732): 0.027371, S5_SFBB4: 0.219725): 0.028560): 0.030177, S5_SFBB17: 0.210856): 0.160284); Detailed output identifying parameters kappa (ts/tv) = 2.40265 dN/dS (w) for site classes (K=2) p: 0.56307 0.43693 w: 0.16537 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 17..1 0.279 416.4 111.6 0.5300 0.0783 0.1476 32.6 16.5 17..5 0.120 416.4 111.6 0.5300 0.0337 0.0636 14.0 7.1 17..18 0.160 416.4 111.6 0.5300 0.0450 0.0849 18.7 9.5 18..19 0.030 416.4 111.6 0.5300 0.0085 0.0160 3.5 1.8 19..20 0.036 416.4 111.6 0.5300 0.0102 0.0192 4.2 2.1 20..21 0.010 416.4 111.6 0.5300 0.0027 0.0052 1.1 0.6 21..2 0.222 416.4 111.6 0.5300 0.0623 0.1175 25.9 13.1 21..3 0.212 416.4 111.6 0.5300 0.0594 0.1120 24.7 12.5 20..4 0.248 416.4 111.6 0.5300 0.0695 0.1311 28.9 14.6 19..22 0.029 416.4 111.6 0.5300 0.0080 0.0151 3.3 1.7 22..23 0.027 416.4 111.6 0.5300 0.0077 0.0145 3.2 1.6 23..24 0.043 416.4 111.6 0.5300 0.0121 0.0228 5.0 2.5 24..25 0.004 416.4 111.6 0.5300 0.0010 0.0019 0.4 0.2 25..26 0.000 416.4 111.6 0.5300 0.0000 0.0000 0.0 0.0 26..6 0.198 416.4 111.6 0.5300 0.0556 0.1050 23.2 11.7 26..9 0.281 416.4 111.6 0.5300 0.0788 0.1486 32.8 16.6 25..10 0.326 416.4 111.6 0.5300 0.0915 0.1726 38.1 19.3 24..27 0.130 416.4 111.6 0.5300 0.0364 0.0686 15.1 7.7 27..28 0.136 416.4 111.6 0.5300 0.0382 0.0721 15.9 8.0 28..7 0.149 416.4 111.6 0.5300 0.0417 0.0787 17.4 8.8 28..15 0.297 416.4 111.6 0.5300 0.0833 0.1571 34.7 17.5 27..29 0.078 416.4 111.6 0.5300 0.0218 0.0411 9.1 4.6 29..30 0.018 416.4 111.6 0.5300 0.0052 0.0098 2.2 1.1 30..12 0.149 416.4 111.6 0.5300 0.0419 0.0791 17.5 8.8 30..14 0.145 416.4 111.6 0.5300 0.0406 0.0765 16.9 8.5 29..13 0.167 416.4 111.6 0.5300 0.0470 0.0887 19.6 9.9 23..16 0.303 416.4 111.6 0.5300 0.0850 0.1603 35.4 17.9 22..11 0.220 416.4 111.6 0.5300 0.0617 0.1164 25.7 13.0 18..8 0.211 416.4 111.6 0.5300 0.0592 0.1117 24.6 12.5 Time used: 1:15 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 5, ((((2, 3), 4), (((((6, 9), 10), ((7, 15), ((12, 14), 13))), 16), 11)), 8)); MP score: 559 check convergence.. lnL(ntime: 29 np: 34): -3625.008556 +0.000000 17..1 17..5 17..18 18..19 19..20 20..21 21..2 21..3 20..4 19..22 22..23 23..24 24..25 25..26 26..6 26..9 25..10 24..27 27..28 28..7 28..15 27..29 29..30 30..12 30..14 29..13 23..16 22..11 18..8 0.299021 0.125394 0.183655 0.021178 0.040377 0.001313 0.252531 0.236330 0.263567 0.026194 0.031537 0.047099 0.001621 0.000004 0.208748 0.307175 0.354051 0.139842 0.145758 0.159839 0.316000 0.078630 0.020455 0.156417 0.154881 0.177758 0.326010 0.231211 0.236486 2.686980 0.462944 0.464978 0.152512 3.998582 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 4.54308 (1: 0.299021, 5: 0.125394, ((((2: 0.252531, 3: 0.236330): 0.001313, 4: 0.263567): 0.040377, (((((6: 0.208748, 9: 0.307175): 0.000004, 10: 0.354051): 0.001621, ((7: 0.159839, 15: 0.316000): 0.145758, ((12: 0.156417, 14: 0.154881): 0.020455, 13: 0.177758): 0.078630): 0.139842): 0.047099, 16: 0.326010): 0.031537, 11: 0.231211): 0.026194): 0.021178, 8: 0.236486): 0.183655); (S5_SFBB1: 0.299021, S5_SFBB13: 0.125394, ((((S5_SFBB10: 0.252531, S5_SFBB11: 0.236330): 0.001313, S5_SFBB12: 0.263567): 0.040377, (((((S5_SFBB14: 0.208748, S5_SFBB18: 0.307175): 0.000004, S5_SFBB3: 0.354051): 0.001621, ((S5_SFBB16: 0.159839, S5_SFBB8: 0.316000): 0.145758, ((S5_SFBB5: 0.156417, S5_SFBB7: 0.154881): 0.020455, S5_SFBB6: 0.177758): 0.078630): 0.139842): 0.047099, S5_SSFBB2: 0.326010): 0.031537, S5_SFBB4: 0.231211): 0.026194): 0.021178, S5_SFBB17: 0.236486): 0.183655); Detailed output identifying parameters kappa (ts/tv) = 2.68698 dN/dS (w) for site classes (K=3) p: 0.46294 0.46498 0.07208 w: 0.15251 1.00000 3.99858 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 17..1 0.299 414.1 113.9 0.8238 0.0953 0.1157 39.5 13.2 17..5 0.125 414.1 113.9 0.8238 0.0400 0.0485 16.5 5.5 17..18 0.184 414.1 113.9 0.8238 0.0585 0.0710 24.2 8.1 18..19 0.021 414.1 113.9 0.8238 0.0067 0.0082 2.8 0.9 19..20 0.040 414.1 113.9 0.8238 0.0129 0.0156 5.3 1.8 20..21 0.001 414.1 113.9 0.8238 0.0004 0.0005 0.2 0.1 21..2 0.253 414.1 113.9 0.8238 0.0805 0.0977 33.3 11.1 21..3 0.236 414.1 113.9 0.8238 0.0753 0.0914 31.2 10.4 20..4 0.264 414.1 113.9 0.8238 0.0840 0.1019 34.8 11.6 19..22 0.026 414.1 113.9 0.8238 0.0083 0.0101 3.5 1.2 22..23 0.032 414.1 113.9 0.8238 0.0100 0.0122 4.2 1.4 23..24 0.047 414.1 113.9 0.8238 0.0150 0.0182 6.2 2.1 24..25 0.002 414.1 113.9 0.8238 0.0005 0.0006 0.2 0.1 25..26 0.000 414.1 113.9 0.8238 0.0000 0.0000 0.0 0.0 26..6 0.209 414.1 113.9 0.8238 0.0665 0.0807 27.5 9.2 26..9 0.307 414.1 113.9 0.8238 0.0979 0.1188 40.5 13.5 25..10 0.354 414.1 113.9 0.8238 0.1128 0.1369 46.7 15.6 24..27 0.140 414.1 113.9 0.8238 0.0446 0.0541 18.5 6.2 27..28 0.146 414.1 113.9 0.8238 0.0464 0.0564 19.2 6.4 28..7 0.160 414.1 113.9 0.8238 0.0509 0.0618 21.1 7.0 28..15 0.316 414.1 113.9 0.8238 0.1007 0.1222 41.7 13.9 27..29 0.079 414.1 113.9 0.8238 0.0251 0.0304 10.4 3.5 29..30 0.020 414.1 113.9 0.8238 0.0065 0.0079 2.7 0.9 30..12 0.156 414.1 113.9 0.8238 0.0498 0.0605 20.6 6.9 30..14 0.155 414.1 113.9 0.8238 0.0494 0.0599 20.4 6.8 29..13 0.178 414.1 113.9 0.8238 0.0566 0.0688 23.5 7.8 23..16 0.326 414.1 113.9 0.8238 0.1039 0.1261 43.0 14.4 22..11 0.231 414.1 113.9 0.8238 0.0737 0.0894 30.5 10.2 18..8 0.236 414.1 113.9 0.8238 0.0754 0.0915 31.2 10.4 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: S5_SFBB1) Pr(w>1) post mean +- SE for w 8 L 0.593 2.778 36 R 0.872 3.616 44 I 0.999** 3.996 46 T 1.000** 3.997 63 Q 0.845 3.533 75 Q 0.566 2.697 78 Y 0.709 3.125 107 E 0.998** 3.991 110 C 0.955* 3.863 126 T 1.000** 3.998 128 E 0.969* 3.905 156 K 0.705 3.114 176 P 0.761 3.283 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: S5_SFBB1) Pr(w>1) post mean +- SE for w 8 L 0.513 2.543 +- 1.562 36 R 0.824 3.594 +- 1.331 44 I 0.999** 4.201 +- 0.684 46 T 0.999** 4.203 +- 0.680 63 Q 0.812 3.580 +- 1.377 75 Q 0.505 2.550 +- 1.596 78 Y 0.636 2.955 +- 1.558 107 E 0.997** 4.194 +- 0.699 110 C 0.941 4.004 +- 0.994 126 T 1.000** 4.204 +- 0.677 128 E 0.960* 4.070 +- 0.910 156 K 0.630 2.939 +- 1.563 176 P 0.705 3.207 +- 1.524 The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.004 0.940 0.056 0.000 0.000 0.000 0.000 0.000 0.000 0.000 w2: 0.000 0.004 0.395 0.503 0.088 0.009 0.001 0.000 0.000 0.000 Posterior for p0-p1 (see the ternary graph) 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.003 0.000 0.000 0.000 0.000 0.000 0.000 0.003 0.083 0.092 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.057 0.614 0.046 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.004 0.014 0.078 0.001 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.001 0.002 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 sum of density on p0-p1 = 1.000000 Time used: 2:54 Model 3: discrete (3 categories) TREE # 1: (1, 5, ((((2, 3), 4), (((((6, 9), 10), ((7, 15), ((12, 14), 13))), 16), 11)), 8)); MP score: 559 lnL(ntime: 29 np: 35): -3622.128473 +0.000000 17..1 17..5 17..18 18..19 19..20 20..21 21..2 21..3 20..4 19..22 22..23 23..24 24..25 25..26 26..6 26..9 25..10 24..27 27..28 28..7 28..15 27..29 29..30 30..12 30..14 29..13 23..16 22..11 18..8 0.298550 0.124386 0.182511 0.021691 0.039414 0.005786 0.247981 0.231102 0.264275 0.027248 0.031779 0.046845 0.000592 0.000004 0.207683 0.306445 0.353927 0.140462 0.144536 0.159411 0.315169 0.079020 0.020895 0.155709 0.154001 0.175873 0.327143 0.231063 0.234134 2.607062 0.330374 0.570670 0.070491 0.693086 3.109512 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 4.52764 (1: 0.298550, 5: 0.124386, ((((2: 0.247981, 3: 0.231102): 0.005786, 4: 0.264275): 0.039414, (((((6: 0.207683, 9: 0.306445): 0.000004, 10: 0.353927): 0.000592, ((7: 0.159411, 15: 0.315169): 0.144536, ((12: 0.155709, 14: 0.154001): 0.020895, 13: 0.175873): 0.079020): 0.140462): 0.046845, 16: 0.327143): 0.031779, 11: 0.231063): 0.027248): 0.021691, 8: 0.234134): 0.182511); (S5_SFBB1: 0.298550, S5_SFBB13: 0.124386, ((((S5_SFBB10: 0.247981, S5_SFBB11: 0.231102): 0.005786, S5_SFBB12: 0.264275): 0.039414, (((((S5_SFBB14: 0.207683, S5_SFBB18: 0.306445): 0.000004, S5_SFBB3: 0.353927): 0.000592, ((S5_SFBB16: 0.159411, S5_SFBB8: 0.315169): 0.144536, ((S5_SFBB5: 0.155709, S5_SFBB7: 0.154001): 0.020895, S5_SFBB6: 0.175873): 0.079020): 0.140462): 0.046845, S5_SSFBB2: 0.327143): 0.031779, S5_SFBB4: 0.231063): 0.027248): 0.021691, S5_SFBB17: 0.234134): 0.182511); Detailed output identifying parameters kappa (ts/tv) = 2.60706 dN/dS (w) for site classes (K=3) p: 0.33037 0.57067 0.09896 w: 0.07049 0.69309 3.10951 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 17..1 0.299 414.7 113.3 0.7265 0.0921 0.1267 38.2 14.4 17..5 0.124 414.7 113.3 0.7265 0.0384 0.0528 15.9 6.0 17..18 0.183 414.7 113.3 0.7265 0.0563 0.0775 23.3 8.8 18..19 0.022 414.7 113.3 0.7265 0.0067 0.0092 2.8 1.0 19..20 0.039 414.7 113.3 0.7265 0.0122 0.0167 5.0 1.9 20..21 0.006 414.7 113.3 0.7265 0.0018 0.0025 0.7 0.3 21..2 0.248 414.7 113.3 0.7265 0.0765 0.1053 31.7 11.9 21..3 0.231 414.7 113.3 0.7265 0.0713 0.0981 29.6 11.1 20..4 0.264 414.7 113.3 0.7265 0.0815 0.1122 33.8 12.7 19..22 0.027 414.7 113.3 0.7265 0.0084 0.0116 3.5 1.3 22..23 0.032 414.7 113.3 0.7265 0.0098 0.0135 4.1 1.5 23..24 0.047 414.7 113.3 0.7265 0.0144 0.0199 6.0 2.3 24..25 0.001 414.7 113.3 0.7265 0.0002 0.0003 0.1 0.0 25..26 0.000 414.7 113.3 0.7265 0.0000 0.0000 0.0 0.0 26..6 0.208 414.7 113.3 0.7265 0.0641 0.0882 26.6 10.0 26..9 0.306 414.7 113.3 0.7265 0.0945 0.1301 39.2 14.7 25..10 0.354 414.7 113.3 0.7265 0.1092 0.1503 45.3 17.0 24..27 0.140 414.7 113.3 0.7265 0.0433 0.0596 18.0 6.8 27..28 0.145 414.7 113.3 0.7265 0.0446 0.0614 18.5 6.9 28..7 0.159 414.7 113.3 0.7265 0.0492 0.0677 20.4 7.7 28..15 0.315 414.7 113.3 0.7265 0.0972 0.1338 40.3 15.2 27..29 0.079 414.7 113.3 0.7265 0.0244 0.0335 10.1 3.8 29..30 0.021 414.7 113.3 0.7265 0.0064 0.0089 2.7 1.0 30..12 0.156 414.7 113.3 0.7265 0.0480 0.0661 19.9 7.5 30..14 0.154 414.7 113.3 0.7265 0.0475 0.0654 19.7 7.4 29..13 0.176 414.7 113.3 0.7265 0.0542 0.0747 22.5 8.5 23..16 0.327 414.7 113.3 0.7265 0.1009 0.1389 41.8 15.7 22..11 0.231 414.7 113.3 0.7265 0.0713 0.0981 29.6 11.1 18..8 0.234 414.7 113.3 0.7265 0.0722 0.0994 30.0 11.3 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: S5_SFBB1) Pr(w>1) post mean +- SE for w 8 L 0.907 2.884 21 G 0.803 2.632 36 R 0.974* 3.046 44 I 1.000** 3.109 46 T 1.000** 3.109 63 Q 0.945 2.976 75 Q 0.835 2.711 78 Y 0.950* 2.989 107 E 1.000** 3.109 110 C 0.991** 3.088 126 T 1.000** 3.109 128 E 0.993** 3.094 156 K 0.926 2.931 167 I 0.597 2.136 173 C 0.523 1.958 176 P 0.937 2.958 Time used: 5:27 Model 7: beta (10 categories) TREE # 1: (1, 5, ((((2, 3), 4), (((((6, 9), 10), ((7, 15), ((12, 14), 13))), 16), 11)), 8)); MP score: 559 lnL(ntime: 29 np: 32): -3648.567478 +0.000000 17..1 17..5 17..18 18..19 19..20 20..21 21..2 21..3 20..4 19..22 22..23 23..24 24..25 25..26 26..6 26..9 25..10 24..27 27..28 28..7 28..15 27..29 29..30 30..12 30..14 29..13 23..16 22..11 18..8 0.281079 0.120404 0.162506 0.030319 0.036616 0.010539 0.223295 0.213022 0.249367 0.028562 0.027818 0.043484 0.003676 0.000284 0.200298 0.282149 0.328515 0.129682 0.137745 0.149005 0.299327 0.079067 0.018399 0.150616 0.145699 0.168595 0.305408 0.222527 0.213853 2.359750 0.429581 0.433915 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 4.26186 (1: 0.281079, 5: 0.120404, ((((2: 0.223295, 3: 0.213022): 0.010539, 4: 0.249367): 0.036616, (((((6: 0.200298, 9: 0.282149): 0.000284, 10: 0.328515): 0.003676, ((7: 0.149005, 15: 0.299327): 0.137745, ((12: 0.150616, 14: 0.145699): 0.018399, 13: 0.168595): 0.079067): 0.129682): 0.043484, 16: 0.305408): 0.027818, 11: 0.222527): 0.028562): 0.030319, 8: 0.213853): 0.162506); (S5_SFBB1: 0.281079, S5_SFBB13: 0.120404, ((((S5_SFBB10: 0.223295, S5_SFBB11: 0.213022): 0.010539, S5_SFBB12: 0.249367): 0.036616, (((((S5_SFBB14: 0.200298, S5_SFBB18: 0.282149): 0.000284, S5_SFBB3: 0.328515): 0.003676, ((S5_SFBB16: 0.149005, S5_SFBB8: 0.299327): 0.137745, ((S5_SFBB5: 0.150616, S5_SFBB7: 0.145699): 0.018399, S5_SFBB6: 0.168595): 0.079067): 0.129682): 0.043484, S5_SSFBB2: 0.305408): 0.027818, S5_SFBB4: 0.222527): 0.028562): 0.030319, S5_SFBB17: 0.213853): 0.162506); Detailed output identifying parameters kappa (ts/tv) = 2.35975 Parameters in M7 (beta): p = 0.42958 q = 0.43391 dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00298 0.03789 0.12019 0.24798 0.40858 0.58172 0.74408 0.87474 0.95998 0.99677 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 17..1 0.281 416.8 111.2 0.4975 0.0773 0.1553 32.2 17.3 17..5 0.120 416.8 111.2 0.4975 0.0331 0.0665 13.8 7.4 17..18 0.163 416.8 111.2 0.4975 0.0447 0.0898 18.6 10.0 18..19 0.030 416.8 111.2 0.4975 0.0083 0.0168 3.5 1.9 19..20 0.037 416.8 111.2 0.4975 0.0101 0.0202 4.2 2.2 20..21 0.011 416.8 111.2 0.4975 0.0029 0.0058 1.2 0.6 21..2 0.223 416.8 111.2 0.4975 0.0614 0.1234 25.6 13.7 21..3 0.213 416.8 111.2 0.4975 0.0586 0.1177 24.4 13.1 20..4 0.249 416.8 111.2 0.4975 0.0685 0.1378 28.6 15.3 19..22 0.029 416.8 111.2 0.4975 0.0079 0.0158 3.3 1.8 22..23 0.028 416.8 111.2 0.4975 0.0076 0.0154 3.2 1.7 23..24 0.043 416.8 111.2 0.4975 0.0120 0.0240 5.0 2.7 24..25 0.004 416.8 111.2 0.4975 0.0010 0.0020 0.4 0.2 25..26 0.000 416.8 111.2 0.4975 0.0001 0.0002 0.0 0.0 26..6 0.200 416.8 111.2 0.4975 0.0551 0.1107 22.9 12.3 26..9 0.282 416.8 111.2 0.4975 0.0775 0.1559 32.3 17.3 25..10 0.329 416.8 111.2 0.4975 0.0903 0.1815 37.6 20.2 24..27 0.130 416.8 111.2 0.4975 0.0356 0.0716 14.9 8.0 27..28 0.138 416.8 111.2 0.4975 0.0379 0.0761 15.8 8.5 28..7 0.149 416.8 111.2 0.4975 0.0410 0.0823 17.1 9.2 28..15 0.299 416.8 111.2 0.4975 0.0823 0.1654 34.3 18.4 27..29 0.079 416.8 111.2 0.4975 0.0217 0.0437 9.1 4.9 29..30 0.018 416.8 111.2 0.4975 0.0051 0.0102 2.1 1.1 30..12 0.151 416.8 111.2 0.4975 0.0414 0.0832 17.3 9.3 30..14 0.146 416.8 111.2 0.4975 0.0400 0.0805 16.7 9.0 29..13 0.169 416.8 111.2 0.4975 0.0463 0.0931 19.3 10.4 23..16 0.305 416.8 111.2 0.4975 0.0839 0.1687 35.0 18.8 22..11 0.223 416.8 111.2 0.4975 0.0612 0.1229 25.5 13.7 18..8 0.214 416.8 111.2 0.4975 0.0588 0.1181 24.5 13.1 Time used: 11:13 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 5, ((((2, 3), 4), (((((6, 9), 10), ((7, 15), ((12, 14), 13))), 16), 11)), 8)); MP score: 559 lnL(ntime: 29 np: 34): -3621.601279 +0.000000 17..1 17..5 17..18 18..19 19..20 20..21 21..2 21..3 20..4 19..22 22..23 23..24 24..25 25..26 26..6 26..9 25..10 24..27 27..28 28..7 28..15 27..29 29..30 30..12 30..14 29..13 23..16 22..11 18..8 0.299555 0.124950 0.183399 0.021588 0.039966 0.004285 0.250305 0.233716 0.264537 0.026821 0.031909 0.046870 0.000945 0.000004 0.208664 0.307834 0.355119 0.140699 0.145258 0.159664 0.316256 0.079304 0.020117 0.156633 0.154860 0.177526 0.327570 0.231950 0.236068 2.614689 0.917900 0.515841 0.533389 3.399222 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 4.54637 (1: 0.299555, 5: 0.124950, ((((2: 0.250305, 3: 0.233716): 0.004285, 4: 0.264537): 0.039966, (((((6: 0.208664, 9: 0.307834): 0.000004, 10: 0.355119): 0.000945, ((7: 0.159664, 15: 0.316256): 0.145258, ((12: 0.156633, 14: 0.154860): 0.020117, 13: 0.177526): 0.079304): 0.140699): 0.046870, 16: 0.327570): 0.031909, 11: 0.231950): 0.026821): 0.021588, 8: 0.236068): 0.183399); (S5_SFBB1: 0.299555, S5_SFBB13: 0.124950, ((((S5_SFBB10: 0.250305, S5_SFBB11: 0.233716): 0.004285, S5_SFBB12: 0.264537): 0.039966, (((((S5_SFBB14: 0.208664, S5_SFBB18: 0.307834): 0.000004, S5_SFBB3: 0.355119): 0.000945, ((S5_SFBB16: 0.159664, S5_SFBB8: 0.316256): 0.145258, ((S5_SFBB5: 0.156633, S5_SFBB7: 0.154860): 0.020117, S5_SFBB6: 0.177526): 0.079304): 0.140699): 0.046870, S5_SSFBB2: 0.327570): 0.031909, S5_SFBB4: 0.231950): 0.026821): 0.021588, S5_SFBB17: 0.236068): 0.183399); Detailed output identifying parameters kappa (ts/tv) = 2.61469 Parameters in M8 (beta&w>1): p0 = 0.91790 p = 0.51584 q = 0.53339 (p1 = 0.08210) w = 3.39922 dN/dS (w) for site classes (K=11) p: 0.09179 0.09179 0.09179 0.09179 0.09179 0.09179 0.09179 0.09179 0.09179 0.09179 0.08210 w: 0.00672 0.05563 0.14535 0.26698 0.40965 0.56096 0.70770 0.83662 0.93513 0.99158 3.39922 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 17..1 0.300 414.7 113.3 0.7303 0.0925 0.1267 38.4 14.4 17..5 0.125 414.7 113.3 0.7303 0.0386 0.0528 16.0 6.0 17..18 0.183 414.7 113.3 0.7303 0.0566 0.0776 23.5 8.8 18..19 0.022 414.7 113.3 0.7303 0.0067 0.0091 2.8 1.0 19..20 0.040 414.7 113.3 0.7303 0.0123 0.0169 5.1 1.9 20..21 0.004 414.7 113.3 0.7303 0.0013 0.0018 0.5 0.2 21..2 0.250 414.7 113.3 0.7303 0.0773 0.1059 32.1 12.0 21..3 0.234 414.7 113.3 0.7303 0.0722 0.0988 29.9 11.2 20..4 0.265 414.7 113.3 0.7303 0.0817 0.1119 33.9 12.7 19..22 0.027 414.7 113.3 0.7303 0.0083 0.0113 3.4 1.3 22..23 0.032 414.7 113.3 0.7303 0.0099 0.0135 4.1 1.5 23..24 0.047 414.7 113.3 0.7303 0.0145 0.0198 6.0 2.2 24..25 0.001 414.7 113.3 0.7303 0.0003 0.0004 0.1 0.0 25..26 0.000 414.7 113.3 0.7303 0.0000 0.0000 0.0 0.0 26..6 0.209 414.7 113.3 0.7303 0.0644 0.0882 26.7 10.0 26..9 0.308 414.7 113.3 0.7303 0.0951 0.1302 39.4 14.8 25..10 0.355 414.7 113.3 0.7303 0.1097 0.1502 45.5 17.0 24..27 0.141 414.7 113.3 0.7303 0.0435 0.0595 18.0 6.7 27..28 0.145 414.7 113.3 0.7303 0.0449 0.0614 18.6 7.0 28..7 0.160 414.7 113.3 0.7303 0.0493 0.0675 20.4 7.7 28..15 0.316 414.7 113.3 0.7303 0.0977 0.1337 40.5 15.2 27..29 0.079 414.7 113.3 0.7303 0.0245 0.0335 10.2 3.8 29..30 0.020 414.7 113.3 0.7303 0.0062 0.0085 2.6 1.0 30..12 0.157 414.7 113.3 0.7303 0.0484 0.0662 20.1 7.5 30..14 0.155 414.7 113.3 0.7303 0.0478 0.0655 19.8 7.4 29..13 0.178 414.7 113.3 0.7303 0.0548 0.0751 22.7 8.5 23..16 0.328 414.7 113.3 0.7303 0.1012 0.1385 42.0 15.7 22..11 0.232 414.7 113.3 0.7303 0.0716 0.0981 29.7 11.1 18..8 0.236 414.7 113.3 0.7303 0.0729 0.0998 30.2 11.3 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: S5_SFBB1) Pr(w>1) post mean +- SE for w 8 L 0.730 2.730 21 G 0.620 2.447 36 R 0.916 3.192 44 I 0.999** 3.397 46 T 1.000** 3.398 63 Q 0.888 3.119 75 Q 0.685 2.612 78 Y 0.813 2.937 107 E 0.998** 3.394 110 C 0.970* 3.324 126 T 1.000** 3.399 128 E 0.978* 3.345 156 K 0.807 2.918 176 P 0.848 3.020 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: S5_SFBB1) Pr(w>1) post mean +- SE for w 8 L 0.648 2.455 +- 1.250 21 G 0.550 2.190 +- 1.271 36 R 0.878 3.129 +- 1.032 44 I 0.999** 3.484 +- 0.676 46 T 0.999** 3.485 +- 0.674 63 Q 0.858 3.086 +- 1.092 75 Q 0.622 2.402 +- 1.292 78 Y 0.745 2.738 +- 1.204 107 E 0.997** 3.478 +- 0.685 110 C 0.960* 3.373 +- 0.829 126 T 1.000** 3.486 +- 0.673 128 E 0.971* 3.407 +- 0.789 156 K 0.737 2.717 +- 1.218 176 P 0.799 2.906 +- 1.171 The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.296 0.703 p : 0.004 0.259 0.382 0.216 0.090 0.035 0.011 0.002 0.000 0.000 q : 0.004 0.261 0.321 0.175 0.106 0.059 0.034 0.020 0.012 0.008 ws: 0.000 0.220 0.586 0.183 0.011 0.000 0.000 0.000 0.000 0.000 Time used: 19:07
Model 1: NearlyNeutral -3649.488118 Model 2: PositiveSelection -3625.008556 Model 0: one-ratio -3727.832062 Model 3: discrete -3622.128473 Model 7: beta -3648.567478 Model 8: beta&w>1 -3621.601279 Model 0 vs 1 156.68788799999948 Model 2 vs 1 48.959123999999974 Additional information for M1 vs M2: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: S5_SFBB1) Pr(w>1) post mean +- SE for w 8 L 0.593 2.778 36 R 0.872 3.616 44 I 0.999** 3.996 46 T 1.000** 3.997 63 Q 0.845 3.533 75 Q 0.566 2.697 78 Y 0.709 3.125 107 E 0.998** 3.991 110 C 0.955* 3.863 126 T 1.000** 3.998 128 E 0.969* 3.905 156 K 0.705 3.114 176 P 0.761 3.283 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: S5_SFBB1) Pr(w>1) post mean +- SE for w 8 L 0.513 2.543 +- 1.562 36 R 0.824 3.594 +- 1.331 44 I 0.999** 4.201 +- 0.684 46 T 0.999** 4.203 +- 0.680 63 Q 0.812 3.580 +- 1.377 75 Q 0.505 2.550 +- 1.596 78 Y 0.636 2.955 +- 1.558 107 E 0.997** 4.194 +- 0.699 110 C 0.941 4.004 +- 0.994 126 T 1.000** 4.204 +- 0.677 128 E 0.960* 4.070 +- 0.910 156 K 0.630 2.939 +- 1.563 176 P 0.705 3.207 +- 1.524 Model 8 vs 7 53.93239799999992 Additional information for M7 vs M8: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: S5_SFBB1) Pr(w>1) post mean +- SE for w 8 L 0.730 2.730 21 G 0.620 2.447 36 R 0.916 3.192 44 I 0.999** 3.397 46 T 1.000** 3.398 63 Q 0.888 3.119 75 Q 0.685 2.612 78 Y 0.813 2.937 107 E 0.998** 3.394 110 C 0.970* 3.324 126 T 1.000** 3.399 128 E 0.978* 3.345 156 K 0.807 2.918 176 P 0.848 3.020 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: S5_SFBB1) Pr(w>1) post mean +- SE for w 8 L 0.648 2.455 +- 1.250 21 G 0.550 2.190 +- 1.271 36 R 0.878 3.129 +- 1.032 44 I 0.999** 3.484 +- 0.676 46 T 0.999** 3.485 +- 0.674 63 Q 0.858 3.086 +- 1.092 75 Q 0.622 2.402 +- 1.292 78 Y 0.745 2.738 +- 1.204 107 E 0.997** 3.478 +- 0.685 110 C 0.960* 3.373 +- 0.829 126 T 1.000** 3.486 +- 0.673 128 E 0.971* 3.407 +- 0.789 156 K 0.737 2.717 +- 1.218 176 P 0.799 2.906 +- 1.171