--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Nov 03 09:05:15 WET 2017
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS1/Srevisao1/S25_wo/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/Srevisao1/S25_wo/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS1/Srevisao1/S25_wo/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -6982.70         -7000.16
2      -6982.12         -7000.54
--------------------------------------
TOTAL    -6982.37         -7000.37
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS1/Srevisao1/S25_wo/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/Srevisao1/S25_wo/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS1/Srevisao1/S25_wo/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         1.322984    0.003197    1.215909    1.433289    1.321732   1438.33   1469.66    1.000
r(A<->C){all}   0.125737    0.000168    0.100958    0.153152    0.125412   1054.73   1127.91    1.000
r(A<->G){all}   0.297175    0.000367    0.260971    0.337011    0.296858    766.02    790.71    1.000
r(A<->T){all}   0.082423    0.000068    0.066726    0.099221    0.082064   1113.06   1131.78    1.001
r(C<->G){all}   0.160281    0.000259    0.125730    0.188794    0.160690    820.45    903.02    1.001
r(C<->T){all}   0.252500    0.000312    0.217481    0.287294    0.252582    708.35    813.60    1.000
r(G<->T){all}   0.081884    0.000090    0.064058    0.099915    0.081620   1183.83   1191.77    1.000
pi(A){all}      0.303576    0.000123    0.283136    0.325971    0.303335   1119.36   1222.25    1.000
pi(C){all}      0.175901    0.000078    0.159542    0.193615    0.175651    966.29   1149.92    1.000
pi(G){all}      0.187724    0.000084    0.171142    0.206984    0.187559    827.13    996.35    1.001
pi(T){all}      0.332799    0.000130    0.310492    0.353671    0.332934    901.06    942.52    1.000
alpha{1,2}      0.814956    0.019030    0.598967    1.099378    0.796088   1033.76   1160.63    1.000
alpha{3}        1.591647    0.170390    0.937624    2.428975    1.517846   1124.33   1261.68    1.000
pinvar{all}     0.050971    0.001568    0.000016    0.129532    0.042146   1176.77   1226.25    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-4614.937215
Model 2: PositiveSelection	-4576.620725
Model 0: one-ratio	-4730.681094
Model 3: discrete	-4576.210114
Model 7: beta	-4622.169065
Model 8: beta&w>1	-4577.413507


Model 0 vs 1	231.4877579999993

Model 2 vs 1	76.63298000000032

Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: S25_SFBB1)

            Pr(w>1)     post mean +- SE for w

    14 N      0.997**       4.110
    20 R      0.997**       4.111
    24 P      0.996**       4.107
    55 L      0.991**       4.092
    60 F      0.788         3.460
    62 E      0.993**       4.098
    64 G      0.710         3.217
   102 R      0.985*        4.075
   109 I      0.995**       4.106
   111 T      1.000**       4.119
   140 Q      0.879         3.743
   157 T      0.833         3.600
   172 E      0.964*        4.010
   175 C      0.995**       4.104
   191 T      0.999**       4.118
   193 E      0.948         3.959
   221 K      0.784         3.445
   238 C      0.683         3.133

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: S25_SFBB1)

            Pr(w>1)     post mean +- SE for w

    14 N      0.996**       4.292 +- 0.539
    20 R      0.996**       4.295 +- 0.532
    24 P      0.995**       4.289 +- 0.548
    55 L      0.988*        4.269 +- 0.605
    60 F      0.734         3.407 +- 1.509
    62 E      0.991**       4.278 +- 0.580
    64 G      0.642         3.092 +- 1.613
   102 R      0.981*        4.244 +- 0.664
   109 I      0.994**       4.287 +- 0.554
   111 T      1.000**       4.305 +- 0.498
   140 Q      0.852         3.814 +- 1.258
   157 T      0.787         3.587 +- 1.415
   172 E      0.951*        4.139 +- 0.861
   175 C      0.994**       4.286 +- 0.558
   191 T      0.999**       4.304 +- 0.503
   193 E      0.934         4.087 +- 0.948
   221 K      0.721         3.356 +- 1.526
   238 C      0.583         2.871 +- 1.627


Model 8 vs 7	89.51111599999967

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: S25_SFBB1)

            Pr(w>1)     post mean +- SE for w

     1 L      0.579         2.503
    14 N      0.998**       3.683
    20 R      0.998**       3.683
    24 P      0.997**       3.681
    55 L      0.995**       3.674
    60 F      0.873         3.334
    62 E      0.996**       3.676
    64 G      0.819         3.182
    75 A      0.636         2.668
   102 R      0.992**       3.665
   109 I      0.997**       3.680
   111 T      1.000**       3.688
   140 Q      0.922         3.470
   157 T      0.899         3.406
   172 E      0.982*        3.637
   175 C      0.997**       3.680
   191 T      1.000**       3.687
   193 E      0.970*        3.604
   221 K      0.870         3.326
   238 C      0.828         3.212

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: S25_SFBB1)

            Pr(w>1)     post mean +- SE for w

    14 N      0.997**       3.805 +- 0.568
    20 R      0.997**       3.806 +- 0.567
    24 P      0.996**       3.802 +- 0.576
    55 L      0.992**       3.790 +- 0.604
    60 F      0.805         3.206 +- 1.232
    62 E      0.993**       3.795 +- 0.595
    64 G      0.732         2.976 +- 1.340
    75 A      0.532         2.355 +- 1.429
   102 R      0.987*        3.774 +- 0.637
   109 I      0.996**       3.802 +- 0.577
   111 T      1.000**       3.813 +- 0.550
   140 Q      0.884         3.461 +- 1.063
   157 T      0.842         3.323 +- 1.162
   172 E      0.968*        3.712 +- 0.742
   175 C      0.996**       3.801 +- 0.579
   191 T      0.999**       3.812 +- 0.553
   193 E      0.952*        3.668 +- 0.817
   221 K      0.794         3.166 +- 1.249
   238 C      0.715         2.900 +- 1.329

>C1
LSSSTCILLNRCQNHVFPDRSWKPEVFWSLINLSIDSDDHNLHYDVEDLN
IPCPLEGHDFVEIGGYCNGIVCVLAWKTLHWIYVILCNPATGEFRQLPHS
CLLQPSRSRRKFELNTISTLLGFGYDCKAKEYKVVQVIENCEYSDAEQYD
YHRIALPHTAEVYTTTANSWREIKIDISSETYCYTCSVYLNGFCYWIATD
EEDFILSFDLGDEIFHRIQLPSRRDSDFKFSNLFLCNKSIASFGYCCNPS
DEDSTooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
o
>C2
MNESETPGDRVVEILSKLWPKSLMRFKCIRKSWCTLINSPSFVVKHLNNS
MDNKLSSSTCILVNRSQPHIFPDQNWKQEIFWSKINISIDSDEHNLHYDV
VDLNIPFPLEDHDFVQIHGYCSGIVCVIVGKHFLLCNPATREFKQLPDSC
LLLPTAEGKFELDTTFEALGFGFDCKAKEYKVVQIIENCEYSDDEQTFYH
CTTLPHTAEVYTTAANSWKEIKIDISSKTYSWSCSVYLKGFCYWYATDDE
EYVLSFDLGDETFHRIQLPSRGVSGFTFFYIFLCNGSLASFCSRYDGSGD
SQSCEIWVMGDYGKVKSSWTKLLTIESLQGIEKPLTFWKSDELLMLASNG
KATSYNSSSGNLKYVHIPPILNKVVDFQALIYVESIVSLKoooooooooo
o
>C3
KSLMRFKCIHKSWFSLINSLSFVGKHLSNFVDKKLSSSTCILLNRSHAHI
FPDQSWKQEVFWSMINFSIDNDENNLHYDVEDLNIPFPLNDHDFVLIFGY
CNGIVCVEAGKNVLLCNPATREFRQLPDSCLLLPSPPEGKFELETSFQAL
GFGYDCNAKEYKVLRIIENCEYSDEERTFYHRIALPHTAELYTATANSWK
EIKIDISSATYSCSRSVFLKGFCYWYATDGEEYVLSFDLGDDTFHIIQLP
PRRESGFRFYYIFLRNESLASFCSRYDRSEDSESCEIWVMDDYDRVKSSW
TKLLTIGPLQGIKKPLTFWKSDEVLMLDSDGRATSYNSNTRNLKYLHIPP
ILKRVVDFEVLIYVKSoooooooooooooooooooooooooooooooooo
o
>C4
ETPEDKVVEILSRLQPKSLMRFKCIHKSWCTLINSPSFVAKHLNNSMDNK
LSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI
IPFPLEDHDFVLIFGYCNGIICVDAGKNVLLCNPATREFRQLPDSCLLLP
PPKGKFELETTFQALGFGYDCNSKEYKVVRIIENCEYSDDEQTFHHRIAL
PHTAEVYTTAANSWKEIKIDISSQTYHCSCSVYLNGFCYWFASDSEEYIL
SFYLGDETFHIIQLPSRRESGFTFDYIFLRNESLASFCSPYNPSEDSKLF
EIWVMDDYDGVKSSWTKLLTVGPFKGIEYPLTLWKCDELLMLASDGRATS
YNSSTGNLKYLHIPPILNKVVDFEGLIYVKSIVPoooooooooooooooo
o
>C5
MSQVRESETLEDRVVETLSRLPPKSLIRFKCIRKSWCTLINNPSFVAKHL
NNSMDNKLSSSTCILLSRSQAHVFPDNSWKPEVFWSLINLSIDSDEHNLH
YDVEDLNIPFPLEGHDFVQIEGYCNGIVCVIAGTSLYLINVLLCNPATGK
FRQLPPSCLLLPSRPKGKFELESIFGGLGFGYDCKAKEYKVVQIIENCEY
SDDQQYYYHRIALPHTAEVYTMAANSWREIKIDLSSETFHCSYSVYLKGF
CYWLATNGEKYILSFDFGDKVFHRIQLPSRRESDFEFSNLFLCNNSMASF
FSCCDPSDEDSTLCEIWVoooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
o
>C6
MWNKIFEMSQARESETLEDKVVQILSRLPPKSLMRFKCTRKSWCTLINSS
SFVAKHLSNSIDNKLSSSTCILLNRSKMPVFLDKSWKYEILWSMIYLSID
SDEHNHHYDVEDLNIPFPLEDHHPVQIHGYCNGIICVIAGKTVIILCNPG
TREFRQLPDSCLLVPLPKEKFQLETIFGGLGFGYDCKAKEYKVVQIIENC
EYSNDERTFYHSIPLPHTAEVYTIAANSWKEIKIDISTKTYPSSCSVYLK
GFCYWFASDGEECILSFDLGDEIFHRIQLPSRRESSFKFYDIFLYNESIT
SYCSHYDPSDDSKLFEIWVMDDYDGSKSSWTKLLTVGPFKGIEYPLALWK
CDELLMLASNGRAISYNSSTGNLKYLHIPPIINEVIDFEALSYVESIVPI
K
>C7
KCIRKSWCTLINSPRFVAKHLNNSTDNKLSSSTRILLHRSQMPIFPCDSW
KREFFWSMINLSIDSDESNLHYDVEDLTNIPLLQWEDHHEVEIHGYCNGI
VCVTVGEYFFLCNPATGEFSQLPNSRLLLPLPGGKGKFGLETTVKGLGFG
YDCKAKEYKVVRIIENYDCEYSDGEETYIKHTALPHTAEVYTTTANSWKE
IQINISSKILSFYSYPYSCSLYLKGFCYWLSSDDEEYVFSFDLGDEIFDR
IELPSRRESGFKLDGIFLYNESITYYCTSYEECSRLFEIWVMDNYDGVKS
SWTKoooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
o
>C8
MSLVRESEIPEDRVVEILPRLSPKSLLRFKCIRKSWCTLINSPSFVAKQL
SNSVDNKFSSSTCILLNRSQTHVFPDNSWKQEVFWSMINLSlDSDEHNLH
YDVEDLNIPFPLEDHDYVLILGYCNGIVCVTAGKNILLCNPTTREFMRLP
SSCLLLPSRPKGKFELETVFRALGFGYDCKAKEYKVVQIIENSEYSDDER
TYYHRIPLPHTAEVYTTAANSWREIKIDISTKTYSCSCQVYLKGFCYWYA
TDAEEYILSFDLGDEIFHRIQLPSRRESGFKFYYIFLCNESIASFCSCYo
oooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
o
>C9
MTQVRESETPEDRVAEILSRLPPKSLMRFKCIRKSWYKVIKNPSFMAKHL
SKNSVDNKFSSSTCILLHRSQMPVFPDRSWKREYFWSMINLSHDSDKHNL
YYDVEDLNIQFPLEDHDHVSIHGYCNGIVCLIVGKNAVLYNPATRELKQL
PDSCLLLPSPPEGKFKLESTFQGMGFGYDSQAKEYKVVKIIENCEYSDDM
RTFSHRIALPHTAEVYVMTTNSWRVIEIEISSDTYNCSCSVYLKGFCYWF
ASDDEEYILSFDLGDEIFHRIQLPYRKESGFLFYNLFLYNESIASFCSHY
DKSDNSGILEILEIWVMDDCDGVKSSWTKLLTLGPFKDNENLLTFWKSDE
LLMVTSDKKTISYNSSTGNLKYIHIPPIINKVoooooooooooooooooo
o
>C10
MSLVRESEIPEDRVVEILPRLSPKSLLRFKCIrKSWCTLINSPSFVAKHL
NNSVDNKRSSSTCILLNRSQFHIFPDQSWKREVLWSMINLSSDSNVHNLH
YDVKPLNIPFSRDDHNPVQIHGYCNGIVCLIEGDNVLLCNPSTREFRLLP
NSCLLVPHPEGKFQLETTFHGMGFGYDCKANEYKVVQIVENCEYSDDEQT
YQHCIAYPYTAEVYTTAANFWKEIKIDISSSTHPYPFSVYLKGFCYWFAT
DGEECILSFDLGDEIFHRIQLPSKIESGFNFCGLFLYNESITSYCCRYDP
SEDSKLFEIWVMDooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
o
>C11
MSQVSESETPEDKVVEILSKLPPKSLMRFKCIRKSWCTIINSPSFVAKHL
SNSVDNKFSSSTCILLNRSQVHVFPDKSWKHEVLWSMIKFFNDRISRTLY
YDVEDLNIPFPRDDHQHVLIHGYCNGIVCVISGKNILLCNPATREFRQLP
DSFLVLPSPLSGKFELETDLGGLGFGYDCRAKDYKVVRIIENCEYSDDER
TYYNRIPLPHTSEVYTMATNSWKEIKIDISRKTYPCSCSVYLKGFCYWFT
RDGEEFILSFDLGDERFHRIQLPSRRESGLEFYYIFLCNESIASFCSLYD
RSEDSKLCEIWVMDDYDGVKSSWTKLLVAGPFKGIEKPLTLWKCDELLMI
DTNGRVISYNSSIGYLSYLHIPLIINRVIDSQALIYoooooooooooooo
o
>C12
KSLMRFKCIRKSWCSIINSPSFVAKHLSNSADNKLSSSTCILLNRCQVHV
FPDKNWKQDVFWSMINRSIDSDEHNLHYDVEDLNIPFPMEDQDNVDLHGY
CNGIVCVIVGKNVLLCNPATGEFRQLPDSSLLLPLPKGRFGLETIFKGLG
FGYDCKAKEYKVVRIIENCDCEYSEGEESYYERILLPHTAEVYTMNANSW
KEIKIDVTSDTDPYCIPYSCSVYLKGFCYWFAMDNGEYIFSFDLGDELFH
IIELPSRKESGFKFYGLFLYNESITSYCSHYEESNSKLFEIWVooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
o
>C13
MSQVHESETPEDKVVEILSRLSPKSLMRFKCVHRSWCTIISSPSFVAKHL
SNTVDNKFSSFTCILFNRCQVHVFPDRSWKRDVFWSMINLSIDSDEHNLH
YDVEDRNIPFPIEVQDNVQLYGYCNGIVCVIVGENVLLCNPATREFKQLP
DSSLLLPLPMGKFGLETLFKGLGFGYDCKTKEYKVVRIIENCDCEYSDGK
ESYIERILLPYTAEVYTTAANSWKEIKIDTSSDTDPYCIPYSCSLYLKGF
CYWFANDNGEYIFSFDLGDEMFHRIELPFRRESDFKFCGLFLYNESVASY
CSCYEEDCKLVEIWVMDDYDGVKSSWTKLLTVGPFKDIESPLKFWKCDEV
LILSSYGKATSYNSSTGNLKYFHIPPIINWMIDYVETIVSVKoooooooo
o
>C14
KSLMRFKCIRKSWCTFINSPSFVAKYLSNSVHNKLSSSTCILLNRTQMHV
FPDQSWKYETLWSMMNLSNYSDEHNLHYDFKDLNIPFPTEDHHPVQIHSY
CNGIVCVITGKSVRILCNPTTREFRQLPASCLLLPSPPQGKFQLETIFEG
LGFGYDYKAKEYKVVQIIENCEYSDDERRYYHRIALPHTAEVYTTTANSW
KEIKIEISSKTYQCYGSEYLKGFCYWLANDGDEYILSFDLGDEIFHIIQL
PSKRESGFKFYNIFLCNESIASFCCCYDPRNEDSTLCEIWVMDooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
o
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=14, Len=482 

C1              --------------------------------------------------
C2              ----------MNESETPGDRVVEILSKLWPKSLMRFKCIRKSWCTLINSP
C3              ------------------------------KSLMRFKCIHKSWFSLINSL
C4              --------------ETPEDKVVEILSRLQPKSLMRFKCIHKSWCTLINSP
C5              -------MSQVRESETLEDRVVETLSRLPPKSLIRFKCIRKSWCTLINNP
C6              MWNKIFEMSQARESETLEDKVVQILSRLPPKSLMRFKCTRKSWCTLINSS
C7              ------------------------------------KCIRKSWCTLINSP
C8              -------MSLVRESEIPEDRVVEILPRLSPKSLLRFKCIRKSWCTLINSP
C9              -------MTQVRESETPEDRVAEILSRLPPKSLMRFKCIRKSWYKVIKNP
C10             -------MSLVRESEIPEDRVVEILPRLSPKSLLRFKCIrKSWCTLINSP
C11             -------MSQVSESETPEDKVVEILSKLPPKSLMRFKCIRKSWCTIINSP
C12             ------------------------------KSLMRFKCIRKSWCSIINSP
C13             -------MSQVHESETPEDKVVEILSRLSPKSLMRFKCVHRSWCTIISSP
C14             ------------------------------KSLMRFKCIRKSWCTFINSP
                                                                  

C1              ---------------LSSSTCILLNRCQNHVFPDRSWKPEVFWSLINLSI
C2              SFVVKHLN-NSMDNKLSSSTCILVNRSQPHIFPDQNWKQEIFWSKINISI
C3              SFVGKHLS-NFVDKKLSSSTCILLNRSHAHIFPDQSWKQEVFWSMINFSI
C4              SFVAKHLN-NSMDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSI
C5              SFVAKHLN-NSMDNKLSSSTCILLSRSQAHVFPDNSWKPEVFWSLINLSI
C6              SFVAKHLS-NSIDNKLSSSTCILLNRSKMPVFLDKSWKYEILWSMIYLSI
C7              RFVAKHLN-NSTDNKLSSSTRILLHRSQMPIFPCDSWKREFFWSMINLSI
C8              SFVAKQLS-NSVDNKFSSSTCILLNRSQTHVFPDNSWKQEVFWSMINLSl
C9              SFMAKHLSKNSVDNKFSSSTCILLHRSQMPVFPDRSWKREYFWSMINLSH
C10             SFVAKHLN-NSVDNKRSSSTCILLNRSQFHIFPDQSWKREVLWSMINLSS
C11             SFVAKHLS-NSVDNKFSSSTCILLNRSQVHVFPDKSWKHEVLWSMIKFFN
C12             SFVAKHLS-NSADNKLSSSTCILLNRCQVHVFPDKNWKQDVFWSMINRSI
C13             SFVAKHLS-NTVDNKFSSFTCILFNRCQVHVFPDRSWKRDVFWSMINLSI
C14             SFVAKYLS-NSVHNKLSSSTCILLNRTQMHVFPDQSWKYETLWSMMNLSN
                                ** * **. * :  :*   .** : :** :    

C1              DSDDHNLHYDVEDLN-IP-CPLEGHDFVEIGGYCNGIVCVLAWKTLHWIY
C2              DSDEHNLHYDVVDLN-IP-FPLEDHDFVQIHGYCSGIVCVIVGKH-----
C3              DNDENNLHYDVEDLN-IP-FPLNDHDFVLIFGYCNGIVCVEAGKN-----
C4              DSDEHNLHYDVEDLI-IP-FPLEDHDFVLIFGYCNGIICVDAGKN-----
C5              DSDEHNLHYDVEDLN-IP-FPLEGHDFVQIEGYCNGIVCVIAGTSLYLIN
C6              DSDEHNHHYDVEDLN-IP-FPLEDHHPVQIHGYCNGIICVIAGKTV----
C7              DSDESNLHYDVEDLTNIPLLQWEDHHEVEIHGYCNGIVCVTVGEY-----
C8              DSDEHNLHYDVEDLN-IP-FPLEDHDYVLILGYCNGIVCVTAGKN-----
C9              DSDKHNLYYDVEDLN-IQ-FPLEDHDHVSIHGYCNGIVCLIVGKN-----
C10             DSNVHNLHYDVKPLN-IP-FSRDDHNPVQIHGYCNGIVCLIEGDN-----
C11             DRISRTLYYDVEDLN-IP-FPRDDHQHVLIHGYCNGIVCVISGKN-----
C12             DSDEHNLHYDVEDLN-IP-FPMEDQDNVDLHGYCNGIVCVIVGKN-----
C13             DSDEHNLHYDVEDRN-IP-FPIEVQDNVQLYGYCNGIVCVIVGEN-----
C14             YSDEHNLHYDFKDLN-IP-FPTEDHHPVQIHSYCNGIVCVITGKSV----
                     . :**.     *     : :. * : .**.**:*:          

C1              VILCNPATGEFRQLPHSCLLQPSR-SRRKFELNTISTLLGFGYDCKAKEY
C2              FLLCNPATREFKQLPDSCLLLP-T-AEGKFELDTTFEALGFGFDCKAKEY
C3              VLLCNPATREFRQLPDSCLLLPSP-PEGKFELETSFQALGFGYDCNAKEY
C4              VLLCNPATREFRQLPDSCLLLP-P-PKGKFELETTFQALGFGYDCNSKEY
C5              VLLCNPATGKFRQLPPSCLLLPSR-PKGKFELESIFGGLGFGYDCKAKEY
C6              IILCNPGTREFRQLPDSCLLVPLP-KE-KFQLETIFGGLGFGYDCKAKEY
C7              FFLCNPATGEFSQLPNSRLLLPLPGGKGKFGLETTVKGLGFGYDCKAKEY
C8              ILLCNPTTREFMRLPSSCLLLPSR-PKGKFELETVFRALGFGYDCKAKEY
C9              AVLYNPATRELKQLPDSCLLLPSP-PEGKFKLESTFQGMGFGYDSQAKEY
C10             VLLCNPSTREFRLLPNSCLLVPHP--EGKFQLETTFHGMGFGYDCKANEY
C11             ILLCNPATREFRQLPDSFLVLPSP-LSGKFELETDLGGLGFGYDCRAKDY
C12             VLLCNPATGEFRQLPDSSLLLPLP--KGRFGLETIFKGLGFGYDCKAKEY
C13             VLLCNPATREFKQLPDSSLLLP-L-PMGKFGLETLFKGLGFGYDCKTKEY
C14             RILCNPTTREFRQLPASCLLLPSP-PQGKFQLETIFEGLGFGYDYKAKEY
                 .* ** * ::  ** * *: *      :* *::    :***:* .:::*

C1              KVVQVIEN--CEYSDAEQYDYHRIALPHTAEVYTTTANSWREIKIDISSE
C2              KVVQIIEN--CEYSDDEQTFYHCTTLPHTAEVYTTAANSWKEIKIDISSK
C3              KVLRIIEN--CEYSDEERTFYHRIALPHTAELYTATANSWKEIKIDISSA
C4              KVVRIIEN--CEYSDDEQTFHHRIALPHTAEVYTTAANSWKEIKIDISSQ
C5              KVVQIIEN--CEYSDDQQYYYHRIALPHTAEVYTMAANSWREIKIDLSSE
C6              KVVQIIEN--CEYSNDERTFYHSIPLPHTAEVYTIAANSWKEIKIDISTK
C7              KVVRIIENYDCEYSDGEETYIKHTALPHTAEVYTTTANSWKEIQINISSK
C8              KVVQIIEN--SEYSDDERTYYHRIPLPHTAEVYTTAANSWREIKIDISTK
C9              KVVKIIEN--CEYSDDMRTFSHRIALPHTAEVYVMTTNSWRVIEIEISSD
C10             KVVQIVEN--CEYSDDEQTYQHCIAYPYTAEVYTTAANFWKEIKIDISSS
C11             KVVRIIEN--CEYSDDERTYYNRIPLPHTSEVYTMATNSWKEIKIDISRK
C12             KVVRIIENCDCEYSEGEESYYERILLPHTAEVYTMNANSWKEIKIDVTSD
C13             KVVRIIENCDCEYSDGKESYIERILLPYTAEVYTTAANSWKEIKIDTSSD
C14             KVVQIIEN--CEYSDDERRYYHRIALPHTAEVYTTTANSWKEIKIEISSK
                **::::**  .***:  .   .    *:*:*:*.  :* *: *:*: :  

C1              T-----YCYTCSVYLNGFCYWIATDEEDFILSFDLGDEIFHRIQLPSRRD
C2              T-----YSWSCSVYLKGFCYWYATDDEEYVLSFDLGDETFHRIQLPSRGV
C3              T-----YSCSRSVFLKGFCYWYATDGEEYVLSFDLGDDTFHIIQLPPRRE
C4              T-----YHCSCSVYLNGFCYWFASDSEEYILSFYLGDETFHIIQLPSRRE
C5              T-----FHCSYSVYLKGFCYWLATNGEKYILSFDFGDKVFHRIQLPSRRE
C6              T-----YPSSCSVYLKGFCYWFASDGEECILSFDLGDEIFHRIQLPSRRE
C7              ILSFYSYPYSCSLYLKGFCYWLSSDDEEYVFSFDLGDEIFDRIELPSRRE
C8              T-----YSCSCQVYLKGFCYWYATDAEEYILSFDLGDEIFHRIQLPSRRE
C9              T-----YNCSCSVYLKGFCYWFASDDEEYILSFDLGDEIFHRIQLPYRKE
C10             T-----HPYPFSVYLKGFCYWFATDGEECILSFDLGDEIFHRIQLPSKIE
C11             T-----YPCSCSVYLKGFCYWFTRDGEEFILSFDLGDERFHRIQLPSRRE
C12             TDP-YCIPYSCSVYLKGFCYWFAMDNGEYIFSFDLGDELFHIIELPSRKE
C13             TDP-YCIPYSCSLYLKGFCYWFANDNGEYIFSFDLGDEMFHRIELPFRRE
C14             T-----YQCYGSEYLKGFCYWLANDGDEYILSFDLGDEIFHIIQLPSKRE
                           . :*:***** : :  . ::** :**. *. *:** :  

C1              SDFKFSNLFLCNKSIASFGYCCNPSDED------SToooooooooooooo
C2              SGFTFFYIFLCNGSLASFCSRYDGSGDS---QSCEIWVMGDYGKVKSSWT
C3              SGFRFYYIFLRNESLASFCSRYDRSEDS---ESCEIWVMDDYDRVKSSWT
C4              SGFTFDYIFLRNESLASFCSPYNPSEDS---KLFEIWVMDDYDGVKSSWT
C5              SDFEFSNLFLCNNSMASFFSCCDPSDEDS--TLCEIWVoooooooooooo
C6              SSFKFYDIFLYNESITSYCSHYDPSDDS---KLFEIWVMDDYDGSKSSWT
C7              SGFKLDGIFLYNESITYYCTSYEEC-SR----LFEIWVMDNYDGVKSSWT
C8              SGFKFYYIFLCNESIASFCSCYoooooooooooooooooooooooooooo
C9              SGFLFYNLFLYNESIASFCSHYDKSDNSGILEILEIWVMDDCDGVKSSWT
C10             SGFNFCGLFLYNESITSYCCRYDPSEDS---KLFEIWVMDoooooooooo
C11             SGLEFYYIFLCNESIASFCSLYDRSEDS---KLCEIWVMDDYDGVKSSWT
C12             SGFKFYGLFLYNESITSYCSHYEESNSK----LFEIWVoooooooooooo
C13             SDFKFCGLFLYNESVASYCSCY--EEDC---KLVEIWVMDDYDGVKSSWT
C14             SGFKFYNIFLCNESIASFCCCYDPRNEDS--TLCEIWVMDoooooooooo
                *.: :  :** * *:: :                                

C1              oooooooooooooooooooooooooooooooooooooooooooooooooo
C2              KLLTIESLQGIEKPLTFWKSDELLMLASNGKATSYNSSSGNLKYVHIPPI
C3              KLLTIGPLQGIKKPLTFWKSDEVLMLDSDGRATSYNSNTRNLKYLHIPPI
C4              KLLTVGPFKGIEYPLTLWKCDELLMLASDGRATSYNSSTGNLKYLHIPPI
C5              oooooooooooooooooooooooooooooooooooooooooooooooooo
C6              KLLTVGPFKGIEYPLALWKCDELLMLASNGRAISYNSSTGNLKYLHIPPI
C7              Kooooooooooooooooooooooooooooooooooooooooooooooooo
C8              oooooooooooooooooooooooooooooooooooooooooooooooooo
C9              KLLTLGPFKDNENLLTFWKSDELLMVTSDKKTISYNSSTGNLKYIHIPPI
C10             oooooooooooooooooooooooooooooooooooooooooooooooooo
C11             KLLVAGPFKGIEKPLTLWKCDELLMIDTNGRVISYNSSIGYLSYLHIPLI
C12             oooooooooooooooooooooooooooooooooooooooooooooooooo
C13             KLLTVGPFKDIESPLKFWKCDEVLILSSYGKATSYNSSTGNLKYFHIPPI
C14             oooooooooooooooooooooooooooooooooooooooooooooooooo
                                                                  

C1              oooooooooooooooooooooooooooooooooooooooooooooooooo
C2              LNKVVDFQALIYVESIVSLKooooooooooo-------------------
C3              LKRVVDFEVLIYVKSooooooooooooooooooooooooooooooooooo
C4              LNKVVDFEGLIYVKSIVPooooooooooooooooo---------------
C5              ooooooooooooooooooooo-----------------------------
C6              INEVIDFEALSYVESIVPIK------------------------------
C7              oooooooooooooooooooooooooooooooooooooooooooooooo--
C8              oooooooooooooooooooooooo--------------------------
C9              INKVooooooooooooooooooo---------------------------
C10             oooooooooooooooooooooooooooo----------------------
C11             INRVIDSQALIYooooooooooooooo-----------------------
C12             oooooooooooooooooooooooooooooooooooooooooooooo----
C13             INWMIDYVETIVSVKooooooooo--------------------------
C14             oooooooooooooooooooooooooooooooooooooooooooooooo--
                                                                  

C1              oooooooooooooooooooooooooooooooo
C2              --------------------------------
C3              --------------------------------
C4              --------------------------------
C5              --------------------------------
C6              --------------------------------
C7              --------------------------------
C8              --------------------------------
C9              --------------------------------
C10             --------------------------------
C11             --------------------------------
C12             --------------------------------
C13             --------------------------------
C14             --------------------------------
                                                




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C14 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  401 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
set
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C14 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  401 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C14 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  401 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C14 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  401 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C14 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  401 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C14 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  401 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C14 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  401 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C14 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  401 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C14 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  401 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C14 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  401 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C14 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  401 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C14 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  401 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C14 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  401 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C14 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  401 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C14 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  401 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C14 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  401 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C14 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  401 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C14 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  401 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C14 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  401 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C14 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  401 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C14 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  401 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C14 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  401 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C14 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  401 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C14 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  401 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C14 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  401 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C13 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C14 Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  401 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.clustal