--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Dec 02 11:38:21 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/97/CG18428-PC/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/97/CG18428-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/97/CG18428-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/97/CG18428-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -636.04 -647.53
2 -636.06 -647.43
--------------------------------------
TOTAL -636.05 -647.48
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/97/CG18428-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/97/CG18428-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/97/CG18428-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.974838 0.037378 0.635684 1.359396 0.956569 1303.88 1376.33 1.000
r(A<->C){all} 0.062701 0.001248 0.001924 0.129022 0.057431 629.69 745.17 1.000
r(A<->G){all} 0.255102 0.006239 0.110713 0.413127 0.246868 412.99 453.43 1.000
r(A<->T){all} 0.123934 0.004326 0.010409 0.248683 0.116122 314.82 354.42 1.000
r(C<->G){all} 0.031451 0.000353 0.000132 0.066491 0.028339 972.63 1008.08 1.000
r(C<->T){all} 0.480777 0.009057 0.305363 0.662836 0.478004 350.34 443.64 1.000
r(G<->T){all} 0.046034 0.000979 0.000202 0.105632 0.039774 757.16 861.43 1.000
pi(A){all} 0.251260 0.000715 0.201453 0.305140 0.250715 1180.53 1246.57 1.000
pi(C){all} 0.289399 0.000775 0.236963 0.344295 0.288946 1122.45 1178.87 1.000
pi(G){all} 0.335334 0.000823 0.281282 0.392391 0.335209 1079.53 1178.75 1.000
pi(T){all} 0.124007 0.000374 0.087764 0.162542 0.123069 1043.47 1171.88 1.001
alpha{1,2} 0.066606 0.001071 0.001156 0.118569 0.069193 1009.59 1131.88 1.000
alpha{3} 2.018898 0.560860 0.770862 3.513536 1.896984 1364.33 1398.53 1.000
pinvar{all} 0.298303 0.009336 0.101346 0.479317 0.302789 1213.02 1293.17 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -587.693763
Model 2: PositiveSelection -586.083879
Model 0: one-ratio -595.14339
Model 3: discrete -586.083879
Model 7: beta -591.386125
Model 8: beta&w>1 -586.196792
Model 0 vs 1 14.899253999999928
Model 2 vs 1 3.219767999999931
Model 8 vs 7 10.378666000000067
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG18428-PC)
Pr(w>1) post mean +- SE for w
52 L 1.000** 4.373
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG18428-PC)
Pr(w>1) post mean +- SE for w
52 L 0.961* 5.788 +- 2.781
>C1
MNSKSHAPETPEEYQRRQSQIRKEVDPVTGRVRLIKGDSEVLEEIVTKER
HLEINKKATRGDGEFYEARSLDAAKRRK
>C2
MNSKSHAPETPEEYQRRQSQIRKEVDPVTGRVRLIKGDSEVLEEIVTKER
HLEINKKATRGDGEFYETRSLNAAKRRK
>C3
MNSKSHAPETPEEYQRRQSQIRKEVDPVTGRVRLIKGDSEVLEEIVTKER
HLEINKKATRGDGEFYEARSLNAAKRRK
>C4
MNSKSHAPETPEEYQRRQSQIRREVDPVTGRVRLIKGDSEVLEEIVTKER
HMEINKKATRGDGEFYEARSLDAAKRRK
>C5
MNSKSHAPETPEEYQRRQSQMRREVDPVTGRVRLIKGDSEVLEEIVTKER
HLEINKKATRGDGDFYEARSLDAAKRRK
>C6
MNSKSHAPETPEEYQRRQSQIRREVDPVTGRVRIIKGDSEVLEEIVTKER
HQEINKKATRGDGEFYEARSLDAARRRK
>C7
MNSKSHAPETPEEYQRRQSQIRREVDPVTGRVRLIKGDSEVLEEIVTKER
HVEINKKATRGDGEFYEARSLDAARRRK
>C8
MNSKSHAPETPEEYQRRQSQIRREVDPVTGRVRLIKGDSEVLEEIVTKER
HVEINKKATRGDGEFYEARSLDAARRRK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=8, Len=78
C1 MNSKSHAPETPEEYQRRQSQIRKEVDPVTGRVRLIKGDSEVLEEIVTKER
C2 MNSKSHAPETPEEYQRRQSQIRKEVDPVTGRVRLIKGDSEVLEEIVTKER
C3 MNSKSHAPETPEEYQRRQSQIRKEVDPVTGRVRLIKGDSEVLEEIVTKER
C4 MNSKSHAPETPEEYQRRQSQIRREVDPVTGRVRLIKGDSEVLEEIVTKER
C5 MNSKSHAPETPEEYQRRQSQMRREVDPVTGRVRLIKGDSEVLEEIVTKER
C6 MNSKSHAPETPEEYQRRQSQIRREVDPVTGRVRIIKGDSEVLEEIVTKER
C7 MNSKSHAPETPEEYQRRQSQIRREVDPVTGRVRLIKGDSEVLEEIVTKER
C8 MNSKSHAPETPEEYQRRQSQIRREVDPVTGRVRLIKGDSEVLEEIVTKER
********************:*:**********:****************
C1 HLEINKKATRGDGEFYEARSLDAAKRRK
C2 HLEINKKATRGDGEFYETRSLNAAKRRK
C3 HLEINKKATRGDGEFYEARSLNAAKRRK
C4 HMEINKKATRGDGEFYEARSLDAAKRRK
C5 HLEINKKATRGDGDFYEARSLDAAKRRK
C6 HQEINKKATRGDGEFYEARSLDAARRRK
C7 HVEINKKATRGDGEFYEARSLDAARRRK
C8 HVEINKKATRGDGEFYEARSLDAARRRK
* ***********:***:***:**:***
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 78 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 78 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4368]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [4368]--->[4368]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/97/CG18428-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.391 Mb, Max= 30.558 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MNSKSHAPETPEEYQRRQSQIRKEVDPVTGRVRLIKGDSEVLEEIVTKER
HLEINKKATRGDGEFYEARSLDAAKRRK
>C2
MNSKSHAPETPEEYQRRQSQIRKEVDPVTGRVRLIKGDSEVLEEIVTKER
HLEINKKATRGDGEFYETRSLNAAKRRK
>C3
MNSKSHAPETPEEYQRRQSQIRKEVDPVTGRVRLIKGDSEVLEEIVTKER
HLEINKKATRGDGEFYEARSLNAAKRRK
>C4
MNSKSHAPETPEEYQRRQSQIRREVDPVTGRVRLIKGDSEVLEEIVTKER
HMEINKKATRGDGEFYEARSLDAAKRRK
>C5
MNSKSHAPETPEEYQRRQSQMRREVDPVTGRVRLIKGDSEVLEEIVTKER
HLEINKKATRGDGDFYEARSLDAAKRRK
>C6
MNSKSHAPETPEEYQRRQSQIRREVDPVTGRVRIIKGDSEVLEEIVTKER
HQEINKKATRGDGEFYEARSLDAARRRK
>C7
MNSKSHAPETPEEYQRRQSQIRREVDPVTGRVRLIKGDSEVLEEIVTKER
HVEINKKATRGDGEFYEARSLDAARRRK
>C8
MNSKSHAPETPEEYQRRQSQIRREVDPVTGRVRLIKGDSEVLEEIVTKER
HVEINKKATRGDGEFYEARSLDAARRRK
FORMAT of file /tmp/tmp3025655214935219147aln Not Supported[FATAL:T-COFFEE]
>C1
MNSKSHAPETPEEYQRRQSQIRKEVDPVTGRVRLIKGDSEVLEEIVTKER
HLEINKKATRGDGEFYEARSLDAAKRRK
>C2
MNSKSHAPETPEEYQRRQSQIRKEVDPVTGRVRLIKGDSEVLEEIVTKER
HLEINKKATRGDGEFYETRSLNAAKRRK
>C3
MNSKSHAPETPEEYQRRQSQIRKEVDPVTGRVRLIKGDSEVLEEIVTKER
HLEINKKATRGDGEFYEARSLNAAKRRK
>C4
MNSKSHAPETPEEYQRRQSQIRREVDPVTGRVRLIKGDSEVLEEIVTKER
HMEINKKATRGDGEFYEARSLDAAKRRK
>C5
MNSKSHAPETPEEYQRRQSQMRREVDPVTGRVRLIKGDSEVLEEIVTKER
HLEINKKATRGDGDFYEARSLDAAKRRK
>C6
MNSKSHAPETPEEYQRRQSQIRREVDPVTGRVRIIKGDSEVLEEIVTKER
HQEINKKATRGDGEFYEARSLDAARRRK
>C7
MNSKSHAPETPEEYQRRQSQIRREVDPVTGRVRLIKGDSEVLEEIVTKER
HVEINKKATRGDGEFYEARSLDAARRRK
>C8
MNSKSHAPETPEEYQRRQSQIRREVDPVTGRVRLIKGDSEVLEEIVTKER
HVEINKKATRGDGEFYEARSLDAARRRK
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:78 S:100 BS:78
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# PW_SEQ_DISTANCES
BOT 0 1 97.44 C1 C2 97.44
TOP 1 0 97.44 C2 C1 97.44
BOT 0 2 98.72 C1 C3 98.72
TOP 2 0 98.72 C3 C1 98.72
BOT 0 3 97.44 C1 C4 97.44
TOP 3 0 97.44 C4 C1 97.44
BOT 0 4 96.15 C1 C5 96.15
TOP 4 0 96.15 C5 C1 96.15
BOT 0 5 94.87 C1 C6 94.87
TOP 5 0 94.87 C6 C1 94.87
BOT 0 6 96.15 C1 C7 96.15
TOP 6 0 96.15 C7 C1 96.15
BOT 0 7 96.15 C1 C8 96.15
TOP 7 0 96.15 C8 C1 96.15
BOT 1 2 98.72 C2 C3 98.72
TOP 2 1 98.72 C3 C2 98.72
BOT 1 3 94.87 C2 C4 94.87
TOP 3 1 94.87 C4 C2 94.87
BOT 1 4 93.59 C2 C5 93.59
TOP 4 1 93.59 C5 C2 93.59
BOT 1 5 92.31 C2 C6 92.31
TOP 5 1 92.31 C6 C2 92.31
BOT 1 6 93.59 C2 C7 93.59
TOP 6 1 93.59 C7 C2 93.59
BOT 1 7 93.59 C2 C8 93.59
TOP 7 1 93.59 C8 C2 93.59
BOT 2 3 96.15 C3 C4 96.15
TOP 3 2 96.15 C4 C3 96.15
BOT 2 4 94.87 C3 C5 94.87
TOP 4 2 94.87 C5 C3 94.87
BOT 2 5 93.59 C3 C6 93.59
TOP 5 2 93.59 C6 C3 93.59
BOT 2 6 94.87 C3 C7 94.87
TOP 6 2 94.87 C7 C3 94.87
BOT 2 7 94.87 C3 C8 94.87
TOP 7 2 94.87 C8 C3 94.87
BOT 3 4 96.15 C4 C5 96.15
TOP 4 3 96.15 C5 C4 96.15
BOT 3 5 96.15 C4 C6 96.15
TOP 5 3 96.15 C6 C4 96.15
BOT 3 6 97.44 C4 C7 97.44
TOP 6 3 97.44 C7 C4 97.44
BOT 3 7 97.44 C4 C8 97.44
TOP 7 3 97.44 C8 C4 97.44
BOT 4 5 93.59 C5 C6 93.59
TOP 5 4 93.59 C6 C5 93.59
BOT 4 6 94.87 C5 C7 94.87
TOP 6 4 94.87 C7 C5 94.87
BOT 4 7 94.87 C5 C8 94.87
TOP 7 4 94.87 C8 C5 94.87
BOT 5 6 97.44 C6 C7 97.44
TOP 6 5 97.44 C7 C6 97.44
BOT 5 7 97.44 C6 C8 97.44
TOP 7 5 97.44 C8 C6 97.44
BOT 6 7 100.00 C7 C8 100.00
TOP 7 6 100.00 C8 C7 100.00
AVG 0 C1 * 96.70
AVG 1 C2 * 94.87
AVG 2 C3 * 95.97
AVG 3 C4 * 96.52
AVG 4 C5 * 94.87
AVG 5 C6 * 95.05
AVG 6 C7 * 96.34
AVG 7 C8 * 96.34
TOT TOT * 95.83
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGAATAGCAAATCACATGCCCCGGAAACTCCAGAGGAATACCAGCGCCG
C2 ATGAATAGCAAATCACATGCCCCGGAAACTCCAGAGGAATACCAGCGCCG
C3 ATGAATAGCAAATCACATGCTCCGGAAACTCCAGAGGAATACCAGCGCCG
C4 ATGAATAGCAAATCGCATGCACCGGAAACTCCAGAGGAATACCAGCGCCG
C5 ATGAATAGCAAATCGCATGCACCGGAAACTCCAGAGGAATACCAGCGCCG
C6 ATGAACAGCAAATCCCATGCACCGGAGACTCCGGAGGAGTACCAGCGACG
C7 ATGAACAGCAAATCGCACGCACCGGAAACTCCAGAGGAGTACCAGCGCCG
C8 ATGAACAGCAAATCGCACGCACCGGAAACTCCGGAGGAGTACCAGCGCCG
***** ******** ** ** *****.*****.*****.********.**
C1 TCAGAGCCAGATCCGCAAAGAGGTGGACCCGGTGACGGGTCGCGTCCGGC
C2 TCAGAGCCAGATCCGCAAAGAGGTGGACCCGGTGACGGGCCGCGTCCGGC
C3 TCAGAGCCAGATCCGCAAAGAGGTGGACCCGGTGACGGGCCGCGTCCGGC
C4 TCAGAGCCAGATCCGCAGAGAGGTGGACCCGGTAACGGGTCGCGTCCGGC
C5 TCAGAGCCAGATGCGCAGGGAGGTTGATCCGGTCACGGGTCGCGTCCGGC
C6 CCAGAGCCAGATCCGCAGGGAGGTGGATCCGGTCACGGGACGCGTGCGCA
C7 CCAGAGCCAGATCCGAAGGGAGGTGGACCCGGTCACTGGACGCGTCCGCC
C8 CCAGAGCCAAATCCGCAGGGAAGTGGATCCGGTGACGGGACGCGTGCGCC
********.** **.*..**.** ** ***** ** ** ***** ** .
C1 TCATCAAAGGCGACAGTGAGGTGCTGGAAGAGATTGTGACCAAAGAGCGC
C2 TCATCAAAGGCGACAGTGAGGTGCTGGAAGAGATTGTGACCAAAGAGCGC
C3 TCATCAAAGGCGACAGTGAGGTGCTGGAAGAGATTGTGACCAAAGAGCGC
C4 TCATCAAGGGCGACAGTGAGGTGCTGGAAGAGATTGTGACCAAGGAGCGC
C5 TCATCAAAGGCGACAGTGAGGTACTGGAAGAGATTGTGACCAAGGAGCGC
C6 TCATCAAGGGCGACAGCGAGGTGCTGGAGGAGATTGTGACCAAGGAGCGC
C7 TCATCAAGGGCGACAGCGAAGTGCTGGAGGAGATTGTGACCAAGGAGCGC
C8 TCATTAAGGGCGACAGCGAGGTGCTGGAGGAGATCGTGACCAAGGAGCGC
**** **.******** **.**.*****.***** ********.******
C1 CACCTGGAGATCAACAAGAAGGCCACCCGCGGTGATGGAGAGTTCTACGA
C2 CACCTGGAGATCAACAAGAAGGCCACCCGCGGTGATGGAGAGTTCTACGA
C3 CACCTGGAGATCAACAAGAAGGCCACCCGCGGTGATGGAGAGTTCTACGA
C4 CACATGGAGATCAATAAAAAGGCCACCCGCGGCGATGGAGAGTTCTATGA
C5 CACTTGGAGATCAACAAAAAGGCCACCCGCGGCGATGGAGACTTCTACGA
C6 CACCAGGAGATCAACAAGAAGGCCACCCGCGGCGACGGCGAGTTCTACGA
C7 CACGTAGAGATCAACAAGAAGGCCACCCGCGGCGACGGCGAGTTCTATGA
C8 CACGTTGAGATCAACAAGAAGGCCACCCGCGGCGACGGCGAGTTTTACGA
*** : ******** **.************** ** **.** ** ** **
C1 AGCCAGATCTCTGGACGCCGCCAAGCGTCGCAAA
C2 AACCAGATCTCTGAACGCCGCCAAGCGTCGCAAA
C3 AGCCAGATCTCTGAACGCCGCCAAGCGTCGCAAA
C4 AGCCAGATCTCTGGATGCCGCCAAGCGTCGCAAA
C5 AGCTAGATCTCTGGATGCCGCCAAGCGTCGCAAA
C6 GGCCAGATCCCTGGACGCCGCCAGGCGACGCAAA
C7 GGCCAGATCTCTAGACGCCGCCAGGCGTCGCAAA
C8 GGCCAGATCTCTAGACGCCGCCAGGCGTCGCAAA
..* ***** **..* *******.***:******
>C1
ATGAATAGCAAATCACATGCCCCGGAAACTCCAGAGGAATACCAGCGCCG
TCAGAGCCAGATCCGCAAAGAGGTGGACCCGGTGACGGGTCGCGTCCGGC
TCATCAAAGGCGACAGTGAGGTGCTGGAAGAGATTGTGACCAAAGAGCGC
CACCTGGAGATCAACAAGAAGGCCACCCGCGGTGATGGAGAGTTCTACGA
AGCCAGATCTCTGGACGCCGCCAAGCGTCGCAAA
>C2
ATGAATAGCAAATCACATGCCCCGGAAACTCCAGAGGAATACCAGCGCCG
TCAGAGCCAGATCCGCAAAGAGGTGGACCCGGTGACGGGCCGCGTCCGGC
TCATCAAAGGCGACAGTGAGGTGCTGGAAGAGATTGTGACCAAAGAGCGC
CACCTGGAGATCAACAAGAAGGCCACCCGCGGTGATGGAGAGTTCTACGA
AACCAGATCTCTGAACGCCGCCAAGCGTCGCAAA
>C3
ATGAATAGCAAATCACATGCTCCGGAAACTCCAGAGGAATACCAGCGCCG
TCAGAGCCAGATCCGCAAAGAGGTGGACCCGGTGACGGGCCGCGTCCGGC
TCATCAAAGGCGACAGTGAGGTGCTGGAAGAGATTGTGACCAAAGAGCGC
CACCTGGAGATCAACAAGAAGGCCACCCGCGGTGATGGAGAGTTCTACGA
AGCCAGATCTCTGAACGCCGCCAAGCGTCGCAAA
>C4
ATGAATAGCAAATCGCATGCACCGGAAACTCCAGAGGAATACCAGCGCCG
TCAGAGCCAGATCCGCAGAGAGGTGGACCCGGTAACGGGTCGCGTCCGGC
TCATCAAGGGCGACAGTGAGGTGCTGGAAGAGATTGTGACCAAGGAGCGC
CACATGGAGATCAATAAAAAGGCCACCCGCGGCGATGGAGAGTTCTATGA
AGCCAGATCTCTGGATGCCGCCAAGCGTCGCAAA
>C5
ATGAATAGCAAATCGCATGCACCGGAAACTCCAGAGGAATACCAGCGCCG
TCAGAGCCAGATGCGCAGGGAGGTTGATCCGGTCACGGGTCGCGTCCGGC
TCATCAAAGGCGACAGTGAGGTACTGGAAGAGATTGTGACCAAGGAGCGC
CACTTGGAGATCAACAAAAAGGCCACCCGCGGCGATGGAGACTTCTACGA
AGCTAGATCTCTGGATGCCGCCAAGCGTCGCAAA
>C6
ATGAACAGCAAATCCCATGCACCGGAGACTCCGGAGGAGTACCAGCGACG
CCAGAGCCAGATCCGCAGGGAGGTGGATCCGGTCACGGGACGCGTGCGCA
TCATCAAGGGCGACAGCGAGGTGCTGGAGGAGATTGTGACCAAGGAGCGC
CACCAGGAGATCAACAAGAAGGCCACCCGCGGCGACGGCGAGTTCTACGA
GGCCAGATCCCTGGACGCCGCCAGGCGACGCAAA
>C7
ATGAACAGCAAATCGCACGCACCGGAAACTCCAGAGGAGTACCAGCGCCG
CCAGAGCCAGATCCGAAGGGAGGTGGACCCGGTCACTGGACGCGTCCGCC
TCATCAAGGGCGACAGCGAAGTGCTGGAGGAGATTGTGACCAAGGAGCGC
CACGTAGAGATCAACAAGAAGGCCACCCGCGGCGACGGCGAGTTCTATGA
GGCCAGATCTCTAGACGCCGCCAGGCGTCGCAAA
>C8
ATGAACAGCAAATCGCACGCACCGGAAACTCCGGAGGAGTACCAGCGCCG
CCAGAGCCAAATCCGCAGGGAAGTGGATCCGGTGACGGGACGCGTGCGCC
TCATTAAGGGCGACAGCGAGGTGCTGGAGGAGATCGTGACCAAGGAGCGC
CACGTTGAGATCAACAAGAAGGCCACCCGCGGCGACGGCGAGTTTTACGA
GGCCAGATCTCTAGACGCCGCCAGGCGTCGCAAA
>C1
MNSKSHAPETPEEYQRRQSQIRKEVDPVTGRVRLIKGDSEVLEEIVTKER
HLEINKKATRGDGEFYEARSLDAAKRRK
>C2
MNSKSHAPETPEEYQRRQSQIRKEVDPVTGRVRLIKGDSEVLEEIVTKER
HLEINKKATRGDGEFYETRSLNAAKRRK
>C3
MNSKSHAPETPEEYQRRQSQIRKEVDPVTGRVRLIKGDSEVLEEIVTKER
HLEINKKATRGDGEFYEARSLNAAKRRK
>C4
MNSKSHAPETPEEYQRRQSQIRREVDPVTGRVRLIKGDSEVLEEIVTKER
HMEINKKATRGDGEFYEARSLDAAKRRK
>C5
MNSKSHAPETPEEYQRRQSQMRREVDPVTGRVRLIKGDSEVLEEIVTKER
HLEINKKATRGDGDFYEARSLDAAKRRK
>C6
MNSKSHAPETPEEYQRRQSQIRREVDPVTGRVRIIKGDSEVLEEIVTKER
HQEINKKATRGDGEFYEARSLDAARRRK
>C7
MNSKSHAPETPEEYQRRQSQIRREVDPVTGRVRLIKGDSEVLEEIVTKER
HVEINKKATRGDGEFYEARSLDAARRRK
>C8
MNSKSHAPETPEEYQRRQSQIRREVDPVTGRVRLIKGDSEVLEEIVTKER
HVEINKKATRGDGEFYEARSLDAARRRK
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/97/CG18428-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 8 taxa and 234 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1480678330
Setting output file names to "/opt/ADOPS/97/CG18428-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1834896286
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 3463337272
Seed = 876113626
Swapseed = 1480678330
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 8 unique site patterns
Division 2 has 7 unique site patterns
Division 3 has 41 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -904.458320 -- -24.349928
Chain 2 -- -924.798836 -- -24.349928
Chain 3 -- -927.606130 -- -24.349928
Chain 4 -- -929.894366 -- -24.349928
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -961.268364 -- -24.349928
Chain 2 -- -964.836861 -- -24.349928
Chain 3 -- -926.171736 -- -24.349928
Chain 4 -- -876.077218 -- -24.349928
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-904.458] (-924.799) (-927.606) (-929.894) * [-961.268] (-964.837) (-926.172) (-876.077)
500 -- (-682.138) [-685.003] (-695.568) (-690.190) * (-689.825) (-686.767) [-682.058] (-689.094) -- 0:00:00
1000 -- [-672.267] (-667.194) (-692.318) (-685.474) * (-681.818) (-675.917) [-681.681] (-683.331) -- 0:00:00
1500 -- (-672.616) [-659.558] (-685.479) (-676.978) * (-673.800) (-677.136) [-652.133] (-678.418) -- 0:00:00
2000 -- (-678.953) [-653.309] (-667.527) (-679.942) * (-659.448) (-670.481) [-647.631] (-671.130) -- 0:00:00
2500 -- (-668.190) [-650.038] (-658.336) (-662.543) * [-657.348] (-657.215) (-644.150) (-663.207) -- 0:00:00
3000 -- (-650.141) [-648.245] (-644.811) (-664.072) * (-645.844) [-646.212] (-639.470) (-649.448) -- 0:00:00
3500 -- (-644.481) (-648.281) (-643.888) [-652.228] * (-652.450) [-648.276] (-642.023) (-649.619) -- 0:00:00
4000 -- (-653.443) (-655.265) (-647.609) [-648.698] * (-647.148) (-650.553) (-642.560) [-651.409] -- 0:00:00
4500 -- (-652.675) (-646.434) (-642.354) [-638.859] * (-648.674) (-644.464) (-645.559) [-643.953] -- 0:03:41
5000 -- (-641.391) [-648.396] (-648.848) (-648.316) * (-641.400) (-641.586) (-641.442) [-642.874] -- 0:03:19
Average standard deviation of split frequencies: 0.085710
5500 -- [-641.474] (-643.472) (-642.298) (-649.117) * (-641.683) [-640.019] (-641.373) (-645.429) -- 0:03:00
6000 -- (-651.498) (-646.001) [-646.604] (-636.473) * (-641.548) (-645.209) [-639.901] (-640.314) -- 0:02:45
6500 -- (-643.782) [-642.164] (-648.973) (-645.155) * (-637.969) [-636.144] (-640.335) (-642.568) -- 0:02:32
7000 -- (-641.959) (-650.243) [-637.593] (-642.957) * (-648.010) (-636.849) [-639.408] (-634.404) -- 0:02:21
7500 -- [-639.473] (-645.318) (-637.893) (-649.233) * (-647.546) (-643.254) (-644.641) [-640.508] -- 0:02:12
8000 -- [-639.830] (-651.543) (-646.176) (-644.968) * (-646.876) (-636.261) [-638.586] (-637.308) -- 0:02:04
8500 -- (-640.317) (-647.420) [-643.989] (-645.186) * [-639.627] (-637.937) (-640.499) (-636.848) -- 0:01:56
9000 -- [-639.459] (-652.816) (-651.492) (-641.381) * (-642.460) (-638.727) [-639.359] (-638.215) -- 0:01:50
9500 -- (-648.757) (-643.928) [-650.171] (-646.904) * [-644.218] (-645.754) (-637.789) (-634.722) -- 0:03:28
10000 -- (-644.588) [-646.558] (-650.563) (-642.555) * [-636.331] (-639.851) (-637.883) (-642.750) -- 0:03:18
Average standard deviation of split frequencies: 0.112494
10500 -- (-633.232) (-653.440) (-646.886) [-642.174] * (-643.231) (-650.227) (-639.525) [-638.240] -- 0:03:08
11000 -- (-640.404) (-645.866) [-643.515] (-637.762) * (-644.342) (-644.513) (-640.781) [-642.151] -- 0:02:59
11500 -- [-636.385] (-649.970) (-637.503) (-643.113) * (-642.641) (-639.869) [-637.895] (-638.824) -- 0:02:51
12000 -- (-640.825) (-647.384) [-646.969] (-637.519) * (-648.274) (-642.001) [-637.548] (-638.493) -- 0:02:44
12500 -- (-643.275) (-642.837) (-648.079) [-640.199] * (-647.016) (-641.065) [-638.276] (-647.842) -- 0:02:38
13000 -- [-637.215] (-642.258) (-642.120) (-647.809) * (-649.221) (-644.055) (-636.625) [-639.925] -- 0:02:31
13500 -- [-638.446] (-645.563) (-642.818) (-644.862) * (-642.610) (-644.203) (-641.308) [-637.829] -- 0:02:26
14000 -- (-640.712) [-637.540] (-642.978) (-644.284) * (-645.007) (-640.781) [-647.087] (-640.952) -- 0:03:31
14500 -- [-641.293] (-646.118) (-640.386) (-642.301) * (-636.386) (-640.171) [-640.899] (-638.750) -- 0:03:23
15000 -- [-637.384] (-648.755) (-642.827) (-643.885) * (-640.423) (-643.741) [-642.932] (-635.548) -- 0:03:17
Average standard deviation of split frequencies: 0.058926
15500 -- (-644.627) [-645.101] (-641.928) (-637.638) * (-642.576) (-642.314) (-646.880) [-636.399] -- 0:03:10
16000 -- (-637.158) [-639.993] (-646.137) (-639.505) * (-634.370) (-646.047) [-641.472] (-647.861) -- 0:03:04
16500 -- (-641.131) [-637.818] (-652.854) (-639.669) * (-645.798) (-651.643) (-641.508) [-645.717] -- 0:02:58
17000 -- (-640.902) [-646.681] (-648.231) (-636.645) * (-641.451) (-652.428) (-639.837) [-636.434] -- 0:02:53
17500 -- (-642.401) [-645.005] (-638.996) (-640.523) * (-639.865) (-643.451) (-639.659) [-636.929] -- 0:02:48
18000 -- (-637.667) (-652.565) (-644.385) [-634.762] * (-640.856) [-639.661] (-640.539) (-644.938) -- 0:02:43
18500 -- [-637.527] (-644.475) (-634.884) (-644.129) * [-643.597] (-635.393) (-645.553) (-646.302) -- 0:02:39
19000 -- (-640.593) [-642.462] (-637.138) (-641.486) * (-637.537) [-639.141] (-640.128) (-642.726) -- 0:03:26
19500 -- (-637.686) [-640.304] (-646.668) (-646.920) * (-637.907) [-641.656] (-639.199) (-641.596) -- 0:03:21
20000 -- (-638.427) [-643.242] (-644.242) (-642.851) * (-642.383) (-638.869) (-641.928) [-641.897] -- 0:03:16
Average standard deviation of split frequencies: 0.063361
20500 -- [-643.143] (-639.569) (-646.399) (-639.924) * (-644.594) (-644.890) [-635.811] (-639.338) -- 0:03:11
21000 -- [-635.312] (-647.929) (-640.090) (-644.777) * (-641.693) (-641.063) [-643.755] (-649.406) -- 0:03:06
21500 -- (-638.651) (-649.328) (-643.838) [-641.239] * (-640.949) (-647.450) [-637.993] (-641.252) -- 0:03:02
22000 -- (-636.932) (-646.062) (-636.924) [-642.429] * [-635.403] (-639.939) (-641.359) (-651.849) -- 0:02:57
22500 -- [-637.182] (-639.176) (-651.076) (-643.673) * (-641.746) (-645.209) (-640.446) [-638.565] -- 0:02:53
23000 -- (-639.050) (-640.503) [-639.273] (-642.943) * [-632.752] (-641.144) (-637.624) (-638.224) -- 0:02:49
23500 -- (-642.450) [-644.290] (-644.781) (-642.491) * (-633.608) (-638.924) [-640.700] (-641.353) -- 0:02:46
24000 -- (-640.325) (-643.330) [-640.952] (-645.984) * (-640.565) [-636.940] (-645.346) (-635.376) -- 0:03:23
24500 -- (-642.032) (-647.148) (-649.085) [-640.188] * [-638.684] (-644.909) (-646.947) (-636.662) -- 0:03:19
25000 -- (-642.063) (-637.719) [-644.823] (-641.466) * (-639.837) (-642.021) [-638.391] (-636.940) -- 0:03:15
Average standard deviation of split frequencies: 0.054393
25500 -- [-645.669] (-640.383) (-641.641) (-640.771) * (-632.971) [-643.966] (-638.984) (-635.282) -- 0:03:11
26000 -- (-649.116) [-640.733] (-645.306) (-651.437) * (-633.651) (-644.748) (-635.833) [-641.598] -- 0:03:07
26500 -- (-645.085) (-645.703) (-645.642) [-636.450] * (-637.209) (-642.584) (-639.044) [-643.268] -- 0:03:03
27000 -- [-639.272] (-641.703) (-641.686) (-651.851) * (-636.550) [-643.957] (-636.600) (-641.338) -- 0:03:00
27500 -- (-648.821) [-636.803] (-634.785) (-643.503) * (-644.192) (-650.622) [-643.254] (-646.833) -- 0:02:56
28000 -- (-647.362) [-645.960] (-639.439) (-644.515) * (-639.403) [-638.451] (-646.317) (-638.479) -- 0:02:53
28500 -- [-641.299] (-643.728) (-642.879) (-651.760) * [-639.597] (-641.593) (-643.790) (-639.152) -- 0:02:50
29000 -- (-648.742) (-654.371) [-633.484] (-649.732) * (-635.854) (-635.751) (-639.443) [-638.254] -- 0:03:20
29500 -- (-644.934) [-636.505] (-639.546) (-644.591) * (-644.479) (-644.229) (-647.852) [-641.464] -- 0:03:17
30000 -- (-644.932) (-636.254) [-638.436] (-645.068) * (-637.192) (-643.425) [-643.710] (-643.279) -- 0:03:14
Average standard deviation of split frequencies: 0.040992
30500 -- [-643.340] (-641.136) (-645.335) (-644.081) * (-647.298) (-646.472) [-639.458] (-643.456) -- 0:03:10
31000 -- (-639.378) (-636.792) [-642.564] (-640.198) * (-638.866) (-639.821) [-641.143] (-639.103) -- 0:03:07
31500 -- (-646.576) (-641.599) [-637.192] (-641.922) * (-635.736) (-637.710) (-639.079) [-637.603] -- 0:03:04
32000 -- (-644.837) (-636.853) (-636.354) [-640.245] * (-640.335) (-638.412) (-639.805) [-640.376] -- 0:03:01
32500 -- (-642.144) [-642.580] (-640.087) (-636.559) * (-637.037) (-643.712) (-646.137) [-637.568] -- 0:02:58
33000 -- (-644.898) [-640.486] (-646.170) (-638.173) * (-637.562) (-641.874) [-640.157] (-639.020) -- 0:02:55
33500 -- (-642.059) (-634.269) (-646.846) [-639.723] * (-642.207) (-638.835) [-632.003] (-645.498) -- 0:02:53
34000 -- (-655.714) [-640.626] (-637.922) (-646.852) * [-640.156] (-639.210) (-639.053) (-641.770) -- 0:03:18
34500 -- (-639.017) (-643.406) [-640.024] (-641.490) * (-636.413) (-644.958) (-637.687) [-642.187] -- 0:03:15
35000 -- (-643.181) (-636.531) (-645.189) [-640.708] * [-635.258] (-644.207) (-640.299) (-638.781) -- 0:03:13
Average standard deviation of split frequencies: 0.040739
35500 -- (-640.614) (-644.754) (-650.218) [-640.905] * [-632.703] (-645.736) (-642.191) (-641.650) -- 0:03:10
36000 -- (-636.516) (-645.242) (-641.579) [-636.807] * (-638.863) (-647.398) (-637.519) [-640.305] -- 0:03:07
36500 -- (-637.277) (-641.010) (-638.772) [-633.735] * [-643.151] (-638.559) (-643.325) (-643.509) -- 0:03:04
37000 -- (-638.001) (-645.564) (-640.207) [-639.910] * (-640.578) (-651.591) [-636.723] (-652.284) -- 0:03:02
37500 -- [-635.513] (-645.468) (-640.592) (-642.205) * [-636.437] (-648.893) (-642.034) (-639.849) -- 0:02:59
38000 -- (-640.056) (-646.758) [-633.727] (-641.189) * [-635.490] (-636.671) (-633.979) (-647.929) -- 0:02:57
38500 -- [-633.713] (-641.016) (-644.320) (-637.386) * (-643.449) (-643.126) [-637.332] (-645.289) -- 0:03:19
39000 -- (-637.524) [-638.478] (-649.650) (-642.297) * [-634.077] (-646.961) (-642.753) (-641.456) -- 0:03:17
39500 -- (-635.429) [-644.353] (-643.966) (-648.798) * (-649.746) (-636.751) [-637.593] (-646.342) -- 0:03:14
40000 -- [-642.355] (-638.243) (-647.097) (-645.351) * (-643.509) (-640.195) (-636.679) [-637.614] -- 0:03:12
Average standard deviation of split frequencies: 0.034776
40500 -- (-639.934) (-646.195) [-641.171] (-644.691) * (-639.288) (-642.632) [-637.141] (-644.854) -- 0:03:09
41000 -- [-634.821] (-646.886) (-644.401) (-649.943) * (-638.426) (-642.374) [-644.426] (-638.507) -- 0:03:07
41500 -- (-647.144) (-646.517) [-642.268] (-644.558) * [-641.969] (-639.648) (-638.224) (-641.933) -- 0:03:04
42000 -- [-640.438] (-646.892) (-636.520) (-646.750) * (-642.269) (-639.520) [-639.179] (-645.189) -- 0:03:02
42500 -- (-640.607) (-648.289) [-641.977] (-646.741) * (-648.185) (-645.819) (-644.749) [-640.867] -- 0:03:00
43000 -- (-645.710) [-636.226] (-637.254) (-638.939) * [-642.221] (-638.939) (-636.815) (-645.412) -- 0:02:58
43500 -- [-641.322] (-638.839) (-646.531) (-638.267) * (-645.302) [-640.842] (-639.593) (-638.337) -- 0:03:17
44000 -- (-646.379) (-633.519) [-643.688] (-637.346) * (-636.262) [-635.401] (-640.815) (-639.342) -- 0:03:15
44500 -- [-643.675] (-645.775) (-646.330) (-648.257) * [-645.728] (-644.081) (-639.462) (-644.027) -- 0:03:13
45000 -- [-641.720] (-645.323) (-639.039) (-640.657) * (-645.351) [-637.791] (-637.624) (-649.155) -- 0:03:11
Average standard deviation of split frequencies: 0.034843
45500 -- [-639.216] (-644.225) (-645.069) (-644.722) * (-644.821) [-639.824] (-638.390) (-642.010) -- 0:03:08
46000 -- (-639.618) (-646.405) (-641.123) [-641.509] * [-641.700] (-641.816) (-636.077) (-638.628) -- 0:03:06
46500 -- [-642.966] (-649.725) (-642.902) (-644.373) * (-635.839) (-647.345) [-638.831] (-643.195) -- 0:03:04
47000 -- [-638.118] (-638.824) (-635.440) (-642.050) * [-639.361] (-638.694) (-639.046) (-644.065) -- 0:03:02
47500 -- (-642.773) (-639.031) [-637.863] (-641.701) * (-643.033) [-639.083] (-640.466) (-637.387) -- 0:03:00
48000 -- (-650.547) (-638.560) [-637.777] (-640.540) * (-637.156) [-636.975] (-645.507) (-640.084) -- 0:02:58
48500 -- (-640.339) [-638.325] (-637.624) (-640.361) * (-648.075) [-645.954] (-639.787) (-635.677) -- 0:03:16
49000 -- (-647.827) (-638.664) (-640.434) [-649.335] * (-638.164) (-646.434) (-640.287) [-638.294] -- 0:03:14
49500 -- (-644.348) [-637.227] (-642.829) (-645.306) * (-638.485) (-639.487) [-640.804] (-637.629) -- 0:03:12
50000 -- [-635.668] (-640.481) (-643.114) (-651.104) * [-635.934] (-640.121) (-641.660) (-643.033) -- 0:03:10
Average standard deviation of split frequencies: 0.032564
50500 -- (-643.528) [-639.205] (-641.831) (-645.668) * (-641.936) (-638.059) (-643.719) [-641.580] -- 0:03:08
51000 -- [-638.570] (-635.693) (-646.894) (-644.238) * (-646.815) (-647.069) (-638.230) [-641.875] -- 0:03:06
51500 -- [-639.455] (-647.035) (-641.895) (-647.308) * (-651.360) (-640.537) (-639.901) [-650.726] -- 0:03:04
52000 -- [-642.913] (-636.724) (-640.974) (-639.434) * [-638.173] (-638.239) (-654.042) (-658.414) -- 0:03:02
52500 -- (-640.580) (-635.038) [-639.275] (-641.028) * [-638.953] (-637.428) (-646.979) (-655.083) -- 0:03:00
53000 -- (-643.524) (-635.943) [-639.202] (-643.276) * (-640.614) [-638.867] (-641.720) (-654.615) -- 0:02:58
53500 -- [-641.509] (-639.299) (-634.806) (-640.797) * (-636.876) [-633.973] (-647.751) (-648.286) -- 0:03:14
54000 -- (-638.708) (-637.846) [-642.021] (-647.270) * (-646.716) [-640.586] (-644.879) (-645.977) -- 0:03:12
54500 -- [-646.426] (-641.321) (-634.441) (-641.842) * (-649.134) (-641.349) (-641.308) [-643.440] -- 0:03:10
55000 -- [-641.915] (-639.862) (-637.804) (-648.677) * (-646.857) [-638.868] (-644.990) (-641.715) -- 0:03:09
Average standard deviation of split frequencies: 0.031988
55500 -- [-638.666] (-640.094) (-638.668) (-652.159) * (-649.842) (-644.242) (-644.317) [-639.424] -- 0:03:07
56000 -- (-639.652) [-641.071] (-652.504) (-644.651) * [-640.231] (-642.360) (-644.834) (-642.313) -- 0:03:05
56500 -- (-635.021) [-635.303] (-645.553) (-645.219) * [-651.476] (-637.780) (-643.299) (-639.426) -- 0:03:03
57000 -- (-646.817) [-640.965] (-638.434) (-644.530) * [-638.621] (-639.793) (-643.433) (-635.811) -- 0:03:01
57500 -- (-647.970) (-637.811) (-644.801) [-647.155] * (-644.276) (-639.218) [-636.949] (-645.363) -- 0:03:00
58000 -- (-639.327) [-635.225] (-641.601) (-648.319) * [-646.681] (-638.431) (-639.730) (-644.779) -- 0:02:58
58500 -- (-646.923) [-641.319] (-645.461) (-654.390) * [-640.644] (-644.157) (-642.315) (-641.535) -- 0:03:13
59000 -- (-645.527) (-644.922) (-638.299) [-643.951] * (-639.559) (-646.000) [-637.731] (-634.310) -- 0:03:11
59500 -- (-641.440) [-644.392] (-643.162) (-658.236) * (-643.351) [-641.800] (-639.817) (-638.066) -- 0:03:09
60000 -- [-639.807] (-634.889) (-641.433) (-644.914) * (-645.158) [-643.560] (-643.911) (-637.575) -- 0:03:08
Average standard deviation of split frequencies: 0.031945
60500 -- (-638.265) [-639.217] (-639.699) (-639.756) * [-637.598] (-633.729) (-641.677) (-638.300) -- 0:03:06
61000 -- (-639.636) [-637.832] (-639.899) (-646.362) * (-652.261) (-639.257) (-646.383) [-633.921] -- 0:03:04
61500 -- (-639.307) (-642.651) [-643.138] (-649.201) * (-642.853) [-636.430] (-638.031) (-641.916) -- 0:03:03
62000 -- [-638.564] (-647.379) (-649.577) (-647.079) * [-640.180] (-638.282) (-640.539) (-646.917) -- 0:03:01
62500 -- (-647.433) (-637.347) (-654.494) [-638.035] * (-638.966) [-642.098] (-641.286) (-645.889) -- 0:03:00
63000 -- (-645.820) [-637.994] (-635.379) (-646.927) * (-638.588) (-639.298) [-636.661] (-655.756) -- 0:03:13
63500 -- (-643.144) (-639.328) [-638.826] (-647.968) * (-638.241) (-645.973) (-644.746) [-643.401] -- 0:03:11
64000 -- [-641.100] (-636.221) (-641.313) (-638.581) * [-643.437] (-644.047) (-641.665) (-639.719) -- 0:03:10
64500 -- (-641.491) [-640.201] (-640.003) (-647.472) * (-644.376) [-637.237] (-653.771) (-641.671) -- 0:03:08
65000 -- (-635.209) (-642.204) (-648.762) [-636.532] * (-644.901) [-636.299] (-638.882) (-642.928) -- 0:03:07
Average standard deviation of split frequencies: 0.026189
65500 -- (-648.494) [-640.513] (-641.822) (-643.091) * (-645.382) [-641.856] (-640.159) (-641.330) -- 0:03:05
66000 -- [-639.390] (-640.495) (-644.564) (-649.311) * (-648.335) [-633.065] (-635.542) (-636.626) -- 0:03:03
66500 -- [-642.076] (-649.800) (-640.962) (-641.556) * (-647.744) [-642.100] (-634.040) (-645.949) -- 0:03:02
67000 -- [-640.163] (-648.541) (-644.918) (-641.727) * (-644.763) [-647.581] (-642.526) (-646.069) -- 0:03:01
67500 -- (-642.285) [-641.644] (-639.465) (-636.121) * (-647.129) [-636.115] (-642.259) (-638.893) -- 0:02:59
68000 -- (-645.144) [-644.570] (-639.427) (-633.254) * (-651.921) (-641.687) (-636.399) [-638.955] -- 0:03:11
68500 -- (-645.278) (-639.283) [-642.537] (-642.937) * (-642.062) (-650.226) [-639.638] (-645.252) -- 0:03:10
69000 -- (-646.674) (-642.950) (-638.336) [-634.653] * (-639.017) (-651.158) (-638.099) [-649.556] -- 0:03:08
69500 -- [-640.367] (-642.507) (-637.320) (-642.919) * (-639.597) [-637.324] (-637.461) (-638.838) -- 0:03:07
70000 -- [-635.246] (-639.021) (-635.860) (-639.989) * (-637.491) (-637.870) [-636.376] (-642.633) -- 0:03:06
Average standard deviation of split frequencies: 0.025942
70500 -- (-635.374) (-644.368) [-635.807] (-642.285) * (-644.785) [-638.912] (-645.298) (-645.226) -- 0:03:04
71000 -- (-644.685) (-647.522) [-640.211] (-640.036) * (-641.947) (-644.308) [-645.295] (-645.065) -- 0:03:03
71500 -- (-643.561) (-637.016) [-638.628] (-643.766) * (-648.691) (-638.992) (-645.475) [-637.949] -- 0:03:01
72000 -- [-644.768] (-651.869) (-651.520) (-641.490) * [-637.159] (-642.888) (-648.020) (-637.856) -- 0:03:00
72500 -- [-646.645] (-642.650) (-642.986) (-637.944) * (-642.605) (-639.102) (-645.535) [-633.704] -- 0:02:59
73000 -- [-641.666] (-646.574) (-635.667) (-644.536) * (-637.130) [-643.465] (-649.540) (-645.264) -- 0:03:10
73500 -- (-643.852) [-647.742] (-635.128) (-643.714) * [-637.430] (-646.090) (-641.661) (-636.844) -- 0:03:09
74000 -- [-640.246] (-641.277) (-644.395) (-641.254) * [-635.859] (-641.408) (-646.065) (-640.047) -- 0:03:07
74500 -- [-640.638] (-640.753) (-636.053) (-649.491) * [-638.640] (-644.288) (-651.487) (-634.179) -- 0:03:06
75000 -- (-644.578) (-647.481) [-644.098] (-640.713) * (-642.786) (-647.953) (-643.729) [-639.004] -- 0:03:05
Average standard deviation of split frequencies: 0.028946
75500 -- (-648.994) (-643.301) (-640.432) [-644.901] * (-637.958) (-641.277) [-637.933] (-637.582) -- 0:03:03
76000 -- (-640.662) [-639.942] (-645.206) (-646.188) * (-644.074) (-644.019) (-638.518) [-642.659] -- 0:03:02
76500 -- (-640.929) (-645.064) (-640.794) [-639.368] * (-642.863) [-638.444] (-647.833) (-640.128) -- 0:03:01
77000 -- [-634.255] (-637.987) (-636.815) (-648.118) * (-643.712) [-634.860] (-645.513) (-637.819) -- 0:02:59
77500 -- (-638.609) (-639.808) [-642.403] (-646.510) * (-636.557) (-640.089) (-639.357) [-641.487] -- 0:02:58
78000 -- (-647.021) (-638.423) (-643.780) [-650.173] * [-639.627] (-645.133) (-644.215) (-650.865) -- 0:03:09
78500 -- (-642.764) [-640.548] (-640.643) (-645.810) * (-643.720) (-641.989) [-639.417] (-644.227) -- 0:03:07
79000 -- [-636.012] (-638.066) (-643.562) (-648.664) * [-640.510] (-639.984) (-638.382) (-640.670) -- 0:03:06
79500 -- (-641.968) (-640.411) [-637.468] (-641.283) * [-636.857] (-635.839) (-640.310) (-644.408) -- 0:03:05
80000 -- (-645.609) [-636.604] (-639.806) (-637.082) * (-644.543) [-636.206] (-644.754) (-637.999) -- 0:03:04
Average standard deviation of split frequencies: 0.027271
80500 -- (-641.412) (-638.432) [-637.465] (-641.241) * (-649.151) (-640.874) [-635.833] (-647.398) -- 0:03:02
81000 -- (-641.343) (-638.776) [-641.227] (-641.737) * (-641.107) (-639.435) (-644.893) [-642.545] -- 0:03:01
81500 -- (-651.050) (-636.287) (-640.154) [-639.968] * (-646.715) (-642.601) [-646.653] (-645.405) -- 0:03:00
82000 -- (-657.990) (-638.519) [-645.068] (-639.771) * (-651.886) (-639.922) (-642.755) [-639.328] -- 0:02:59
82500 -- (-638.116) (-636.918) (-644.171) [-636.854] * (-649.018) (-644.647) [-639.147] (-637.428) -- 0:02:57
83000 -- (-636.061) [-634.086] (-638.695) (-645.876) * [-645.956] (-635.698) (-638.555) (-639.449) -- 0:03:07
83500 -- [-641.494] (-646.458) (-634.435) (-641.545) * (-648.793) [-637.524] (-648.745) (-641.395) -- 0:03:06
84000 -- [-639.984] (-641.076) (-648.924) (-636.954) * (-639.094) (-645.485) [-639.493] (-639.602) -- 0:03:05
84500 -- (-646.848) (-641.332) [-651.077] (-639.109) * (-637.196) [-640.731] (-640.020) (-637.546) -- 0:03:04
85000 -- [-636.099] (-645.470) (-644.644) (-642.144) * (-643.719) (-645.175) [-636.893] (-646.698) -- 0:03:03
Average standard deviation of split frequencies: 0.031671
85500 -- (-642.536) (-635.026) (-638.143) [-646.164] * [-636.205] (-634.642) (-638.454) (-642.322) -- 0:03:01
86000 -- (-642.781) (-641.713) [-639.183] (-639.540) * [-640.366] (-640.449) (-642.544) (-637.577) -- 0:03:00
86500 -- [-642.041] (-643.432) (-638.746) (-636.348) * (-646.252) [-635.282] (-638.676) (-642.995) -- 0:02:59
87000 -- (-639.222) (-640.799) (-638.710) [-639.240] * (-661.292) (-646.228) [-635.962] (-637.807) -- 0:02:58
87500 -- [-634.112] (-642.191) (-644.955) (-637.440) * (-649.127) [-642.720] (-641.878) (-641.713) -- 0:02:57
88000 -- (-644.132) [-635.248] (-642.348) (-640.979) * (-647.302) [-637.374] (-644.468) (-641.406) -- 0:03:06
88500 -- (-641.946) (-642.177) (-643.999) [-642.146] * (-645.012) [-634.248] (-640.295) (-636.038) -- 0:03:05
89000 -- (-649.743) (-642.124) (-640.691) [-641.198] * (-642.691) [-643.918] (-643.743) (-637.142) -- 0:03:04
89500 -- [-640.645] (-643.071) (-648.096) (-642.720) * (-644.003) (-634.755) (-641.354) [-642.330] -- 0:03:03
90000 -- (-640.439) (-638.521) (-639.577) [-641.508] * [-637.032] (-642.671) (-633.158) (-638.410) -- 0:03:02
Average standard deviation of split frequencies: 0.030040
90500 -- [-639.692] (-641.270) (-635.312) (-648.311) * (-641.228) [-635.559] (-641.400) (-638.634) -- 0:03:00
91000 -- [-634.318] (-642.993) (-632.855) (-639.984) * [-646.119] (-643.960) (-646.879) (-638.961) -- 0:02:59
91500 -- (-640.204) [-641.571] (-643.555) (-645.258) * (-644.708) (-641.334) (-644.928) [-637.526] -- 0:02:58
92000 -- (-645.517) [-634.870] (-641.751) (-635.759) * (-642.750) [-641.034] (-639.901) (-644.054) -- 0:02:57
92500 -- [-641.672] (-644.309) (-644.363) (-646.013) * (-638.309) (-641.886) (-637.718) [-643.990] -- 0:03:06
93000 -- (-643.736) (-640.896) (-644.857) [-639.488] * (-640.435) [-639.123] (-644.257) (-642.788) -- 0:03:05
93500 -- (-641.613) [-641.624] (-641.526) (-643.627) * (-642.678) [-645.085] (-641.410) (-648.093) -- 0:03:04
94000 -- [-641.110] (-640.699) (-643.140) (-643.533) * [-643.487] (-636.862) (-641.169) (-638.894) -- 0:03:03
94500 -- (-635.523) (-643.304) [-638.965] (-641.076) * [-642.754] (-639.679) (-635.648) (-640.298) -- 0:03:02
95000 -- [-633.954] (-648.398) (-639.357) (-638.090) * (-641.548) (-640.642) [-633.925] (-643.881) -- 0:03:01
Average standard deviation of split frequencies: 0.026025
95500 -- (-646.589) (-642.480) [-640.213] (-644.538) * [-642.520] (-642.391) (-637.283) (-644.185) -- 0:02:59
96000 -- (-644.045) (-639.808) [-635.571] (-643.530) * [-642.278] (-645.136) (-642.131) (-644.060) -- 0:02:58
96500 -- (-642.343) (-637.271) [-638.389] (-653.533) * (-647.185) (-643.129) (-642.954) [-635.807] -- 0:02:57
97000 -- [-634.119] (-637.583) (-637.889) (-643.305) * (-643.655) [-639.116] (-644.304) (-643.245) -- 0:02:56
97500 -- (-637.621) [-644.800] (-634.459) (-643.414) * [-642.764] (-643.111) (-645.616) (-641.204) -- 0:03:05
98000 -- [-646.992] (-638.869) (-640.713) (-641.837) * (-648.090) (-643.437) (-646.281) [-636.898] -- 0:03:04
98500 -- (-640.588) (-639.777) (-637.223) [-638.405] * (-639.804) (-641.360) (-646.418) [-639.058] -- 0:03:03
99000 -- [-641.447] (-643.459) (-641.304) (-637.569) * (-641.123) (-638.848) [-644.218] (-646.828) -- 0:03:02
99500 -- [-636.672] (-647.139) (-637.453) (-645.470) * (-638.504) (-640.225) (-646.310) [-641.106] -- 0:03:01
100000 -- (-633.886) [-638.292] (-639.775) (-648.077) * (-643.473) (-640.337) [-641.169] (-640.788) -- 0:03:00
Average standard deviation of split frequencies: 0.026016
100500 -- (-637.419) [-641.816] (-637.183) (-641.121) * (-643.238) (-640.823) [-640.413] (-636.565) -- 0:02:59
101000 -- [-643.898] (-640.858) (-639.053) (-640.253) * (-641.595) [-646.632] (-637.251) (-650.814) -- 0:02:58
101500 -- (-639.710) (-639.205) [-640.962] (-654.295) * (-648.118) [-641.044] (-637.623) (-640.529) -- 0:02:57
102000 -- (-639.640) [-634.687] (-638.741) (-635.923) * (-637.930) (-640.206) (-640.054) [-641.384] -- 0:02:56
102500 -- (-641.232) [-640.876] (-637.629) (-642.726) * [-637.193] (-638.356) (-642.153) (-644.678) -- 0:03:03
103000 -- (-642.677) (-640.808) (-637.008) [-640.760] * (-644.091) [-638.838] (-641.335) (-644.347) -- 0:03:02
103500 -- (-635.900) (-637.344) (-637.417) [-639.679] * (-637.913) (-646.598) [-635.279] (-644.365) -- 0:03:01
104000 -- [-637.056] (-638.461) (-649.073) (-638.765) * (-638.949) (-637.668) (-634.970) [-642.007] -- 0:03:00
104500 -- (-643.732) (-643.385) (-639.468) [-642.230] * (-636.870) (-639.564) [-638.354] (-644.167) -- 0:02:59
105000 -- [-637.475] (-649.437) (-635.612) (-643.121) * [-644.311] (-644.508) (-638.083) (-642.777) -- 0:02:59
Average standard deviation of split frequencies: 0.021791
105500 -- (-642.179) (-638.946) (-640.765) [-639.149] * (-644.753) (-640.261) [-643.818] (-640.264) -- 0:02:58
106000 -- (-643.607) (-639.704) (-638.361) [-631.193] * [-636.143] (-640.735) (-643.345) (-637.065) -- 0:02:57
106500 -- (-647.323) (-638.679) (-639.073) [-638.553] * [-639.257] (-643.974) (-652.102) (-639.472) -- 0:02:56
107000 -- (-640.878) (-642.687) (-649.990) [-636.865] * (-642.256) (-641.938) (-641.649) [-637.103] -- 0:02:55
107500 -- (-640.620) (-639.615) (-639.206) [-637.827] * (-638.846) (-639.248) (-639.043) [-636.923] -- 0:03:02
108000 -- (-646.307) (-648.051) (-642.051) [-638.580] * [-640.916] (-646.207) (-642.412) (-648.102) -- 0:03:01
108500 -- (-636.293) [-641.201] (-646.768) (-637.089) * (-642.750) (-636.262) (-633.574) [-645.576] -- 0:03:00
109000 -- [-646.471] (-646.447) (-641.158) (-640.082) * (-644.080) [-634.054] (-641.472) (-641.224) -- 0:02:59
109500 -- (-642.783) [-639.108] (-647.980) (-649.875) * (-640.148) [-636.613] (-644.536) (-639.598) -- 0:02:58
110000 -- (-647.305) [-638.623] (-643.427) (-638.747) * (-642.947) [-637.225] (-641.931) (-642.714) -- 0:02:58
Average standard deviation of split frequencies: 0.023192
110500 -- [-644.277] (-644.067) (-641.075) (-649.640) * [-638.550] (-651.498) (-639.586) (-641.599) -- 0:02:57
111000 -- [-644.150] (-641.840) (-638.295) (-645.908) * (-640.044) (-642.588) [-642.165] (-639.320) -- 0:02:56
111500 -- (-642.179) (-641.539) [-640.098] (-647.544) * (-650.666) [-640.604] (-644.119) (-647.731) -- 0:02:55
112000 -- (-643.367) (-648.458) [-642.925] (-650.436) * (-636.271) (-640.288) (-636.255) [-642.080] -- 0:03:02
112500 -- (-637.591) [-639.555] (-639.166) (-661.839) * [-637.785] (-633.874) (-636.505) (-640.684) -- 0:03:01
113000 -- (-644.538) (-635.183) [-634.240] (-642.663) * [-638.773] (-641.401) (-641.807) (-641.075) -- 0:03:00
113500 -- [-643.051] (-638.313) (-652.227) (-637.591) * (-639.470) (-640.199) [-635.588] (-637.694) -- 0:02:59
114000 -- (-644.404) (-636.379) [-634.964] (-644.715) * (-641.094) [-638.257] (-642.009) (-645.391) -- 0:02:58
114500 -- (-643.740) [-639.235] (-642.592) (-639.316) * (-638.036) (-643.449) (-640.853) [-639.697] -- 0:02:57
115000 -- (-647.350) (-640.693) [-640.818] (-638.964) * (-638.963) (-640.576) (-642.340) [-643.101] -- 0:02:57
Average standard deviation of split frequencies: 0.020771
115500 -- (-638.832) (-640.927) [-638.376] (-636.349) * [-633.881] (-637.580) (-640.647) (-639.580) -- 0:02:56
116000 -- (-642.576) (-639.010) [-634.611] (-642.655) * [-637.647] (-635.307) (-638.723) (-646.118) -- 0:02:55
116500 -- [-640.674] (-642.776) (-642.794) (-643.203) * [-637.763] (-645.304) (-647.842) (-653.964) -- 0:02:54
117000 -- (-644.076) (-640.921) (-635.389) [-642.485] * (-637.856) (-646.398) [-642.951] (-652.916) -- 0:03:01
117500 -- (-640.135) (-640.160) (-639.933) [-639.049] * [-636.251] (-640.686) (-640.659) (-638.827) -- 0:03:00
118000 -- (-650.506) [-641.263] (-644.475) (-642.901) * [-636.599] (-646.580) (-642.573) (-642.456) -- 0:02:59
118500 -- [-636.454] (-643.406) (-642.757) (-640.100) * [-638.119] (-642.151) (-642.352) (-636.923) -- 0:02:58
119000 -- [-639.982] (-635.665) (-647.984) (-634.440) * (-637.984) [-638.294] (-640.781) (-637.152) -- 0:02:57
119500 -- (-645.937) (-642.692) (-643.223) [-636.985] * (-638.588) (-634.928) [-643.212] (-632.584) -- 0:02:56
120000 -- (-637.693) (-640.498) (-645.736) [-639.943] * (-640.029) (-642.065) (-652.426) [-639.287] -- 0:02:56
Average standard deviation of split frequencies: 0.018752
120500 -- (-641.626) (-644.241) (-646.520) [-648.294] * (-647.521) (-636.063) (-642.747) [-646.883] -- 0:02:55
121000 -- [-639.779] (-641.956) (-647.252) (-635.081) * (-645.207) (-638.765) (-646.028) [-646.261] -- 0:02:54
121500 -- (-635.089) (-647.486) (-642.233) [-643.114] * (-646.511) (-644.468) [-640.528] (-641.087) -- 0:02:53
122000 -- [-643.218] (-639.469) (-641.067) (-644.257) * (-641.642) (-634.641) (-636.167) [-638.552] -- 0:02:59
122500 -- [-635.753] (-643.733) (-637.799) (-639.866) * (-647.240) (-644.733) [-637.223] (-650.126) -- 0:02:59
123000 -- [-638.305] (-640.249) (-635.026) (-640.417) * [-641.724] (-646.670) (-634.710) (-648.357) -- 0:02:58
123500 -- (-636.894) (-639.451) [-639.817] (-642.911) * [-643.057] (-646.216) (-641.678) (-647.156) -- 0:02:57
124000 -- [-641.398] (-646.338) (-641.134) (-641.253) * (-645.175) [-647.816] (-640.346) (-639.785) -- 0:02:56
124500 -- (-642.557) (-640.882) [-642.848] (-642.100) * (-643.172) (-648.850) [-638.564] (-646.115) -- 0:02:55
125000 -- (-647.810) (-648.531) (-648.760) [-640.887] * (-652.476) [-644.873] (-634.434) (-655.370) -- 0:02:55
Average standard deviation of split frequencies: 0.019455
125500 -- [-643.625] (-644.884) (-645.866) (-637.320) * (-643.350) [-647.028] (-642.746) (-646.307) -- 0:02:54
126000 -- (-640.020) (-645.670) [-642.992] (-645.248) * [-642.465] (-640.975) (-638.157) (-644.536) -- 0:02:53
126500 -- (-640.552) (-636.675) [-638.051] (-638.689) * (-638.256) (-640.160) [-642.053] (-652.893) -- 0:02:52
127000 -- [-640.452] (-646.025) (-641.555) (-645.221) * [-644.472] (-644.391) (-644.974) (-645.324) -- 0:02:58
127500 -- [-641.924] (-644.468) (-634.384) (-638.351) * (-639.136) (-637.483) [-641.305] (-640.389) -- 0:02:57
128000 -- (-640.901) (-646.071) [-638.818] (-633.824) * (-642.647) (-644.089) [-646.139] (-642.608) -- 0:02:57
128500 -- (-645.206) (-644.729) (-637.508) [-640.444] * (-643.402) (-638.529) [-637.658] (-649.433) -- 0:02:56
129000 -- (-637.843) (-642.600) [-638.986] (-636.943) * (-643.927) (-637.027) [-639.405] (-640.048) -- 0:02:55
129500 -- (-648.220) (-643.022) (-641.998) [-644.168] * [-635.564] (-639.147) (-643.784) (-645.176) -- 0:02:54
130000 -- (-641.926) [-637.980] (-645.035) (-638.557) * [-638.663] (-641.217) (-647.145) (-649.167) -- 0:02:54
Average standard deviation of split frequencies: 0.016595
130500 -- (-638.508) (-645.295) (-647.085) [-643.919] * (-636.875) [-641.762] (-647.662) (-639.870) -- 0:02:53
131000 -- [-638.191] (-643.633) (-641.791) (-646.552) * [-638.726] (-643.174) (-645.291) (-640.182) -- 0:02:52
131500 -- [-637.767] (-636.078) (-641.470) (-644.776) * [-637.784] (-640.414) (-637.285) (-641.577) -- 0:02:51
132000 -- (-643.228) (-644.269) [-646.483] (-642.651) * (-643.196) (-641.325) [-637.416] (-641.257) -- 0:02:57
132500 -- (-650.219) (-639.484) (-637.506) [-635.055] * (-651.818) [-642.194] (-635.509) (-640.284) -- 0:02:56
133000 -- (-649.398) (-636.203) [-646.349] (-644.152) * (-640.531) (-654.741) [-635.800] (-637.721) -- 0:02:56
133500 -- (-639.879) [-636.644] (-639.697) (-645.098) * (-648.663) [-638.564] (-644.096) (-641.340) -- 0:02:55
134000 -- (-636.996) (-638.434) [-644.991] (-635.582) * (-641.863) (-639.202) [-638.993] (-645.323) -- 0:02:54
134500 -- (-651.566) (-637.367) [-636.530] (-642.529) * (-643.932) (-641.402) [-636.775] (-643.759) -- 0:02:53
135000 -- (-640.586) [-636.586] (-646.363) (-637.181) * (-646.955) (-644.179) [-647.112] (-636.158) -- 0:02:53
Average standard deviation of split frequencies: 0.015251
135500 -- (-634.478) (-636.731) [-642.301] (-647.756) * (-647.127) [-636.894] (-642.320) (-643.056) -- 0:02:52
136000 -- [-639.007] (-644.196) (-638.803) (-639.824) * (-642.510) [-638.025] (-645.779) (-643.149) -- 0:02:51
136500 -- (-646.947) [-640.453] (-643.926) (-636.515) * [-642.432] (-644.823) (-638.740) (-640.749) -- 0:02:50
137000 -- (-641.217) (-641.511) (-637.944) [-636.176] * [-635.539] (-641.231) (-641.653) (-640.002) -- 0:02:56
137500 -- (-639.656) (-635.648) [-641.568] (-638.030) * (-642.470) (-643.612) [-639.356] (-646.135) -- 0:02:55
138000 -- (-635.118) (-643.442) (-640.886) [-637.859] * [-643.468] (-644.155) (-638.575) (-636.922) -- 0:02:54
138500 -- (-642.814) (-641.924) (-643.439) [-637.992] * (-639.900) [-646.033] (-645.720) (-639.195) -- 0:02:54
139000 -- (-636.363) [-642.327] (-636.792) (-635.007) * (-648.121) (-644.193) (-636.562) [-641.100] -- 0:02:53
139500 -- (-634.278) (-643.255) (-640.116) [-637.999] * (-637.617) (-647.019) (-641.826) [-642.625] -- 0:02:52
140000 -- [-639.647] (-640.698) (-634.580) (-638.635) * (-642.508) (-645.893) [-635.113] (-644.916) -- 0:02:52
Average standard deviation of split frequencies: 0.011729
140500 -- [-639.883] (-640.865) (-639.591) (-638.794) * (-641.532) (-639.915) (-642.118) [-647.851] -- 0:02:51
141000 -- (-644.154) [-643.666] (-636.937) (-638.999) * (-641.252) (-650.743) [-637.160] (-641.917) -- 0:02:50
141500 -- (-647.162) [-637.257] (-641.074) (-646.241) * (-636.424) [-642.017] (-640.049) (-640.103) -- 0:02:49
142000 -- (-637.801) [-643.846] (-638.070) (-645.749) * (-637.891) (-640.057) (-642.602) [-640.861] -- 0:02:55
142500 -- [-639.329] (-643.815) (-641.866) (-639.430) * [-638.008] (-646.951) (-641.069) (-649.033) -- 0:02:54
143000 -- (-645.516) (-640.564) [-636.705] (-638.443) * (-638.295) (-644.844) [-636.791] (-639.661) -- 0:02:53
143500 -- (-641.796) [-636.198] (-640.724) (-639.879) * (-647.762) (-637.637) [-646.067] (-646.898) -- 0:02:53
144000 -- (-633.839) (-637.089) [-640.407] (-640.015) * (-662.708) [-645.364] (-638.694) (-645.173) -- 0:02:52
144500 -- (-641.691) (-643.047) (-643.540) [-639.672] * (-646.893) (-639.637) (-641.202) [-634.994] -- 0:02:51
145000 -- (-645.067) [-634.192] (-638.823) (-641.545) * (-646.406) (-639.675) (-648.101) [-637.981] -- 0:02:51
Average standard deviation of split frequencies: 0.011704
145500 -- (-649.272) (-637.125) [-636.202] (-646.066) * [-643.549] (-646.920) (-644.970) (-640.722) -- 0:02:50
146000 -- (-641.011) (-637.526) [-647.436] (-644.056) * (-656.695) (-638.122) (-639.935) [-641.860] -- 0:02:49
146500 -- (-636.268) (-642.561) (-637.015) [-637.526] * (-641.322) [-642.854] (-643.665) (-641.682) -- 0:02:48
147000 -- [-638.168] (-639.963) (-637.571) (-637.203) * (-649.604) [-631.611] (-641.628) (-644.202) -- 0:02:54
147500 -- [-634.504] (-639.938) (-638.554) (-638.881) * (-639.773) (-636.577) (-649.317) [-638.369] -- 0:02:53
148000 -- (-640.777) (-634.825) [-642.340] (-635.129) * [-643.156] (-646.799) (-641.233) (-643.993) -- 0:02:52
148500 -- (-637.016) (-638.643) [-644.515] (-643.563) * [-637.025] (-649.333) (-644.435) (-640.585) -- 0:02:52
149000 -- (-641.430) [-637.109] (-645.954) (-648.093) * [-646.358] (-649.098) (-639.975) (-644.925) -- 0:02:51
149500 -- [-643.903] (-645.918) (-646.741) (-641.834) * (-645.051) (-641.870) (-643.784) [-637.439] -- 0:02:50
150000 -- (-641.421) [-641.391] (-652.643) (-639.789) * (-642.773) [-642.396] (-650.470) (-636.351) -- 0:02:50
Average standard deviation of split frequencies: 0.005910
150500 -- (-644.209) (-641.712) (-645.893) [-642.865] * [-638.922] (-645.423) (-650.449) (-648.208) -- 0:02:49
151000 -- [-640.543] (-641.469) (-652.807) (-644.012) * (-641.303) (-646.773) (-641.904) [-639.625] -- 0:02:48
151500 -- (-640.054) [-637.207] (-637.587) (-639.195) * (-648.876) [-634.784] (-639.477) (-638.986) -- 0:02:53
152000 -- (-640.193) (-640.792) [-640.526] (-637.680) * (-651.218) [-643.053] (-643.339) (-642.786) -- 0:02:52
152500 -- (-646.447) (-646.515) (-649.082) [-642.805] * [-636.862] (-644.482) (-636.229) (-641.827) -- 0:02:52
153000 -- (-651.313) (-639.367) [-644.070] (-644.597) * (-641.171) (-640.317) (-641.999) [-647.327] -- 0:02:51
153500 -- (-644.832) [-644.102] (-642.844) (-636.707) * (-638.857) (-637.943) (-643.514) [-639.474] -- 0:02:50
154000 -- (-641.185) (-635.224) [-642.198] (-642.762) * [-636.519] (-640.461) (-639.928) (-641.723) -- 0:02:50
154500 -- (-644.774) (-636.850) (-644.444) [-644.342] * (-637.063) [-644.058] (-637.210) (-646.876) -- 0:02:49
155000 -- (-647.241) [-641.491] (-642.198) (-645.264) * (-638.239) (-644.136) [-640.130] (-644.804) -- 0:02:49
Average standard deviation of split frequencies: 0.009065
155500 -- [-640.648] (-636.154) (-638.519) (-647.435) * [-647.192] (-640.631) (-643.919) (-641.240) -- 0:02:48
156000 -- (-635.348) [-638.194] (-636.825) (-642.149) * (-644.967) [-648.280] (-640.606) (-640.223) -- 0:02:47
156500 -- (-637.922) [-646.268] (-638.657) (-647.569) * (-651.666) (-641.893) (-638.692) [-647.594] -- 0:02:52
157000 -- (-646.043) [-633.208] (-644.739) (-638.790) * (-642.808) [-638.534] (-642.792) (-638.426) -- 0:02:51
157500 -- (-641.650) (-646.562) [-636.714] (-642.230) * (-638.179) (-647.030) (-640.327) [-634.892] -- 0:02:51
158000 -- (-653.264) (-640.060) [-636.686] (-640.974) * [-644.383] (-646.130) (-642.085) (-642.403) -- 0:02:50
158500 -- (-637.912) [-638.270] (-640.784) (-642.402) * (-636.162) (-642.580) (-636.559) [-641.696] -- 0:02:49
159000 -- (-644.410) (-636.084) (-644.756) [-636.743] * [-633.780] (-638.515) (-643.567) (-642.428) -- 0:02:49
159500 -- (-637.655) [-638.992] (-636.869) (-643.592) * (-647.888) [-637.605] (-641.028) (-644.137) -- 0:02:48
160000 -- (-639.821) (-642.610) [-637.365] (-642.337) * [-637.751] (-641.202) (-645.698) (-642.830) -- 0:02:48
Average standard deviation of split frequencies: 0.010856
160500 -- [-638.383] (-637.502) (-640.562) (-648.989) * (-642.459) [-638.800] (-648.367) (-640.848) -- 0:02:47
161000 -- [-642.381] (-643.110) (-636.923) (-645.795) * (-640.823) [-646.030] (-642.729) (-638.703) -- 0:02:46
161500 -- (-641.691) (-637.361) (-638.034) [-640.958] * (-647.274) (-654.102) [-642.737] (-645.637) -- 0:02:51
162000 -- (-641.717) (-644.144) [-640.671] (-639.390) * (-649.321) (-652.078) [-633.302] (-640.548) -- 0:02:50
162500 -- (-646.376) (-643.501) (-645.624) [-647.325] * [-636.268] (-642.896) (-639.775) (-643.617) -- 0:02:50
163000 -- [-644.264] (-649.847) (-644.709) (-638.216) * (-635.681) (-644.298) [-640.152] (-637.979) -- 0:02:49
163500 -- (-638.991) (-653.464) [-642.404] (-639.425) * (-650.962) (-646.262) [-639.496] (-644.789) -- 0:02:48
164000 -- (-637.725) [-638.138] (-646.288) (-641.362) * [-643.620] (-646.698) (-639.606) (-641.599) -- 0:02:48
164500 -- (-640.533) (-640.210) [-642.024] (-638.851) * [-641.833] (-656.004) (-643.852) (-637.869) -- 0:02:47
165000 -- (-650.756) (-646.640) (-641.591) [-640.166] * [-639.942] (-643.327) (-640.709) (-640.288) -- 0:02:47
Average standard deviation of split frequencies: 0.009781
165500 -- (-650.066) [-645.975] (-642.882) (-637.684) * (-647.283) [-647.517] (-639.159) (-635.920) -- 0:02:46
166000 -- (-643.499) (-636.787) (-646.696) [-637.544] * (-647.474) (-647.870) (-648.956) [-641.852] -- 0:02:50
166500 -- [-635.226] (-644.433) (-646.973) (-640.853) * (-642.541) (-650.817) (-639.734) [-643.973] -- 0:02:50
167000 -- (-645.128) [-639.063] (-642.089) (-638.429) * [-642.451] (-641.350) (-641.608) (-640.918) -- 0:02:49
167500 -- (-640.188) (-638.992) [-635.275] (-638.749) * (-648.885) [-636.072] (-638.820) (-633.895) -- 0:02:48
168000 -- (-639.738) (-648.823) (-643.520) [-647.084] * (-640.098) (-640.656) [-640.463] (-643.504) -- 0:02:48
168500 -- (-645.423) (-644.467) (-645.379) [-641.577] * (-642.926) (-643.790) (-636.191) [-646.682] -- 0:02:47
169000 -- (-641.743) (-645.600) [-640.073] (-644.762) * [-641.988] (-642.909) (-636.642) (-644.939) -- 0:02:47
169500 -- (-638.608) (-639.285) (-640.658) [-640.031] * [-647.035] (-644.341) (-637.606) (-645.356) -- 0:02:46
170000 -- (-651.931) (-645.454) [-638.574] (-644.827) * (-642.972) [-647.532] (-649.740) (-650.117) -- 0:02:46
Average standard deviation of split frequencies: 0.010742
170500 -- (-638.344) (-637.889) [-638.224] (-638.305) * (-638.168) (-638.668) [-644.286] (-653.755) -- 0:02:45
171000 -- (-645.713) (-643.247) [-644.471] (-655.281) * (-639.251) (-639.017) [-639.659] (-646.478) -- 0:02:49
171500 -- (-640.416) (-636.541) [-637.765] (-637.728) * (-647.781) (-642.204) (-646.620) [-652.460] -- 0:02:49
172000 -- (-640.081) (-636.842) [-642.876] (-637.237) * (-641.175) (-652.162) (-638.307) [-643.809] -- 0:02:48
172500 -- [-639.904] (-645.281) (-641.790) (-645.194) * [-635.256] (-643.931) (-642.841) (-644.734) -- 0:02:47
173000 -- (-636.579) (-636.014) [-644.827] (-642.108) * (-640.319) [-639.685] (-642.057) (-655.304) -- 0:02:47
173500 -- (-643.852) [-639.850] (-652.687) (-645.724) * [-641.951] (-634.410) (-642.247) (-636.819) -- 0:02:46
174000 -- (-637.011) [-639.209] (-644.032) (-644.496) * (-645.510) [-642.386] (-641.190) (-641.796) -- 0:02:46
174500 -- (-643.654) [-636.177] (-649.284) (-639.292) * (-635.941) (-645.469) (-638.728) [-641.020] -- 0:02:45
175000 -- (-643.463) (-643.802) (-642.305) [-643.303] * (-643.105) (-639.417) [-647.451] (-635.366) -- 0:02:45
Average standard deviation of split frequencies: 0.009821
175500 -- (-644.415) (-636.467) [-638.498] (-639.653) * (-639.412) (-641.992) (-647.184) [-639.764] -- 0:02:44
176000 -- (-645.973) (-635.279) (-638.139) [-638.042] * (-641.243) (-644.934) [-642.957] (-639.804) -- 0:02:48
176500 -- (-643.412) [-640.589] (-639.071) (-646.377) * (-650.574) (-643.455) [-636.168] (-644.134) -- 0:02:47
177000 -- (-637.598) (-638.353) (-643.815) [-638.602] * (-642.752) [-644.568] (-645.266) (-640.465) -- 0:02:47
177500 -- [-638.206] (-640.475) (-639.569) (-642.057) * [-639.669] (-641.905) (-641.662) (-635.437) -- 0:02:46
178000 -- (-639.015) [-638.292] (-646.399) (-640.096) * (-636.979) (-643.345) [-638.980] (-645.901) -- 0:02:46
178500 -- (-633.758) [-647.674] (-648.328) (-641.736) * (-636.519) [-647.627] (-642.907) (-645.874) -- 0:02:45
179000 -- (-637.015) (-639.349) [-641.054] (-641.382) * [-638.763] (-644.318) (-639.415) (-639.440) -- 0:02:45
179500 -- [-642.862] (-637.533) (-639.546) (-638.629) * (-646.726) (-645.651) [-642.298] (-639.669) -- 0:02:44
180000 -- (-636.120) (-641.675) [-636.052] (-639.497) * (-636.578) (-649.420) [-638.362] (-643.867) -- 0:02:44
Average standard deviation of split frequencies: 0.009277
180500 -- (-639.122) (-643.124) [-639.551] (-649.865) * (-654.438) (-642.003) (-645.358) [-636.332] -- 0:02:47
181000 -- (-636.105) (-640.734) [-634.184] (-640.445) * (-641.900) (-637.940) [-638.767] (-638.527) -- 0:02:47
181500 -- (-646.837) (-639.132) (-648.291) [-638.070] * (-640.914) (-645.903) (-637.681) [-637.701] -- 0:02:46
182000 -- (-641.020) (-640.966) [-642.626] (-635.156) * [-633.746] (-638.266) (-638.812) (-645.909) -- 0:02:46
182500 -- [-636.131] (-639.823) (-645.178) (-638.717) * [-635.668] (-640.488) (-642.707) (-642.755) -- 0:02:45
183000 -- [-642.178] (-639.256) (-636.945) (-639.885) * [-639.521] (-648.984) (-642.469) (-642.973) -- 0:02:45
183500 -- [-644.607] (-639.060) (-642.504) (-639.162) * (-642.357) (-645.946) (-638.527) [-636.125] -- 0:02:44
184000 -- (-635.802) [-636.760] (-645.045) (-642.384) * (-642.147) [-636.406] (-639.835) (-637.628) -- 0:02:44
184500 -- (-644.275) (-640.828) [-641.472] (-641.831) * (-641.351) (-654.282) [-638.216] (-640.470) -- 0:02:43
185000 -- (-653.494) (-640.274) (-645.230) [-635.359] * (-639.076) (-650.077) [-643.715] (-642.726) -- 0:02:43
Average standard deviation of split frequencies: 0.010138
185500 -- (-642.127) (-642.044) (-647.182) [-637.421] * (-644.662) (-647.282) (-649.754) [-642.462] -- 0:02:46
186000 -- (-644.978) (-639.642) [-637.226] (-636.373) * [-642.553] (-643.966) (-638.768) (-644.348) -- 0:02:46
186500 -- (-647.652) [-638.686] (-642.871) (-643.081) * (-644.977) (-640.219) [-635.205] (-636.584) -- 0:02:45
187000 -- (-644.279) [-638.304] (-645.963) (-644.436) * (-645.811) (-644.812) [-642.666] (-644.875) -- 0:02:45
187500 -- [-638.588] (-642.728) (-640.929) (-651.523) * (-645.240) (-643.842) [-643.975] (-645.681) -- 0:02:44
188000 -- (-637.963) (-636.971) (-640.003) [-637.570] * (-639.803) (-639.659) [-639.609] (-643.088) -- 0:02:44
188500 -- [-652.665] (-636.200) (-643.554) (-646.321) * [-642.147] (-636.498) (-641.380) (-647.438) -- 0:02:43
189000 -- [-644.113] (-637.435) (-643.665) (-639.103) * (-643.509) (-642.661) [-642.667] (-651.230) -- 0:02:43
189500 -- (-639.287) (-645.008) [-646.496] (-644.944) * (-651.497) [-637.205] (-638.793) (-643.713) -- 0:02:42
190000 -- (-645.627) [-644.836] (-642.009) (-639.523) * (-645.731) [-636.217] (-639.351) (-651.723) -- 0:02:42
Average standard deviation of split frequencies: 0.012362
190500 -- (-641.013) (-643.062) [-642.169] (-638.569) * (-643.896) [-642.054] (-641.727) (-645.907) -- 0:02:45
191000 -- (-643.209) [-640.801] (-649.134) (-647.484) * (-645.453) (-638.621) [-637.510] (-645.187) -- 0:02:45
191500 -- [-642.829] (-645.838) (-637.615) (-642.672) * (-641.799) (-639.391) (-644.141) [-638.806] -- 0:02:44
192000 -- [-639.515] (-641.012) (-636.350) (-639.509) * (-650.861) (-638.233) (-645.488) [-637.603] -- 0:02:44
192500 -- [-641.668] (-641.760) (-640.665) (-635.466) * (-647.667) (-646.325) (-645.002) [-643.217] -- 0:02:43
193000 -- [-638.536] (-638.066) (-646.272) (-636.135) * (-642.530) (-639.071) [-643.513] (-640.500) -- 0:02:43
193500 -- (-639.650) (-644.452) (-640.414) [-638.731] * (-643.310) (-640.289) [-642.013] (-645.749) -- 0:02:42
194000 -- (-640.961) (-648.043) (-643.595) [-642.071] * (-639.998) [-642.614] (-641.110) (-641.888) -- 0:02:42
194500 -- [-639.749] (-643.556) (-647.936) (-635.958) * [-642.800] (-647.624) (-644.714) (-643.464) -- 0:02:41
195000 -- [-640.208] (-640.525) (-642.282) (-641.227) * [-641.070] (-648.487) (-644.273) (-637.058) -- 0:02:41
Average standard deviation of split frequencies: 0.011785
195500 -- (-637.114) (-636.021) (-646.150) [-645.536] * (-639.337) (-642.980) [-641.111] (-647.593) -- 0:02:44
196000 -- (-637.385) (-640.034) [-643.431] (-640.659) * (-642.941) (-639.678) (-641.736) [-643.905] -- 0:02:44
196500 -- (-642.808) (-644.692) (-641.351) [-639.876] * (-638.219) [-636.273] (-636.738) (-639.317) -- 0:02:43
197000 -- (-647.091) (-640.165) (-653.075) [-633.753] * (-638.437) (-634.812) [-641.889] (-638.763) -- 0:02:43
197500 -- (-644.827) (-645.861) (-651.083) [-642.333] * (-638.923) [-642.799] (-639.915) (-639.500) -- 0:02:42
198000 -- (-635.627) (-642.941) (-638.901) [-636.439] * (-645.608) (-639.712) [-640.124] (-642.538) -- 0:02:42
198500 -- (-647.398) (-647.364) (-639.940) [-635.931] * (-640.993) (-639.855) (-652.079) [-635.255] -- 0:02:41
199000 -- (-641.952) (-640.384) [-649.848] (-636.097) * (-641.346) [-640.888] (-646.991) (-647.013) -- 0:02:41
199500 -- [-637.295] (-649.410) (-643.037) (-639.305) * (-645.465) (-641.246) (-654.989) [-638.648] -- 0:02:40
200000 -- (-642.372) (-642.490) (-640.058) [-638.734] * (-638.673) (-636.156) [-642.908] (-647.508) -- 0:02:40
Average standard deviation of split frequencies: 0.011276
200500 -- (-643.293) [-642.510] (-652.307) (-637.664) * [-636.165] (-643.278) (-642.658) (-646.113) -- 0:02:43
201000 -- [-641.106] (-640.469) (-638.453) (-638.735) * (-640.271) (-636.076) (-638.671) [-644.433] -- 0:02:42
201500 -- (-640.132) (-639.723) (-640.902) [-641.963] * [-634.786] (-635.897) (-641.255) (-642.760) -- 0:02:42
202000 -- [-644.136] (-636.473) (-640.478) (-642.824) * (-642.185) [-633.723] (-649.558) (-646.221) -- 0:02:41
202500 -- (-641.915) (-642.235) [-638.339] (-635.233) * [-640.243] (-636.993) (-641.967) (-640.606) -- 0:02:41
203000 -- (-646.452) (-636.239) (-636.468) [-641.853] * [-637.817] (-641.908) (-642.378) (-648.605) -- 0:02:40
203500 -- (-641.623) (-641.904) [-637.442] (-637.561) * (-640.858) [-644.077] (-640.373) (-639.617) -- 0:02:40
204000 -- (-645.175) (-642.448) (-636.252) [-638.322] * (-643.362) [-640.894] (-640.771) (-640.951) -- 0:02:39
204500 -- (-642.958) [-637.848] (-644.376) (-636.820) * (-642.548) [-644.261] (-642.301) (-639.333) -- 0:02:39
205000 -- (-639.232) (-636.933) (-652.407) [-639.245] * [-642.160] (-636.381) (-641.920) (-641.265) -- 0:02:42
Average standard deviation of split frequencies: 0.010527
205500 -- [-641.108] (-641.726) (-640.171) (-640.059) * [-636.926] (-643.172) (-648.758) (-640.075) -- 0:02:42
206000 -- (-641.536) (-636.255) (-652.407) [-638.133] * [-642.000] (-639.730) (-645.947) (-644.784) -- 0:02:41
206500 -- (-643.193) (-635.182) [-640.660] (-638.336) * (-637.151) (-649.318) [-640.257] (-647.648) -- 0:02:41
207000 -- (-638.095) (-636.810) [-642.066] (-634.885) * [-637.794] (-633.920) (-649.978) (-639.344) -- 0:02:40
207500 -- (-637.605) [-639.559] (-638.183) (-640.616) * (-639.328) [-642.575] (-648.666) (-638.226) -- 0:02:40
208000 -- (-649.699) [-640.825] (-643.304) (-640.868) * (-642.025) (-649.416) [-641.517] (-641.427) -- 0:02:39
208500 -- (-654.074) (-640.336) [-638.509] (-641.464) * (-639.014) [-643.765] (-650.785) (-638.122) -- 0:02:39
209000 -- (-658.482) (-638.556) (-645.408) [-640.508] * [-644.158] (-640.203) (-639.339) (-645.113) -- 0:02:38
209500 -- (-640.789) [-635.874] (-645.745) (-642.963) * (-647.956) (-648.752) (-647.127) [-641.179] -- 0:02:38
210000 -- (-644.046) [-639.563] (-646.529) (-642.888) * (-652.547) (-643.868) (-640.837) [-638.095] -- 0:02:41
Average standard deviation of split frequencies: 0.013426
210500 -- (-642.093) (-651.615) (-636.342) [-641.108] * (-644.334) (-647.104) (-638.936) [-641.081] -- 0:02:41
211000 -- [-640.673] (-640.553) (-644.794) (-639.451) * (-651.662) (-647.658) (-642.485) [-640.950] -- 0:02:40
211500 -- (-640.733) [-641.161] (-641.106) (-642.992) * (-637.687) (-648.509) [-637.403] (-636.409) -- 0:02:40
212000 -- (-638.483) (-642.704) [-640.415] (-652.414) * [-635.757] (-649.035) (-638.700) (-639.644) -- 0:02:39
212500 -- (-637.901) [-635.250] (-637.601) (-645.560) * (-648.904) (-647.479) [-639.536] (-646.493) -- 0:02:39
213000 -- (-635.026) [-645.412] (-638.909) (-643.176) * (-646.550) (-645.074) (-638.678) [-645.991] -- 0:02:38
213500 -- (-639.813) [-637.801] (-646.426) (-644.572) * [-644.721] (-646.643) (-636.559) (-640.225) -- 0:02:38
214000 -- [-641.194] (-643.935) (-648.072) (-640.562) * (-644.807) (-648.199) [-638.355] (-647.638) -- 0:02:37
214500 -- (-642.879) (-643.438) [-640.286] (-639.085) * (-647.836) (-647.574) [-641.295] (-638.709) -- 0:02:37
215000 -- (-642.192) (-638.379) [-636.042] (-638.727) * [-640.397] (-643.618) (-645.508) (-643.633) -- 0:02:40
Average standard deviation of split frequencies: 0.013749
215500 -- (-641.130) (-640.773) [-641.984] (-641.780) * (-645.921) (-636.872) (-639.051) [-641.444] -- 0:02:40
216000 -- (-644.354) (-635.605) (-638.091) [-640.546] * (-637.716) (-640.881) [-644.334] (-638.586) -- 0:02:39
216500 -- (-634.427) [-643.361] (-641.119) (-639.850) * [-645.965] (-645.425) (-653.754) (-643.826) -- 0:02:39
217000 -- (-648.337) (-642.778) [-636.442] (-638.702) * (-639.526) (-646.313) (-640.871) [-640.813] -- 0:02:38
217500 -- (-642.984) (-646.495) (-640.315) [-641.538] * [-638.798] (-646.194) (-643.492) (-638.471) -- 0:02:38
218000 -- [-635.158] (-646.559) (-641.446) (-636.940) * (-642.552) (-646.458) (-643.516) [-636.510] -- 0:02:37
218500 -- (-639.147) [-637.476] (-639.955) (-645.001) * (-642.547) (-639.311) [-645.295] (-644.506) -- 0:02:37
219000 -- [-637.741] (-635.570) (-640.579) (-637.420) * (-639.168) (-651.026) [-638.915] (-647.234) -- 0:02:36
219500 -- (-638.596) (-647.336) [-641.600] (-644.692) * [-635.505] (-640.735) (-641.332) (-646.053) -- 0:02:40
220000 -- (-634.728) (-641.977) [-639.220] (-639.436) * (-640.432) (-641.901) [-644.654] (-645.360) -- 0:02:39
Average standard deviation of split frequencies: 0.014954
220500 -- [-636.865] (-643.456) (-643.002) (-641.414) * (-646.762) (-639.321) (-642.106) [-637.921] -- 0:02:39
221000 -- [-637.443] (-637.481) (-639.829) (-654.797) * [-634.558] (-639.626) (-642.351) (-649.582) -- 0:02:38
221500 -- (-640.532) [-641.288] (-642.921) (-640.544) * (-639.590) (-648.251) (-636.656) [-640.375] -- 0:02:38
222000 -- (-646.440) [-645.861] (-647.177) (-637.649) * (-639.035) (-642.642) [-640.232] (-651.587) -- 0:02:37
222500 -- (-648.036) (-657.062) (-638.852) [-637.857] * [-637.283] (-642.884) (-641.165) (-636.199) -- 0:02:37
223000 -- (-640.398) (-641.428) [-638.654] (-639.604) * (-636.611) (-640.332) [-633.771] (-644.337) -- 0:02:36
223500 -- (-643.443) (-642.651) [-635.159] (-640.205) * (-645.722) [-646.654] (-638.366) (-644.720) -- 0:02:36
224000 -- (-645.854) (-644.521) [-636.689] (-645.196) * [-633.046] (-638.143) (-634.646) (-644.832) -- 0:02:35
224500 -- (-641.495) (-643.392) [-641.263] (-649.826) * (-639.829) (-645.195) [-637.007] (-644.451) -- 0:02:38
225000 -- (-642.104) (-642.976) (-643.186) [-641.935] * [-639.926] (-643.471) (-636.181) (-642.189) -- 0:02:38
Average standard deviation of split frequencies: 0.015644
225500 -- (-641.491) [-643.327] (-644.512) (-650.263) * (-639.267) [-640.787] (-641.960) (-642.853) -- 0:02:37
226000 -- (-634.926) [-643.333] (-635.946) (-645.667) * [-637.887] (-637.439) (-649.377) (-645.015) -- 0:02:37
226500 -- (-640.998) [-638.511] (-646.480) (-644.410) * [-649.457] (-636.020) (-639.964) (-641.353) -- 0:02:37
227000 -- (-639.028) (-642.288) (-641.691) [-637.367] * (-638.886) (-638.858) [-645.486] (-641.854) -- 0:02:36
227500 -- (-645.469) (-648.685) [-644.283] (-640.906) * [-639.847] (-645.479) (-643.213) (-647.065) -- 0:02:36
228000 -- (-640.358) [-636.459] (-638.513) (-637.031) * (-647.732) (-652.496) [-642.626] (-639.518) -- 0:02:35
228500 -- (-637.610) [-640.745] (-640.216) (-642.205) * (-648.188) [-640.126] (-641.958) (-641.481) -- 0:02:35
229000 -- (-639.439) [-641.075] (-641.562) (-640.209) * (-647.344) (-639.957) (-645.830) [-644.161] -- 0:02:34
229500 -- (-658.748) [-636.808] (-640.183) (-639.168) * (-646.333) [-644.177] (-641.342) (-640.086) -- 0:02:37
230000 -- (-643.938) (-648.522) (-646.892) [-638.107] * (-638.612) (-645.535) (-639.339) [-637.134] -- 0:02:37
Average standard deviation of split frequencies: 0.016554
230500 -- (-640.701) (-647.861) [-636.470] (-641.327) * [-636.394] (-640.185) (-649.367) (-638.351) -- 0:02:36
231000 -- (-647.098) (-641.290) [-635.207] (-640.290) * (-642.816) (-650.252) (-640.074) [-637.011] -- 0:02:36
231500 -- (-646.260) [-641.219] (-642.153) (-648.673) * (-641.864) (-642.281) (-644.012) [-637.477] -- 0:02:36
232000 -- (-644.365) (-636.103) [-644.705] (-637.469) * (-645.569) (-642.794) (-640.628) [-637.365] -- 0:02:35
232500 -- (-640.701) (-632.225) [-633.872] (-645.834) * (-651.411) [-640.720] (-641.989) (-638.989) -- 0:02:35
233000 -- [-637.874] (-643.278) (-639.598) (-648.609) * [-638.533] (-646.187) (-635.011) (-641.101) -- 0:02:34
233500 -- [-639.865] (-636.157) (-638.110) (-651.554) * [-639.108] (-634.929) (-642.809) (-650.975) -- 0:02:34
234000 -- (-636.910) (-642.310) [-636.791] (-645.181) * [-648.384] (-640.626) (-636.796) (-635.450) -- 0:02:33
234500 -- (-645.274) (-639.861) [-649.376] (-645.888) * (-647.581) [-643.071] (-640.325) (-644.578) -- 0:02:36
235000 -- (-639.242) (-638.760) (-640.868) [-641.515] * (-643.518) (-641.167) [-636.702] (-634.128) -- 0:02:36
Average standard deviation of split frequencies: 0.016979
235500 -- [-644.825] (-639.199) (-641.880) (-643.361) * (-644.412) (-637.124) (-646.582) [-641.879] -- 0:02:35
236000 -- [-642.658] (-646.382) (-638.339) (-649.757) * [-639.978] (-639.304) (-648.948) (-639.794) -- 0:02:35
236500 -- (-641.608) (-636.761) (-650.218) [-637.418] * [-638.023] (-635.146) (-644.689) (-641.486) -- 0:02:34
237000 -- (-638.232) (-642.133) (-639.297) [-645.282] * (-637.696) (-643.343) (-648.126) [-641.817] -- 0:02:34
237500 -- (-644.217) [-641.976] (-644.471) (-650.634) * (-642.229) (-635.557) (-640.511) [-638.676] -- 0:02:34
238000 -- (-642.954) [-642.710] (-646.727) (-651.007) * (-649.779) [-638.503] (-639.847) (-636.356) -- 0:02:33
238500 -- [-639.693] (-639.759) (-641.046) (-642.673) * (-642.512) (-638.548) [-643.189] (-632.903) -- 0:02:33
239000 -- (-643.015) [-639.116] (-643.085) (-639.303) * (-637.977) [-644.225] (-643.402) (-640.199) -- 0:02:36
239500 -- (-637.745) [-639.990] (-640.273) (-643.801) * (-641.554) (-644.883) (-637.952) [-640.538] -- 0:02:35
240000 -- [-641.152] (-638.831) (-640.025) (-644.576) * (-643.678) (-645.255) [-639.707] (-643.225) -- 0:02:35
Average standard deviation of split frequencies: 0.015278
240500 -- (-646.817) (-634.432) [-641.792] (-644.251) * [-635.810] (-637.777) (-643.961) (-639.706) -- 0:02:34
241000 -- (-649.820) [-635.703] (-642.684) (-650.498) * [-641.133] (-637.103) (-644.096) (-638.236) -- 0:02:34
241500 -- (-649.781) (-642.115) [-642.983] (-643.214) * [-640.262] (-639.488) (-642.847) (-637.601) -- 0:02:33
242000 -- (-646.868) (-642.907) (-644.170) [-640.097] * [-636.989] (-639.520) (-645.530) (-648.711) -- 0:02:33
242500 -- (-644.016) (-640.221) [-639.045] (-648.141) * [-642.396] (-638.301) (-647.700) (-644.421) -- 0:02:33
243000 -- (-647.793) [-636.351] (-640.846) (-636.720) * [-638.241] (-639.457) (-643.373) (-644.573) -- 0:02:32
243500 -- (-643.860) (-638.586) (-642.318) [-640.800] * (-648.778) (-642.540) (-636.080) [-641.737] -- 0:02:32
244000 -- (-639.804) [-634.483] (-634.240) (-642.721) * (-644.002) (-638.235) (-642.990) [-636.563] -- 0:02:34
244500 -- (-645.957) (-641.641) (-648.121) [-635.310] * [-643.721] (-642.219) (-634.801) (-640.754) -- 0:02:34
245000 -- [-634.445] (-634.502) (-640.765) (-638.473) * (-639.224) (-636.569) [-642.880] (-640.600) -- 0:02:34
Average standard deviation of split frequencies: 0.016672
245500 -- [-640.146] (-652.811) (-645.982) (-636.503) * (-639.679) [-637.750] (-648.228) (-637.023) -- 0:02:33
246000 -- [-640.914] (-634.971) (-639.968) (-645.674) * (-642.177) [-643.354] (-650.936) (-642.017) -- 0:02:33
246500 -- (-643.262) [-639.036] (-641.133) (-644.221) * (-639.677) (-641.724) [-640.733] (-643.725) -- 0:02:32
247000 -- (-641.295) (-641.156) (-655.476) [-643.727] * (-637.879) [-633.708] (-642.977) (-642.815) -- 0:02:32
247500 -- [-639.106] (-642.989) (-645.609) (-642.905) * (-639.794) [-638.010] (-642.706) (-643.479) -- 0:02:32
248000 -- (-642.274) [-644.374] (-646.045) (-643.797) * (-648.563) (-640.141) (-640.679) [-638.534] -- 0:02:31
248500 -- [-638.342] (-642.979) (-646.509) (-647.127) * (-646.488) (-639.872) (-641.137) [-639.379] -- 0:02:31
249000 -- [-646.094] (-639.974) (-643.396) (-638.733) * [-640.887] (-645.927) (-644.159) (-644.052) -- 0:02:33
249500 -- (-640.674) [-641.908] (-650.650) (-641.863) * (-648.066) [-642.906] (-639.030) (-642.165) -- 0:02:33
250000 -- (-644.330) [-640.795] (-650.952) (-644.608) * (-639.817) (-636.794) (-646.316) [-641.190] -- 0:02:33
Average standard deviation of split frequencies: 0.014857
250500 -- (-648.697) (-646.986) [-640.427] (-644.440) * (-636.438) (-643.723) [-641.313] (-647.614) -- 0:02:32
251000 -- [-641.658] (-648.953) (-648.774) (-640.446) * (-645.156) (-637.470) (-638.925) [-637.883] -- 0:02:32
251500 -- [-637.863] (-638.732) (-639.583) (-640.834) * (-650.967) (-640.184) (-645.478) [-642.224] -- 0:02:31
252000 -- [-639.577] (-656.036) (-645.249) (-644.442) * (-652.673) [-641.058] (-637.448) (-646.760) -- 0:02:31
252500 -- (-640.053) (-644.567) [-644.213] (-644.697) * (-638.957) (-645.131) [-646.048] (-644.376) -- 0:02:30
253000 -- (-641.942) [-638.195] (-647.439) (-638.596) * (-642.268) (-634.878) (-644.987) [-641.126] -- 0:02:30
253500 -- (-639.439) [-648.292] (-640.760) (-639.065) * (-640.200) [-637.918] (-649.281) (-643.838) -- 0:02:30
254000 -- [-634.787] (-648.168) (-641.520) (-647.763) * (-642.518) (-642.090) [-642.511] (-643.561) -- 0:02:32
254500 -- (-637.435) [-635.712] (-642.217) (-642.635) * (-640.197) [-643.850] (-640.491) (-647.108) -- 0:02:32
255000 -- [-633.472] (-641.185) (-638.372) (-639.052) * (-645.146) [-638.629] (-640.402) (-640.295) -- 0:02:31
Average standard deviation of split frequencies: 0.016205
255500 -- (-644.623) (-641.739) [-641.010] (-648.775) * [-635.289] (-647.803) (-644.079) (-647.435) -- 0:02:31
256000 -- (-636.612) [-640.280] (-642.791) (-646.978) * (-648.377) [-639.119] (-640.712) (-641.651) -- 0:02:31
256500 -- [-640.303] (-645.400) (-639.672) (-644.173) * (-646.686) (-640.159) [-644.980] (-647.189) -- 0:02:30
257000 -- (-638.060) (-637.188) (-645.621) [-638.419] * [-642.456] (-636.402) (-647.482) (-639.194) -- 0:02:30
257500 -- (-642.062) (-638.782) [-643.437] (-646.361) * [-645.697] (-651.205) (-638.350) (-649.158) -- 0:02:29
258000 -- (-637.568) [-638.743] (-642.912) (-640.952) * (-638.433) [-641.612] (-649.977) (-637.346) -- 0:02:29
258500 -- [-646.355] (-635.780) (-641.617) (-644.945) * (-639.996) (-641.628) [-640.187] (-647.005) -- 0:02:32
259000 -- (-639.622) (-643.738) (-641.209) [-642.707] * (-638.587) [-640.868] (-639.628) (-643.496) -- 0:02:31
259500 -- [-654.099] (-644.222) (-640.399) (-636.234) * (-642.678) [-640.572] (-643.660) (-641.456) -- 0:02:31
260000 -- (-640.695) (-639.205) (-638.295) [-642.846] * (-635.498) (-637.778) (-636.798) [-646.223] -- 0:02:30
Average standard deviation of split frequencies: 0.016999
260500 -- (-642.867) [-636.198] (-636.278) (-638.503) * [-638.219] (-642.795) (-637.884) (-646.532) -- 0:02:30
261000 -- (-637.116) (-644.240) [-636.952] (-637.919) * [-641.283] (-637.129) (-643.962) (-647.942) -- 0:02:30
261500 -- (-643.887) [-637.538] (-634.714) (-640.955) * (-645.939) (-649.407) [-646.225] (-649.904) -- 0:02:29
262000 -- [-638.802] (-637.225) (-642.736) (-645.016) * (-639.236) [-640.552] (-643.787) (-643.528) -- 0:02:29
262500 -- [-639.627] (-642.586) (-633.804) (-636.137) * (-651.094) (-642.168) [-645.183] (-642.687) -- 0:02:28
263000 -- [-638.893] (-644.507) (-647.054) (-642.874) * [-638.536] (-636.491) (-646.009) (-644.902) -- 0:02:28
263500 -- [-640.472] (-645.991) (-640.769) (-637.557) * (-640.534) (-642.622) (-637.910) [-636.268] -- 0:02:30
264000 -- [-648.998] (-645.186) (-639.069) (-642.452) * [-639.651] (-644.052) (-650.971) (-637.633) -- 0:02:30
264500 -- (-646.557) (-647.466) [-638.482] (-642.664) * (-646.733) (-639.226) [-639.330] (-641.197) -- 0:02:30
265000 -- (-638.923) (-643.050) (-642.382) [-639.551] * [-636.361] (-638.454) (-637.506) (-641.264) -- 0:02:29
Average standard deviation of split frequencies: 0.016127
265500 -- [-640.351] (-646.028) (-641.809) (-640.177) * [-636.344] (-636.992) (-644.657) (-643.724) -- 0:02:29
266000 -- (-640.665) (-639.171) (-640.606) [-645.522] * (-635.472) [-642.941] (-637.857) (-648.151) -- 0:02:29
266500 -- [-638.723] (-638.201) (-643.443) (-641.268) * (-635.074) (-639.634) (-639.975) [-636.244] -- 0:02:28
267000 -- [-635.316] (-641.249) (-639.938) (-645.123) * (-638.408) (-634.655) [-641.026] (-643.437) -- 0:02:28
267500 -- (-654.035) [-633.977] (-648.444) (-639.302) * [-642.540] (-642.491) (-650.633) (-641.809) -- 0:02:27
268000 -- (-646.906) (-639.369) [-643.249] (-644.381) * [-638.504] (-636.768) (-639.459) (-638.737) -- 0:02:27
268500 -- (-636.636) [-636.565] (-643.662) (-642.984) * (-642.666) [-636.554] (-643.655) (-643.078) -- 0:02:29
269000 -- (-644.662) (-638.152) (-640.799) [-639.392] * (-642.254) (-637.590) (-639.804) [-640.925] -- 0:02:29
269500 -- [-641.508] (-639.994) (-644.326) (-638.921) * (-637.734) (-646.202) (-649.737) [-634.927] -- 0:02:29
270000 -- (-642.332) (-638.666) (-642.908) [-637.984] * (-635.274) (-642.336) (-646.095) [-637.291] -- 0:02:28
Average standard deviation of split frequencies: 0.018113
270500 -- (-638.588) (-653.414) [-647.668] (-637.822) * [-639.777] (-637.284) (-638.067) (-643.729) -- 0:02:28
271000 -- [-640.290] (-643.814) (-638.922) (-642.343) * (-650.150) (-645.555) (-638.241) [-640.035] -- 0:02:27
271500 -- (-641.507) (-635.818) (-647.292) [-644.348] * (-637.457) (-645.636) [-635.228] (-649.786) -- 0:02:27
272000 -- (-645.142) [-641.051] (-642.570) (-643.875) * [-640.162] (-640.557) (-638.179) (-642.373) -- 0:02:27
272500 -- (-639.873) (-640.919) (-640.615) [-639.175] * (-642.581) [-639.975] (-642.266) (-649.170) -- 0:02:26
273000 -- (-639.243) [-639.474] (-643.311) (-639.452) * (-646.004) (-643.668) [-638.230] (-636.565) -- 0:02:26
273500 -- (-643.334) (-642.498) (-637.448) [-636.614] * (-639.089) [-638.147] (-643.058) (-644.092) -- 0:02:28
274000 -- (-642.353) (-651.638) [-639.499] (-641.972) * (-644.757) [-644.878] (-640.308) (-643.239) -- 0:02:28
274500 -- (-641.574) (-645.102) (-647.405) [-640.352] * [-644.922] (-643.697) (-640.294) (-642.373) -- 0:02:28
275000 -- (-640.081) [-636.362] (-644.200) (-638.119) * (-646.662) (-638.236) (-648.447) [-632.262] -- 0:02:27
Average standard deviation of split frequencies: 0.017934
275500 -- (-639.531) [-638.417] (-652.178) (-641.525) * (-654.699) [-639.988] (-644.216) (-642.061) -- 0:02:27
276000 -- (-642.940) [-640.765] (-649.355) (-640.091) * [-637.317] (-636.550) (-643.325) (-641.001) -- 0:02:26
276500 -- [-640.284] (-642.765) (-647.486) (-645.215) * (-642.999) (-639.944) [-637.170] (-637.711) -- 0:02:26
277000 -- (-652.668) (-633.753) (-644.585) [-637.607] * (-648.553) (-640.752) (-645.813) [-642.257] -- 0:02:26
277500 -- [-638.132] (-641.428) (-644.888) (-643.319) * (-639.853) (-643.666) (-638.616) [-637.789] -- 0:02:25
278000 -- (-638.059) [-644.753] (-646.609) (-643.190) * (-647.100) (-643.104) (-643.382) [-642.316] -- 0:02:28
278500 -- (-639.151) (-641.481) [-636.546] (-637.886) * (-652.964) (-646.880) [-645.601] (-642.254) -- 0:02:27
279000 -- (-644.413) [-635.062] (-641.845) (-642.116) * (-645.331) (-649.006) (-634.077) [-638.141] -- 0:02:27
279500 -- (-644.431) (-642.875) [-641.052] (-636.536) * (-646.019) (-649.089) [-638.802] (-642.047) -- 0:02:26
280000 -- [-640.185] (-646.815) (-645.379) (-637.630) * (-642.598) [-652.600] (-645.996) (-645.049) -- 0:02:26
Average standard deviation of split frequencies: 0.017132
280500 -- (-642.060) [-637.813] (-638.960) (-639.562) * (-652.518) (-651.289) (-643.468) [-645.419] -- 0:02:26
281000 -- (-635.993) [-638.407] (-640.998) (-638.432) * (-642.668) [-642.854] (-642.829) (-639.131) -- 0:02:25
281500 -- (-644.599) (-641.343) [-638.030] (-640.997) * [-642.256] (-644.073) (-638.956) (-641.737) -- 0:02:25
282000 -- (-642.123) (-637.181) [-643.168] (-642.497) * (-646.008) (-644.294) (-639.906) [-644.423] -- 0:02:25
282500 -- [-646.323] (-644.146) (-639.481) (-648.633) * (-649.475) (-648.441) (-642.534) [-644.817] -- 0:02:24
283000 -- (-639.591) (-645.386) [-636.632] (-648.293) * (-638.617) [-643.991] (-639.447) (-648.674) -- 0:02:26
283500 -- [-640.795] (-644.164) (-640.942) (-641.112) * [-644.496] (-641.234) (-644.562) (-656.406) -- 0:02:26
284000 -- (-640.881) (-647.729) [-644.271] (-644.059) * [-639.537] (-640.932) (-640.270) (-663.552) -- 0:02:26
284500 -- (-637.234) (-640.364) [-637.541] (-648.515) * (-640.750) (-648.927) [-643.335] (-643.659) -- 0:02:25
285000 -- (-642.466) (-640.653) [-640.445] (-646.796) * (-639.543) [-648.068] (-643.447) (-640.474) -- 0:02:25
Average standard deviation of split frequencies: 0.017307
285500 -- (-640.273) (-643.312) (-650.579) [-636.047] * (-640.801) (-643.036) [-643.113] (-647.167) -- 0:02:25
286000 -- (-645.926) (-637.366) (-640.520) [-640.207] * (-640.417) (-644.793) [-643.027] (-637.696) -- 0:02:24
286500 -- (-641.145) [-637.303] (-640.159) (-637.604) * [-639.373] (-641.300) (-644.512) (-639.501) -- 0:02:24
287000 -- (-641.456) [-635.303] (-637.099) (-641.620) * (-644.147) [-640.125] (-641.951) (-648.627) -- 0:02:24
287500 -- (-641.228) (-637.625) [-635.885] (-645.835) * [-639.154] (-640.938) (-648.230) (-642.968) -- 0:02:23
288000 -- [-642.440] (-641.743) (-644.969) (-648.017) * (-649.223) (-648.329) [-641.994] (-642.530) -- 0:02:25
288500 -- (-642.284) (-645.331) [-632.275] (-645.720) * (-643.264) (-639.597) [-638.362] (-648.021) -- 0:02:25
289000 -- (-643.509) (-637.603) (-641.151) [-641.868] * (-641.535) (-639.216) (-637.200) [-641.519] -- 0:02:25
289500 -- (-638.642) (-638.414) [-637.618] (-636.481) * (-636.682) (-646.143) [-652.833] (-639.631) -- 0:02:24
290000 -- (-647.222) (-647.425) (-642.825) [-637.409] * [-640.057] (-642.832) (-644.362) (-644.601) -- 0:02:24
Average standard deviation of split frequencies: 0.016380
290500 -- (-646.941) (-642.693) [-643.184] (-641.664) * [-640.908] (-635.569) (-645.138) (-645.561) -- 0:02:24
291000 -- [-638.487] (-643.186) (-636.915) (-642.562) * [-647.624] (-639.839) (-642.886) (-640.137) -- 0:02:23
291500 -- (-649.316) (-649.642) [-643.561] (-647.428) * (-643.502) (-641.426) (-643.559) [-641.122] -- 0:02:23
292000 -- (-640.493) (-642.325) [-640.574] (-638.850) * (-644.829) (-638.277) [-635.672] (-639.276) -- 0:02:23
292500 -- (-639.962) (-636.409) [-636.593] (-651.476) * (-643.693) (-644.979) (-637.408) [-637.961] -- 0:02:22
293000 -- (-648.202) [-638.445] (-637.139) (-646.831) * (-642.519) [-640.262] (-645.467) (-641.884) -- 0:02:24
293500 -- (-637.182) (-641.831) (-634.255) [-640.128] * [-645.252] (-648.448) (-642.097) (-644.923) -- 0:02:24
294000 -- [-642.420] (-638.697) (-635.160) (-647.082) * (-641.409) [-634.753] (-642.523) (-637.947) -- 0:02:24
294500 -- (-641.116) (-657.431) [-636.351] (-638.940) * [-637.506] (-640.506) (-641.273) (-643.279) -- 0:02:23
295000 -- (-635.253) (-649.262) [-635.725] (-638.378) * [-638.160] (-646.228) (-652.081) (-646.081) -- 0:02:23
Average standard deviation of split frequencies: 0.016085
295500 -- [-636.777] (-642.771) (-638.456) (-641.850) * (-646.395) (-640.555) [-652.957] (-644.249) -- 0:02:23
296000 -- [-637.856] (-645.235) (-639.180) (-641.211) * (-645.441) [-641.086] (-643.225) (-640.901) -- 0:02:22
296500 -- (-639.486) (-644.797) (-639.876) [-638.166] * (-640.250) (-641.345) [-636.793] (-641.142) -- 0:02:22
297000 -- (-647.921) (-641.576) [-634.410] (-649.306) * (-642.343) [-640.873] (-643.753) (-641.158) -- 0:02:22
297500 -- (-644.855) [-642.457] (-641.812) (-640.158) * (-634.361) (-644.075) [-640.097] (-637.190) -- 0:02:21
298000 -- (-637.749) (-635.088) (-637.833) [-639.993] * (-644.657) (-650.358) [-639.347] (-640.665) -- 0:02:23
298500 -- (-643.752) (-644.978) (-651.455) [-639.938] * (-643.844) (-638.814) [-641.434] (-640.347) -- 0:02:23
299000 -- [-639.898] (-639.439) (-641.771) (-639.205) * [-639.704] (-642.227) (-636.876) (-637.797) -- 0:02:23
299500 -- (-641.481) (-640.033) (-642.966) [-645.251] * (-645.264) (-647.146) [-640.621] (-642.748) -- 0:02:22
300000 -- (-643.272) (-641.302) [-634.123] (-648.108) * (-640.195) (-636.889) [-639.612] (-636.554) -- 0:02:22
Average standard deviation of split frequencies: 0.016463
300500 -- (-650.298) [-641.053] (-642.752) (-647.965) * (-638.327) (-642.704) [-640.219] (-637.490) -- 0:02:21
301000 -- (-645.411) (-647.393) (-636.119) [-642.795] * (-639.974) (-642.438) (-645.373) [-631.747] -- 0:02:21
301500 -- [-640.273] (-640.196) (-645.666) (-642.936) * (-643.955) (-639.028) (-643.049) [-644.571] -- 0:02:21
302000 -- [-642.343] (-643.338) (-642.521) (-647.277) * (-638.775) [-637.130] (-648.296) (-637.870) -- 0:02:20
302500 -- (-644.055) (-643.560) [-638.059] (-643.370) * (-643.177) (-648.755) (-639.909) [-643.487] -- 0:02:22
303000 -- (-646.385) (-637.450) [-642.998] (-641.325) * (-636.247) (-641.151) (-645.485) [-640.988] -- 0:02:22
303500 -- (-644.935) (-641.159) (-641.100) [-637.946] * [-642.677] (-645.852) (-640.348) (-642.924) -- 0:02:22
304000 -- [-640.428] (-646.484) (-645.922) (-647.360) * (-638.578) [-642.992] (-647.774) (-644.037) -- 0:02:21
304500 -- (-638.980) (-641.914) (-645.802) [-642.398] * (-645.290) [-639.229] (-639.180) (-638.298) -- 0:02:21
305000 -- (-643.508) [-636.990] (-641.317) (-641.333) * (-640.777) (-650.645) (-649.229) [-638.370] -- 0:02:21
Average standard deviation of split frequencies: 0.015097
305500 -- [-638.677] (-643.383) (-639.965) (-645.384) * (-642.573) (-644.086) [-643.683] (-640.385) -- 0:02:20
306000 -- (-640.427) (-649.981) [-636.674] (-638.675) * (-639.129) (-637.160) (-635.991) [-642.167] -- 0:02:20
306500 -- [-637.933] (-641.005) (-646.681) (-641.271) * (-640.004) (-640.420) [-638.872] (-649.166) -- 0:02:20
307000 -- (-645.199) (-649.929) (-642.887) [-645.237] * (-634.027) (-642.137) [-638.597] (-649.625) -- 0:02:19
307500 -- [-643.348] (-643.079) (-644.291) (-642.513) * (-637.664) [-640.105] (-639.593) (-636.996) -- 0:02:21
308000 -- (-644.479) [-639.938] (-649.107) (-634.794) * [-641.339] (-640.283) (-639.281) (-634.599) -- 0:02:21
308500 -- [-647.250] (-637.595) (-640.619) (-649.460) * [-637.796] (-636.270) (-654.918) (-647.955) -- 0:02:21
309000 -- (-646.336) (-648.662) (-645.692) [-634.432] * (-643.913) [-639.372] (-645.215) (-641.508) -- 0:02:20
309500 -- (-640.762) (-648.466) (-648.225) [-637.013] * (-650.852) (-637.960) (-641.230) [-638.908] -- 0:02:20
310000 -- [-641.354] (-650.895) (-639.399) (-640.820) * (-651.807) (-641.304) [-636.000] (-649.798) -- 0:02:20
Average standard deviation of split frequencies: 0.014112
310500 -- (-649.127) (-644.353) [-637.067] (-647.192) * (-644.150) (-640.479) (-639.757) [-638.307] -- 0:02:19
311000 -- (-647.500) [-645.351] (-642.528) (-634.248) * (-647.312) (-639.145) (-639.943) [-636.304] -- 0:02:19
311500 -- (-642.801) (-642.851) (-638.993) [-645.999] * (-641.315) (-642.279) [-637.819] (-646.256) -- 0:02:19
312000 -- (-638.750) (-643.546) (-638.357) [-641.631] * (-653.312) (-639.002) (-641.126) [-640.604] -- 0:02:18
312500 -- [-634.918] (-642.826) (-643.173) (-641.872) * (-634.932) (-637.829) [-638.436] (-651.621) -- 0:02:20
313000 -- [-643.856] (-645.415) (-637.830) (-635.538) * [-645.125] (-643.211) (-638.672) (-642.558) -- 0:02:20
313500 -- (-642.813) [-641.002] (-648.106) (-639.850) * (-637.794) (-639.924) [-642.662] (-647.587) -- 0:02:20
314000 -- (-645.319) [-644.625] (-640.297) (-639.823) * (-639.979) [-640.864] (-642.614) (-642.496) -- 0:02:19
314500 -- (-641.832) [-640.707] (-637.048) (-639.414) * (-646.688) (-640.200) (-643.100) [-636.622] -- 0:02:19
315000 -- (-638.338) (-646.749) (-638.695) [-642.365] * (-646.079) (-643.234) (-642.316) [-639.818] -- 0:02:19
Average standard deviation of split frequencies: 0.013128
315500 -- (-644.907) (-646.534) [-637.473] (-645.336) * (-647.666) (-642.026) [-638.452] (-644.324) -- 0:02:18
316000 -- [-649.713] (-645.551) (-636.465) (-643.299) * (-649.241) [-640.425] (-642.291) (-635.235) -- 0:02:18
316500 -- (-634.972) [-634.471] (-641.437) (-650.963) * (-648.502) [-639.216] (-642.482) (-638.213) -- 0:02:18
317000 -- (-648.542) [-638.318] (-639.908) (-646.612) * (-641.576) (-639.770) [-639.187] (-644.752) -- 0:02:17
317500 -- [-634.844] (-634.538) (-647.503) (-639.792) * (-644.286) [-640.336] (-639.667) (-639.161) -- 0:02:19
318000 -- (-642.177) (-640.643) [-638.009] (-640.635) * [-642.010] (-643.851) (-647.031) (-641.197) -- 0:02:19
318500 -- (-641.620) [-640.921] (-637.437) (-644.907) * (-642.041) (-651.716) (-642.497) [-641.532] -- 0:02:19
319000 -- (-633.665) (-644.717) [-640.802] (-640.848) * (-654.598) [-638.316] (-642.501) (-637.795) -- 0:02:18
319500 -- (-636.939) (-646.087) [-642.379] (-645.280) * (-645.781) (-642.533) (-645.166) [-641.767] -- 0:02:18
320000 -- (-636.055) (-645.053) (-648.632) [-635.221] * (-645.601) (-646.525) (-639.022) [-641.076] -- 0:02:18
Average standard deviation of split frequencies: 0.014113
320500 -- (-644.887) (-637.482) (-645.228) [-639.479] * (-648.034) (-645.484) [-637.145] (-637.211) -- 0:02:17
321000 -- (-640.514) [-640.304] (-638.784) (-640.898) * (-638.719) (-642.580) [-639.706] (-642.674) -- 0:02:17
321500 -- [-636.723] (-642.931) (-641.601) (-637.383) * (-639.387) (-643.310) (-646.791) [-641.084] -- 0:02:17
322000 -- [-636.889] (-642.135) (-640.418) (-638.459) * [-642.147] (-641.962) (-635.405) (-642.568) -- 0:02:18
322500 -- (-642.264) [-642.069] (-637.017) (-644.536) * (-641.500) (-642.019) [-640.731] (-636.550) -- 0:02:18
323000 -- (-647.070) [-641.471] (-639.788) (-647.551) * (-641.215) (-643.663) [-635.085] (-645.858) -- 0:02:18
323500 -- (-645.755) (-638.987) (-643.085) [-642.412] * (-646.025) (-653.041) (-636.025) [-644.402] -- 0:02:18
324000 -- [-637.446] (-644.858) (-640.206) (-639.567) * (-645.543) [-641.369] (-638.929) (-656.134) -- 0:02:17
324500 -- (-646.753) (-641.220) [-639.338] (-637.634) * (-645.328) [-635.517] (-642.520) (-642.608) -- 0:02:17
325000 -- [-642.912] (-639.151) (-643.470) (-643.970) * [-640.133] (-649.913) (-643.967) (-645.303) -- 0:02:17
Average standard deviation of split frequencies: 0.013448
325500 -- (-641.387) (-640.623) [-638.981] (-639.709) * [-638.255] (-647.482) (-639.326) (-649.430) -- 0:02:16
326000 -- (-639.433) (-648.723) [-638.736] (-636.794) * (-633.979) (-650.265) (-638.507) [-644.801] -- 0:02:16
326500 -- [-635.516] (-647.615) (-639.321) (-651.500) * [-642.398] (-643.229) (-642.207) (-643.284) -- 0:02:16
327000 -- (-640.947) (-645.915) [-648.306] (-644.917) * (-639.011) [-640.953] (-645.695) (-639.370) -- 0:02:17
327500 -- [-635.160] (-644.407) (-651.806) (-644.677) * [-634.414] (-640.076) (-637.994) (-644.293) -- 0:02:17
328000 -- [-638.637] (-638.201) (-644.871) (-641.446) * [-641.132] (-645.150) (-641.934) (-635.510) -- 0:02:17
328500 -- [-639.735] (-657.207) (-639.477) (-651.668) * (-645.177) (-639.704) [-642.521] (-637.634) -- 0:02:16
329000 -- (-641.935) [-641.902] (-635.505) (-649.755) * (-638.978) (-641.897) [-642.605] (-640.672) -- 0:02:16
329500 -- (-647.407) [-639.146] (-638.130) (-644.809) * (-640.222) (-642.312) (-642.046) [-647.311] -- 0:02:16
330000 -- (-641.199) (-641.458) (-635.469) [-641.133] * [-636.837] (-638.854) (-640.068) (-643.201) -- 0:02:16
Average standard deviation of split frequencies: 0.012118
330500 -- (-636.448) (-645.939) [-632.635] (-654.154) * (-636.545) (-643.630) (-641.404) [-639.249] -- 0:02:15
331000 -- (-643.529) [-638.043] (-643.614) (-639.206) * (-637.407) (-638.471) (-646.036) [-640.166] -- 0:02:15
331500 -- [-634.364] (-639.717) (-636.749) (-641.361) * (-641.120) (-642.986) (-642.451) [-635.689] -- 0:02:15
332000 -- (-646.344) (-655.810) (-636.896) [-641.729] * [-642.414] (-638.005) (-640.891) (-639.643) -- 0:02:16
332500 -- (-638.816) [-637.765] (-643.812) (-642.060) * (-641.424) (-647.801) (-646.011) [-639.620] -- 0:02:16
333000 -- (-649.883) (-637.489) (-639.066) [-635.901] * (-639.615) (-641.847) (-646.487) [-642.864] -- 0:02:16
333500 -- (-644.800) (-646.113) [-637.879] (-641.490) * (-648.430) [-636.710] (-651.732) (-645.690) -- 0:02:15
334000 -- (-651.573) [-639.545] (-644.563) (-640.051) * (-646.575) (-640.057) [-639.193] (-631.873) -- 0:02:15
334500 -- (-657.289) (-639.513) (-638.410) [-637.133] * (-640.536) (-640.097) (-640.017) [-638.426] -- 0:02:15
335000 -- (-649.928) (-636.885) [-644.076] (-641.557) * [-633.991] (-649.624) (-644.938) (-642.500) -- 0:02:14
Average standard deviation of split frequencies: 0.011847
335500 -- (-639.121) (-649.948) (-647.209) [-638.420] * (-643.833) (-642.981) (-645.708) [-637.448] -- 0:02:14
336000 -- (-642.672) (-636.334) (-639.573) [-643.863] * (-642.203) [-636.778] (-643.540) (-638.905) -- 0:02:14
336500 -- (-646.331) [-639.365] (-651.382) (-645.893) * (-640.856) (-641.929) [-643.702] (-641.997) -- 0:02:14
337000 -- (-643.688) (-637.299) (-646.750) [-641.874] * (-640.086) (-641.175) (-647.553) [-640.079] -- 0:02:15
337500 -- (-642.706) [-639.554] (-647.435) (-643.478) * [-637.886] (-646.889) (-641.730) (-636.936) -- 0:02:15
338000 -- [-642.307] (-643.675) (-637.964) (-640.076) * [-639.938] (-646.831) (-644.463) (-640.818) -- 0:02:15
338500 -- [-643.865] (-638.720) (-640.300) (-647.163) * (-639.081) (-639.528) [-646.270] (-636.379) -- 0:02:14
339000 -- (-647.805) [-641.836] (-644.318) (-642.686) * (-642.721) (-641.916) (-643.797) [-646.557] -- 0:02:14
339500 -- (-647.880) (-646.630) [-636.681] (-637.345) * (-642.410) (-645.592) [-641.277] (-637.035) -- 0:02:14
340000 -- (-646.980) [-649.574] (-640.248) (-635.638) * (-648.790) [-641.930] (-639.600) (-642.475) -- 0:02:13
Average standard deviation of split frequencies: 0.014299
340500 -- (-642.101) (-651.099) (-650.033) [-637.517] * [-641.113] (-643.552) (-644.538) (-640.984) -- 0:02:13
341000 -- (-648.079) [-635.824] (-643.859) (-643.047) * (-641.163) (-639.703) (-649.819) [-635.016] -- 0:02:13
341500 -- (-642.579) (-641.020) (-638.725) [-643.560] * (-643.854) (-634.127) (-641.382) [-637.530] -- 0:02:13
342000 -- (-639.974) (-637.274) (-639.548) [-646.149] * (-640.409) (-639.740) (-644.078) [-640.445] -- 0:02:14
342500 -- (-647.138) (-642.717) [-637.911] (-641.452) * [-634.149] (-639.134) (-642.126) (-647.623) -- 0:02:14
343000 -- [-645.745] (-636.050) (-639.764) (-643.143) * [-633.408] (-647.404) (-651.532) (-644.930) -- 0:02:14
343500 -- [-641.471] (-641.712) (-644.240) (-645.964) * [-634.969] (-648.065) (-641.487) (-636.633) -- 0:02:13
344000 -- (-651.693) [-641.485] (-640.348) (-643.693) * (-639.868) (-639.737) [-645.318] (-646.927) -- 0:02:13
344500 -- (-645.201) (-651.203) [-636.693] (-636.436) * (-640.365) (-642.058) (-643.226) [-641.635] -- 0:02:13
345000 -- [-643.773] (-647.339) (-644.565) (-645.969) * [-640.623] (-638.515) (-643.179) (-649.009) -- 0:02:12
Average standard deviation of split frequencies: 0.016349
345500 -- (-643.966) (-650.834) [-636.491] (-645.362) * [-639.490] (-655.973) (-641.833) (-651.228) -- 0:02:12
346000 -- (-642.201) [-639.099] (-636.728) (-643.808) * (-644.701) (-649.517) [-644.604] (-644.804) -- 0:02:12
346500 -- (-643.711) [-633.091] (-639.645) (-641.022) * (-646.296) (-641.104) [-633.940] (-643.671) -- 0:02:13
347000 -- [-644.429] (-648.932) (-637.855) (-645.249) * (-643.709) [-642.862] (-645.832) (-637.166) -- 0:02:13
347500 -- [-643.516] (-640.635) (-640.347) (-639.348) * (-655.224) (-643.532) [-638.295] (-641.917) -- 0:02:13
348000 -- [-643.201] (-639.529) (-637.307) (-639.600) * [-639.219] (-643.431) (-638.764) (-643.132) -- 0:02:13
348500 -- (-638.975) [-634.382] (-639.115) (-640.965) * (-641.149) (-646.748) [-641.422] (-641.225) -- 0:02:12
349000 -- (-640.150) (-640.083) [-639.430] (-639.100) * [-640.228] (-642.168) (-640.993) (-639.280) -- 0:02:12
349500 -- (-646.223) (-649.163) (-641.654) [-639.398] * (-640.356) (-638.327) [-640.173] (-641.966) -- 0:02:12
350000 -- (-638.961) [-643.463] (-643.742) (-636.555) * (-639.255) [-638.324] (-651.070) (-643.586) -- 0:02:11
Average standard deviation of split frequencies: 0.016669
350500 -- (-642.071) (-642.126) (-647.686) [-642.924] * (-640.260) (-637.779) (-654.842) [-638.646] -- 0:02:11
351000 -- (-640.975) (-638.547) (-645.333) [-635.353] * (-641.521) (-642.093) (-636.827) [-643.550] -- 0:02:11
351500 -- (-642.721) (-643.585) (-641.559) [-644.569] * (-639.887) (-639.736) [-640.177] (-638.450) -- 0:02:12
352000 -- [-636.774] (-644.982) (-639.256) (-639.843) * (-639.408) (-641.123) (-641.821) [-639.827] -- 0:02:12
352500 -- (-641.396) (-644.015) (-638.894) [-640.102] * (-641.205) (-638.360) [-638.756] (-643.293) -- 0:02:12
353000 -- (-640.941) (-637.579) (-643.599) [-645.367] * (-638.079) (-645.801) [-638.797] (-649.835) -- 0:02:11
353500 -- [-635.867] (-644.794) (-645.643) (-639.361) * (-640.457) (-639.950) [-637.114] (-641.707) -- 0:02:11
354000 -- (-641.102) (-639.678) [-641.061] (-643.659) * (-647.982) (-638.505) (-644.925) [-643.531] -- 0:02:11
354500 -- [-637.898] (-643.286) (-638.156) (-635.894) * (-648.024) (-646.194) [-634.271] (-638.286) -- 0:02:11
355000 -- [-634.890] (-651.127) (-639.906) (-643.531) * (-643.922) (-643.198) [-639.408] (-635.104) -- 0:02:10
Average standard deviation of split frequencies: 0.015890
355500 -- [-634.717] (-637.971) (-641.662) (-640.771) * [-640.557] (-634.854) (-649.918) (-640.883) -- 0:02:10
356000 -- (-640.164) [-632.282] (-641.124) (-640.934) * (-658.277) [-637.901] (-647.848) (-640.005) -- 0:02:10
356500 -- [-638.924] (-637.934) (-650.884) (-647.157) * (-634.047) (-639.550) (-634.915) [-639.871] -- 0:02:11
357000 -- (-644.229) (-648.661) (-635.351) [-643.055] * (-642.563) (-637.195) [-635.139] (-652.180) -- 0:02:11
357500 -- (-639.901) [-642.827] (-636.556) (-643.425) * (-644.808) [-639.866] (-636.646) (-644.442) -- 0:02:11
358000 -- [-641.777] (-646.065) (-642.095) (-651.112) * (-641.497) [-638.266] (-639.533) (-639.934) -- 0:02:10
358500 -- (-641.307) (-641.469) (-637.125) [-637.850] * (-639.674) (-642.848) [-636.412] (-642.741) -- 0:02:10
359000 -- (-643.030) [-635.918] (-639.590) (-633.863) * (-635.657) (-646.375) [-638.048] (-638.816) -- 0:02:10
359500 -- (-638.841) (-641.590) [-641.808] (-645.239) * [-639.120] (-646.930) (-641.972) (-640.059) -- 0:02:10
360000 -- (-647.923) (-642.629) [-641.279] (-639.817) * [-642.423] (-637.929) (-644.336) (-637.118) -- 0:02:09
Average standard deviation of split frequencies: 0.016599
360500 -- (-643.856) [-640.692] (-638.921) (-639.042) * (-642.065) (-642.445) (-641.195) [-643.111] -- 0:02:09
361000 -- (-640.830) (-640.225) [-637.269] (-644.654) * [-640.414] (-648.631) (-642.513) (-645.836) -- 0:02:09
361500 -- (-641.086) [-636.081] (-637.173) (-648.243) * (-635.214) [-645.143] (-642.777) (-646.409) -- 0:02:10
362000 -- (-639.762) [-650.436] (-646.258) (-652.905) * (-636.329) (-650.193) (-638.305) [-641.042] -- 0:02:10
362500 -- [-638.590] (-649.097) (-648.071) (-641.423) * (-638.758) (-638.803) (-640.528) [-645.853] -- 0:02:10
363000 -- (-642.771) [-647.300] (-639.447) (-645.854) * (-638.316) (-643.890) (-637.043) [-636.178] -- 0:02:09
363500 -- (-640.323) (-647.761) [-636.832] (-640.623) * (-641.741) (-644.037) [-636.958] (-642.924) -- 0:02:09
364000 -- (-641.270) (-648.553) (-646.932) [-635.495] * (-639.459) (-642.919) [-636.915] (-644.352) -- 0:02:09
364500 -- (-639.311) (-645.279) (-644.613) [-635.577] * (-637.355) [-638.145] (-636.390) (-639.463) -- 0:02:09
365000 -- (-638.456) (-640.585) (-641.525) [-645.110] * (-644.436) (-648.904) [-639.065] (-641.003) -- 0:02:08
Average standard deviation of split frequencies: 0.014425
365500 -- [-648.356] (-641.345) (-636.485) (-646.827) * (-636.674) (-649.518) (-640.446) [-637.523] -- 0:02:08
366000 -- (-637.813) (-635.945) (-640.224) [-643.454] * (-641.947) [-642.153] (-645.157) (-643.281) -- 0:02:09
366500 -- [-643.623] (-648.995) (-643.179) (-642.266) * (-639.425) [-640.844] (-640.794) (-642.600) -- 0:02:09
367000 -- (-645.482) (-642.855) [-634.510] (-645.379) * (-633.576) [-645.629] (-644.438) (-644.533) -- 0:02:09
367500 -- [-634.164] (-647.877) (-645.305) (-647.119) * (-646.210) (-651.326) [-636.472] (-639.584) -- 0:02:09
368000 -- (-639.926) (-636.126) [-641.219] (-639.073) * (-635.874) (-648.600) [-642.745] (-642.943) -- 0:02:08
368500 -- (-638.827) (-638.134) (-639.703) [-640.105] * [-635.797] (-646.661) (-641.452) (-641.791) -- 0:02:08
369000 -- (-644.972) (-637.540) [-638.455] (-634.304) * (-645.449) [-638.049] (-645.374) (-638.999) -- 0:02:08
369500 -- (-642.791) [-644.302] (-644.156) (-641.610) * [-643.559] (-643.107) (-644.249) (-641.533) -- 0:02:07
370000 -- (-641.370) [-643.384] (-638.081) (-643.321) * (-640.321) [-650.493] (-650.477) (-639.575) -- 0:02:07
Average standard deviation of split frequencies: 0.014753
370500 -- [-641.872] (-648.277) (-631.081) (-647.943) * (-640.169) [-641.845] (-655.886) (-642.433) -- 0:02:07
371000 -- (-642.047) [-637.707] (-640.764) (-640.229) * (-638.623) (-638.934) [-646.735] (-643.641) -- 0:02:08
371500 -- (-640.756) (-641.297) (-643.900) [-638.714] * (-643.974) (-646.687) [-644.189] (-638.585) -- 0:02:08
372000 -- (-646.951) (-639.551) [-636.821] (-641.812) * (-639.065) (-639.190) (-638.931) [-638.969] -- 0:02:08
372500 -- (-641.778) [-639.712] (-639.403) (-649.577) * (-638.873) (-635.691) [-633.146] (-644.117) -- 0:02:08
373000 -- (-639.037) (-642.378) [-636.887] (-637.027) * (-646.158) (-648.729) [-637.849] (-637.579) -- 0:02:07
373500 -- (-635.223) [-639.176] (-642.975) (-637.416) * [-636.505] (-637.839) (-642.370) (-638.220) -- 0:02:07
374000 -- (-638.161) (-639.590) (-635.093) [-642.335] * (-642.632) [-642.007] (-641.207) (-638.739) -- 0:02:07
374500 -- (-639.588) (-649.404) [-641.327] (-641.580) * (-648.713) [-640.749] (-646.657) (-647.630) -- 0:02:06
375000 -- (-639.177) [-641.924] (-638.886) (-641.018) * (-649.265) (-641.692) (-643.205) [-640.711] -- 0:02:06
Average standard deviation of split frequencies: 0.015463
375500 -- (-641.974) (-648.636) [-642.657] (-639.939) * (-645.483) [-636.178] (-642.646) (-641.424) -- 0:02:06
376000 -- (-642.400) (-645.400) (-641.813) [-639.695] * [-644.215] (-640.813) (-645.382) (-645.931) -- 0:02:07
376500 -- [-640.160] (-645.871) (-644.794) (-644.188) * (-641.523) (-639.677) (-648.186) [-640.572] -- 0:02:07
377000 -- [-641.260] (-652.394) (-642.949) (-644.360) * (-638.142) (-644.885) [-644.417] (-637.184) -- 0:02:07
377500 -- (-654.282) (-648.269) [-636.600] (-647.213) * (-645.465) (-646.891) [-643.230] (-647.838) -- 0:02:06
378000 -- [-643.142] (-637.816) (-637.549) (-639.281) * (-647.876) (-643.526) [-637.005] (-641.101) -- 0:02:06
378500 -- [-635.510] (-640.003) (-642.239) (-635.461) * [-639.971] (-637.394) (-641.555) (-636.476) -- 0:02:06
379000 -- (-636.438) (-643.934) [-637.719] (-640.466) * [-642.256] (-638.169) (-640.148) (-639.057) -- 0:02:06
379500 -- [-636.222] (-640.909) (-637.721) (-643.659) * (-640.791) (-638.431) (-647.792) [-645.104] -- 0:02:05
380000 -- (-641.595) (-642.726) (-637.367) [-637.272] * (-640.139) (-636.612) [-639.745] (-644.984) -- 0:02:05
Average standard deviation of split frequencies: 0.014310
380500 -- (-635.914) (-640.547) [-644.470] (-641.806) * (-643.070) (-646.299) (-637.852) [-642.554] -- 0:02:06
381000 -- (-638.987) (-637.200) (-638.187) [-641.490] * (-642.204) (-638.727) [-640.028] (-639.011) -- 0:02:06
381500 -- (-637.731) (-641.579) [-644.778] (-653.176) * (-636.220) (-645.441) (-644.244) [-637.838] -- 0:02:06
382000 -- (-641.212) [-640.842] (-654.322) (-641.498) * (-642.437) (-637.459) [-640.530] (-636.005) -- 0:02:06
382500 -- (-635.749) [-641.403] (-645.281) (-638.489) * (-641.543) [-636.569] (-637.626) (-643.512) -- 0:02:05
383000 -- (-638.351) [-640.871] (-637.944) (-641.021) * (-639.468) (-644.354) (-648.374) [-635.621] -- 0:02:05
383500 -- [-642.557] (-637.731) (-633.750) (-639.949) * (-641.665) (-645.586) (-656.121) [-643.007] -- 0:02:05
384000 -- (-645.372) (-650.107) [-635.042] (-640.839) * (-635.799) (-645.787) (-641.110) [-639.816] -- 0:02:05
384500 -- (-637.907) (-644.558) (-638.271) [-635.845] * (-637.033) (-641.619) (-639.209) [-637.746] -- 0:02:04
385000 -- (-640.657) [-644.709] (-649.109) (-634.818) * [-637.161] (-638.309) (-637.887) (-639.816) -- 0:02:04
Average standard deviation of split frequencies: 0.015062
385500 -- (-641.253) [-639.831] (-641.179) (-645.664) * [-639.298] (-645.789) (-645.688) (-645.896) -- 0:02:05
386000 -- (-636.536) [-635.147] (-643.843) (-644.475) * [-642.551] (-641.070) (-638.805) (-643.575) -- 0:02:05
386500 -- [-636.883] (-642.430) (-649.525) (-642.325) * [-636.921] (-647.568) (-646.093) (-637.090) -- 0:02:05
387000 -- (-640.563) (-640.343) (-640.486) [-645.096] * [-638.088] (-638.659) (-646.455) (-643.316) -- 0:02:05
387500 -- [-636.908] (-641.877) (-655.715) (-649.173) * (-641.271) [-638.428] (-635.705) (-644.736) -- 0:02:04
388000 -- (-643.828) [-640.538] (-641.565) (-645.786) * [-644.830] (-645.082) (-640.379) (-637.336) -- 0:02:04
388500 -- [-641.556] (-648.298) (-639.714) (-648.548) * (-639.669) (-639.724) (-653.287) [-643.401] -- 0:02:04
389000 -- [-637.120] (-654.153) (-637.036) (-655.359) * (-644.986) (-642.467) [-638.883] (-642.456) -- 0:02:04
389500 -- [-637.892] (-646.055) (-646.141) (-651.849) * [-637.641] (-647.773) (-641.125) (-648.573) -- 0:02:03
390000 -- (-640.134) [-640.442] (-640.431) (-647.492) * [-637.599] (-641.961) (-641.586) (-640.687) -- 0:02:03
Average standard deviation of split frequencies: 0.015821
390500 -- (-642.146) [-639.041] (-641.486) (-653.631) * (-640.135) [-643.328] (-636.924) (-643.898) -- 0:02:04
391000 -- (-641.140) [-635.366] (-638.641) (-646.454) * (-637.783) (-644.248) (-643.228) [-643.746] -- 0:02:04
391500 -- [-643.689] (-636.508) (-646.754) (-653.066) * (-635.720) (-640.407) (-644.229) [-642.241] -- 0:02:04
392000 -- [-633.372] (-644.749) (-642.153) (-655.628) * (-642.487) (-646.489) (-644.031) [-637.725] -- 0:02:04
392500 -- (-642.245) (-641.287) [-636.799] (-655.080) * (-641.896) (-647.288) (-643.265) [-642.442] -- 0:02:03
393000 -- (-637.381) [-639.586] (-639.184) (-647.632) * (-636.151) (-641.060) (-639.914) [-636.136] -- 0:02:03
393500 -- (-643.455) (-644.588) [-640.003] (-651.255) * (-636.172) (-641.395) [-633.930] (-635.938) -- 0:02:03
394000 -- [-639.190] (-641.219) (-642.365) (-645.700) * (-651.754) (-640.709) (-639.657) [-635.169] -- 0:02:03
394500 -- [-631.388] (-644.546) (-639.970) (-645.796) * (-646.651) (-641.630) [-638.903] (-642.014) -- 0:02:02
395000 -- [-637.156] (-638.903) (-637.155) (-639.033) * (-644.966) [-638.310] (-638.765) (-640.460) -- 0:02:02
Average standard deviation of split frequencies: 0.016269
395500 -- (-643.704) (-640.725) [-643.829] (-653.933) * [-634.081] (-641.068) (-649.480) (-643.948) -- 0:02:03
396000 -- [-643.452] (-636.301) (-645.377) (-642.003) * (-646.305) (-642.490) (-637.421) [-636.179] -- 0:02:03
396500 -- (-643.048) (-639.902) [-645.586] (-641.677) * (-639.044) [-638.339] (-636.089) (-656.163) -- 0:02:03
397000 -- (-642.151) (-643.257) [-640.358] (-650.102) * [-639.318] (-641.356) (-638.868) (-644.835) -- 0:02:03
397500 -- [-638.784] (-649.904) (-641.293) (-640.449) * (-634.540) [-637.229] (-644.112) (-642.048) -- 0:02:02
398000 -- (-646.955) (-644.233) (-640.043) [-641.981] * (-641.698) (-642.346) [-633.438] (-644.974) -- 0:02:02
398500 -- (-643.350) (-639.775) [-634.101] (-636.051) * (-648.749) (-634.799) (-636.440) [-638.543] -- 0:02:02
399000 -- (-647.506) (-636.784) [-635.115] (-644.426) * (-643.798) (-637.904) [-644.990] (-637.822) -- 0:02:02
399500 -- [-640.541] (-639.442) (-640.292) (-637.950) * [-642.503] (-642.225) (-646.289) (-642.760) -- 0:02:01
400000 -- (-633.203) (-647.649) [-636.111] (-633.638) * (-650.126) (-635.896) (-646.803) [-645.354] -- 0:02:01
Average standard deviation of split frequencies: 0.016080
400500 -- (-642.478) [-642.781] (-635.024) (-648.745) * [-635.336] (-635.674) (-645.748) (-643.753) -- 0:02:02
401000 -- (-641.763) (-640.512) [-636.178] (-640.561) * [-635.801] (-639.374) (-644.283) (-644.040) -- 0:02:02
401500 -- [-640.644] (-640.680) (-639.533) (-644.564) * (-644.403) (-639.294) [-638.246] (-646.945) -- 0:02:02
402000 -- [-640.125] (-644.013) (-639.028) (-642.247) * (-632.430) (-641.594) [-641.823] (-645.798) -- 0:02:01
402500 -- (-643.605) (-640.532) (-637.145) [-636.493] * [-639.441] (-642.735) (-646.977) (-646.939) -- 0:02:01
403000 -- (-641.427) (-638.723) (-643.042) [-640.613] * (-629.695) (-635.532) [-638.373] (-643.411) -- 0:02:01
403500 -- (-641.533) [-636.814] (-643.282) (-636.607) * (-641.169) (-640.433) [-637.527] (-645.664) -- 0:02:01
404000 -- (-654.290) (-652.589) [-634.928] (-638.890) * [-640.857] (-640.115) (-640.819) (-640.681) -- 0:02:00
404500 -- (-644.659) (-638.850) [-637.301] (-639.896) * (-647.050) (-643.109) (-632.288) [-639.461] -- 0:02:00
405000 -- (-640.390) (-645.614) [-641.773] (-642.024) * (-637.771) (-639.135) [-641.645] (-648.102) -- 0:02:01
Average standard deviation of split frequencies: 0.016126
405500 -- (-641.623) [-640.428] (-643.435) (-646.304) * (-642.433) (-638.407) [-640.150] (-642.775) -- 0:02:01
406000 -- (-648.819) (-644.950) [-642.890] (-638.754) * (-642.232) [-633.822] (-639.859) (-641.957) -- 0:02:01
406500 -- (-647.455) (-648.217) (-638.703) [-641.790] * (-641.585) (-642.869) [-637.832] (-643.309) -- 0:02:01
407000 -- [-639.961] (-640.604) (-639.238) (-639.570) * (-637.909) (-643.759) (-637.109) [-636.188] -- 0:02:00
407500 -- (-645.437) (-640.038) (-647.518) [-634.943] * (-638.269) [-644.931] (-640.174) (-640.006) -- 0:02:00
408000 -- (-643.810) (-640.849) (-638.335) [-640.045] * [-637.596] (-639.689) (-638.858) (-639.677) -- 0:02:00
408500 -- (-647.727) (-643.877) [-640.346] (-639.228) * [-639.555] (-642.061) (-646.116) (-646.859) -- 0:02:00
409000 -- [-637.824] (-642.483) (-639.266) (-636.926) * (-645.253) (-640.223) [-640.726] (-642.911) -- 0:01:59
409500 -- [-638.537] (-641.707) (-645.027) (-644.420) * (-644.068) [-644.150] (-644.925) (-639.899) -- 0:01:59
410000 -- (-638.949) (-637.778) [-637.960] (-650.023) * (-644.119) [-636.889] (-641.195) (-644.609) -- 0:02:00
Average standard deviation of split frequencies: 0.016071
410500 -- (-644.532) [-643.945] (-643.357) (-638.619) * (-644.108) [-641.104] (-637.336) (-644.623) -- 0:02:00
411000 -- (-646.034) (-640.421) [-634.240] (-642.196) * [-641.255] (-643.380) (-641.863) (-646.986) -- 0:02:00
411500 -- [-635.597] (-644.029) (-644.445) (-641.977) * [-634.674] (-636.469) (-635.675) (-648.954) -- 0:02:00
412000 -- (-633.477) (-648.720) (-646.085) [-639.102] * [-641.443] (-638.300) (-640.102) (-651.866) -- 0:01:59
412500 -- [-637.894] (-645.869) (-646.114) (-642.384) * [-642.444] (-641.240) (-641.840) (-643.686) -- 0:01:59
413000 -- (-641.680) (-638.854) (-644.274) [-635.869] * (-639.942) (-635.931) (-636.369) [-638.059] -- 0:01:59
413500 -- [-636.174] (-643.117) (-641.769) (-635.173) * (-637.403) [-637.496] (-641.409) (-650.185) -- 0:01:59
414000 -- [-640.473] (-642.889) (-639.343) (-642.924) * [-644.782] (-643.082) (-646.833) (-640.552) -- 0:01:58
414500 -- [-639.093] (-638.242) (-652.169) (-637.257) * (-638.983) (-638.193) (-644.458) [-643.691] -- 0:01:58
415000 -- [-637.154] (-642.272) (-641.498) (-652.453) * (-645.014) (-646.756) (-640.242) [-637.645] -- 0:01:59
Average standard deviation of split frequencies: 0.015990
415500 -- (-637.351) (-647.930) (-640.395) [-639.438] * (-635.015) [-640.284] (-634.951) (-644.807) -- 0:01:59
416000 -- (-644.252) [-641.031] (-641.189) (-641.187) * [-640.818] (-641.578) (-639.372) (-645.707) -- 0:01:59
416500 -- [-645.761] (-639.259) (-640.623) (-650.886) * (-641.626) (-643.158) [-638.316] (-645.113) -- 0:01:59
417000 -- (-642.022) (-646.172) [-635.932] (-642.641) * [-639.551] (-642.242) (-639.351) (-644.623) -- 0:01:58
417500 -- [-637.790] (-640.243) (-647.509) (-640.501) * (-642.190) (-643.118) (-637.082) [-639.978] -- 0:01:58
418000 -- (-642.656) (-641.736) [-635.763] (-639.564) * (-640.532) (-639.588) [-636.186] (-640.013) -- 0:01:58
418500 -- [-640.177] (-643.097) (-646.802) (-638.807) * (-636.977) (-640.397) [-638.194] (-644.544) -- 0:01:58
419000 -- (-642.494) (-641.916) [-636.487] (-646.681) * (-645.194) (-643.687) [-640.229] (-644.250) -- 0:01:57
419500 -- (-644.952) (-636.001) [-639.353] (-643.398) * (-645.385) (-639.879) (-642.324) [-636.773] -- 0:01:57
420000 -- [-639.352] (-642.612) (-641.245) (-650.877) * (-650.337) [-635.611] (-641.065) (-641.109) -- 0:01:58
Average standard deviation of split frequencies: 0.015440
420500 -- (-643.116) (-641.142) [-641.158] (-637.789) * (-643.568) (-637.756) [-637.232] (-642.373) -- 0:01:58
421000 -- (-644.855) [-636.510] (-641.941) (-640.943) * (-644.455) (-636.059) (-648.130) [-636.747] -- 0:01:58
421500 -- (-640.155) (-639.166) (-635.048) [-642.268] * [-635.048] (-635.027) (-640.150) (-639.541) -- 0:01:58
422000 -- (-639.578) (-643.307) [-639.858] (-640.321) * (-642.852) [-640.852] (-640.234) (-633.989) -- 0:01:57
422500 -- [-647.247] (-639.627) (-640.666) (-639.612) * (-645.954) (-639.450) (-640.173) [-638.820] -- 0:01:57
423000 -- (-633.231) [-636.941] (-641.186) (-639.729) * (-638.427) (-639.978) [-637.546] (-639.812) -- 0:01:57
423500 -- (-638.621) [-638.368] (-636.734) (-642.941) * [-639.362] (-639.275) (-640.384) (-644.953) -- 0:01:57
424000 -- [-635.412] (-644.044) (-641.532) (-643.823) * (-638.092) (-637.322) (-642.345) [-637.142] -- 0:01:56
424500 -- (-642.109) (-640.237) [-638.659] (-636.584) * (-641.612) (-635.859) (-640.115) [-638.832] -- 0:01:56
425000 -- (-637.379) (-638.708) [-638.875] (-638.241) * (-649.212) (-643.317) [-639.157] (-644.667) -- 0:01:57
Average standard deviation of split frequencies: 0.014631
425500 -- (-652.163) [-638.794] (-647.162) (-641.986) * (-636.973) (-642.740) [-634.733] (-641.499) -- 0:01:57
426000 -- (-632.399) [-635.350] (-643.885) (-644.085) * (-644.274) [-638.045] (-644.838) (-643.983) -- 0:01:57
426500 -- (-635.701) (-638.520) (-650.129) [-636.359] * (-639.877) (-640.783) [-641.111] (-641.440) -- 0:01:56
427000 -- (-641.054) (-640.512) [-638.419] (-641.823) * [-639.817] (-643.534) (-645.894) (-641.359) -- 0:01:56
427500 -- (-638.607) [-636.970] (-639.558) (-641.102) * (-644.691) (-643.269) [-643.474] (-647.123) -- 0:01:56
428000 -- (-642.406) [-640.348] (-639.283) (-641.398) * [-640.614] (-641.366) (-648.936) (-644.120) -- 0:01:56
428500 -- [-643.864] (-637.873) (-640.171) (-642.451) * [-639.597] (-640.599) (-646.532) (-645.924) -- 0:01:56
429000 -- (-647.141) (-643.798) (-640.488) [-639.619] * [-636.715] (-640.214) (-638.765) (-639.257) -- 0:01:55
429500 -- [-643.585] (-644.800) (-646.191) (-635.726) * (-639.743) [-639.034] (-644.047) (-633.611) -- 0:01:56
430000 -- (-642.187) (-639.196) [-635.213] (-644.694) * (-656.588) [-635.005] (-640.010) (-634.847) -- 0:01:56
Average standard deviation of split frequencies: 0.014230
430500 -- [-636.163] (-638.641) (-644.753) (-643.357) * [-642.582] (-639.979) (-638.747) (-648.937) -- 0:01:56
431000 -- [-642.477] (-647.191) (-637.283) (-642.695) * (-644.675) [-634.510] (-646.914) (-640.405) -- 0:01:56
431500 -- (-637.534) (-645.456) [-639.699] (-642.697) * (-640.172) (-638.544) (-643.878) [-640.692] -- 0:01:55
432000 -- (-635.871) (-640.748) [-640.255] (-636.538) * (-637.693) [-641.831] (-638.424) (-651.081) -- 0:01:55
432500 -- (-640.643) (-645.282) (-639.524) [-641.144] * (-642.917) [-639.034] (-644.284) (-650.672) -- 0:01:55
433000 -- (-641.136) (-647.717) (-638.555) [-645.520] * (-641.009) (-644.426) [-637.001] (-644.440) -- 0:01:55
433500 -- (-641.383) (-639.925) [-637.593] (-638.424) * (-642.486) (-637.280) [-639.591] (-642.552) -- 0:01:54
434000 -- [-644.202] (-647.552) (-638.300) (-639.937) * (-643.474) [-637.064] (-642.711) (-635.150) -- 0:01:54
434500 -- (-640.324) (-652.196) [-639.625] (-638.238) * [-635.571] (-639.757) (-644.786) (-642.713) -- 0:01:55
435000 -- (-637.115) (-638.040) [-638.555] (-648.161) * [-640.912] (-642.383) (-644.456) (-640.673) -- 0:01:55
Average standard deviation of split frequencies: 0.014176
435500 -- (-647.033) (-645.632) [-637.885] (-645.735) * [-639.814] (-641.419) (-641.211) (-645.252) -- 0:01:55
436000 -- (-645.528) (-643.696) [-640.334] (-642.244) * (-642.762) (-633.944) [-641.803] (-637.158) -- 0:01:55
436500 -- (-643.776) [-642.167] (-642.080) (-649.227) * [-635.882] (-637.487) (-647.641) (-643.546) -- 0:01:54
437000 -- (-645.874) (-641.672) (-643.505) [-639.613] * (-647.180) (-639.908) (-646.283) [-636.407] -- 0:01:54
437500 -- (-645.696) (-646.961) (-645.013) [-645.371] * (-643.819) [-641.454] (-643.898) (-641.773) -- 0:01:54
438000 -- [-641.129] (-638.900) (-652.083) (-640.494) * (-636.210) [-639.586] (-641.875) (-641.755) -- 0:01:54
438500 -- (-648.449) [-633.915] (-641.575) (-641.010) * (-635.897) (-637.961) [-636.713] (-642.375) -- 0:01:53
439000 -- (-645.087) [-639.213] (-639.928) (-644.461) * (-647.349) (-648.123) [-641.958] (-638.584) -- 0:01:53
439500 -- (-643.739) (-642.762) [-636.997] (-643.331) * [-634.964] (-643.052) (-641.117) (-641.846) -- 0:01:54
440000 -- (-641.659) [-635.793] (-642.447) (-646.447) * (-642.297) (-641.789) (-640.483) [-639.455] -- 0:01:54
Average standard deviation of split frequencies: 0.013550
440500 -- (-644.211) (-640.927) (-646.600) [-642.792] * (-647.004) (-645.471) (-643.975) [-637.392] -- 0:01:54
441000 -- [-640.557] (-640.430) (-644.948) (-640.708) * (-652.152) [-639.437] (-638.077) (-644.717) -- 0:01:54
441500 -- (-641.419) [-637.323] (-647.060) (-635.886) * (-641.588) [-639.450] (-636.210) (-639.571) -- 0:01:53
442000 -- (-643.386) [-635.583] (-644.329) (-648.612) * (-644.739) [-639.405] (-641.087) (-639.399) -- 0:01:53
442500 -- (-647.936) [-635.657] (-641.474) (-638.306) * (-644.308) [-642.589] (-643.082) (-634.556) -- 0:01:53
443000 -- (-647.715) (-647.386) (-643.810) [-636.032] * [-640.768] (-644.753) (-636.748) (-646.125) -- 0:01:53
443500 -- (-648.747) [-639.105] (-647.696) (-636.096) * (-646.587) (-643.788) (-636.825) [-643.494] -- 0:01:52
444000 -- (-639.850) [-636.488] (-643.125) (-643.460) * (-634.233) [-638.994] (-640.122) (-636.021) -- 0:01:52
444500 -- (-641.527) (-639.511) (-640.910) [-637.820] * (-636.762) (-644.163) (-645.742) [-638.166] -- 0:01:53
445000 -- (-645.325) (-646.297) (-651.154) [-641.859] * (-644.202) (-639.444) (-641.987) [-639.602] -- 0:01:53
Average standard deviation of split frequencies: 0.013623
445500 -- (-636.995) (-644.498) (-647.038) [-640.616] * (-640.016) (-643.032) (-648.522) [-638.766] -- 0:01:53
446000 -- [-642.754] (-634.417) (-647.079) (-643.960) * [-634.706] (-640.438) (-649.058) (-641.930) -- 0:01:53
446500 -- (-649.759) [-637.365] (-646.889) (-641.401) * (-641.041) [-641.059] (-641.773) (-638.626) -- 0:01:52
447000 -- (-648.581) (-636.320) (-651.454) [-640.107] * (-641.204) (-648.001) (-644.332) [-640.626] -- 0:01:52
447500 -- [-638.322] (-638.275) (-644.646) (-639.289) * [-633.068] (-641.522) (-635.423) (-648.287) -- 0:01:52
448000 -- [-641.469] (-646.170) (-643.834) (-644.543) * (-647.375) (-655.008) (-645.208) [-636.341] -- 0:01:52
448500 -- (-642.312) (-650.312) (-655.473) [-638.677] * (-645.373) (-645.604) [-640.627] (-640.305) -- 0:01:51
449000 -- [-645.943] (-640.779) (-648.662) (-644.404) * [-642.666] (-649.549) (-641.776) (-654.599) -- 0:01:51
449500 -- (-644.255) [-647.095] (-644.634) (-638.687) * (-646.414) (-643.237) (-633.965) [-642.515] -- 0:01:52
450000 -- (-642.048) [-640.464] (-650.761) (-637.311) * (-649.840) [-641.509] (-634.998) (-642.850) -- 0:01:52
Average standard deviation of split frequencies: 0.013366
450500 -- [-640.113] (-640.291) (-644.334) (-634.282) * (-636.896) (-643.279) [-636.206] (-644.920) -- 0:01:52
451000 -- (-644.118) (-637.825) [-648.414] (-640.714) * (-646.609) (-642.104) [-639.937] (-642.526) -- 0:01:51
451500 -- (-643.191) [-642.013] (-641.278) (-639.213) * [-636.712] (-636.146) (-643.568) (-647.742) -- 0:01:51
452000 -- (-644.318) (-649.228) (-645.543) [-643.004] * (-638.863) [-638.936] (-642.767) (-645.137) -- 0:01:51
452500 -- (-640.778) (-643.179) [-640.138] (-633.804) * (-640.622) [-639.894] (-644.787) (-651.339) -- 0:01:51
453000 -- (-662.452) (-641.646) (-638.011) [-634.454] * (-644.579) [-638.357] (-643.079) (-642.287) -- 0:01:51
453500 -- (-642.960) (-644.842) (-637.990) [-638.708] * [-635.046] (-638.269) (-640.939) (-643.593) -- 0:01:50
454000 -- (-640.372) (-642.081) [-636.817] (-641.718) * (-649.094) [-638.564] (-649.542) (-648.158) -- 0:01:50
454500 -- (-646.031) (-647.556) [-644.275] (-645.179) * (-641.594) (-642.976) [-645.585] (-644.582) -- 0:01:51
455000 -- (-642.498) [-640.343] (-648.555) (-641.413) * (-642.188) [-637.351] (-647.839) (-644.846) -- 0:01:51
Average standard deviation of split frequencies: 0.013784
455500 -- (-640.967) (-640.430) (-637.818) [-637.150] * (-651.742) [-644.177] (-641.638) (-638.787) -- 0:01:51
456000 -- (-640.518) (-640.325) [-638.915] (-637.656) * (-643.647) (-642.450) (-648.872) [-638.928] -- 0:01:50
456500 -- [-638.260] (-641.240) (-636.539) (-637.630) * (-640.545) [-635.776] (-644.613) (-636.780) -- 0:01:50
457000 -- (-646.471) (-643.563) [-638.781] (-639.522) * [-639.501] (-642.052) (-642.397) (-642.362) -- 0:01:50
457500 -- (-648.021) [-642.584] (-632.981) (-640.291) * [-642.981] (-640.243) (-639.408) (-648.439) -- 0:01:50
458000 -- (-646.538) (-636.671) (-640.100) [-637.945] * (-636.847) (-640.144) [-646.040] (-639.750) -- 0:01:50
458500 -- (-641.071) (-645.319) [-636.196] (-642.532) * (-648.280) [-636.399] (-654.138) (-638.103) -- 0:01:49
459000 -- (-641.363) (-645.816) (-642.694) [-635.820] * (-645.569) (-637.508) (-640.887) [-640.866] -- 0:01:50
459500 -- (-638.647) (-654.356) [-645.095] (-639.673) * (-646.213) [-644.716] (-639.825) (-648.002) -- 0:01:50
460000 -- (-643.558) [-639.206] (-636.998) (-633.120) * (-643.237) [-641.920] (-640.024) (-644.786) -- 0:01:50
Average standard deviation of split frequencies: 0.014781
460500 -- (-642.696) (-637.153) (-644.621) [-640.874] * [-645.104] (-641.945) (-639.814) (-640.825) -- 0:01:50
461000 -- (-641.939) (-640.524) (-643.050) [-643.340] * [-644.624] (-649.735) (-647.171) (-637.669) -- 0:01:49
461500 -- [-644.982] (-637.906) (-638.917) (-635.777) * (-643.547) (-640.574) (-637.804) [-634.326] -- 0:01:49
462000 -- (-641.294) [-637.687] (-643.304) (-636.841) * (-637.213) [-639.389] (-641.692) (-637.011) -- 0:01:49
462500 -- (-640.657) (-637.363) [-637.617] (-642.880) * (-637.198) (-642.185) (-639.728) [-637.755] -- 0:01:49
463000 -- (-646.036) (-638.846) (-640.848) [-642.729] * (-641.949) (-640.114) (-643.085) [-638.278] -- 0:01:49
463500 -- (-641.362) [-638.892] (-638.206) (-632.404) * (-645.876) [-634.236] (-644.461) (-645.766) -- 0:01:49
464000 -- (-639.043) (-642.991) (-639.731) [-636.556] * (-648.670) (-635.577) (-642.447) [-634.561] -- 0:01:49
464500 -- (-641.651) [-636.769] (-642.104) (-638.684) * [-647.637] (-646.115) (-642.884) (-632.788) -- 0:01:49
465000 -- (-646.137) (-638.245) [-645.629] (-639.492) * (-638.261) (-633.258) (-639.011) [-637.094] -- 0:01:49
Average standard deviation of split frequencies: 0.014162
465500 -- [-638.928] (-639.945) (-636.344) (-645.021) * [-636.590] (-647.975) (-641.424) (-646.291) -- 0:01:49
466000 -- (-644.455) [-637.431] (-646.251) (-641.496) * (-641.301) (-641.830) [-637.559] (-643.517) -- 0:01:48
466500 -- (-648.165) (-646.800) [-638.166] (-635.913) * (-645.053) [-642.943] (-639.347) (-641.277) -- 0:01:48
467000 -- (-640.417) [-641.130] (-638.194) (-637.483) * [-642.522] (-635.990) (-644.167) (-647.683) -- 0:01:48
467500 -- [-642.811] (-640.717) (-640.728) (-645.799) * (-636.318) (-641.098) (-642.752) [-639.221] -- 0:01:48
468000 -- (-648.631) (-642.219) [-641.533] (-640.016) * (-646.850) (-641.426) (-649.315) [-639.466] -- 0:01:47
468500 -- (-641.070) (-635.363) [-646.832] (-647.764) * (-646.480) [-638.682] (-647.327) (-647.065) -- 0:01:48
469000 -- (-642.077) [-639.617] (-642.719) (-640.750) * (-644.467) (-641.710) [-646.383] (-646.834) -- 0:01:48
469500 -- (-636.064) [-637.722] (-636.793) (-641.423) * (-640.016) (-641.540) (-650.381) [-644.922] -- 0:01:48
470000 -- (-648.407) [-638.924] (-640.233) (-644.787) * (-643.297) [-636.524] (-637.213) (-648.594) -- 0:01:48
Average standard deviation of split frequencies: 0.014578
470500 -- (-642.017) (-635.041) [-643.739] (-639.624) * (-636.208) [-641.881] (-639.207) (-641.113) -- 0:01:48
471000 -- (-633.429) [-644.111] (-644.693) (-643.488) * (-643.765) [-643.298] (-634.898) (-641.346) -- 0:01:47
471500 -- (-639.730) (-640.876) (-644.300) [-634.726] * (-646.975) (-644.146) [-640.568] (-643.023) -- 0:01:47
472000 -- (-640.389) (-642.725) [-641.998] (-640.459) * [-646.604] (-640.838) (-640.440) (-651.001) -- 0:01:47
472500 -- (-642.238) [-643.038] (-638.944) (-642.407) * (-641.230) (-638.398) [-641.959] (-638.943) -- 0:01:47
473000 -- (-646.477) (-643.379) (-642.277) [-639.522] * (-639.268) (-648.559) [-636.463] (-640.960) -- 0:01:46
473500 -- (-643.912) (-638.072) [-639.856] (-641.615) * (-647.118) (-639.983) (-636.784) [-645.353] -- 0:01:47
474000 -- (-645.129) (-640.798) (-643.796) [-643.607] * [-640.555] (-640.465) (-652.382) (-637.918) -- 0:01:47
474500 -- (-645.953) [-641.712] (-647.138) (-638.488) * [-640.806] (-638.919) (-636.414) (-651.228) -- 0:01:47
475000 -- (-637.558) [-640.908] (-643.388) (-637.124) * (-638.783) [-641.834] (-643.810) (-639.466) -- 0:01:47
Average standard deviation of split frequencies: 0.013975
475500 -- [-641.888] (-644.185) (-647.674) (-645.413) * (-640.379) [-639.903] (-642.664) (-642.182) -- 0:01:46
476000 -- [-640.697] (-649.024) (-638.826) (-643.010) * (-637.836) (-635.850) [-640.319] (-635.108) -- 0:01:46
476500 -- (-637.222) (-638.370) (-638.252) [-640.760] * [-642.861] (-641.758) (-643.801) (-637.769) -- 0:01:46
477000 -- [-637.374] (-639.732) (-638.933) (-643.545) * (-643.393) [-641.817] (-637.369) (-636.078) -- 0:01:46
477500 -- (-641.155) [-646.212] (-650.105) (-644.452) * (-644.583) (-637.426) (-643.582) [-632.701] -- 0:01:46
478000 -- [-637.305] (-639.456) (-642.500) (-640.888) * (-640.693) [-638.295] (-639.763) (-645.133) -- 0:01:45
478500 -- (-636.281) [-642.047] (-642.622) (-640.100) * (-653.275) (-638.342) [-639.801] (-634.704) -- 0:01:46
479000 -- (-642.220) [-649.428] (-647.641) (-643.178) * (-646.502) (-638.641) (-641.403) [-637.359] -- 0:01:46
479500 -- (-647.552) (-642.795) (-641.979) [-639.867] * (-641.680) (-634.300) [-643.694] (-637.852) -- 0:01:46
480000 -- (-643.288) (-636.007) (-636.288) [-638.742] * [-636.340] (-647.441) (-641.912) (-649.550) -- 0:01:46
Average standard deviation of split frequencies: 0.014275
480500 -- [-641.752] (-639.945) (-647.408) (-638.886) * (-646.488) (-640.577) [-638.400] (-640.218) -- 0:01:45
481000 -- (-648.595) (-643.693) (-639.232) [-641.143] * (-639.008) [-637.580] (-638.317) (-633.511) -- 0:01:45
481500 -- (-646.009) [-647.138] (-644.122) (-641.454) * (-642.485) (-637.045) [-642.031] (-641.352) -- 0:01:45
482000 -- (-645.167) (-639.172) [-651.668] (-643.758) * (-653.112) (-643.370) [-645.253] (-646.976) -- 0:01:45
482500 -- (-643.178) (-637.054) (-647.314) [-643.907] * (-644.068) (-645.637) [-644.928] (-638.276) -- 0:01:45
483000 -- (-640.282) (-639.711) [-647.504] (-644.901) * [-638.319] (-646.349) (-641.496) (-637.762) -- 0:01:45
483500 -- (-638.326) (-645.150) [-640.459] (-637.264) * (-647.036) (-649.494) (-641.854) [-638.781] -- 0:01:45
484000 -- (-649.548) [-641.678] (-641.091) (-641.952) * (-643.283) (-643.188) (-637.741) [-637.722] -- 0:01:45
484500 -- (-632.618) [-636.407] (-641.676) (-638.896) * (-643.093) [-648.388] (-651.980) (-634.720) -- 0:01:45
485000 -- [-637.845] (-639.389) (-639.379) (-640.989) * (-648.360) (-640.756) [-645.161] (-636.927) -- 0:01:45
Average standard deviation of split frequencies: 0.014550
485500 -- [-632.995] (-639.523) (-635.771) (-640.030) * (-642.898) (-640.018) (-635.108) [-636.996] -- 0:01:44
486000 -- (-643.140) [-638.932] (-639.688) (-640.900) * (-642.703) (-644.849) (-645.490) [-640.037] -- 0:01:44
486500 -- (-637.776) (-642.424) [-640.591] (-643.728) * (-642.127) (-641.851) (-642.585) [-641.377] -- 0:01:44
487000 -- (-647.361) (-651.014) (-643.752) [-635.745] * (-643.297) (-637.721) [-635.746] (-643.686) -- 0:01:44
487500 -- (-645.984) (-643.168) [-633.293] (-647.603) * (-636.382) (-645.060) (-641.823) [-637.876] -- 0:01:44
488000 -- [-643.459] (-644.626) (-639.302) (-642.269) * (-639.059) [-636.716] (-643.605) (-632.955) -- 0:01:44
488500 -- (-651.069) (-641.758) (-641.028) [-643.222] * (-641.021) (-637.839) (-640.529) [-645.246] -- 0:01:44
489000 -- (-651.706) (-641.191) [-638.095] (-645.155) * [-644.497] (-646.118) (-639.815) (-633.762) -- 0:01:44
489500 -- (-642.590) (-645.634) (-648.753) [-643.649] * [-635.937] (-643.846) (-640.662) (-643.447) -- 0:01:44
490000 -- [-637.571] (-644.247) (-650.520) (-633.093) * (-642.691) (-642.709) (-644.509) [-643.664] -- 0:01:44
Average standard deviation of split frequencies: 0.015479
490500 -- (-640.683) (-638.928) (-642.636) [-636.683] * (-644.400) (-644.784) [-636.088] (-648.008) -- 0:01:43
491000 -- (-642.807) [-634.658] (-637.054) (-635.909) * (-634.285) [-640.556] (-652.853) (-643.143) -- 0:01:43
491500 -- [-643.077] (-638.036) (-638.512) (-649.103) * (-637.729) (-640.574) (-648.614) [-641.500] -- 0:01:43
492000 -- (-642.841) (-636.818) [-638.661] (-640.397) * (-641.577) (-638.520) [-639.893] (-647.642) -- 0:01:43
492500 -- [-641.494] (-638.312) (-641.472) (-644.007) * (-645.094) [-637.561] (-646.187) (-637.933) -- 0:01:43
493000 -- (-642.352) (-638.095) (-639.398) [-642.741] * (-636.116) (-643.582) [-639.758] (-640.893) -- 0:01:43
493500 -- (-645.948) (-639.846) [-637.519] (-641.315) * [-635.761] (-649.302) (-640.834) (-648.578) -- 0:01:43
494000 -- (-638.421) (-636.653) (-640.575) [-640.760] * [-635.196] (-644.250) (-637.446) (-643.003) -- 0:01:43
494500 -- (-647.752) [-634.989] (-644.877) (-639.743) * [-635.211] (-645.483) (-639.529) (-646.192) -- 0:01:43
495000 -- [-635.349] (-641.320) (-640.503) (-644.999) * (-639.685) (-638.484) [-634.780] (-641.439) -- 0:01:43
Average standard deviation of split frequencies: 0.014784
495500 -- [-637.443] (-643.543) (-646.045) (-647.030) * (-641.312) (-642.529) [-634.962] (-639.411) -- 0:01:42
496000 -- (-636.764) (-646.446) [-639.417] (-648.769) * [-637.615] (-644.800) (-639.019) (-642.212) -- 0:01:42
496500 -- [-644.753] (-641.021) (-644.384) (-640.362) * (-643.088) (-652.709) [-639.554] (-645.865) -- 0:01:42
497000 -- [-642.426] (-639.741) (-637.577) (-643.805) * [-640.134] (-641.675) (-644.969) (-647.258) -- 0:01:42
497500 -- [-642.817] (-636.802) (-637.476) (-644.954) * (-650.735) (-644.139) [-636.152] (-637.879) -- 0:01:42
498000 -- [-640.638] (-644.128) (-649.669) (-642.599) * [-645.051] (-641.675) (-642.560) (-639.682) -- 0:01:42
498500 -- (-638.011) (-641.782) [-634.514] (-645.575) * (-645.063) (-644.360) (-646.608) [-639.154] -- 0:01:42
499000 -- (-642.131) (-650.609) [-647.414] (-640.282) * (-648.522) (-643.261) [-636.201] (-638.477) -- 0:01:42
499500 -- (-641.526) (-641.955) [-635.163] (-645.240) * (-645.700) [-642.574] (-634.848) (-637.310) -- 0:01:42
500000 -- (-646.242) (-644.616) (-646.304) [-643.065] * (-643.530) (-644.137) [-636.903] (-640.136) -- 0:01:42
Average standard deviation of split frequencies: 0.014542
500500 -- [-639.527] (-638.468) (-638.014) (-637.546) * (-648.695) [-634.436] (-640.200) (-636.754) -- 0:01:41
501000 -- [-644.289] (-642.746) (-634.297) (-640.498) * [-640.628] (-635.324) (-643.815) (-642.033) -- 0:01:41
501500 -- (-640.832) (-640.086) (-644.893) [-638.803] * [-641.814] (-645.509) (-641.330) (-645.837) -- 0:01:41
502000 -- (-641.593) [-636.755] (-641.786) (-641.825) * (-643.445) (-654.207) [-635.337] (-641.943) -- 0:01:41
502500 -- [-637.086] (-641.324) (-648.451) (-643.084) * (-639.687) (-649.000) (-635.002) [-638.718] -- 0:01:40
503000 -- [-642.039] (-639.867) (-641.887) (-644.450) * (-634.751) [-640.273] (-644.361) (-646.576) -- 0:01:41
503500 -- (-641.941) (-645.387) (-644.135) [-639.855] * (-643.345) [-647.361] (-639.088) (-638.800) -- 0:01:41
504000 -- (-650.052) (-647.694) [-645.557] (-646.764) * [-638.092] (-640.319) (-646.514) (-636.881) -- 0:01:41
504500 -- (-637.901) [-637.527] (-636.552) (-641.884) * [-643.750] (-649.338) (-644.262) (-633.434) -- 0:01:41
505000 -- (-640.972) (-637.015) [-643.753] (-643.320) * [-639.668] (-646.505) (-646.437) (-639.341) -- 0:01:40
Average standard deviation of split frequencies: 0.014181
505500 -- (-646.595) (-640.480) [-646.085] (-639.828) * (-644.216) (-642.743) (-641.981) [-643.596] -- 0:01:40
506000 -- (-642.837) (-643.177) (-651.093) [-640.917] * (-646.049) (-643.043) [-650.033] (-640.026) -- 0:01:40
506500 -- (-648.945) [-638.917] (-641.456) (-643.880) * [-637.864] (-643.651) (-642.956) (-642.240) -- 0:01:40
507000 -- (-653.317) (-639.896) [-642.519] (-641.151) * (-639.966) [-636.303] (-647.520) (-646.527) -- 0:01:40
507500 -- (-638.049) [-642.176] (-642.839) (-645.540) * (-650.174) [-635.974] (-647.469) (-637.190) -- 0:01:39
508000 -- [-635.429] (-645.998) (-642.491) (-640.533) * [-644.970] (-644.510) (-639.211) (-640.421) -- 0:01:40
508500 -- (-634.873) (-636.764) (-645.885) [-640.662] * (-639.193) [-641.924] (-639.317) (-638.571) -- 0:01:40
509000 -- (-641.475) [-634.334] (-642.839) (-641.693) * (-646.643) (-642.393) (-645.451) [-638.450] -- 0:01:40
509500 -- (-639.778) (-645.002) [-639.385] (-643.851) * (-645.640) [-640.821] (-642.391) (-649.951) -- 0:01:40
510000 -- [-643.059] (-643.413) (-645.402) (-633.044) * (-646.121) (-641.575) (-635.338) [-640.812] -- 0:01:39
Average standard deviation of split frequencies: 0.013642
510500 -- (-645.573) (-641.768) (-651.499) [-635.492] * [-645.301] (-639.351) (-644.187) (-642.434) -- 0:01:39
511000 -- (-642.162) (-641.512) (-641.679) [-635.237] * (-639.646) (-641.788) (-642.490) [-635.769] -- 0:01:39
511500 -- [-641.730] (-643.189) (-644.745) (-639.167) * (-651.422) (-640.823) [-637.963] (-635.922) -- 0:01:39
512000 -- [-639.325] (-642.995) (-641.235) (-655.491) * [-638.322] (-646.424) (-645.559) (-643.943) -- 0:01:39
512500 -- (-642.169) (-640.272) [-636.512] (-643.620) * (-642.231) [-643.675] (-643.132) (-638.499) -- 0:01:39
513000 -- (-642.298) (-637.574) [-633.306] (-649.329) * [-639.503] (-649.797) (-644.171) (-645.074) -- 0:01:39
513500 -- (-649.589) [-634.276] (-639.838) (-653.154) * (-646.119) (-643.002) (-635.572) [-637.600] -- 0:01:39
514000 -- (-639.885) (-638.764) [-641.906] (-641.701) * [-641.196] (-648.069) (-643.806) (-651.662) -- 0:01:39
514500 -- [-634.938] (-633.997) (-639.505) (-646.894) * (-646.502) (-640.818) (-638.600) [-635.428] -- 0:01:39
515000 -- (-638.179) (-640.167) [-640.080] (-639.513) * (-633.207) (-640.612) (-642.114) [-641.171] -- 0:01:38
Average standard deviation of split frequencies: 0.013501
515500 -- (-635.893) [-637.305] (-637.161) (-652.198) * [-638.649] (-641.875) (-644.504) (-636.521) -- 0:01:38
516000 -- (-643.468) [-637.610] (-642.754) (-638.834) * (-643.067) (-646.059) [-637.363] (-637.119) -- 0:01:38
516500 -- (-641.273) (-639.737) (-642.334) [-638.050] * (-642.029) (-644.545) [-640.707] (-639.510) -- 0:01:38
517000 -- [-641.493] (-641.100) (-643.793) (-639.841) * [-636.935] (-645.575) (-643.344) (-640.999) -- 0:01:38
517500 -- (-643.363) [-635.072] (-646.188) (-636.793) * [-639.968] (-641.282) (-640.621) (-651.227) -- 0:01:38
518000 -- (-642.610) (-643.865) [-643.638] (-646.850) * (-640.703) (-640.258) [-637.996] (-643.874) -- 0:01:38
518500 -- (-646.600) [-638.980] (-652.007) (-639.071) * (-644.977) [-635.553] (-640.920) (-637.718) -- 0:01:38
519000 -- [-639.494] (-640.877) (-645.694) (-635.050) * [-640.267] (-643.259) (-649.272) (-640.754) -- 0:01:38
519500 -- (-633.687) (-639.224) [-640.871] (-638.995) * (-640.031) [-639.666] (-648.643) (-637.934) -- 0:01:38
520000 -- (-643.845) [-638.643] (-640.396) (-637.836) * (-641.582) (-638.721) (-640.469) [-637.601] -- 0:01:37
Average standard deviation of split frequencies: 0.012675
520500 -- (-641.206) (-635.675) [-638.021] (-649.461) * [-646.663] (-645.045) (-648.404) (-639.895) -- 0:01:37
521000 -- [-634.980] (-639.438) (-637.363) (-640.986) * (-641.879) (-638.289) [-642.242] (-637.270) -- 0:01:37
521500 -- [-632.856] (-639.629) (-639.788) (-637.980) * [-637.572] (-646.120) (-638.664) (-645.411) -- 0:01:37
522000 -- (-635.857) [-641.362] (-644.843) (-638.343) * (-647.312) [-639.218] (-641.115) (-644.767) -- 0:01:37
522500 -- [-639.721] (-643.727) (-641.343) (-642.616) * (-646.780) [-638.286] (-643.937) (-641.869) -- 0:01:37
523000 -- (-639.538) (-635.055) [-647.873] (-644.172) * [-636.753] (-651.267) (-638.281) (-637.766) -- 0:01:37
523500 -- [-637.101] (-646.061) (-641.962) (-646.919) * [-641.975] (-644.161) (-644.018) (-636.130) -- 0:01:37
524000 -- (-650.382) (-643.767) [-639.814] (-632.284) * [-639.564] (-645.464) (-644.110) (-636.508) -- 0:01:37
524500 -- (-639.844) [-645.649] (-644.336) (-637.436) * [-642.280] (-640.516) (-647.064) (-640.253) -- 0:01:37
525000 -- [-642.347] (-649.612) (-642.703) (-642.469) * (-646.215) [-644.486] (-641.998) (-633.689) -- 0:01:36
Average standard deviation of split frequencies: 0.011750
525500 -- (-645.870) (-647.391) [-639.822] (-638.916) * (-647.853) (-643.204) (-646.394) [-633.778] -- 0:01:36
526000 -- (-637.107) [-637.864] (-650.267) (-641.415) * (-646.336) (-642.582) (-647.932) [-640.130] -- 0:01:36
526500 -- (-638.428) (-641.329) [-652.406] (-644.127) * (-641.224) (-640.549) (-643.090) [-641.588] -- 0:01:36
527000 -- (-637.738) (-645.940) [-645.775] (-640.636) * (-643.499) (-655.769) (-642.000) [-638.732] -- 0:01:36
527500 -- [-635.393] (-638.153) (-649.628) (-648.285) * (-637.497) (-643.143) (-644.309) [-638.293] -- 0:01:36
528000 -- (-640.466) [-634.603] (-640.130) (-641.306) * (-640.012) [-644.445] (-635.382) (-637.677) -- 0:01:36
528500 -- (-637.549) [-641.469] (-641.807) (-642.680) * (-642.981) (-641.755) [-639.493] (-643.878) -- 0:01:36
529000 -- (-640.557) (-645.458) (-644.468) [-640.935] * (-641.517) [-637.984] (-642.985) (-640.025) -- 0:01:36
529500 -- [-637.188] (-638.167) (-647.254) (-635.975) * (-646.655) [-640.709] (-642.862) (-643.810) -- 0:01:35
530000 -- (-634.426) [-638.963] (-644.535) (-639.747) * [-643.441] (-637.943) (-648.301) (-635.838) -- 0:01:35
Average standard deviation of split frequencies: 0.011153
530500 -- [-637.527] (-635.665) (-646.977) (-642.911) * [-640.326] (-646.614) (-639.083) (-637.308) -- 0:01:35
531000 -- (-637.804) (-639.808) (-644.923) [-639.799] * (-639.743) (-635.245) [-637.049] (-641.893) -- 0:01:35
531500 -- [-647.991] (-644.112) (-651.126) (-636.181) * (-647.759) [-638.691] (-645.287) (-642.071) -- 0:01:35
532000 -- (-643.290) [-639.373] (-647.150) (-642.130) * (-638.815) (-643.673) (-645.575) [-641.773] -- 0:01:35
532500 -- (-653.953) [-640.632] (-643.326) (-647.245) * (-640.755) (-638.755) (-646.813) [-641.357] -- 0:01:35
533000 -- (-643.459) [-646.422] (-643.063) (-643.608) * [-636.192] (-638.848) (-645.730) (-653.480) -- 0:01:35
533500 -- (-635.916) (-655.372) [-637.431] (-644.350) * (-645.042) [-639.846] (-636.763) (-643.545) -- 0:01:35
534000 -- (-640.331) (-636.125) (-644.847) [-645.292] * (-640.085) (-638.863) (-643.095) [-640.451] -- 0:01:35
534500 -- [-643.527] (-639.767) (-655.409) (-637.795) * (-643.020) [-640.207] (-643.970) (-638.633) -- 0:01:34
535000 -- (-641.933) (-639.531) [-637.683] (-647.351) * (-647.223) (-646.155) (-641.007) [-644.160] -- 0:01:34
Average standard deviation of split frequencies: 0.011726
535500 -- [-643.246] (-639.095) (-641.472) (-641.701) * [-638.165] (-639.848) (-650.754) (-639.806) -- 0:01:34
536000 -- [-643.584] (-633.523) (-642.233) (-637.458) * (-642.557) (-636.325) (-641.008) [-651.905] -- 0:01:34
536500 -- (-640.291) [-636.868] (-642.431) (-641.857) * (-642.529) [-638.442] (-641.002) (-642.921) -- 0:01:34
537000 -- (-639.068) (-638.389) (-640.602) [-638.645] * (-644.291) (-640.854) [-634.701] (-642.292) -- 0:01:34
537500 -- (-642.345) [-639.408] (-650.151) (-647.997) * (-641.594) [-637.557] (-639.955) (-641.869) -- 0:01:34
538000 -- [-637.526] (-639.473) (-639.759) (-644.659) * (-646.666) (-647.127) [-644.040] (-641.567) -- 0:01:34
538500 -- (-639.448) (-642.554) (-646.232) [-639.730] * [-641.074] (-639.886) (-640.944) (-646.562) -- 0:01:34
539000 -- [-637.750] (-640.386) (-642.928) (-647.910) * [-637.329] (-642.156) (-639.937) (-647.397) -- 0:01:34
539500 -- [-651.205] (-646.892) (-637.775) (-641.147) * (-636.858) [-639.247] (-645.454) (-636.392) -- 0:01:33
540000 -- (-640.555) (-639.037) [-637.239] (-641.634) * (-645.395) (-641.279) (-645.458) [-638.635] -- 0:01:33
Average standard deviation of split frequencies: 0.010947
540500 -- (-644.356) (-642.198) [-632.778] (-641.235) * (-644.762) (-639.371) (-639.386) [-640.093] -- 0:01:33
541000 -- [-634.026] (-646.260) (-636.591) (-638.266) * (-641.626) (-645.588) (-652.877) [-639.264] -- 0:01:33
541500 -- [-640.461] (-646.666) (-641.538) (-643.801) * [-635.665] (-643.312) (-641.833) (-646.233) -- 0:01:33
542000 -- (-642.730) [-640.480] (-644.701) (-643.952) * (-645.946) (-642.070) [-639.939] (-646.037) -- 0:01:33
542500 -- (-637.147) [-641.414] (-640.436) (-644.369) * [-641.587] (-650.475) (-640.268) (-640.876) -- 0:01:33
543000 -- (-639.939) (-634.170) [-646.445] (-647.436) * (-647.295) [-647.115] (-642.383) (-640.105) -- 0:01:33
543500 -- [-635.492] (-643.838) (-650.203) (-644.099) * (-641.693) (-646.115) (-649.803) [-643.587] -- 0:01:33
544000 -- [-638.062] (-646.739) (-644.353) (-642.481) * [-635.945] (-651.792) (-646.109) (-639.695) -- 0:01:33
544500 -- (-635.541) (-641.920) [-639.785] (-643.625) * (-646.398) (-647.177) (-637.066) [-632.843] -- 0:01:32
545000 -- (-639.340) (-641.227) [-640.847] (-637.614) * (-646.073) (-640.090) (-651.183) [-638.114] -- 0:01:32
Average standard deviation of split frequencies: 0.010706
545500 -- (-643.383) [-638.222] (-635.493) (-642.451) * [-637.739] (-649.557) (-643.528) (-644.089) -- 0:01:32
546000 -- [-643.416] (-639.652) (-638.108) (-649.609) * (-642.851) (-644.115) (-639.900) [-640.032] -- 0:01:32
546500 -- (-644.699) [-637.828] (-639.769) (-638.173) * (-634.850) (-645.203) [-636.868] (-644.557) -- 0:01:32
547000 -- (-636.365) (-646.068) [-646.049] (-642.753) * (-643.396) (-649.100) (-637.582) [-639.228] -- 0:01:32
547500 -- (-643.924) [-647.351] (-636.465) (-644.770) * (-642.389) (-647.807) (-635.750) [-640.435] -- 0:01:32
548000 -- (-648.085) (-640.302) [-638.548] (-641.343) * (-638.591) (-645.015) [-639.992] (-642.153) -- 0:01:32
548500 -- (-652.539) [-641.118] (-643.561) (-641.066) * (-632.958) (-642.975) [-640.011] (-640.221) -- 0:01:32
549000 -- [-646.326] (-636.715) (-636.650) (-646.461) * (-641.382) (-645.930) (-645.548) [-640.593] -- 0:01:32
549500 -- [-642.310] (-640.233) (-650.520) (-644.956) * (-642.822) [-637.875] (-645.505) (-639.680) -- 0:01:31
550000 -- (-641.800) [-642.360] (-640.405) (-643.418) * (-638.336) (-636.636) [-642.434] (-649.145) -- 0:01:31
Average standard deviation of split frequencies: 0.010358
550500 -- [-640.042] (-645.172) (-646.214) (-643.261) * [-637.026] (-641.131) (-640.900) (-637.226) -- 0:01:31
551000 -- [-641.456] (-644.228) (-639.708) (-639.715) * (-641.496) [-639.937] (-646.515) (-640.337) -- 0:01:31
551500 -- [-641.308] (-661.965) (-634.372) (-650.137) * (-642.337) [-641.998] (-642.173) (-638.072) -- 0:01:31
552000 -- (-639.819) [-649.779] (-641.649) (-647.129) * [-638.900] (-645.415) (-640.920) (-644.975) -- 0:01:31
552500 -- [-641.205] (-645.866) (-642.320) (-649.127) * (-637.154) (-641.089) [-641.696] (-644.144) -- 0:01:31
553000 -- [-634.603] (-648.008) (-641.496) (-651.513) * (-647.815) (-645.539) [-638.907] (-653.978) -- 0:01:31
553500 -- (-652.934) (-645.644) (-641.074) [-642.255] * (-641.801) (-646.586) (-645.138) [-640.082] -- 0:01:31
554000 -- (-643.009) (-639.129) [-639.757] (-643.652) * [-633.785] (-641.600) (-643.714) (-641.647) -- 0:01:30
554500 -- [-636.507] (-635.236) (-640.738) (-647.919) * (-649.550) (-646.972) (-642.546) [-644.246] -- 0:01:30
555000 -- (-644.335) [-644.618] (-637.454) (-643.309) * (-641.929) (-649.746) (-644.678) [-643.512] -- 0:01:30
Average standard deviation of split frequencies: 0.010429
555500 -- (-651.078) [-640.529] (-640.083) (-644.479) * [-635.169] (-648.006) (-639.274) (-641.902) -- 0:01:30
556000 -- (-644.332) [-636.866] (-643.391) (-648.454) * (-642.679) [-639.023] (-647.229) (-645.851) -- 0:01:30
556500 -- [-635.433] (-643.757) (-638.654) (-637.724) * (-646.069) [-644.091] (-647.089) (-640.124) -- 0:01:30
557000 -- [-638.390] (-641.769) (-637.465) (-645.499) * [-641.295] (-637.348) (-642.389) (-643.763) -- 0:01:30
557500 -- [-643.107] (-648.258) (-646.262) (-639.941) * (-637.632) (-643.308) (-645.895) [-640.504] -- 0:01:30
558000 -- (-645.818) (-636.186) [-639.133] (-640.417) * (-638.312) [-633.972] (-645.516) (-643.963) -- 0:01:30
558500 -- (-635.970) (-641.321) [-640.328] (-648.147) * [-639.181] (-639.442) (-640.994) (-640.521) -- 0:01:30
559000 -- (-650.896) (-646.791) [-637.468] (-644.615) * (-640.151) (-635.690) (-642.410) [-644.244] -- 0:01:29
559500 -- (-640.340) (-642.809) [-641.846] (-634.724) * [-635.300] (-638.870) (-646.645) (-642.944) -- 0:01:29
560000 -- [-636.533] (-641.834) (-649.245) (-638.520) * (-640.391) (-646.316) (-644.131) [-639.484] -- 0:01:29
Average standard deviation of split frequencies: 0.009585
560500 -- (-644.358) (-640.710) [-646.322] (-645.996) * (-642.400) (-642.452) [-643.172] (-648.582) -- 0:01:29
561000 -- (-652.113) (-645.335) [-638.465] (-638.675) * (-638.491) (-642.014) [-642.991] (-654.505) -- 0:01:29
561500 -- (-645.377) (-645.066) [-642.352] (-637.466) * (-642.927) (-648.375) [-637.353] (-646.163) -- 0:01:29
562000 -- (-644.837) (-640.518) (-638.633) [-638.111] * (-642.801) (-640.904) (-655.885) [-650.888] -- 0:01:29
562500 -- (-651.589) (-643.799) [-639.138] (-643.951) * (-638.949) [-638.559] (-646.593) (-649.808) -- 0:01:29
563000 -- (-637.798) [-640.309] (-646.584) (-646.106) * (-636.430) (-641.043) (-647.321) [-639.838] -- 0:01:29
563500 -- [-642.063] (-640.161) (-644.042) (-641.511) * [-640.441] (-643.467) (-648.153) (-642.052) -- 0:01:29
564000 -- (-642.547) (-641.610) [-638.968] (-643.882) * (-640.596) (-645.488) (-642.412) [-642.199] -- 0:01:28
564500 -- [-639.313] (-640.514) (-653.211) (-638.622) * (-637.474) [-641.764] (-635.888) (-636.289) -- 0:01:28
565000 -- (-641.551) (-645.295) (-643.392) [-638.273] * (-640.198) (-637.596) [-643.314] (-636.038) -- 0:01:28
Average standard deviation of split frequencies: 0.010411
565500 -- [-641.543] (-641.803) (-644.042) (-633.554) * [-641.726] (-646.619) (-640.670) (-639.035) -- 0:01:28
566000 -- [-642.085] (-641.018) (-642.881) (-642.873) * (-643.973) [-643.065] (-647.917) (-645.356) -- 0:01:28
566500 -- (-640.847) (-654.109) (-640.263) [-633.895] * [-643.656] (-641.340) (-642.420) (-642.917) -- 0:01:28
567000 -- (-635.016) (-639.576) [-641.110] (-648.014) * [-637.436] (-650.816) (-639.869) (-639.324) -- 0:01:28
567500 -- (-635.911) (-642.665) (-633.964) [-643.827] * (-637.719) (-649.905) (-642.968) [-635.356] -- 0:01:28
568000 -- (-634.666) [-642.232] (-637.096) (-639.441) * [-636.630] (-652.588) (-640.187) (-634.526) -- 0:01:28
568500 -- (-642.685) (-641.514) (-637.139) [-641.255] * [-637.960] (-645.982) (-642.477) (-638.139) -- 0:01:28
569000 -- (-640.213) [-638.784] (-642.440) (-647.695) * [-641.499] (-646.048) (-640.919) (-647.335) -- 0:01:27
569500 -- [-637.829] (-638.738) (-660.715) (-641.880) * (-644.708) [-652.488] (-645.495) (-643.358) -- 0:01:27
570000 -- [-638.643] (-640.224) (-638.132) (-644.043) * (-642.158) (-646.756) [-647.246] (-640.710) -- 0:01:27
Average standard deviation of split frequencies: 0.010408
570500 -- (-639.936) (-638.073) [-639.845] (-645.001) * [-646.663] (-641.225) (-652.169) (-640.918) -- 0:01:27
571000 -- (-640.223) (-638.305) [-638.765] (-639.226) * (-641.943) (-637.608) (-646.891) [-639.594] -- 0:01:27
571500 -- [-635.866] (-646.674) (-642.940) (-644.150) * [-643.079] (-645.861) (-649.269) (-642.085) -- 0:01:27
572000 -- (-637.263) [-640.902] (-644.429) (-637.693) * (-637.856) (-641.788) (-644.048) [-643.978] -- 0:01:27
572500 -- (-641.724) [-643.132] (-645.751) (-641.785) * (-638.534) (-643.648) (-640.447) [-642.634] -- 0:01:27
573000 -- (-645.625) (-649.070) (-638.987) [-639.526] * (-639.721) (-645.829) (-642.069) [-639.084] -- 0:01:27
573500 -- (-640.211) (-641.029) (-645.827) [-639.027] * (-636.399) [-640.690] (-643.678) (-644.721) -- 0:01:27
574000 -- (-637.278) [-639.568] (-635.378) (-639.608) * (-642.245) (-641.830) [-639.432] (-637.784) -- 0:01:26
574500 -- (-639.142) [-638.341] (-643.074) (-639.663) * (-635.895) [-638.456] (-640.552) (-641.644) -- 0:01:26
575000 -- (-643.171) (-641.085) (-643.671) [-639.406] * (-638.043) [-636.974] (-642.098) (-639.072) -- 0:01:26
Average standard deviation of split frequencies: 0.009330
575500 -- (-639.186) (-643.609) [-639.791] (-644.438) * [-645.201] (-645.731) (-636.463) (-647.704) -- 0:01:26
576000 -- (-646.171) (-641.175) (-642.419) [-646.952] * (-642.860) (-643.425) (-638.469) [-644.139] -- 0:01:26
576500 -- (-638.564) (-637.929) [-641.347] (-647.183) * (-639.163) (-636.701) [-633.436] (-638.694) -- 0:01:26
577000 -- (-643.618) (-639.675) [-637.568] (-640.441) * (-648.715) (-643.829) [-635.708] (-639.777) -- 0:01:26
577500 -- (-636.958) (-641.462) [-640.598] (-640.191) * (-638.393) (-641.785) [-642.202] (-639.363) -- 0:01:26
578000 -- (-639.248) (-641.317) (-645.358) [-637.821] * [-633.989] (-644.248) (-651.665) (-643.372) -- 0:01:26
578500 -- (-639.391) (-653.074) [-635.818] (-640.516) * (-638.242) (-644.226) (-648.334) [-638.673] -- 0:01:25
579000 -- (-645.722) [-638.199] (-637.347) (-638.702) * (-647.349) (-647.639) [-634.813] (-650.931) -- 0:01:25
579500 -- (-638.931) (-640.703) (-638.146) [-640.301] * (-640.228) [-637.647] (-637.896) (-650.397) -- 0:01:25
580000 -- (-635.528) (-647.342) [-642.854] (-633.964) * (-636.507) (-641.919) [-643.025] (-647.711) -- 0:01:25
Average standard deviation of split frequencies: 0.009498
580500 -- (-636.103) (-643.958) (-639.160) [-639.005] * (-641.003) (-640.550) [-638.626] (-644.732) -- 0:01:25
581000 -- (-651.706) [-640.003] (-645.650) (-638.469) * (-650.024) (-641.256) [-638.935] (-642.794) -- 0:01:25
581500 -- [-639.501] (-641.014) (-635.586) (-641.760) * (-641.349) (-637.359) (-639.163) [-636.193] -- 0:01:25
582000 -- [-637.090] (-640.164) (-651.585) (-642.920) * (-646.855) [-634.754] (-635.355) (-648.145) -- 0:01:25
582500 -- (-639.176) (-647.039) [-642.378] (-648.473) * (-638.059) (-653.565) [-640.443] (-646.627) -- 0:01:25
583000 -- [-638.256] (-638.064) (-648.538) (-643.173) * (-636.768) (-645.787) (-642.370) [-647.794] -- 0:01:25
583500 -- (-645.458) (-643.222) (-644.125) [-641.298] * [-634.731] (-647.838) (-645.008) (-643.911) -- 0:01:24
584000 -- (-641.054) (-647.151) [-639.162] (-634.607) * (-641.927) (-648.758) [-637.022] (-645.200) -- 0:01:24
584500 -- (-643.159) (-642.234) (-633.829) [-635.342] * (-642.087) (-639.468) (-646.095) [-647.517] -- 0:01:24
585000 -- (-647.078) (-649.129) [-647.962] (-639.896) * [-637.971] (-637.986) (-641.571) (-644.707) -- 0:01:24
Average standard deviation of split frequencies: 0.009573
585500 -- [-640.099] (-645.327) (-646.890) (-643.638) * [-635.333] (-642.412) (-649.401) (-637.484) -- 0:01:24
586000 -- (-644.875) [-637.185] (-641.263) (-640.143) * (-642.255) [-638.799] (-642.700) (-640.892) -- 0:01:24
586500 -- [-637.725] (-641.057) (-649.043) (-639.559) * (-641.774) [-644.173] (-639.866) (-641.555) -- 0:01:24
587000 -- (-644.183) (-646.604) [-648.168] (-639.215) * [-636.909] (-639.160) (-648.578) (-640.618) -- 0:01:24
587500 -- (-637.960) [-637.167] (-646.158) (-636.232) * (-644.247) [-636.030] (-638.507) (-641.699) -- 0:01:24
588000 -- [-646.012] (-641.495) (-644.472) (-637.607) * (-646.437) [-640.963] (-640.605) (-645.400) -- 0:01:24
588500 -- (-642.687) [-632.655] (-638.377) (-642.092) * [-638.921] (-643.273) (-650.652) (-643.487) -- 0:01:23
589000 -- [-637.524] (-636.756) (-645.033) (-644.139) * [-636.478] (-637.322) (-645.186) (-647.668) -- 0:01:23
589500 -- [-646.904] (-639.676) (-648.774) (-646.002) * [-635.208] (-644.877) (-640.427) (-634.415) -- 0:01:23
590000 -- (-643.722) (-640.735) (-641.217) [-637.469] * (-643.404) [-640.155] (-639.070) (-645.204) -- 0:01:23
Average standard deviation of split frequencies: 0.008619
590500 -- (-637.013) (-640.716) [-645.804] (-648.487) * (-648.760) [-638.772] (-638.950) (-639.472) -- 0:01:23
591000 -- (-638.456) [-640.892] (-636.866) (-645.310) * (-638.068) (-643.679) [-647.169] (-642.724) -- 0:01:23
591500 -- (-639.856) [-641.072] (-632.046) (-643.359) * (-647.530) (-636.812) [-635.979] (-642.914) -- 0:01:23
592000 -- (-643.812) (-644.589) (-640.098) [-645.192] * (-647.964) (-631.005) [-639.513] (-641.217) -- 0:01:23
592500 -- (-636.925) [-639.349] (-637.137) (-640.657) * (-642.471) (-644.640) (-641.174) [-646.405] -- 0:01:23
593000 -- (-640.189) (-635.421) [-639.391] (-642.789) * (-644.864) [-644.877] (-642.435) (-639.196) -- 0:01:23
593500 -- (-641.848) [-634.845] (-640.542) (-641.542) * (-638.190) (-636.290) (-634.386) [-639.340] -- 0:01:22
594000 -- [-644.494] (-642.630) (-642.771) (-643.061) * (-651.798) [-638.108] (-637.035) (-641.422) -- 0:01:22
594500 -- (-645.683) (-640.021) [-641.471] (-646.891) * [-638.550] (-640.135) (-639.072) (-637.730) -- 0:01:22
595000 -- (-637.075) (-643.460) [-644.279] (-643.270) * [-640.770] (-642.045) (-637.255) (-635.617) -- 0:01:22
Average standard deviation of split frequencies: 0.008700
595500 -- (-641.479) (-639.150) (-639.415) [-637.360] * (-643.327) [-643.742] (-636.027) (-649.198) -- 0:01:22
596000 -- [-643.086] (-642.409) (-644.302) (-647.958) * (-651.150) (-637.168) (-641.828) [-643.448] -- 0:01:22
596500 -- (-639.633) (-643.482) [-643.313] (-644.765) * (-634.871) [-637.010] (-647.873) (-646.174) -- 0:01:22
597000 -- [-642.007] (-651.034) (-643.277) (-633.045) * [-638.084] (-641.111) (-645.389) (-640.291) -- 0:01:22
597500 -- (-643.655) [-639.510] (-635.549) (-630.921) * (-640.068) (-639.065) (-638.774) [-638.339] -- 0:01:22
598000 -- [-640.759] (-639.855) (-642.919) (-635.491) * (-638.837) (-648.086) [-641.202] (-639.362) -- 0:01:22
598500 -- (-642.972) [-635.233] (-644.614) (-645.373) * (-638.339) (-646.875) [-647.795] (-634.881) -- 0:01:21
599000 -- (-647.042) [-645.328] (-636.041) (-646.352) * (-642.641) (-642.539) [-642.643] (-641.820) -- 0:01:21
599500 -- [-634.888] (-636.123) (-641.976) (-641.863) * (-640.446) (-645.919) [-638.521] (-636.833) -- 0:01:21
600000 -- [-644.357] (-639.674) (-637.436) (-640.526) * (-647.190) [-636.962] (-642.960) (-652.011) -- 0:01:21
Average standard deviation of split frequencies: 0.008807
600500 -- (-641.938) [-644.071] (-641.721) (-642.902) * [-643.055] (-640.697) (-642.405) (-643.111) -- 0:01:21
601000 -- (-636.784) (-651.242) [-637.842] (-637.845) * (-634.608) (-640.589) [-642.549] (-641.311) -- 0:01:21
601500 -- [-638.948] (-647.445) (-639.959) (-643.515) * (-636.316) [-638.322] (-644.261) (-639.332) -- 0:01:21
602000 -- (-638.139) (-642.075) (-642.292) [-640.257] * [-642.158] (-635.585) (-649.318) (-635.842) -- 0:01:21
602500 -- (-646.332) (-648.922) (-637.328) [-641.511] * (-640.760) (-640.411) (-641.035) [-638.951] -- 0:01:21
603000 -- [-635.838] (-642.201) (-644.031) (-639.478) * (-648.273) (-642.745) (-641.383) [-633.412] -- 0:01:20
603500 -- (-642.971) [-641.305] (-644.112) (-643.814) * (-653.207) [-640.941] (-648.283) (-640.296) -- 0:01:20
604000 -- (-641.915) (-643.145) (-640.944) [-638.800] * [-646.010] (-641.978) (-643.701) (-637.188) -- 0:01:20
604500 -- (-645.646) (-638.883) (-641.877) [-635.844] * (-642.026) [-634.926] (-649.885) (-637.444) -- 0:01:20
605000 -- (-637.272) (-643.237) (-643.958) [-640.051] * (-641.829) (-641.098) (-640.737) [-643.373] -- 0:01:20
Average standard deviation of split frequencies: 0.008401
605500 -- [-639.848] (-644.395) (-647.559) (-649.141) * (-649.169) [-642.098] (-639.008) (-639.571) -- 0:01:20
606000 -- (-644.239) (-643.291) [-644.937] (-636.337) * (-641.723) [-635.640] (-650.858) (-646.623) -- 0:01:20
606500 -- [-641.414] (-643.521) (-648.166) (-639.889) * (-643.873) (-641.716) (-634.880) [-644.620] -- 0:01:20
607000 -- [-635.460] (-637.754) (-640.252) (-641.617) * (-639.992) [-641.061] (-647.591) (-644.442) -- 0:01:20
607500 -- (-642.230) [-643.913] (-646.018) (-648.326) * (-640.594) (-637.613) (-639.481) [-643.684] -- 0:01:20
608000 -- (-644.598) (-640.391) (-648.705) [-644.151] * (-644.507) (-640.433) [-639.661] (-648.061) -- 0:01:19
608500 -- (-636.789) (-641.290) [-637.357] (-643.530) * (-645.119) (-641.853) [-643.914] (-643.607) -- 0:01:19
609000 -- (-643.163) (-638.265) [-635.609] (-640.539) * (-638.041) (-647.929) [-644.315] (-644.843) -- 0:01:19
609500 -- (-642.374) (-644.341) (-645.764) [-637.237] * [-639.719] (-659.351) (-643.481) (-639.295) -- 0:01:19
610000 -- (-637.874) (-642.788) (-637.921) [-638.398] * (-639.099) [-641.319] (-648.849) (-639.016) -- 0:01:19
Average standard deviation of split frequencies: 0.009109
610500 -- (-650.139) (-641.244) (-638.923) [-641.186] * (-647.973) [-641.883] (-634.768) (-636.379) -- 0:01:19
611000 -- (-644.715) [-639.161] (-636.594) (-640.703) * (-642.635) (-641.962) (-648.107) [-639.134] -- 0:01:19
611500 -- [-639.384] (-642.550) (-636.224) (-637.405) * (-650.045) [-641.110] (-644.964) (-637.204) -- 0:01:19
612000 -- (-650.181) (-647.656) [-639.123] (-645.737) * (-643.587) [-641.438] (-643.465) (-639.797) -- 0:01:19
612500 -- (-644.116) (-642.492) [-635.015] (-642.648) * (-640.735) [-642.765] (-643.025) (-641.692) -- 0:01:19
613000 -- [-638.591] (-640.525) (-636.268) (-643.443) * (-647.493) [-648.951] (-639.223) (-647.354) -- 0:01:18
613500 -- [-646.590] (-639.806) (-644.831) (-644.297) * (-639.556) [-642.971] (-643.042) (-643.963) -- 0:01:18
614000 -- [-637.130] (-643.579) (-643.399) (-650.568) * (-644.456) (-644.170) [-638.388] (-644.627) -- 0:01:18
614500 -- (-641.565) (-645.841) (-648.077) [-640.318] * (-638.930) (-650.028) [-633.568] (-644.191) -- 0:01:18
615000 -- (-635.189) [-639.290] (-642.318) (-644.995) * (-644.675) (-643.191) [-643.036] (-644.531) -- 0:01:18
Average standard deviation of split frequencies: 0.008265
615500 -- [-638.917] (-642.804) (-641.653) (-643.515) * (-641.597) [-639.540] (-642.979) (-641.991) -- 0:01:18
616000 -- (-639.445) (-642.214) (-643.533) [-641.324] * (-641.922) [-644.646] (-638.960) (-642.400) -- 0:01:18
616500 -- (-651.982) (-641.497) [-635.203] (-657.040) * (-638.598) (-646.825) (-643.525) [-643.604] -- 0:01:18
617000 -- (-657.218) (-641.085) (-637.283) [-640.227] * [-637.805] (-644.243) (-645.980) (-647.515) -- 0:01:18
617500 -- (-647.672) (-649.045) [-637.733] (-647.263) * [-640.718] (-637.914) (-638.084) (-643.159) -- 0:01:18
618000 -- [-643.709] (-640.347) (-636.984) (-638.921) * (-646.333) (-641.414) [-642.219] (-639.740) -- 0:01:17
618500 -- (-644.301) [-638.427] (-633.278) (-643.806) * [-647.754] (-647.955) (-639.755) (-650.170) -- 0:01:17
619000 -- (-641.792) (-645.405) (-645.448) [-637.545] * [-642.767] (-649.788) (-643.188) (-647.962) -- 0:01:17
619500 -- (-648.730) (-634.737) [-635.583] (-637.322) * (-649.036) (-641.396) [-641.597] (-643.657) -- 0:01:17
620000 -- (-639.483) (-650.080) (-644.211) [-640.661] * (-645.189) (-643.665) (-641.694) [-641.764] -- 0:01:17
Average standard deviation of split frequencies: 0.009283
620500 -- (-643.107) (-638.510) (-640.796) [-641.259] * (-642.643) [-640.247] (-640.340) (-643.320) -- 0:01:17
621000 -- [-641.852] (-636.056) (-636.819) (-646.822) * (-645.536) [-639.958] (-640.314) (-634.233) -- 0:01:17
621500 -- (-636.166) (-636.423) (-641.290) [-637.884] * (-652.316) [-637.403] (-642.230) (-641.764) -- 0:01:17
622000 -- (-644.396) [-639.664] (-638.169) (-641.362) * (-646.176) [-639.296] (-641.470) (-640.324) -- 0:01:17
622500 -- (-645.175) [-640.946] (-642.713) (-635.816) * [-647.271] (-640.091) (-642.906) (-651.500) -- 0:01:17
623000 -- [-638.233] (-638.989) (-640.134) (-642.320) * [-643.436] (-637.778) (-639.850) (-644.426) -- 0:01:16
623500 -- [-640.694] (-637.702) (-647.981) (-641.258) * [-641.668] (-643.036) (-639.379) (-642.861) -- 0:01:16
624000 -- (-637.383) (-640.326) (-639.483) [-640.947] * (-648.730) (-640.476) [-638.100] (-645.383) -- 0:01:16
624500 -- [-637.100] (-641.288) (-640.150) (-643.625) * (-645.792) [-640.446] (-639.735) (-639.930) -- 0:01:16
625000 -- [-636.731] (-640.244) (-644.246) (-649.741) * (-646.217) (-646.258) [-645.707] (-640.988) -- 0:01:16
Average standard deviation of split frequencies: 0.007832
625500 -- (-638.253) [-641.721] (-640.315) (-650.585) * (-640.292) (-637.793) (-642.126) [-644.714] -- 0:01:16
626000 -- [-638.715] (-643.800) (-639.643) (-637.875) * (-647.320) (-640.945) (-639.494) [-640.770] -- 0:01:16
626500 -- [-638.323] (-640.641) (-642.666) (-644.493) * (-644.691) (-641.719) [-635.105] (-638.232) -- 0:01:16
627000 -- (-638.717) [-639.966] (-645.441) (-643.511) * (-646.666) [-637.081] (-642.150) (-641.132) -- 0:01:16
627500 -- (-641.578) [-639.384] (-643.134) (-644.274) * (-647.749) [-636.843] (-644.768) (-649.110) -- 0:01:15
628000 -- (-646.487) (-645.928) [-643.014] (-640.401) * (-639.293) [-638.515] (-649.058) (-638.189) -- 0:01:15
628500 -- [-642.560] (-645.593) (-643.106) (-640.551) * (-642.911) (-640.539) (-643.661) [-644.205] -- 0:01:15
629000 -- (-635.408) (-642.632) [-646.668] (-644.037) * (-644.604) [-639.107] (-644.622) (-644.929) -- 0:01:15
629500 -- (-636.626) [-635.326] (-638.012) (-646.035) * [-632.577] (-642.819) (-649.153) (-644.614) -- 0:01:15
630000 -- (-653.133) (-644.946) [-644.694] (-639.376) * (-645.478) (-644.288) [-633.346] (-645.205) -- 0:01:15
Average standard deviation of split frequencies: 0.008720
630500 -- (-641.159) (-640.372) (-642.528) [-644.348] * (-648.670) [-642.552] (-642.549) (-637.888) -- 0:01:15
631000 -- [-638.307] (-646.907) (-642.465) (-641.444) * (-643.128) (-642.389) [-646.002] (-641.625) -- 0:01:15
631500 -- (-639.281) (-643.111) (-639.390) [-637.538] * (-641.142) (-638.592) (-642.418) [-651.148] -- 0:01:15
632000 -- (-635.554) (-646.573) [-635.782] (-655.461) * (-635.751) (-639.679) [-648.537] (-647.627) -- 0:01:15
632500 -- (-639.743) (-641.718) (-637.559) [-640.385] * [-644.851] (-647.099) (-645.666) (-641.450) -- 0:01:14
633000 -- (-640.899) (-645.076) [-636.973] (-644.207) * [-640.630] (-642.114) (-639.622) (-637.243) -- 0:01:14
633500 -- (-638.164) [-638.711] (-638.821) (-638.054) * (-637.830) (-639.522) (-642.556) [-639.279] -- 0:01:14
634000 -- (-640.893) (-641.173) [-636.618] (-641.218) * (-636.682) (-643.930) (-639.433) [-638.291] -- 0:01:14
634500 -- (-641.207) (-644.659) [-642.450] (-650.180) * (-640.825) (-648.615) [-641.171] (-634.174) -- 0:01:14
635000 -- [-645.359] (-634.985) (-638.928) (-643.724) * (-641.119) (-633.893) (-638.534) [-636.481] -- 0:01:14
Average standard deviation of split frequencies: 0.008400
635500 -- (-643.879) [-631.485] (-643.047) (-644.557) * [-646.009] (-633.913) (-640.677) (-653.878) -- 0:01:14
636000 -- [-648.264] (-644.084) (-642.299) (-637.819) * (-634.976) (-639.945) [-647.335] (-636.793) -- 0:01:14
636500 -- [-638.632] (-637.188) (-645.053) (-640.056) * (-644.177) [-641.775] (-646.598) (-638.296) -- 0:01:14
637000 -- (-644.651) (-639.260) [-647.639] (-636.856) * (-646.347) [-641.010] (-637.035) (-641.941) -- 0:01:14
637500 -- (-648.421) [-644.506] (-642.071) (-641.268) * (-637.766) (-639.587) [-637.539] (-641.242) -- 0:01:13
638000 -- [-636.952] (-646.758) (-639.445) (-640.898) * (-646.294) [-636.954] (-642.158) (-643.979) -- 0:01:13
638500 -- (-642.384) (-639.382) (-639.737) [-639.687] * (-647.966) (-638.886) [-638.019] (-642.687) -- 0:01:13
639000 -- (-640.774) [-638.994] (-638.298) (-646.725) * [-641.703] (-642.269) (-641.512) (-638.659) -- 0:01:13
639500 -- (-642.493) (-640.493) (-643.420) [-644.064] * (-640.821) (-648.050) [-642.332] (-645.063) -- 0:01:13
640000 -- (-637.381) (-637.213) (-639.489) [-638.112] * (-645.436) (-646.170) [-636.407] (-646.071) -- 0:01:13
Average standard deviation of split frequencies: 0.008012
640500 -- (-642.280) [-639.476] (-652.295) (-643.794) * (-643.605) (-650.115) (-650.412) [-638.082] -- 0:01:13
641000 -- [-635.031] (-648.212) (-646.276) (-641.945) * (-638.945) (-651.746) [-634.774] (-640.448) -- 0:01:13
641500 -- (-635.205) [-636.823] (-647.268) (-641.035) * (-639.916) (-646.238) [-636.952] (-639.079) -- 0:01:13
642000 -- (-638.121) (-638.904) (-640.844) [-645.106] * (-635.922) (-645.640) (-639.370) [-639.796] -- 0:01:13
642500 -- (-642.335) [-638.563] (-642.979) (-645.487) * (-637.692) (-651.285) (-635.790) [-646.510] -- 0:01:12
643000 -- (-641.280) (-644.123) [-641.078] (-641.210) * [-647.692] (-641.710) (-639.746) (-641.358) -- 0:01:12
643500 -- (-643.242) (-639.843) [-638.969] (-654.128) * (-655.380) (-635.263) (-646.462) [-636.808] -- 0:01:12
644000 -- (-645.751) (-641.931) (-637.971) [-641.360] * [-642.898] (-639.796) (-651.262) (-644.442) -- 0:01:12
644500 -- [-640.288] (-640.076) (-637.451) (-642.510) * [-648.493] (-639.380) (-652.085) (-643.818) -- 0:01:12
645000 -- (-648.052) (-637.358) [-639.815] (-649.971) * (-646.236) [-635.624] (-643.810) (-634.710) -- 0:01:12
Average standard deviation of split frequencies: 0.007865
645500 -- [-643.349] (-643.836) (-648.373) (-644.635) * (-643.722) (-639.613) [-644.680] (-642.797) -- 0:01:12
646000 -- [-640.422] (-641.778) (-647.172) (-649.809) * (-647.654) (-638.121) (-646.904) [-638.443] -- 0:01:12
646500 -- (-632.622) [-643.617] (-637.537) (-648.200) * (-640.353) [-633.770] (-641.272) (-643.008) -- 0:01:12
647000 -- [-639.451] (-646.868) (-635.417) (-648.605) * [-636.368] (-637.427) (-639.565) (-639.572) -- 0:01:12
647500 -- [-642.048] (-638.372) (-645.989) (-645.482) * (-637.646) [-636.057] (-645.547) (-643.122) -- 0:01:11
648000 -- (-640.766) (-640.743) (-641.411) [-640.486] * [-638.965] (-639.290) (-641.972) (-639.709) -- 0:01:11
648500 -- (-644.340) (-638.446) [-638.387] (-637.459) * (-638.069) (-649.350) (-636.184) [-643.480] -- 0:01:11
649000 -- (-642.404) (-637.405) [-643.585] (-646.616) * (-640.262) [-635.872] (-643.498) (-643.976) -- 0:01:11
649500 -- (-650.970) [-639.509] (-637.043) (-642.882) * (-638.078) (-637.910) (-649.984) [-642.203] -- 0:01:11
650000 -- [-640.665] (-641.993) (-639.535) (-644.920) * (-640.674) (-631.784) (-636.351) [-638.609] -- 0:01:11
Average standard deviation of split frequencies: 0.008452
650500 -- (-644.464) (-639.628) [-638.771] (-641.388) * (-651.541) [-635.430] (-636.548) (-638.985) -- 0:01:11
651000 -- (-643.399) [-636.712] (-642.672) (-641.134) * [-645.513] (-648.440) (-637.841) (-650.227) -- 0:01:11
651500 -- (-645.751) [-644.399] (-638.793) (-639.498) * (-641.922) (-644.720) [-640.750] (-647.602) -- 0:01:11
652000 -- (-640.964) [-642.428] (-636.537) (-643.052) * (-649.444) (-645.220) [-640.997] (-656.941) -- 0:01:10
652500 -- [-635.640] (-640.816) (-641.466) (-637.030) * [-640.793] (-641.916) (-641.563) (-653.948) -- 0:01:10
653000 -- (-643.489) (-646.375) [-642.414] (-633.657) * (-640.017) (-638.802) (-643.198) [-636.690] -- 0:01:10
653500 -- (-652.379) (-645.348) [-642.201] (-641.049) * (-641.375) (-643.457) (-657.410) [-639.974] -- 0:01:10
654000 -- (-649.359) (-644.710) (-647.833) [-636.101] * (-641.068) [-637.739] (-651.666) (-647.604) -- 0:01:10
654500 -- (-637.773) (-640.961) (-637.883) [-638.454] * (-647.398) [-637.452] (-647.449) (-651.621) -- 0:01:10
655000 -- (-638.700) [-637.012] (-641.856) (-637.953) * (-641.435) (-640.135) [-641.659] (-638.264) -- 0:01:10
Average standard deviation of split frequencies: 0.007585
655500 -- (-637.963) [-638.508] (-641.828) (-643.958) * (-644.753) (-640.476) (-644.152) [-639.349] -- 0:01:10
656000 -- (-637.855) (-640.874) [-638.504] (-635.102) * (-642.585) [-636.140] (-642.691) (-638.041) -- 0:01:10
656500 -- [-635.794] (-638.773) (-647.921) (-635.999) * (-637.326) (-642.493) (-648.579) [-636.270] -- 0:01:10
657000 -- [-633.504] (-644.302) (-648.690) (-643.289) * (-632.493) [-637.742] (-641.468) (-644.109) -- 0:01:09
657500 -- (-639.810) (-652.108) [-640.147] (-634.192) * (-646.742) (-641.189) (-642.168) [-638.151] -- 0:01:09
658000 -- (-643.052) (-638.765) [-636.052] (-644.247) * [-644.330] (-641.841) (-642.318) (-640.372) -- 0:01:09
658500 -- (-648.973) (-636.929) (-648.545) [-637.642] * (-636.839) (-639.459) (-638.964) [-637.616] -- 0:01:09
659000 -- (-637.830) [-635.268] (-641.891) (-649.003) * (-648.730) [-640.316] (-641.326) (-639.143) -- 0:01:09
659500 -- (-639.785) [-644.237] (-644.890) (-646.501) * [-645.402] (-638.832) (-643.480) (-639.456) -- 0:01:09
660000 -- [-642.700] (-641.318) (-644.969) (-639.489) * (-639.263) (-642.047) (-638.564) [-637.374] -- 0:01:09
Average standard deviation of split frequencies: 0.007611
660500 -- (-644.165) (-646.126) (-644.535) [-638.311] * (-642.418) (-639.537) [-641.781] (-642.216) -- 0:01:09
661000 -- (-654.422) (-642.068) (-650.693) [-638.990] * (-646.808) (-637.117) (-644.395) [-640.760] -- 0:01:09
661500 -- (-644.165) [-640.848] (-647.155) (-635.943) * [-644.647] (-646.526) (-641.500) (-644.248) -- 0:01:09
662000 -- [-641.067] (-639.947) (-640.645) (-646.604) * (-644.570) (-641.361) [-640.419] (-644.756) -- 0:01:08
662500 -- (-640.214) [-637.656] (-637.361) (-635.189) * (-642.277) (-641.778) (-643.806) [-638.802] -- 0:01:08
663000 -- [-639.672] (-640.467) (-638.197) (-639.227) * (-642.102) (-641.377) [-642.795] (-642.793) -- 0:01:08
663500 -- (-636.610) (-645.048) [-642.547] (-642.259) * (-638.932) (-639.262) [-633.417] (-643.358) -- 0:01:08
664000 -- (-638.198) [-636.201] (-638.977) (-639.696) * (-649.689) (-632.402) [-637.914] (-643.452) -- 0:01:08
664500 -- (-644.688) (-643.187) (-639.722) [-638.281] * (-640.639) [-638.499] (-640.695) (-649.162) -- 0:01:08
665000 -- (-655.231) [-638.687] (-641.781) (-641.308) * [-632.087] (-638.707) (-638.808) (-647.031) -- 0:01:08
Average standard deviation of split frequencies: 0.007629
665500 -- (-640.899) (-653.186) [-642.093] (-641.165) * [-636.913] (-640.105) (-642.466) (-645.385) -- 0:01:08
666000 -- (-642.042) (-640.538) [-638.075] (-642.095) * (-633.493) (-637.706) [-636.254] (-639.495) -- 0:01:08
666500 -- [-642.517] (-642.662) (-639.567) (-641.495) * (-641.336) [-636.073] (-639.400) (-641.289) -- 0:01:08
667000 -- (-640.038) (-641.173) [-636.691] (-639.659) * (-640.322) [-637.938] (-641.715) (-635.684) -- 0:01:07
667500 -- (-649.995) [-634.738] (-644.338) (-648.383) * (-640.570) (-637.048) [-644.537] (-632.076) -- 0:01:07
668000 -- (-638.079) (-645.422) [-634.294] (-641.270) * [-638.915] (-642.156) (-638.748) (-639.418) -- 0:01:07
668500 -- [-637.623] (-639.680) (-639.340) (-640.518) * (-637.231) (-638.348) [-642.973] (-640.719) -- 0:01:07
669000 -- (-647.653) (-648.761) [-639.423] (-641.236) * (-646.018) (-643.361) (-643.976) [-641.387] -- 0:01:07
669500 -- (-640.923) (-640.116) (-645.394) [-639.514] * (-638.734) (-645.026) (-646.697) [-639.023] -- 0:01:07
670000 -- [-639.752] (-647.989) (-645.277) (-636.425) * (-640.371) [-638.891] (-644.335) (-643.023) -- 0:01:07
Average standard deviation of split frequencies: 0.008669
670500 -- [-640.003] (-643.204) (-651.023) (-635.994) * (-637.639) (-640.061) (-642.526) [-640.167] -- 0:01:07
671000 -- (-638.460) (-649.587) (-641.170) [-637.569] * (-639.694) [-638.358] (-640.070) (-641.015) -- 0:01:07
671500 -- [-639.268] (-641.827) (-647.812) (-644.070) * (-641.842) [-636.088] (-641.554) (-637.327) -- 0:01:07
672000 -- (-634.776) [-639.984] (-639.780) (-640.824) * (-638.922) (-643.660) (-640.381) [-636.617] -- 0:01:06
672500 -- (-640.610) (-636.376) [-646.520] (-646.359) * [-634.495] (-645.931) (-644.081) (-644.448) -- 0:01:06
673000 -- [-643.389] (-650.755) (-636.817) (-641.557) * (-637.500) (-647.750) (-636.578) [-638.361] -- 0:01:06
673500 -- [-638.605] (-648.745) (-637.893) (-648.910) * [-637.564] (-643.168) (-639.365) (-645.808) -- 0:01:06
674000 -- (-640.874) (-643.116) (-639.987) [-641.203] * (-640.801) [-635.052] (-649.688) (-647.216) -- 0:01:06
674500 -- (-649.704) (-647.258) [-638.484] (-641.694) * (-635.027) (-639.209) (-645.060) [-642.339] -- 0:01:06
675000 -- (-661.854) (-644.827) [-648.544] (-644.963) * (-643.525) (-646.751) [-636.380] (-640.853) -- 0:01:06
Average standard deviation of split frequencies: 0.009143
675500 -- [-644.839] (-639.105) (-639.504) (-648.785) * (-643.172) [-639.555] (-643.188) (-647.006) -- 0:01:06
676000 -- [-637.540] (-642.209) (-649.586) (-640.043) * (-647.298) (-645.928) [-646.022] (-645.654) -- 0:01:06
676500 -- [-639.155] (-643.488) (-646.387) (-645.150) * (-648.893) [-638.588] (-647.486) (-644.073) -- 0:01:05
677000 -- [-638.653] (-643.616) (-645.929) (-637.770) * (-643.511) (-638.855) (-642.133) [-645.634] -- 0:01:05
677500 -- (-637.747) [-637.784] (-643.910) (-649.087) * (-648.933) (-639.401) (-638.666) [-637.112] -- 0:01:05
678000 -- [-640.239] (-640.940) (-636.044) (-653.517) * (-643.306) (-639.980) (-643.163) [-639.768] -- 0:01:05
678500 -- (-643.779) [-639.551] (-643.767) (-647.783) * (-640.671) (-635.880) (-636.705) [-641.241] -- 0:01:05
679000 -- [-638.115] (-637.026) (-646.869) (-645.730) * (-644.771) [-638.513] (-642.081) (-643.611) -- 0:01:05
679500 -- (-643.018) [-634.077] (-637.796) (-641.455) * [-633.396] (-644.307) (-643.943) (-646.444) -- 0:01:05
680000 -- (-641.207) [-640.216] (-638.924) (-647.507) * (-645.528) (-642.478) (-645.058) [-636.706] -- 0:01:05
Average standard deviation of split frequencies: 0.010004
680500 -- [-637.699] (-645.020) (-638.709) (-645.085) * [-643.604] (-634.592) (-639.590) (-646.916) -- 0:01:05
681000 -- (-635.810) (-642.587) (-642.623) [-634.792] * (-645.703) (-637.467) (-640.547) [-633.483] -- 0:01:05
681500 -- (-643.407) (-645.600) [-635.368] (-643.662) * (-633.974) [-641.352] (-653.968) (-638.759) -- 0:01:04
682000 -- (-639.082) (-652.746) [-635.677] (-644.515) * [-639.549] (-637.411) (-643.879) (-634.910) -- 0:01:04
682500 -- (-643.904) (-651.607) (-635.563) [-635.293] * (-644.177) [-642.721] (-636.330) (-641.363) -- 0:01:04
683000 -- (-645.728) [-648.895] (-640.750) (-641.599) * (-640.958) [-639.132] (-640.997) (-642.122) -- 0:01:04
683500 -- [-637.730] (-644.940) (-641.213) (-642.554) * (-641.725) [-637.455] (-641.832) (-637.875) -- 0:01:04
684000 -- (-640.528) (-645.590) [-637.419] (-643.756) * [-643.664] (-640.700) (-638.478) (-646.673) -- 0:01:04
684500 -- (-639.852) (-640.566) [-638.580] (-644.844) * (-642.320) [-642.053] (-646.523) (-642.834) -- 0:01:04
685000 -- [-636.993] (-637.738) (-635.252) (-638.047) * (-644.628) [-637.447] (-647.356) (-640.691) -- 0:01:04
Average standard deviation of split frequencies: 0.009086
685500 -- (-648.972) (-641.971) [-637.012] (-637.026) * [-641.808] (-643.444) (-640.733) (-649.792) -- 0:01:04
686000 -- (-642.068) (-640.607) (-638.568) [-643.048] * (-642.194) (-644.999) [-636.287] (-649.772) -- 0:01:04
686500 -- (-646.548) [-640.962] (-634.960) (-652.264) * (-640.579) [-638.687] (-638.492) (-642.186) -- 0:01:03
687000 -- [-647.485] (-639.225) (-640.800) (-636.583) * (-637.131) [-640.485] (-642.749) (-640.603) -- 0:01:03
687500 -- (-640.297) (-635.603) (-642.280) [-638.420] * [-639.373] (-633.589) (-638.698) (-638.797) -- 0:01:03
688000 -- (-642.619) (-646.465) (-639.799) [-642.952] * [-635.344] (-643.719) (-652.035) (-641.668) -- 0:01:03
688500 -- [-640.953] (-643.034) (-643.651) (-634.418) * [-637.497] (-642.574) (-641.533) (-642.698) -- 0:01:03
689000 -- (-641.521) (-641.839) (-640.551) [-639.039] * (-638.165) [-642.482] (-644.143) (-641.612) -- 0:01:03
689500 -- (-635.166) (-642.946) (-642.095) [-637.061] * (-646.222) [-631.753] (-646.731) (-638.735) -- 0:01:03
690000 -- (-640.790) (-638.724) [-640.390] (-645.207) * (-643.909) [-642.602] (-643.109) (-638.960) -- 0:01:03
Average standard deviation of split frequencies: 0.009025
690500 -- (-646.041) [-642.746] (-646.453) (-641.367) * (-644.986) (-637.896) (-637.109) [-632.962] -- 0:01:03
691000 -- [-645.926] (-639.736) (-642.333) (-645.185) * (-643.205) (-639.848) [-634.978] (-644.905) -- 0:01:03
691500 -- (-638.054) [-640.637] (-649.189) (-646.327) * (-642.607) (-638.368) (-641.226) [-640.917] -- 0:01:02
692000 -- [-643.013] (-644.673) (-643.788) (-641.875) * [-634.577] (-639.879) (-641.500) (-641.441) -- 0:01:02
692500 -- [-640.097] (-643.461) (-641.592) (-640.951) * (-643.977) [-649.763] (-647.532) (-637.841) -- 0:01:02
693000 -- (-640.443) (-642.756) (-643.761) [-635.300] * (-640.710) (-647.496) [-642.395] (-641.368) -- 0:01:02
693500 -- [-634.733] (-635.910) (-643.212) (-641.414) * (-635.885) (-648.322) [-635.504] (-635.939) -- 0:01:02
694000 -- (-638.356) (-640.514) [-634.584] (-643.354) * [-640.582] (-643.199) (-644.411) (-642.613) -- 0:01:02
694500 -- (-649.016) [-638.474] (-636.122) (-646.287) * [-632.291] (-637.901) (-636.368) (-645.959) -- 0:01:02
695000 -- (-642.055) [-640.306] (-639.284) (-645.036) * [-639.641] (-633.515) (-644.207) (-646.129) -- 0:01:02
Average standard deviation of split frequencies: 0.009106
695500 -- (-642.430) [-646.207] (-641.257) (-640.719) * (-640.215) (-639.909) [-643.582] (-637.126) -- 0:01:02
696000 -- (-639.106) (-647.061) (-644.221) [-637.715] * (-641.139) (-646.005) [-645.012] (-639.783) -- 0:01:02
696500 -- (-644.065) (-639.288) [-642.044] (-642.759) * [-639.523] (-642.433) (-641.510) (-641.642) -- 0:01:01
697000 -- [-634.906] (-640.602) (-635.674) (-634.236) * (-642.724) (-640.232) (-646.134) [-647.672] -- 0:01:01
697500 -- [-642.744] (-640.867) (-641.404) (-645.410) * (-642.154) (-642.220) [-636.938] (-645.672) -- 0:01:01
698000 -- (-640.125) [-635.802] (-638.573) (-650.885) * (-639.229) (-640.177) (-637.695) [-636.082] -- 0:01:01
698500 -- (-645.321) [-634.641] (-636.695) (-641.398) * (-645.549) [-635.510] (-643.860) (-637.060) -- 0:01:01
699000 -- [-637.284] (-643.708) (-634.778) (-637.173) * [-640.305] (-642.410) (-642.340) (-653.188) -- 0:01:01
699500 -- (-643.881) (-637.216) (-642.771) [-639.723] * (-647.767) [-645.750] (-638.844) (-646.550) -- 0:01:01
700000 -- (-646.917) (-643.187) (-636.240) [-635.977] * [-640.048] (-648.477) (-644.692) (-644.294) -- 0:01:01
Average standard deviation of split frequencies: 0.008821
700500 -- [-637.775] (-645.894) (-636.607) (-651.365) * (-640.028) [-637.440] (-639.268) (-642.956) -- 0:01:01
701000 -- (-655.587) (-642.933) (-642.342) [-638.986] * (-634.108) [-636.745] (-650.018) (-641.035) -- 0:01:00
701500 -- (-645.511) (-644.224) [-637.473] (-639.836) * (-642.667) [-637.882] (-645.033) (-646.509) -- 0:01:00
702000 -- (-642.861) [-640.355] (-640.334) (-642.878) * (-639.001) [-645.796] (-643.325) (-646.087) -- 0:01:00
702500 -- (-652.016) (-635.589) (-637.222) [-638.331] * (-641.768) (-647.956) [-643.979] (-637.821) -- 0:01:00
703000 -- (-639.165) (-640.852) (-640.325) [-649.074] * [-636.968] (-640.565) (-642.813) (-643.950) -- 0:01:00
703500 -- [-639.142] (-641.438) (-638.062) (-642.128) * (-644.246) (-636.515) (-639.247) [-640.224] -- 0:01:00
704000 -- [-641.338] (-639.792) (-638.581) (-644.003) * (-647.534) (-638.143) (-637.796) [-646.707] -- 0:01:00
704500 -- (-640.342) (-639.890) [-637.833] (-639.463) * (-639.961) (-647.816) [-640.036] (-636.735) -- 0:01:00
705000 -- (-650.873) [-639.204] (-638.892) (-646.185) * (-641.135) (-641.556) [-639.188] (-640.934) -- 0:01:00
Average standard deviation of split frequencies: 0.008977
705500 -- (-645.368) (-643.197) [-635.679] (-646.188) * (-637.598) [-642.560] (-643.722) (-645.132) -- 0:01:00
706000 -- (-644.607) [-640.477] (-641.291) (-637.238) * (-640.869) [-641.147] (-637.335) (-645.402) -- 0:00:59
706500 -- (-649.598) (-637.010) (-643.227) [-638.974] * (-648.978) (-639.931) [-643.134] (-647.795) -- 0:00:59
707000 -- (-645.719) [-637.238] (-642.680) (-638.343) * [-645.543] (-650.324) (-639.602) (-643.345) -- 0:00:59
707500 -- (-639.958) (-641.027) (-638.202) [-636.194] * (-640.027) (-645.022) (-644.119) [-641.612] -- 0:00:59
708000 -- (-641.444) [-645.079] (-643.040) (-633.863) * (-643.467) [-647.019] (-636.218) (-645.542) -- 0:00:59
708500 -- [-645.418] (-642.494) (-641.050) (-639.635) * [-645.669] (-639.333) (-637.078) (-647.702) -- 0:00:59
709000 -- (-651.842) [-637.472] (-637.760) (-640.956) * (-641.730) (-656.634) [-644.718] (-640.829) -- 0:00:59
709500 -- (-638.784) (-636.198) [-650.621] (-643.227) * (-643.578) (-646.940) (-648.155) [-639.870] -- 0:00:59
710000 -- (-640.881) [-637.474] (-643.662) (-642.833) * (-636.872) (-645.967) [-635.578] (-638.691) -- 0:00:59
Average standard deviation of split frequencies: 0.009508
710500 -- (-636.730) (-639.183) (-637.496) [-634.511] * (-641.106) (-643.215) (-642.173) [-638.165] -- 0:00:59
711000 -- [-635.936] (-644.849) (-645.508) (-643.902) * (-641.311) (-643.946) (-648.213) [-642.238] -- 0:00:58
711500 -- [-644.193] (-641.080) (-645.359) (-646.192) * (-639.374) (-642.851) (-645.031) [-643.528] -- 0:00:58
712000 -- (-642.507) (-643.286) (-637.512) [-642.138] * [-644.448] (-647.394) (-643.024) (-639.479) -- 0:00:58
712500 -- (-639.853) [-643.674] (-644.741) (-641.959) * (-641.293) [-641.038] (-639.925) (-649.717) -- 0:00:58
713000 -- (-638.948) (-638.157) [-640.470] (-647.996) * (-641.254) [-637.784] (-647.889) (-638.499) -- 0:00:58
713500 -- (-637.477) (-639.016) (-645.795) [-637.258] * (-652.489) [-638.769] (-644.705) (-635.880) -- 0:00:58
714000 -- (-644.312) [-639.818] (-645.712) (-652.707) * (-653.867) (-639.922) [-639.028] (-646.134) -- 0:00:58
714500 -- (-638.095) [-640.404] (-647.458) (-640.548) * (-639.363) (-648.638) (-638.140) [-636.005] -- 0:00:58
715000 -- (-637.945) [-641.052] (-641.072) (-638.263) * [-641.118] (-644.187) (-650.174) (-637.462) -- 0:00:58
Average standard deviation of split frequencies: 0.010534
715500 -- (-646.336) (-640.623) [-635.051] (-647.817) * (-647.641) (-637.893) (-639.131) [-640.015] -- 0:00:58
716000 -- (-639.902) (-647.737) [-640.004] (-641.381) * (-658.986) [-640.456] (-644.816) (-644.516) -- 0:00:57
716500 -- (-642.570) [-641.044] (-643.562) (-639.582) * (-647.437) (-641.361) (-647.141) [-636.861] -- 0:00:57
717000 -- (-640.860) (-641.636) [-643.803] (-639.226) * (-642.400) (-639.670) [-639.821] (-635.426) -- 0:00:57
717500 -- [-646.370] (-641.578) (-635.968) (-645.580) * (-642.295) (-640.477) [-641.728] (-638.154) -- 0:00:57
718000 -- (-644.525) (-642.467) (-642.568) [-641.960] * (-631.865) (-639.010) [-645.819] (-641.396) -- 0:00:57
718500 -- (-638.509) [-643.997] (-642.922) (-644.666) * (-640.495) (-643.487) [-637.685] (-638.373) -- 0:00:57
719000 -- (-632.778) (-638.851) [-637.819] (-638.936) * (-640.875) [-641.004] (-640.044) (-640.600) -- 0:00:57
719500 -- (-643.746) (-644.111) (-634.002) [-634.741] * (-648.185) (-641.744) [-637.286] (-639.307) -- 0:00:57
720000 -- (-645.838) (-639.740) [-639.101] (-641.186) * (-638.694) [-647.169] (-638.733) (-646.009) -- 0:00:57
Average standard deviation of split frequencies: 0.011193
720500 -- (-641.129) [-642.115] (-653.863) (-642.334) * (-637.514) (-647.121) (-637.173) [-643.280] -- 0:00:57
721000 -- (-637.582) (-643.446) (-648.115) [-641.988] * (-647.188) (-652.919) [-643.100] (-641.503) -- 0:00:56
721500 -- [-637.344] (-635.902) (-652.703) (-636.081) * (-639.378) (-639.532) [-643.181] (-643.707) -- 0:00:56
722000 -- (-640.735) [-643.731] (-641.762) (-639.595) * (-643.654) [-641.919] (-638.016) (-648.952) -- 0:00:56
722500 -- (-638.022) (-646.248) [-648.478] (-634.410) * (-640.580) (-643.387) [-637.541] (-642.531) -- 0:00:56
723000 -- [-637.121] (-645.675) (-634.466) (-643.367) * (-638.949) (-638.270) [-635.842] (-640.003) -- 0:00:56
723500 -- (-634.020) [-639.309] (-639.569) (-649.296) * (-644.684) (-640.409) (-635.807) [-636.786] -- 0:00:56
724000 -- (-638.038) [-633.438] (-639.629) (-640.989) * (-637.701) [-638.427] (-640.210) (-643.028) -- 0:00:56
724500 -- (-637.233) (-645.105) (-643.762) [-641.641] * [-640.870] (-639.890) (-647.046) (-633.870) -- 0:00:56
725000 -- (-641.495) (-640.210) (-641.676) [-641.179] * [-642.104] (-647.076) (-643.397) (-645.979) -- 0:00:56
Average standard deviation of split frequencies: 0.011183
725500 -- (-643.056) (-652.424) [-632.669] (-641.019) * (-633.258) (-646.004) [-640.685] (-645.329) -- 0:00:55
726000 -- (-649.655) (-640.336) [-640.831] (-640.586) * (-641.970) (-632.778) (-644.805) [-638.041] -- 0:00:55
726500 -- (-638.796) (-646.851) (-637.089) [-643.342] * (-637.718) [-644.834] (-651.542) (-644.565) -- 0:00:55
727000 -- (-643.564) [-637.324] (-636.324) (-642.092) * (-641.166) (-642.487) [-640.657] (-636.851) -- 0:00:55
727500 -- (-640.036) (-650.214) (-640.807) [-643.391] * (-642.987) (-642.970) [-641.259] (-643.439) -- 0:00:55
728000 -- (-643.259) (-648.501) [-643.585] (-645.836) * [-636.297] (-647.607) (-641.966) (-637.180) -- 0:00:55
728500 -- (-639.264) [-635.134] (-646.466) (-641.583) * (-637.212) (-637.584) (-649.378) [-641.353] -- 0:00:55
729000 -- (-636.748) [-640.067] (-641.815) (-640.970) * (-636.771) (-645.414) [-645.427] (-641.951) -- 0:00:55
729500 -- (-642.561) (-640.692) (-647.869) [-641.110] * [-638.199] (-644.981) (-635.842) (-637.509) -- 0:00:55
730000 -- (-638.935) (-643.315) [-645.879] (-639.579) * (-641.341) (-639.872) (-646.919) [-631.667] -- 0:00:55
Average standard deviation of split frequencies: 0.011111
730500 -- [-640.888] (-638.431) (-642.875) (-637.813) * (-643.305) (-642.305) (-645.091) [-647.121] -- 0:00:54
731000 -- (-650.145) [-645.990] (-646.562) (-643.366) * [-641.752] (-636.182) (-639.865) (-644.220) -- 0:00:54
731500 -- (-644.442) (-643.311) (-646.390) [-634.690] * (-647.120) [-637.204] (-637.422) (-660.531) -- 0:00:54
732000 -- [-642.160] (-648.937) (-642.320) (-631.014) * (-645.447) (-643.106) [-636.858] (-639.243) -- 0:00:54
732500 -- (-642.988) (-640.018) [-641.578] (-638.205) * (-646.159) [-642.312] (-647.591) (-640.974) -- 0:00:54
733000 -- [-640.392] (-647.739) (-637.029) (-647.546) * (-643.993) (-645.403) (-645.104) [-646.159] -- 0:00:54
733500 -- (-643.350) [-640.898] (-641.675) (-639.818) * (-643.922) (-647.170) [-648.327] (-645.281) -- 0:00:54
734000 -- [-640.266] (-644.529) (-645.254) (-644.484) * (-642.767) (-639.993) [-643.733] (-633.558) -- 0:00:54
734500 -- (-642.477) (-645.345) [-641.280] (-643.985) * (-653.677) [-638.807] (-640.381) (-637.066) -- 0:00:54
735000 -- (-642.273) [-644.704] (-642.777) (-641.200) * (-645.851) (-641.253) (-637.297) [-637.759] -- 0:00:54
Average standard deviation of split frequencies: 0.010960
735500 -- (-638.754) (-643.703) [-635.748] (-645.532) * (-637.921) (-636.187) (-640.031) [-636.827] -- 0:00:53
736000 -- (-633.241) [-644.978] (-638.329) (-643.009) * (-646.425) (-639.221) [-641.515] (-645.726) -- 0:00:53
736500 -- [-646.434] (-643.056) (-639.980) (-650.434) * [-635.106] (-640.841) (-643.657) (-636.729) -- 0:00:53
737000 -- (-637.408) [-640.425] (-640.347) (-640.443) * (-640.747) (-639.512) (-641.250) [-639.223] -- 0:00:53
737500 -- (-635.985) (-647.897) (-635.983) [-645.712] * (-646.422) (-643.266) (-644.146) [-639.535] -- 0:00:53
738000 -- (-644.494) (-639.210) (-633.447) [-636.930] * [-638.557] (-637.469) (-650.916) (-638.803) -- 0:00:53
738500 -- (-640.305) [-635.878] (-640.686) (-634.160) * (-633.876) (-644.032) [-644.558] (-646.208) -- 0:00:53
739000 -- (-638.290) [-639.234] (-638.402) (-636.645) * (-640.553) (-640.463) (-642.963) [-637.317] -- 0:00:53
739500 -- (-640.494) (-645.110) (-643.108) [-636.615] * (-642.407) (-653.327) (-639.867) [-647.968] -- 0:00:53
740000 -- (-643.480) (-648.452) [-640.661] (-637.575) * (-642.712) [-643.131] (-638.319) (-641.794) -- 0:00:53
Average standard deviation of split frequencies: 0.010961
740500 -- (-640.981) (-647.231) (-645.394) [-640.661] * (-638.896) (-643.706) (-641.656) [-642.674] -- 0:00:52
741000 -- (-642.082) [-645.621] (-647.634) (-642.349) * (-636.164) [-641.429] (-638.841) (-645.700) -- 0:00:52
741500 -- (-641.227) (-651.981) (-639.999) [-639.105] * (-644.313) (-637.739) (-651.821) [-634.953] -- 0:00:52
742000 -- (-642.404) (-648.263) [-639.789] (-642.511) * (-639.005) [-635.008] (-638.581) (-635.155) -- 0:00:52
742500 -- (-643.268) [-642.074] (-639.395) (-640.539) * (-642.693) (-642.742) (-643.220) [-647.462] -- 0:00:52
743000 -- [-644.839] (-647.683) (-634.154) (-648.324) * (-638.301) [-640.537] (-639.583) (-640.459) -- 0:00:52
743500 -- (-639.560) (-655.296) (-640.622) [-642.846] * (-639.637) [-644.566] (-637.891) (-647.156) -- 0:00:52
744000 -- (-648.261) [-636.257] (-643.621) (-641.464) * (-639.345) [-640.719] (-633.721) (-638.940) -- 0:00:52
744500 -- (-639.240) (-641.724) [-644.387] (-637.921) * (-637.200) [-635.326] (-642.911) (-640.772) -- 0:00:52
745000 -- (-640.944) (-642.487) (-642.155) [-639.215] * (-642.065) (-639.972) [-642.228] (-642.761) -- 0:00:52
Average standard deviation of split frequencies: 0.010953
745500 -- [-643.114] (-646.338) (-642.896) (-650.385) * [-641.071] (-641.172) (-646.531) (-639.034) -- 0:00:51
746000 -- (-647.559) [-642.906] (-651.265) (-640.261) * [-648.186] (-636.939) (-637.773) (-651.129) -- 0:00:51
746500 -- [-637.673] (-648.042) (-645.626) (-637.069) * (-638.778) [-639.242] (-646.035) (-643.088) -- 0:00:51
747000 -- (-647.991) [-638.121] (-642.407) (-641.754) * (-640.659) (-638.847) (-647.489) [-639.698] -- 0:00:51
747500 -- (-642.603) [-634.606] (-648.833) (-638.319) * (-638.306) [-643.269] (-634.693) (-638.813) -- 0:00:51
748000 -- (-638.937) [-643.555] (-643.916) (-638.862) * (-641.533) [-636.800] (-646.033) (-643.731) -- 0:00:51
748500 -- (-639.254) (-644.471) [-637.951] (-642.415) * (-646.499) (-648.232) [-636.651] (-638.101) -- 0:00:51
749000 -- [-645.051] (-637.506) (-640.492) (-640.910) * [-636.620] (-641.870) (-640.899) (-648.167) -- 0:00:51
749500 -- (-638.710) (-641.904) [-642.739] (-646.284) * [-636.607] (-641.833) (-642.738) (-647.789) -- 0:00:51
750000 -- [-643.255] (-641.838) (-643.543) (-643.524) * (-637.742) (-638.873) (-645.280) [-639.266] -- 0:00:51
Average standard deviation of split frequencies: 0.010536
750500 -- (-650.542) (-639.484) [-638.078] (-642.489) * (-648.980) (-646.623) (-640.039) [-641.935] -- 0:00:50
751000 -- [-645.792] (-638.501) (-636.842) (-644.171) * [-638.075] (-641.847) (-634.354) (-638.880) -- 0:00:50
751500 -- [-644.531] (-642.010) (-642.220) (-648.773) * (-639.206) (-642.163) (-643.807) [-636.652] -- 0:00:50
752000 -- (-646.283) [-631.828] (-645.137) (-646.531) * (-639.910) (-640.466) (-641.920) [-637.401] -- 0:00:50
752500 -- (-641.488) [-635.140] (-640.448) (-647.385) * (-638.681) (-634.770) [-644.534] (-644.393) -- 0:00:50
753000 -- [-642.635] (-647.402) (-638.305) (-641.882) * (-641.961) (-638.022) (-645.761) [-637.231] -- 0:00:50
753500 -- [-647.752] (-647.474) (-636.705) (-640.236) * (-636.434) (-637.661) [-641.529] (-636.713) -- 0:00:50
754000 -- (-646.078) (-644.840) (-641.317) [-642.995] * (-639.631) (-646.926) [-637.579] (-645.372) -- 0:00:50
754500 -- (-642.112) (-639.267) (-641.905) [-637.546] * (-639.441) (-649.085) [-633.980] (-639.512) -- 0:00:50
755000 -- (-639.647) [-641.713] (-638.703) (-640.877) * (-640.274) (-649.901) (-635.022) [-637.666] -- 0:00:49
Average standard deviation of split frequencies: 0.010531
755500 -- [-633.692] (-633.641) (-645.118) (-639.056) * (-639.276) (-647.777) [-638.488] (-642.858) -- 0:00:49
756000 -- (-643.095) (-641.772) (-646.223) [-641.243] * (-641.263) [-639.339] (-642.382) (-645.927) -- 0:00:49
756500 -- [-646.983] (-640.485) (-642.294) (-643.556) * (-647.294) [-635.554] (-638.744) (-650.749) -- 0:00:49
757000 -- [-638.138] (-648.536) (-644.464) (-642.651) * (-637.190) [-644.702] (-638.012) (-640.170) -- 0:00:49
757500 -- [-638.540] (-647.250) (-648.261) (-644.123) * (-643.088) (-644.956) (-642.075) [-640.132] -- 0:00:49
758000 -- (-640.655) (-646.892) (-640.361) [-640.671] * (-644.444) (-646.222) (-640.307) [-640.894] -- 0:00:49
758500 -- (-637.626) (-645.422) (-637.841) [-635.283] * [-638.708] (-645.794) (-637.549) (-637.871) -- 0:00:49
759000 -- (-639.763) (-640.340) [-639.548] (-644.970) * (-649.466) [-640.085] (-638.005) (-638.371) -- 0:00:49
759500 -- (-645.791) (-643.382) [-640.294] (-633.370) * (-654.220) (-645.605) [-634.312] (-634.635) -- 0:00:49
760000 -- [-642.896] (-635.973) (-638.331) (-636.823) * (-641.628) [-642.491] (-642.005) (-640.833) -- 0:00:48
Average standard deviation of split frequencies: 0.010604
760500 -- (-645.231) (-640.706) (-645.809) [-634.234] * (-645.521) (-643.284) (-649.297) [-639.410] -- 0:00:48
761000 -- (-638.350) (-638.920) [-637.887] (-642.151) * [-641.769] (-645.424) (-638.866) (-638.200) -- 0:00:48
761500 -- [-644.154] (-640.684) (-648.641) (-644.131) * (-639.080) (-641.716) (-638.998) [-640.055] -- 0:00:48
762000 -- (-644.140) [-644.628] (-639.313) (-647.195) * (-645.662) (-647.469) (-640.865) [-645.052] -- 0:00:48
762500 -- (-649.115) [-642.464] (-640.977) (-642.210) * [-635.671] (-646.501) (-641.710) (-652.561) -- 0:00:48
763000 -- (-646.332) (-641.247) (-642.856) [-640.626] * (-645.084) (-647.377) [-635.100] (-645.117) -- 0:00:48
763500 -- (-645.419) (-641.322) [-643.615] (-644.919) * (-649.356) (-642.493) (-642.603) [-648.163] -- 0:00:48
764000 -- (-652.173) (-642.022) [-637.096] (-637.810) * (-645.049) [-635.941] (-649.543) (-651.510) -- 0:00:48
764500 -- (-638.777) [-638.294] (-640.821) (-642.686) * (-641.321) (-636.654) [-636.941] (-649.289) -- 0:00:48
765000 -- (-644.112) (-639.778) [-638.037] (-638.370) * (-638.179) (-638.495) [-638.523] (-646.104) -- 0:00:47
Average standard deviation of split frequencies: 0.010667
765500 -- (-649.182) [-644.836] (-636.161) (-644.436) * (-634.111) [-641.473] (-639.913) (-634.658) -- 0:00:47
766000 -- (-644.632) (-645.989) [-636.946] (-638.860) * (-645.184) (-651.259) [-640.092] (-638.199) -- 0:00:47
766500 -- (-638.582) [-645.215] (-640.819) (-656.677) * (-645.992) [-650.212] (-644.835) (-653.121) -- 0:00:47
767000 -- [-635.298] (-648.749) (-642.261) (-636.751) * (-646.689) (-655.548) [-639.084] (-636.706) -- 0:00:47
767500 -- [-638.211] (-645.144) (-647.177) (-643.502) * (-644.352) (-646.932) (-634.670) [-635.597] -- 0:00:47
768000 -- (-645.490) [-642.023] (-644.698) (-635.202) * (-644.760) (-637.956) (-641.625) [-636.651] -- 0:00:47
768500 -- (-643.706) (-649.989) (-645.131) [-633.925] * [-638.440] (-639.176) (-641.975) (-641.779) -- 0:00:47
769000 -- (-634.256) (-648.784) (-644.079) [-637.701] * (-641.944) (-642.834) [-635.601] (-644.181) -- 0:00:47
769500 -- (-645.089) (-638.564) [-639.909] (-647.345) * (-638.761) (-638.991) (-640.393) [-642.453] -- 0:00:47
770000 -- (-640.193) [-642.640] (-641.076) (-638.007) * [-641.763] (-643.961) (-640.840) (-644.098) -- 0:00:46
Average standard deviation of split frequencies: 0.010127
770500 -- [-644.666] (-639.671) (-644.017) (-639.103) * (-642.614) [-634.327] (-649.560) (-641.692) -- 0:00:46
771000 -- (-644.567) [-633.507] (-644.610) (-647.123) * (-643.275) (-644.244) (-638.642) [-638.560] -- 0:00:46
771500 -- (-646.393) (-642.346) [-639.995] (-639.734) * (-649.377) (-638.360) [-639.751] (-638.723) -- 0:00:46
772000 -- (-643.771) (-637.002) [-645.239] (-647.361) * (-643.789) [-643.854] (-641.618) (-638.876) -- 0:00:46
772500 -- (-637.993) [-638.045] (-637.361) (-638.288) * (-639.820) (-640.817) [-643.560] (-646.778) -- 0:00:46
773000 -- [-639.654] (-646.432) (-636.773) (-641.672) * [-642.683] (-641.820) (-643.988) (-634.545) -- 0:00:46
773500 -- [-639.863] (-646.328) (-643.286) (-647.794) * (-642.144) [-644.598] (-644.216) (-636.582) -- 0:00:46
774000 -- (-644.225) [-640.701] (-643.760) (-637.669) * (-644.931) [-642.064] (-636.643) (-637.424) -- 0:00:46
774500 -- (-642.807) (-638.949) [-634.495] (-637.522) * (-647.082) [-638.642] (-635.281) (-645.243) -- 0:00:46
775000 -- [-635.588] (-635.104) (-650.152) (-641.285) * [-644.106] (-648.034) (-638.232) (-643.723) -- 0:00:45
Average standard deviation of split frequencies: 0.010665
775500 -- (-634.147) (-655.814) [-638.531] (-646.405) * (-645.342) [-645.268] (-636.171) (-638.352) -- 0:00:45
776000 -- [-640.276] (-655.692) (-647.539) (-640.075) * (-638.126) (-637.989) (-642.807) [-635.638] -- 0:00:45
776500 -- (-649.216) (-639.945) [-637.406] (-639.191) * (-637.969) (-644.583) [-639.567] (-645.569) -- 0:00:45
777000 -- (-645.480) [-639.945] (-640.811) (-642.295) * [-645.214] (-644.289) (-637.607) (-641.788) -- 0:00:45
777500 -- (-635.315) [-640.766] (-635.062) (-642.796) * (-641.280) (-645.952) [-632.046] (-643.827) -- 0:00:45
778000 -- [-639.278] (-642.979) (-642.078) (-637.936) * (-643.124) [-637.889] (-640.680) (-636.448) -- 0:00:45
778500 -- [-636.504] (-637.609) (-642.405) (-636.013) * (-641.565) (-639.934) (-641.261) [-640.795] -- 0:00:45
779000 -- (-637.257) [-647.254] (-655.824) (-645.723) * (-641.839) [-639.625] (-642.674) (-638.086) -- 0:00:45
779500 -- [-639.683] (-647.830) (-651.764) (-637.434) * (-646.805) (-640.306) [-640.456] (-644.236) -- 0:00:44
780000 -- [-637.832] (-638.737) (-637.708) (-640.471) * (-642.088) [-643.472] (-637.859) (-644.904) -- 0:00:44
Average standard deviation of split frequencies: 0.010802
780500 -- (-640.652) (-640.490) (-639.064) [-640.346] * (-643.104) [-640.168] (-639.654) (-639.000) -- 0:00:44
781000 -- (-643.658) (-652.609) [-633.999] (-647.259) * (-650.338) (-645.460) [-643.309] (-640.723) -- 0:00:44
781500 -- [-639.618] (-637.399) (-642.589) (-644.589) * [-639.500] (-643.291) (-643.309) (-649.610) -- 0:00:44
782000 -- [-636.843] (-637.960) (-639.880) (-639.899) * (-656.310) (-646.442) (-644.281) [-642.848] -- 0:00:44
782500 -- (-644.585) (-635.851) (-640.833) [-636.614] * (-650.287) [-638.193] (-640.379) (-647.474) -- 0:00:44
783000 -- (-641.948) (-638.125) (-640.390) [-641.958] * [-637.997] (-639.854) (-645.315) (-639.305) -- 0:00:44
783500 -- (-645.155) [-637.027] (-639.090) (-640.224) * (-637.409) [-641.255] (-639.687) (-646.772) -- 0:00:44
784000 -- [-644.041] (-644.943) (-633.600) (-639.881) * (-651.543) (-639.154) (-637.877) [-639.001] -- 0:00:44
784500 -- (-651.780) (-636.709) [-638.992] (-642.023) * [-640.606] (-644.178) (-646.445) (-638.199) -- 0:00:43
785000 -- (-639.762) (-641.248) [-632.211] (-646.025) * (-646.274) [-638.094] (-642.395) (-653.767) -- 0:00:43
Average standard deviation of split frequencies: 0.011062
785500 -- (-634.217) (-639.067) [-641.973] (-642.925) * (-638.231) (-636.080) [-644.629] (-639.555) -- 0:00:43
786000 -- [-635.846] (-642.141) (-640.850) (-637.468) * (-651.211) [-639.817] (-643.878) (-639.696) -- 0:00:43
786500 -- (-645.622) (-641.574) [-638.283] (-640.353) * [-646.856] (-647.271) (-640.401) (-640.335) -- 0:00:43
787000 -- (-638.862) [-638.478] (-643.762) (-646.002) * (-644.645) (-642.703) (-642.787) [-640.951] -- 0:00:43
787500 -- [-641.645] (-640.056) (-641.451) (-642.591) * (-654.019) (-642.334) [-642.517] (-648.253) -- 0:00:43
788000 -- (-643.145) (-643.155) (-640.261) [-640.751] * (-641.465) (-638.934) (-636.929) [-639.732] -- 0:00:43
788500 -- (-648.073) (-646.952) [-643.203] (-648.864) * (-645.185) (-638.898) [-634.872] (-645.349) -- 0:00:43
789000 -- (-643.532) (-643.083) [-638.595] (-647.697) * (-653.347) (-642.323) [-638.815] (-641.671) -- 0:00:43
789500 -- (-650.180) (-638.260) [-642.474] (-639.358) * (-639.021) (-636.419) [-634.997] (-649.621) -- 0:00:42
790000 -- (-638.379) [-634.197] (-639.027) (-641.770) * (-643.505) [-641.602] (-636.068) (-643.523) -- 0:00:42
Average standard deviation of split frequencies: 0.011063
790500 -- [-644.077] (-643.403) (-637.058) (-645.133) * (-635.896) (-642.312) [-639.229] (-638.643) -- 0:00:42
791000 -- (-643.852) (-638.672) [-636.293] (-646.550) * (-640.193) (-637.776) (-642.815) [-638.989] -- 0:00:42
791500 -- (-643.625) (-637.646) (-638.041) [-637.841] * (-648.121) (-635.403) (-638.471) [-640.627] -- 0:00:42
792000 -- (-639.710) (-637.315) [-636.884] (-640.967) * (-645.365) [-640.686] (-644.244) (-641.176) -- 0:00:42
792500 -- (-647.281) (-644.232) [-635.309] (-638.370) * (-648.379) (-639.828) (-643.985) [-641.101] -- 0:00:42
793000 -- (-640.331) (-647.772) (-644.435) [-635.578] * (-639.695) (-642.410) [-642.595] (-640.042) -- 0:00:42
793500 -- (-643.423) (-661.199) [-640.927] (-638.996) * (-636.817) [-643.717] (-640.834) (-638.020) -- 0:00:42
794000 -- (-648.459) (-645.771) (-658.364) [-639.707] * (-644.105) (-646.437) (-642.578) [-636.645] -- 0:00:42
794500 -- (-640.335) (-639.644) (-641.450) [-636.998] * (-636.110) (-651.043) [-642.455] (-636.524) -- 0:00:41
795000 -- (-642.204) [-639.461] (-643.965) (-644.911) * (-636.608) (-639.959) [-645.872] (-642.811) -- 0:00:41
Average standard deviation of split frequencies: 0.010857
795500 -- (-637.804) [-638.497] (-643.733) (-647.631) * [-637.983] (-648.340) (-640.334) (-640.680) -- 0:00:41
796000 -- (-642.299) (-650.198) [-642.195] (-640.850) * [-639.691] (-650.022) (-640.062) (-641.388) -- 0:00:41
796500 -- (-635.847) (-645.495) [-638.931] (-651.110) * (-643.086) (-644.798) [-636.694] (-642.896) -- 0:00:41
797000 -- [-639.342] (-639.615) (-637.701) (-643.681) * [-638.051] (-656.533) (-641.928) (-640.896) -- 0:00:41
797500 -- (-640.970) (-640.792) (-637.620) [-639.935] * (-648.766) [-641.496] (-646.461) (-636.963) -- 0:00:41
798000 -- (-638.815) (-638.962) [-639.851] (-637.958) * (-647.891) (-644.557) (-645.935) [-648.964] -- 0:00:41
798500 -- (-639.055) (-645.168) (-639.797) [-641.253] * (-645.702) (-642.245) [-644.902] (-642.896) -- 0:00:41
799000 -- (-642.825) (-647.091) (-640.534) [-636.492] * [-639.530] (-644.192) (-650.240) (-639.103) -- 0:00:41
799500 -- (-645.346) (-642.639) [-634.785] (-637.281) * (-641.388) (-640.098) [-640.625] (-644.492) -- 0:00:40
800000 -- (-642.905) [-640.414] (-645.316) (-636.300) * [-643.512] (-646.507) (-638.363) (-634.232) -- 0:00:40
Average standard deviation of split frequencies: 0.010925
800500 -- [-637.378] (-642.354) (-639.196) (-642.241) * (-647.174) (-643.577) (-640.556) [-638.846] -- 0:00:40
801000 -- (-638.197) (-636.162) (-637.119) [-639.045] * (-647.465) [-642.591] (-646.639) (-640.202) -- 0:00:40
801500 -- [-636.694] (-639.584) (-642.047) (-642.538) * (-647.134) (-640.811) [-638.154] (-649.861) -- 0:00:40
802000 -- (-645.040) (-644.551) [-639.357] (-646.268) * (-644.491) (-650.606) [-632.963] (-646.072) -- 0:00:40
802500 -- (-640.335) (-643.800) [-638.335] (-643.985) * (-642.511) (-644.095) [-641.275] (-652.049) -- 0:00:40
803000 -- (-646.250) [-638.655] (-643.413) (-648.175) * (-633.487) (-639.944) [-634.123] (-642.926) -- 0:00:40
803500 -- (-647.817) [-640.320] (-638.132) (-646.462) * [-634.962] (-633.205) (-643.259) (-650.255) -- 0:00:40
804000 -- (-639.614) (-640.343) (-645.962) [-639.510] * (-632.942) [-636.794] (-639.112) (-638.896) -- 0:00:39
804500 -- [-636.397] (-639.239) (-640.584) (-639.431) * (-633.612) [-639.472] (-639.521) (-636.557) -- 0:00:39
805000 -- (-641.413) [-633.494] (-634.502) (-645.697) * [-652.766] (-639.670) (-637.980) (-645.109) -- 0:00:39
Average standard deviation of split frequencies: 0.010463
805500 -- [-641.743] (-645.033) (-640.323) (-647.630) * (-642.053) (-637.316) [-643.542] (-643.463) -- 0:00:39
806000 -- (-639.998) [-646.420] (-643.221) (-646.025) * (-638.537) (-643.926) (-646.785) [-643.495] -- 0:00:39
806500 -- (-637.459) [-642.263] (-644.461) (-643.033) * (-648.946) (-648.715) (-645.421) [-642.129] -- 0:00:39
807000 -- (-647.405) (-638.918) [-644.203] (-639.369) * (-641.099) [-640.922] (-645.435) (-638.642) -- 0:00:39
807500 -- (-643.595) (-641.408) [-643.936] (-649.776) * (-643.921) (-640.633) [-638.043] (-645.429) -- 0:00:39
808000 -- [-644.671] (-646.907) (-642.833) (-639.933) * [-649.999] (-642.555) (-640.457) (-634.542) -- 0:00:39
808500 -- (-641.615) (-646.604) (-645.097) [-642.115] * (-643.465) (-652.868) [-640.365] (-645.036) -- 0:00:39
809000 -- (-638.107) [-642.931] (-641.553) (-644.602) * (-647.725) (-645.992) (-643.175) [-637.903] -- 0:00:38
809500 -- [-640.159] (-637.315) (-640.270) (-639.800) * (-642.035) [-635.528] (-637.141) (-636.161) -- 0:00:38
810000 -- (-644.515) (-642.481) [-639.341] (-645.994) * (-643.449) (-642.161) [-640.364] (-642.762) -- 0:00:38
Average standard deviation of split frequencies: 0.010402
810500 -- (-645.196) [-638.568] (-643.902) (-638.519) * (-644.846) (-653.690) (-639.736) [-640.497] -- 0:00:38
811000 -- [-651.222] (-640.315) (-641.094) (-644.706) * (-643.273) (-647.848) (-635.926) [-640.652] -- 0:00:38
811500 -- (-642.762) [-632.859] (-636.342) (-649.374) * [-638.042] (-636.293) (-633.901) (-640.831) -- 0:00:38
812000 -- (-644.110) (-638.885) [-634.587] (-642.090) * [-636.250] (-634.534) (-640.432) (-634.682) -- 0:00:38
812500 -- [-652.798] (-639.873) (-640.709) (-639.676) * (-640.255) (-645.549) [-644.009] (-643.238) -- 0:00:38
813000 -- (-645.073) [-634.047] (-639.153) (-644.665) * (-634.635) (-636.514) [-634.759] (-647.315) -- 0:00:38
813500 -- (-643.328) (-638.370) [-636.427] (-642.640) * [-644.429] (-642.209) (-638.093) (-644.845) -- 0:00:38
814000 -- [-647.611] (-643.022) (-640.362) (-645.992) * (-643.516) (-641.856) [-638.710] (-642.189) -- 0:00:37
814500 -- (-644.687) [-642.142] (-642.496) (-646.532) * (-638.818) (-643.697) (-641.244) [-641.594] -- 0:00:37
815000 -- (-641.621) (-641.502) [-639.918] (-636.989) * (-644.758) (-637.797) (-639.506) [-639.351] -- 0:00:37
Average standard deviation of split frequencies: 0.010591
815500 -- (-642.426) [-638.466] (-637.097) (-642.226) * (-645.256) (-640.081) (-634.670) [-637.686] -- 0:00:37
816000 -- (-649.472) [-641.456] (-639.668) (-641.665) * [-634.070] (-640.696) (-638.067) (-645.142) -- 0:00:37
816500 -- (-644.732) (-651.981) [-636.405] (-642.934) * (-638.324) (-640.236) [-639.996] (-638.548) -- 0:00:37
817000 -- (-641.406) (-650.527) (-644.838) [-643.895] * (-644.414) (-642.407) (-645.938) [-635.783] -- 0:00:37
817500 -- (-652.744) (-645.167) [-636.992] (-637.269) * (-644.244) [-642.149] (-637.936) (-641.470) -- 0:00:37
818000 -- (-645.605) [-642.404] (-643.886) (-641.715) * (-641.667) (-638.333) [-639.916] (-651.296) -- 0:00:37
818500 -- (-648.188) (-637.463) [-634.391] (-642.263) * (-639.945) (-638.309) [-636.690] (-641.286) -- 0:00:37
819000 -- (-638.416) (-642.282) [-637.315] (-641.991) * (-643.529) (-637.106) [-641.139] (-641.273) -- 0:00:36
819500 -- (-647.598) (-637.447) [-636.652] (-638.499) * (-644.341) (-642.487) (-643.170) [-642.037] -- 0:00:36
820000 -- (-638.972) [-644.920] (-644.702) (-642.668) * (-641.853) (-642.561) [-637.744] (-642.009) -- 0:00:36
Average standard deviation of split frequencies: 0.010722
820500 -- (-646.735) [-640.596] (-645.940) (-644.438) * (-643.426) [-641.783] (-644.703) (-643.860) -- 0:00:36
821000 -- (-638.565) (-640.906) (-639.401) [-643.293] * [-649.531] (-640.998) (-647.277) (-643.622) -- 0:00:36
821500 -- (-639.360) (-637.948) (-643.361) [-638.760] * (-648.299) (-652.593) [-644.392] (-640.265) -- 0:00:36
822000 -- (-640.664) (-639.451) (-645.040) [-636.303] * (-635.842) (-631.248) (-647.959) [-637.364] -- 0:00:36
822500 -- [-640.451] (-636.581) (-643.164) (-636.912) * (-646.601) (-633.551) (-649.891) [-640.589] -- 0:00:36
823000 -- [-643.714] (-643.030) (-646.549) (-641.815) * (-641.715) (-636.949) (-641.538) [-643.171] -- 0:00:36
823500 -- [-642.683] (-636.587) (-638.685) (-636.560) * (-637.709) (-636.730) (-637.459) [-641.157] -- 0:00:36
824000 -- (-640.603) (-645.819) [-634.425] (-634.822) * [-637.196] (-638.072) (-638.545) (-637.363) -- 0:00:35
824500 -- (-643.642) [-640.468] (-638.568) (-646.456) * (-641.651) [-642.025] (-638.027) (-634.544) -- 0:00:35
825000 -- (-645.229) (-645.530) [-642.590] (-641.508) * (-639.406) [-638.798] (-647.367) (-637.068) -- 0:00:35
Average standard deviation of split frequencies: 0.009531
825500 -- [-636.163] (-649.575) (-640.571) (-637.926) * [-634.545] (-647.185) (-640.519) (-641.634) -- 0:00:35
826000 -- [-637.532] (-641.150) (-638.777) (-637.306) * (-640.029) (-642.278) (-642.148) [-641.967] -- 0:00:35
826500 -- (-641.720) [-637.213] (-640.013) (-638.590) * (-639.980) [-638.712] (-639.810) (-636.148) -- 0:00:35
827000 -- (-642.141) (-641.952) (-642.390) [-637.816] * (-641.723) (-639.092) [-636.825] (-641.862) -- 0:00:35
827500 -- [-637.469] (-647.121) (-643.451) (-633.816) * (-640.351) [-645.777] (-641.974) (-640.748) -- 0:00:35
828000 -- (-636.745) (-634.531) (-639.967) [-639.748] * [-638.979] (-640.871) (-639.148) (-647.198) -- 0:00:35
828500 -- (-644.188) [-634.681] (-645.166) (-641.275) * (-638.326) (-638.597) (-636.441) [-644.723] -- 0:00:34
829000 -- (-641.317) (-640.657) [-637.663] (-639.494) * (-644.982) [-638.465] (-648.661) (-639.639) -- 0:00:34
829500 -- [-639.527] (-635.719) (-635.894) (-648.474) * (-641.644) [-632.201] (-642.066) (-639.012) -- 0:00:34
830000 -- [-641.372] (-641.195) (-637.598) (-648.482) * (-645.765) (-638.815) [-641.375] (-632.263) -- 0:00:34
Average standard deviation of split frequencies: 0.009818
830500 -- (-645.166) (-637.335) (-641.371) [-637.382] * (-641.605) (-639.087) [-636.960] (-643.501) -- 0:00:34
831000 -- (-649.295) [-639.048] (-644.833) (-641.283) * (-641.054) (-643.628) (-636.564) [-647.828] -- 0:00:34
831500 -- (-635.581) (-644.130) [-640.848] (-642.593) * (-635.293) (-639.732) [-638.548] (-642.748) -- 0:00:34
832000 -- (-638.967) (-640.300) (-646.868) [-637.773] * (-643.288) (-637.925) [-638.026] (-640.968) -- 0:00:34
832500 -- [-641.661] (-644.155) (-641.355) (-644.543) * (-650.040) (-638.727) (-638.642) [-636.447] -- 0:00:34
833000 -- [-638.034] (-634.448) (-639.272) (-641.283) * (-641.923) (-637.282) (-636.233) [-639.301] -- 0:00:34
833500 -- [-639.395] (-642.731) (-642.851) (-643.444) * (-643.144) (-640.710) (-637.924) [-638.070] -- 0:00:33
834000 -- (-641.035) (-640.386) (-646.591) [-636.997] * (-639.658) (-647.909) [-638.229] (-635.984) -- 0:00:33
834500 -- (-639.559) [-645.196] (-640.772) (-653.665) * (-637.254) (-641.190) [-632.698] (-639.139) -- 0:00:33
835000 -- [-639.898] (-640.737) (-649.085) (-652.425) * [-634.594] (-640.802) (-636.307) (-635.363) -- 0:00:33
Average standard deviation of split frequencies: 0.010037
835500 -- [-645.504] (-638.910) (-646.688) (-648.875) * (-638.829) (-637.181) (-642.709) [-642.700] -- 0:00:33
836000 -- (-637.611) [-640.878] (-641.921) (-651.202) * [-637.277] (-648.964) (-635.981) (-639.133) -- 0:00:33
836500 -- (-643.858) [-641.724] (-639.598) (-645.799) * (-651.254) (-645.404) (-642.368) [-641.944] -- 0:00:33
837000 -- (-642.980) (-642.011) [-642.593] (-641.562) * (-641.848) (-642.210) (-643.002) [-637.169] -- 0:00:33
837500 -- (-644.514) (-639.161) [-643.592] (-640.194) * (-645.462) (-647.983) (-642.913) [-640.655] -- 0:00:33
838000 -- (-637.229) (-641.081) (-638.961) [-644.788] * [-638.990] (-638.422) (-639.718) (-637.934) -- 0:00:33
838500 -- [-644.255] (-640.107) (-642.347) (-641.791) * (-638.661) (-638.944) [-641.971] (-640.327) -- 0:00:32
839000 -- (-633.535) (-642.606) (-632.568) [-641.128] * [-638.881] (-640.817) (-646.174) (-638.051) -- 0:00:32
839500 -- (-638.439) (-642.099) [-635.622] (-639.439) * (-643.887) (-647.944) (-645.308) [-646.606] -- 0:00:32
840000 -- (-642.493) [-635.406] (-636.466) (-641.492) * (-640.141) (-638.457) [-637.826] (-642.336) -- 0:00:32
Average standard deviation of split frequencies: 0.010318
840500 -- (-640.344) (-643.558) (-634.575) [-639.844] * (-638.073) [-637.836] (-647.634) (-651.375) -- 0:00:32
841000 -- (-635.431) (-642.507) [-636.251] (-649.579) * [-636.046] (-635.847) (-646.986) (-646.192) -- 0:00:32
841500 -- (-641.052) (-644.421) [-636.760] (-647.399) * (-645.171) [-639.673] (-641.599) (-641.104) -- 0:00:32
842000 -- (-636.991) (-643.309) (-640.855) [-642.998] * (-638.371) [-639.168] (-647.813) (-637.031) -- 0:00:32
842500 -- (-646.654) [-645.447] (-646.337) (-646.034) * (-646.784) [-642.781] (-648.039) (-640.678) -- 0:00:32
843000 -- (-644.519) (-641.942) (-649.429) [-638.200] * (-643.021) (-640.381) (-641.318) [-641.869] -- 0:00:32
843500 -- (-644.795) (-644.768) (-641.382) [-641.304] * (-635.414) [-636.410] (-651.123) (-646.680) -- 0:00:31
844000 -- (-639.395) (-644.561) [-634.879] (-641.606) * (-641.354) (-642.700) (-641.463) [-643.333] -- 0:00:31
844500 -- [-640.380] (-644.423) (-645.576) (-641.267) * (-635.376) (-644.614) [-638.379] (-646.154) -- 0:00:31
845000 -- (-646.595) (-633.358) (-637.319) [-650.977] * (-639.640) [-637.209] (-641.390) (-637.377) -- 0:00:31
Average standard deviation of split frequencies: 0.010030
845500 -- [-633.864] (-633.973) (-636.538) (-646.565) * (-643.160) [-638.021] (-639.796) (-645.531) -- 0:00:31
846000 -- (-638.826) [-645.606] (-646.443) (-643.460) * (-636.997) [-641.762] (-647.882) (-639.877) -- 0:00:31
846500 -- (-638.298) [-638.608] (-638.796) (-642.649) * (-640.779) (-641.107) (-636.697) [-642.871] -- 0:00:31
847000 -- (-643.849) (-645.112) (-645.225) [-638.559] * [-642.323] (-643.393) (-643.361) (-643.078) -- 0:00:31
847500 -- (-643.446) (-647.265) (-639.514) [-638.473] * (-639.417) (-646.371) (-654.854) [-637.611] -- 0:00:31
848000 -- (-637.842) (-636.737) [-642.556] (-638.307) * [-642.153] (-643.308) (-647.318) (-644.233) -- 0:00:31
848500 -- (-638.443) [-640.767] (-637.946) (-639.715) * (-641.367) (-639.905) [-636.415] (-643.242) -- 0:00:30
849000 -- [-642.270] (-643.694) (-641.183) (-637.870) * [-640.073] (-639.240) (-643.369) (-645.211) -- 0:00:30
849500 -- (-644.139) (-640.516) [-636.237] (-643.157) * [-642.194] (-641.651) (-646.546) (-640.241) -- 0:00:30
850000 -- (-642.735) (-638.444) (-637.452) [-636.468] * (-638.907) (-645.266) [-643.963] (-646.110) -- 0:00:30
Average standard deviation of split frequencies: 0.011083
850500 -- (-642.265) (-643.678) (-643.034) [-634.256] * (-639.464) (-638.778) (-634.423) [-645.259] -- 0:00:30
851000 -- (-645.813) [-643.940] (-645.536) (-639.752) * (-650.289) (-642.181) (-648.110) [-638.103] -- 0:00:30
851500 -- [-639.850] (-644.395) (-642.709) (-641.314) * (-641.711) [-642.353] (-643.624) (-636.316) -- 0:00:30
852000 -- (-643.446) [-635.410] (-648.616) (-641.531) * (-639.486) (-649.924) (-640.769) [-641.246] -- 0:00:30
852500 -- (-643.855) (-642.046) [-640.604] (-640.984) * (-638.514) [-637.828] (-634.514) (-634.793) -- 0:00:30
853000 -- (-642.180) (-634.152) [-640.355] (-643.751) * (-643.242) [-638.505] (-657.648) (-643.281) -- 0:00:29
853500 -- (-640.001) (-639.694) (-632.429) [-643.544] * (-644.963) [-640.121] (-636.201) (-649.512) -- 0:00:29
854000 -- [-646.023] (-638.992) (-636.311) (-640.715) * (-643.294) (-648.133) [-639.484] (-635.470) -- 0:00:29
854500 -- (-639.362) [-636.752] (-642.715) (-637.360) * (-645.038) (-637.765) (-643.054) [-636.518] -- 0:00:29
855000 -- (-637.022) (-644.830) [-639.053] (-645.008) * (-640.938) (-640.363) [-641.901] (-645.111) -- 0:00:29
Average standard deviation of split frequencies: 0.010892
855500 -- [-635.170] (-652.516) (-640.063) (-643.852) * [-638.737] (-639.745) (-640.156) (-637.795) -- 0:00:29
856000 -- (-643.541) (-636.828) (-645.688) [-639.557] * (-640.156) [-640.921] (-642.377) (-636.512) -- 0:00:29
856500 -- (-640.508) [-641.052] (-638.440) (-638.554) * (-644.472) (-638.619) [-647.072] (-640.328) -- 0:00:29
857000 -- [-636.020] (-641.633) (-647.766) (-645.471) * (-638.279) (-642.188) [-642.220] (-635.997) -- 0:00:29
857500 -- [-640.053] (-641.138) (-642.355) (-638.436) * [-650.083] (-643.124) (-645.959) (-635.784) -- 0:00:29
858000 -- (-642.578) (-638.965) (-644.581) [-639.998] * (-644.227) [-637.915] (-639.454) (-644.908) -- 0:00:28
858500 -- (-642.670) (-634.286) (-636.651) [-640.211] * [-637.644] (-646.108) (-640.170) (-637.919) -- 0:00:28
859000 -- [-638.911] (-639.833) (-636.872) (-645.831) * (-640.024) (-636.777) [-639.078] (-639.162) -- 0:00:28
859500 -- [-638.107] (-646.730) (-646.790) (-644.963) * (-641.401) (-641.518) [-638.684] (-640.426) -- 0:00:28
860000 -- (-646.334) (-637.526) (-640.170) [-648.012] * (-638.329) (-637.697) [-641.243] (-642.944) -- 0:00:28
Average standard deviation of split frequencies: 0.011076
860500 -- [-638.116] (-639.007) (-640.038) (-641.288) * (-634.882) (-647.264) [-637.826] (-639.602) -- 0:00:28
861000 -- (-641.203) (-637.116) [-639.913] (-642.262) * [-638.687] (-635.801) (-641.439) (-641.258) -- 0:00:28
861500 -- (-645.138) (-640.284) [-637.764] (-637.392) * [-640.100] (-643.381) (-652.379) (-648.958) -- 0:00:28
862000 -- (-648.147) [-637.530] (-642.572) (-644.516) * (-648.895) [-639.267] (-643.591) (-641.250) -- 0:00:28
862500 -- (-638.495) (-640.249) (-636.832) [-643.021] * (-642.162) (-645.792) [-646.583] (-641.705) -- 0:00:28
863000 -- (-642.481) [-637.607] (-648.439) (-644.918) * (-646.211) [-639.913] (-641.703) (-639.329) -- 0:00:27
863500 -- (-637.023) [-639.691] (-641.765) (-637.632) * (-637.444) [-639.539] (-635.769) (-640.257) -- 0:00:27
864000 -- (-639.129) (-642.426) (-644.512) [-647.687] * (-640.520) (-644.026) [-641.191] (-641.159) -- 0:00:27
864500 -- (-646.194) [-640.155] (-643.002) (-638.655) * (-642.406) [-638.989] (-642.688) (-643.514) -- 0:00:27
865000 -- [-637.373] (-646.934) (-643.528) (-640.658) * (-646.781) (-636.742) [-641.300] (-646.642) -- 0:00:27
Average standard deviation of split frequencies: 0.011189
865500 -- (-640.118) (-646.783) [-638.475] (-641.860) * (-649.994) (-642.689) (-642.096) [-641.173] -- 0:00:27
866000 -- (-635.142) (-642.704) (-643.944) [-638.451] * (-639.529) (-635.561) (-639.467) [-645.503] -- 0:00:27
866500 -- (-636.234) (-639.599) (-637.245) [-638.803] * [-646.448] (-638.434) (-646.930) (-649.537) -- 0:00:27
867000 -- (-642.762) [-635.956] (-638.791) (-641.889) * (-646.986) [-638.733] (-644.766) (-648.771) -- 0:00:27
867500 -- (-644.857) (-646.760) (-636.385) [-646.405] * (-642.527) (-637.302) (-648.171) [-645.517] -- 0:00:27
868000 -- (-645.196) (-639.012) [-638.276] (-654.142) * [-638.746] (-637.305) (-635.573) (-644.093) -- 0:00:26
868500 -- (-639.854) [-634.301] (-646.467) (-642.045) * (-640.158) [-637.908] (-643.715) (-640.214) -- 0:00:26
869000 -- (-639.558) [-634.939] (-640.969) (-642.904) * (-641.014) (-632.996) [-638.518] (-642.911) -- 0:00:26
869500 -- (-640.396) [-636.636] (-639.346) (-637.626) * (-640.292) [-639.957] (-645.513) (-638.353) -- 0:00:26
870000 -- (-636.619) (-645.578) (-641.652) [-638.259] * (-656.138) [-641.269] (-647.620) (-638.379) -- 0:00:26
Average standard deviation of split frequencies: 0.011430
870500 -- (-648.115) [-637.902] (-636.395) (-646.904) * (-638.615) [-637.133] (-646.808) (-639.193) -- 0:00:26
871000 -- (-644.684) (-640.514) [-636.601] (-642.745) * (-646.498) (-644.133) (-641.606) [-642.375] -- 0:00:26
871500 -- (-640.872) (-638.249) [-638.193] (-639.279) * [-644.125] (-642.335) (-648.186) (-637.819) -- 0:00:26
872000 -- [-643.782] (-643.652) (-642.084) (-637.222) * [-644.242] (-636.732) (-637.400) (-636.851) -- 0:00:26
872500 -- [-644.902] (-640.313) (-636.535) (-640.956) * [-646.570] (-640.661) (-641.443) (-636.388) -- 0:00:26
873000 -- (-642.665) (-638.111) [-638.507] (-638.275) * (-647.615) [-638.782] (-644.575) (-640.958) -- 0:00:25
873500 -- (-641.649) (-640.042) [-639.149] (-640.961) * (-646.129) [-641.860] (-640.414) (-646.101) -- 0:00:25
874000 -- (-641.306) [-644.376] (-641.267) (-637.660) * (-644.165) [-640.676] (-639.820) (-640.857) -- 0:00:25
874500 -- (-646.886) (-638.965) (-636.599) [-638.743] * (-635.949) [-636.882] (-643.933) (-643.094) -- 0:00:25
875000 -- (-634.070) [-640.276] (-642.175) (-639.358) * (-640.621) (-644.201) (-639.977) [-642.032] -- 0:00:25
Average standard deviation of split frequencies: 0.010942
875500 -- [-640.533] (-641.063) (-637.163) (-642.182) * (-639.680) (-648.360) (-639.126) [-636.724] -- 0:00:25
876000 -- [-635.714] (-636.036) (-645.091) (-645.085) * [-643.967] (-639.829) (-641.348) (-642.495) -- 0:00:25
876500 -- [-640.328] (-638.023) (-642.778) (-637.849) * (-642.317) (-636.893) [-641.668] (-641.059) -- 0:00:25
877000 -- (-639.661) [-635.083] (-636.085) (-641.120) * (-646.992) (-639.412) [-646.208] (-647.219) -- 0:00:25
877500 -- [-642.272] (-638.601) (-636.715) (-639.907) * (-643.244) [-637.161] (-648.850) (-640.568) -- 0:00:24
878000 -- [-639.939] (-645.214) (-641.608) (-638.886) * (-639.747) (-640.455) [-642.213] (-643.890) -- 0:00:24
878500 -- (-642.746) (-639.893) (-641.444) [-642.359] * [-639.024] (-641.756) (-640.120) (-638.557) -- 0:00:24
879000 -- (-649.299) (-640.499) [-645.424] (-642.092) * (-637.966) (-647.316) [-637.792] (-642.345) -- 0:00:24
879500 -- [-636.955] (-639.659) (-648.051) (-645.934) * [-643.453] (-642.480) (-636.214) (-642.692) -- 0:00:24
880000 -- (-637.174) (-645.389) [-641.783] (-637.780) * (-643.161) (-646.771) (-640.872) [-642.641] -- 0:00:24
Average standard deviation of split frequencies: 0.010944
880500 -- (-641.729) [-636.672] (-647.012) (-643.810) * (-647.048) (-640.903) [-637.548] (-635.135) -- 0:00:24
881000 -- (-642.884) (-645.354) (-646.052) [-636.215] * (-645.808) (-644.963) (-637.092) [-644.180] -- 0:00:24
881500 -- (-638.328) (-645.533) (-643.279) [-635.223] * (-642.435) [-636.801] (-647.199) (-648.829) -- 0:00:24
882000 -- [-641.729] (-640.108) (-646.050) (-638.678) * [-637.486] (-643.052) (-640.235) (-644.909) -- 0:00:24
882500 -- (-641.612) [-638.316] (-650.892) (-644.349) * [-641.172] (-640.113) (-640.903) (-648.360) -- 0:00:23
883000 -- (-640.748) [-636.311] (-646.258) (-645.243) * (-647.527) [-636.403] (-639.786) (-645.402) -- 0:00:23
883500 -- (-641.351) (-644.033) (-644.417) [-640.994] * (-648.771) [-634.019] (-646.268) (-639.070) -- 0:00:23
884000 -- (-642.704) (-640.439) (-644.940) [-638.660] * (-642.903) (-646.095) (-642.419) [-641.491] -- 0:00:23
884500 -- [-636.933] (-643.419) (-650.326) (-641.725) * [-637.619] (-647.022) (-648.749) (-650.134) -- 0:00:23
885000 -- (-646.779) [-645.039] (-642.423) (-640.262) * (-637.524) (-644.253) [-642.484] (-641.530) -- 0:00:23
Average standard deviation of split frequencies: 0.010109
885500 -- (-637.343) (-651.148) [-639.015] (-642.291) * [-639.465] (-640.721) (-647.294) (-641.633) -- 0:00:23
886000 -- [-638.964] (-640.204) (-653.722) (-638.061) * [-640.256] (-643.768) (-639.107) (-646.909) -- 0:00:23
886500 -- [-636.226] (-643.486) (-646.764) (-651.257) * (-636.362) (-641.470) (-639.749) [-644.244] -- 0:00:23
887000 -- [-639.225] (-650.129) (-641.954) (-643.644) * (-641.300) [-645.480] (-640.608) (-648.321) -- 0:00:23
887500 -- (-639.568) (-646.588) (-640.097) [-642.666] * (-640.985) [-642.778] (-641.444) (-634.855) -- 0:00:22
888000 -- (-640.992) (-643.174) (-639.791) [-647.077] * (-644.787) [-639.253] (-640.109) (-636.552) -- 0:00:22
888500 -- (-642.881) (-639.514) [-639.593] (-646.404) * (-639.597) [-632.309] (-638.234) (-643.154) -- 0:00:22
889000 -- (-634.698) [-640.658] (-634.656) (-640.727) * (-640.302) (-643.431) (-643.265) [-636.007] -- 0:00:22
889500 -- [-636.759] (-633.577) (-641.746) (-644.033) * (-646.040) (-645.096) [-638.487] (-636.285) -- 0:00:22
890000 -- (-638.741) (-636.935) (-638.739) [-636.125] * (-641.585) [-644.776] (-637.209) (-642.617) -- 0:00:22
Average standard deviation of split frequencies: 0.010585
890500 -- [-635.827] (-642.539) (-644.705) (-646.600) * (-641.788) (-649.343) (-646.421) [-636.709] -- 0:00:22
891000 -- (-643.106) [-635.622] (-635.512) (-641.560) * (-636.245) (-645.517) [-641.855] (-638.850) -- 0:00:22
891500 -- [-635.735] (-636.956) (-643.855) (-644.113) * [-636.706] (-637.146) (-645.897) (-646.475) -- 0:00:22
892000 -- (-649.460) [-637.312] (-635.908) (-643.419) * [-639.302] (-638.881) (-650.691) (-648.575) -- 0:00:22
892500 -- (-645.927) (-639.224) [-640.981] (-633.576) * (-642.942) [-639.792] (-642.149) (-638.579) -- 0:00:21
893000 -- (-640.256) (-645.442) [-640.002] (-646.016) * (-648.279) [-639.198] (-638.602) (-637.996) -- 0:00:21
893500 -- [-642.072] (-649.592) (-646.777) (-638.269) * (-636.684) (-640.668) [-637.854] (-641.160) -- 0:00:21
894000 -- (-637.909) (-647.194) [-642.535] (-648.732) * (-644.007) (-642.423) [-636.622] (-640.522) -- 0:00:21
894500 -- (-640.439) (-643.734) [-642.019] (-648.173) * [-641.054] (-641.749) (-638.463) (-643.568) -- 0:00:21
895000 -- (-647.356) [-641.459] (-642.851) (-640.602) * (-645.622) [-642.619] (-644.282) (-641.323) -- 0:00:21
Average standard deviation of split frequencies: 0.010470
895500 -- (-641.354) (-647.210) (-640.969) [-643.399] * (-637.994) (-642.123) [-644.555] (-640.067) -- 0:00:21
896000 -- (-637.325) [-635.034] (-638.078) (-637.504) * (-639.815) (-638.985) [-636.322] (-638.412) -- 0:00:21
896500 -- (-642.476) [-639.114] (-639.874) (-640.051) * (-642.085) (-639.311) [-648.153] (-639.163) -- 0:00:21
897000 -- (-642.187) (-647.037) [-640.657] (-644.240) * (-647.852) [-639.003] (-640.993) (-642.152) -- 0:00:21
897500 -- [-649.052] (-647.834) (-646.997) (-648.906) * (-656.006) (-640.410) (-643.141) [-634.388] -- 0:00:20
898000 -- [-639.748] (-646.087) (-637.999) (-642.985) * [-636.490] (-650.973) (-656.238) (-638.843) -- 0:00:20
898500 -- (-643.295) (-651.323) [-644.097] (-648.875) * (-641.885) [-643.578] (-643.856) (-634.733) -- 0:00:20
899000 -- (-644.814) (-641.720) [-640.616] (-648.246) * (-639.569) [-637.753] (-643.473) (-641.494) -- 0:00:20
899500 -- (-642.704) (-640.882) [-646.621] (-639.434) * [-636.465] (-649.098) (-645.812) (-639.064) -- 0:00:20
900000 -- (-641.284) (-645.210) [-638.962] (-647.954) * [-642.237] (-650.725) (-638.029) (-639.866) -- 0:00:20
Average standard deviation of split frequencies: 0.011224
900500 -- (-646.632) (-641.391) (-642.065) [-640.049] * (-639.607) (-652.401) [-645.390] (-644.694) -- 0:00:20
901000 -- [-634.402] (-639.269) (-644.885) (-639.604) * (-648.879) (-647.064) (-638.360) [-639.394] -- 0:00:20
901500 -- (-639.331) (-648.146) [-637.558] (-641.957) * (-646.452) (-648.851) [-647.581] (-648.235) -- 0:00:20
902000 -- (-641.816) [-637.641] (-639.057) (-641.998) * [-641.004] (-640.734) (-649.088) (-647.041) -- 0:00:19
902500 -- (-638.886) [-639.320] (-645.048) (-646.799) * [-644.792] (-639.797) (-652.607) (-638.778) -- 0:00:19
903000 -- (-642.303) [-640.796] (-638.169) (-644.953) * [-640.731] (-643.823) (-639.693) (-648.354) -- 0:00:19
903500 -- (-640.094) (-640.900) [-637.358] (-645.644) * (-640.093) (-636.930) (-641.694) [-640.521] -- 0:00:19
904000 -- (-644.553) (-641.553) [-642.736] (-640.256) * (-640.065) [-640.195] (-640.134) (-643.250) -- 0:00:19
904500 -- (-640.126) (-640.938) (-641.969) [-635.209] * (-643.841) (-636.449) (-647.802) [-637.613] -- 0:00:19
905000 -- (-635.946) [-642.307] (-653.214) (-650.864) * (-643.482) (-639.776) [-636.082] (-638.317) -- 0:00:19
Average standard deviation of split frequencies: 0.009730
905500 -- (-637.383) [-643.446] (-637.808) (-639.833) * (-646.135) (-645.425) (-636.942) [-643.292] -- 0:00:19
906000 -- (-636.696) (-643.235) (-642.767) [-634.058] * (-641.571) [-643.452] (-643.436) (-645.500) -- 0:00:19
906500 -- (-641.065) (-638.094) (-646.687) [-643.938] * (-646.532) (-638.361) (-639.398) [-642.493] -- 0:00:19
907000 -- [-633.510] (-644.160) (-637.588) (-639.685) * [-638.588] (-644.871) (-645.662) (-649.685) -- 0:00:18
907500 -- (-642.201) (-643.289) (-641.145) [-637.320] * (-642.063) (-639.691) (-642.791) [-642.370] -- 0:00:18
908000 -- [-634.025] (-648.063) (-637.792) (-636.892) * [-643.246] (-640.657) (-647.130) (-640.281) -- 0:00:18
908500 -- (-638.198) (-644.361) [-641.397] (-632.755) * (-644.604) [-641.394] (-641.925) (-639.347) -- 0:00:18
909000 -- [-641.739] (-644.638) (-643.102) (-637.252) * [-642.751] (-641.608) (-636.179) (-647.967) -- 0:00:18
909500 -- (-631.802) (-649.593) (-640.584) [-637.116] * (-642.969) [-641.933] (-636.642) (-637.809) -- 0:00:18
910000 -- [-646.840] (-649.113) (-637.676) (-641.627) * [-641.530] (-658.591) (-638.942) (-634.833) -- 0:00:18
Average standard deviation of split frequencies: 0.010583
910500 -- (-643.211) (-643.914) [-642.820] (-640.710) * (-640.004) (-645.984) (-639.080) [-636.429] -- 0:00:18
911000 -- (-641.524) (-642.945) [-638.180] (-642.911) * (-645.992) [-652.239] (-639.209) (-636.305) -- 0:00:18
911500 -- (-645.191) (-641.487) (-644.509) [-636.968] * (-637.451) (-647.634) (-634.046) [-643.353] -- 0:00:18
912000 -- (-648.579) (-639.928) [-636.446] (-638.899) * (-639.842) (-639.429) (-640.666) [-638.120] -- 0:00:17
912500 -- [-635.630] (-651.290) (-645.096) (-634.455) * [-638.529] (-641.189) (-638.679) (-638.626) -- 0:00:17
913000 -- [-640.965] (-640.176) (-647.722) (-641.718) * (-641.229) (-639.953) [-637.838] (-642.178) -- 0:00:17
913500 -- [-641.244] (-655.298) (-641.784) (-639.314) * (-639.752) (-645.856) (-637.807) [-641.867] -- 0:00:17
914000 -- (-641.419) (-647.168) (-642.460) [-638.214] * [-639.875] (-649.630) (-646.940) (-636.925) -- 0:00:17
914500 -- [-643.599] (-643.911) (-647.271) (-643.151) * (-637.668) (-655.910) (-639.929) [-636.743] -- 0:00:17
915000 -- [-635.238] (-641.249) (-649.178) (-649.966) * [-642.987] (-655.545) (-643.696) (-641.508) -- 0:00:17
Average standard deviation of split frequencies: 0.009892
915500 -- (-636.408) (-644.107) (-636.044) [-641.876] * (-639.932) (-639.460) [-643.140] (-636.143) -- 0:00:17
916000 -- (-645.584) (-640.705) [-638.317] (-639.077) * (-639.852) (-645.956) (-638.771) [-640.448] -- 0:00:17
916500 -- [-641.855] (-647.561) (-642.583) (-644.683) * (-640.735) (-640.111) [-634.356] (-641.394) -- 0:00:17
917000 -- (-636.353) [-634.384] (-639.675) (-647.329) * (-638.838) (-642.675) [-644.074] (-642.656) -- 0:00:16
917500 -- [-640.487] (-639.186) (-644.820) (-642.929) * (-641.127) [-637.403] (-644.515) (-637.963) -- 0:00:16
918000 -- (-637.086) (-643.255) [-634.313] (-640.110) * (-637.999) [-638.667] (-643.315) (-644.243) -- 0:00:16
918500 -- (-644.060) (-638.513) (-637.068) [-638.896] * (-637.882) (-639.689) [-641.461] (-638.161) -- 0:00:16
919000 -- (-639.753) [-640.077] (-643.877) (-644.828) * (-641.695) [-640.527] (-646.536) (-637.060) -- 0:00:16
919500 -- (-641.135) (-640.148) (-637.234) [-647.493] * (-642.441) (-642.010) [-637.407] (-645.876) -- 0:00:16
920000 -- (-640.851) [-637.225] (-643.084) (-647.000) * (-641.646) [-647.970] (-640.645) (-643.372) -- 0:00:16
Average standard deviation of split frequencies: 0.010013
920500 -- (-644.079) [-640.934] (-643.020) (-642.737) * (-638.134) (-641.943) [-634.184] (-641.905) -- 0:00:16
921000 -- [-636.868] (-637.074) (-640.527) (-642.033) * (-652.562) (-641.287) [-638.196] (-648.420) -- 0:00:16
921500 -- (-644.339) [-638.898] (-640.555) (-638.081) * (-642.096) (-642.000) (-639.139) [-637.299] -- 0:00:16
922000 -- (-648.934) (-640.291) [-634.244] (-650.047) * (-640.934) [-640.606] (-639.730) (-648.517) -- 0:00:15
922500 -- [-638.045] (-640.644) (-647.755) (-641.750) * (-644.462) [-637.204] (-641.564) (-642.330) -- 0:00:15
923000 -- (-647.028) [-641.177] (-646.219) (-639.451) * (-644.031) (-650.502) [-637.920] (-648.075) -- 0:00:15
923500 -- (-642.860) (-643.199) [-638.019] (-648.004) * (-644.012) (-646.269) (-638.598) [-648.133] -- 0:00:15
924000 -- (-643.616) (-639.425) (-641.077) [-640.696] * [-638.696] (-642.045) (-646.426) (-645.331) -- 0:00:15
924500 -- (-639.407) [-638.000] (-644.313) (-636.413) * [-635.960] (-639.401) (-638.937) (-642.413) -- 0:00:15
925000 -- (-635.529) [-639.792] (-643.829) (-637.150) * (-646.231) [-637.423] (-636.180) (-646.246) -- 0:00:15
Average standard deviation of split frequencies: 0.009899
925500 -- (-638.026) (-636.191) [-646.646] (-644.952) * (-645.131) (-636.194) [-638.660] (-644.282) -- 0:00:15
926000 -- [-636.244] (-634.580) (-644.824) (-639.763) * (-638.944) [-644.268] (-640.782) (-642.038) -- 0:00:15
926500 -- (-640.402) (-641.013) [-632.751] (-645.343) * (-638.325) (-637.829) [-638.494] (-641.078) -- 0:00:14
927000 -- (-645.670) (-645.238) [-637.380] (-649.008) * [-637.733] (-643.643) (-641.042) (-643.547) -- 0:00:14
927500 -- [-638.718] (-633.301) (-643.833) (-641.410) * (-643.589) (-643.552) [-642.542] (-637.690) -- 0:00:14
928000 -- (-642.252) [-648.131] (-644.553) (-647.023) * (-636.210) [-643.018] (-645.768) (-639.901) -- 0:00:14
928500 -- (-648.140) [-645.796] (-648.018) (-646.724) * (-642.009) (-639.923) (-645.892) [-636.646] -- 0:00:14
929000 -- (-637.694) (-645.890) (-638.521) [-634.503] * (-644.474) (-638.133) (-653.260) [-639.402] -- 0:00:14
929500 -- (-644.129) (-642.118) [-644.761] (-638.329) * (-647.084) (-640.725) (-649.048) [-638.166] -- 0:00:14
930000 -- (-643.312) (-650.012) [-645.418] (-642.625) * (-641.728) (-640.268) (-641.104) [-639.173] -- 0:00:14
Average standard deviation of split frequencies: 0.009962
930500 -- (-639.742) [-641.118] (-649.930) (-642.995) * (-643.073) [-640.929] (-647.224) (-640.614) -- 0:00:14
931000 -- (-640.227) [-636.866] (-640.195) (-647.289) * (-642.382) (-643.804) [-642.873] (-645.176) -- 0:00:14
931500 -- [-642.981] (-644.014) (-639.224) (-644.170) * (-632.009) [-642.730] (-636.696) (-646.647) -- 0:00:13
932000 -- (-641.907) (-640.902) [-639.275] (-649.728) * (-637.746) (-643.646) [-638.731] (-640.278) -- 0:00:13
932500 -- (-638.003) (-638.147) (-643.850) [-652.321] * (-641.363) (-644.900) [-648.471] (-644.890) -- 0:00:13
933000 -- (-637.143) [-637.057] (-638.608) (-647.642) * (-643.527) (-641.181) (-636.153) [-643.819] -- 0:00:13
933500 -- (-638.045) [-639.185] (-638.971) (-650.240) * [-643.188] (-646.847) (-638.720) (-641.364) -- 0:00:13
934000 -- [-636.888] (-637.386) (-642.210) (-646.484) * (-645.929) (-634.293) (-648.187) [-641.013] -- 0:00:13
934500 -- (-636.431) (-644.456) (-644.311) [-642.406] * [-643.838] (-634.945) (-645.611) (-642.360) -- 0:00:13
935000 -- (-640.599) [-638.230] (-647.960) (-642.832) * (-648.222) [-646.350] (-651.043) (-637.330) -- 0:00:13
Average standard deviation of split frequencies: 0.010520
935500 -- (-644.598) (-636.154) (-645.475) [-644.902] * (-648.162) (-652.441) [-645.471] (-639.536) -- 0:00:13
936000 -- [-638.752] (-637.159) (-643.720) (-645.814) * (-646.911) [-639.933] (-642.325) (-641.138) -- 0:00:13
936500 -- (-646.743) (-643.559) [-637.367] (-642.672) * (-648.712) (-641.206) [-637.756] (-640.940) -- 0:00:12
937000 -- [-640.605] (-652.786) (-641.098) (-640.703) * [-639.988] (-643.802) (-647.935) (-655.970) -- 0:00:12
937500 -- (-641.123) (-646.819) (-640.404) [-640.398] * (-637.199) (-637.300) [-635.298] (-648.931) -- 0:00:12
938000 -- (-638.793) (-641.066) (-639.701) [-641.803] * (-650.606) (-643.117) (-638.804) [-647.976] -- 0:00:12
938500 -- (-643.718) (-645.804) [-638.960] (-643.337) * (-640.995) [-640.226] (-637.747) (-638.918) -- 0:00:12
939000 -- (-639.433) (-644.647) [-638.054] (-642.829) * (-636.969) [-640.771] (-636.955) (-639.178) -- 0:00:12
939500 -- (-646.699) (-640.788) [-639.322] (-639.249) * [-640.012] (-646.024) (-638.731) (-637.439) -- 0:00:12
940000 -- (-648.549) (-636.072) [-639.325] (-644.280) * (-643.815) (-640.672) [-637.835] (-638.054) -- 0:00:12
Average standard deviation of split frequencies: 0.009271
940500 -- [-644.265] (-642.226) (-635.452) (-650.044) * (-634.117) (-642.028) [-635.371] (-648.588) -- 0:00:12
941000 -- (-639.989) (-639.849) [-645.977] (-647.572) * (-641.366) (-640.898) [-644.467] (-646.852) -- 0:00:12
941500 -- [-637.728] (-638.984) (-643.631) (-641.815) * (-646.407) (-642.855) [-636.687] (-648.648) -- 0:00:11
942000 -- (-641.061) [-642.744] (-643.391) (-636.547) * (-643.199) [-637.400] (-639.107) (-642.469) -- 0:00:11
942500 -- [-648.220] (-643.500) (-638.256) (-639.753) * (-635.950) (-639.947) (-642.295) [-638.856] -- 0:00:11
943000 -- (-643.693) [-635.665] (-642.513) (-636.405) * [-633.533] (-639.966) (-643.423) (-637.323) -- 0:00:11
943500 -- (-639.039) (-641.379) [-636.505] (-639.285) * (-651.197) (-642.099) (-657.874) [-640.817] -- 0:00:11
944000 -- (-639.933) [-641.998] (-642.917) (-639.007) * (-644.775) (-641.652) (-641.432) [-643.599] -- 0:00:11
944500 -- (-639.407) (-646.252) (-639.611) [-637.204] * (-642.464) (-640.901) [-639.929] (-642.552) -- 0:00:11
945000 -- (-647.064) (-645.411) (-645.524) [-647.163] * (-638.516) [-635.694] (-641.696) (-638.145) -- 0:00:11
Average standard deviation of split frequencies: 0.009318
945500 -- (-645.102) [-639.708] (-636.060) (-647.844) * (-642.304) (-639.390) (-638.222) [-638.140] -- 0:00:11
946000 -- (-638.291) (-648.160) [-636.127] (-641.482) * [-639.014] (-640.830) (-636.983) (-642.603) -- 0:00:11
946500 -- (-639.931) (-640.260) (-641.073) [-637.476] * (-642.333) (-638.888) (-647.211) [-638.175] -- 0:00:10
947000 -- (-645.699) (-640.725) (-647.414) [-634.895] * [-642.832] (-641.201) (-646.215) (-635.694) -- 0:00:10
947500 -- (-633.853) [-639.555] (-648.663) (-635.387) * (-641.638) (-641.029) (-639.120) [-640.389] -- 0:00:10
948000 -- (-637.203) [-642.797] (-639.507) (-640.183) * [-647.126] (-645.576) (-636.475) (-634.533) -- 0:00:10
948500 -- (-642.570) (-642.948) (-642.006) [-642.131] * (-643.072) (-648.212) [-635.123] (-646.042) -- 0:00:10
949000 -- (-639.608) [-639.557] (-639.812) (-636.447) * [-636.948] (-639.809) (-641.511) (-634.498) -- 0:00:10
949500 -- (-642.643) (-642.696) [-639.918] (-636.989) * (-642.922) (-642.782) (-643.718) [-647.364] -- 0:00:10
950000 -- (-643.089) [-638.385] (-652.141) (-641.316) * (-646.762) (-642.512) [-640.096] (-643.654) -- 0:00:10
Average standard deviation of split frequencies: 0.009273
950500 -- (-643.498) (-637.354) [-636.036] (-640.124) * (-647.212) (-647.338) (-648.146) [-640.435] -- 0:00:10
951000 -- (-640.857) (-638.623) [-639.900] (-642.395) * [-636.110] (-649.754) (-639.984) (-642.698) -- 0:00:09
951500 -- [-634.344] (-635.057) (-645.817) (-640.461) * (-639.472) (-647.815) [-634.924] (-639.245) -- 0:00:09
952000 -- [-648.742] (-642.409) (-638.612) (-640.466) * (-641.121) (-644.198) [-641.101] (-642.594) -- 0:00:09
952500 -- (-647.756) (-634.847) [-637.443] (-642.084) * (-647.436) (-645.542) (-642.413) [-641.527] -- 0:00:09
953000 -- (-641.353) [-646.170] (-636.527) (-644.269) * [-639.002] (-646.445) (-638.983) (-645.270) -- 0:00:09
953500 -- (-647.454) (-639.079) (-640.668) [-640.959] * [-639.825] (-647.513) (-640.434) (-639.806) -- 0:00:09
954000 -- (-642.349) (-641.974) [-641.085] (-639.419) * (-636.282) (-646.331) (-642.569) [-644.145] -- 0:00:09
954500 -- (-639.346) [-638.657] (-648.270) (-641.428) * [-641.291] (-647.610) (-640.819) (-643.359) -- 0:00:09
955000 -- [-638.843] (-636.840) (-642.773) (-643.869) * [-636.845] (-648.753) (-639.670) (-643.218) -- 0:00:09
Average standard deviation of split frequencies: 0.009024
955500 -- (-638.051) (-639.585) (-633.140) [-638.401] * (-638.696) (-639.932) [-640.426] (-637.626) -- 0:00:09
956000 -- (-639.971) (-641.386) (-646.635) [-635.886] * (-642.887) (-642.800) [-638.354] (-644.296) -- 0:00:08
956500 -- (-640.668) (-645.326) [-636.277] (-634.317) * (-644.295) (-641.549) (-640.117) [-642.986] -- 0:00:08
957000 -- (-639.870) (-648.886) (-638.537) [-638.690] * (-649.857) [-639.122] (-645.373) (-638.072) -- 0:00:08
957500 -- (-641.219) (-641.049) (-640.708) [-643.871] * (-645.474) [-640.040] (-647.290) (-643.612) -- 0:00:08
958000 -- (-636.906) (-647.677) (-637.909) [-639.986] * (-642.864) (-642.539) [-645.229] (-641.507) -- 0:00:08
958500 -- (-635.408) [-634.382] (-644.776) (-638.969) * (-640.721) [-638.878] (-644.057) (-643.298) -- 0:00:08
959000 -- (-639.010) [-639.277] (-648.183) (-643.617) * (-636.132) (-640.859) (-633.861) [-641.057] -- 0:00:08
959500 -- (-640.732) [-639.217] (-642.747) (-643.133) * [-642.703] (-636.014) (-641.741) (-644.507) -- 0:00:08
960000 -- [-643.502] (-638.379) (-635.655) (-647.591) * [-634.052] (-651.706) (-641.833) (-640.695) -- 0:00:08
Average standard deviation of split frequencies: 0.009372
960500 -- (-641.147) [-642.583] (-648.651) (-643.083) * [-637.058] (-636.391) (-637.782) (-643.489) -- 0:00:08
961000 -- (-637.054) [-636.916] (-652.643) (-644.841) * (-644.011) [-643.926] (-641.807) (-636.855) -- 0:00:07
961500 -- (-640.594) [-636.363] (-647.428) (-642.317) * (-639.508) (-646.078) (-644.696) [-637.914] -- 0:00:07
962000 -- (-644.460) [-635.322] (-637.696) (-647.271) * (-638.095) (-640.465) [-638.353] (-645.820) -- 0:00:07
962500 -- (-633.038) (-653.516) [-639.963] (-640.867) * (-639.228) [-639.667] (-646.770) (-649.797) -- 0:00:07
963000 -- (-637.988) (-647.383) [-646.213] (-639.572) * [-640.984] (-643.083) (-642.801) (-639.838) -- 0:00:07
963500 -- [-648.069] (-642.809) (-639.932) (-637.710) * (-641.453) [-642.691] (-637.383) (-634.697) -- 0:00:07
964000 -- (-642.092) (-639.131) [-641.601] (-640.082) * (-651.864) (-638.840) (-639.767) [-635.984] -- 0:00:07
964500 -- (-641.218) (-638.853) [-633.137] (-649.986) * (-647.947) (-642.313) (-636.402) [-641.218] -- 0:00:07
965000 -- (-644.096) (-642.639) (-640.045) [-643.375] * (-646.711) (-638.389) (-641.694) [-641.443] -- 0:00:07
Average standard deviation of split frequencies: 0.008930
965500 -- (-648.869) (-647.608) (-643.906) [-637.671] * (-645.198) (-641.113) (-636.427) [-635.938] -- 0:00:07
966000 -- (-643.426) (-646.637) (-637.163) [-641.840] * (-643.464) [-634.838] (-637.170) (-638.831) -- 0:00:06
966500 -- (-648.538) (-641.397) (-642.678) [-646.614] * (-642.426) (-649.745) [-636.936] (-638.542) -- 0:00:06
967000 -- (-642.596) (-636.368) [-636.396] (-641.854) * (-647.000) (-635.007) (-639.163) [-640.888] -- 0:00:06
967500 -- [-647.199] (-646.452) (-637.947) (-649.215) * [-640.197] (-642.573) (-649.013) (-646.339) -- 0:00:06
968000 -- (-643.339) (-641.416) [-636.075] (-641.621) * (-645.364) (-636.646) [-635.476] (-644.961) -- 0:00:06
968500 -- (-643.790) (-646.830) [-637.289] (-634.977) * (-646.584) (-641.671) (-646.555) [-645.796] -- 0:00:06
969000 -- [-643.610] (-644.821) (-634.238) (-641.873) * (-642.811) (-642.820) (-648.954) [-636.604] -- 0:00:06
969500 -- (-644.793) [-642.516] (-641.382) (-644.530) * (-637.971) [-639.366] (-642.604) (-635.361) -- 0:00:06
970000 -- [-643.876] (-649.885) (-642.648) (-641.654) * [-639.817] (-647.159) (-644.470) (-642.766) -- 0:00:06
Average standard deviation of split frequencies: 0.009324
970500 -- (-648.252) (-635.801) (-642.862) [-634.557] * (-639.179) (-650.653) (-650.955) [-639.737] -- 0:00:06
971000 -- (-647.972) (-644.710) (-636.377) [-642.631] * (-638.646) (-632.887) (-638.325) [-636.839] -- 0:00:05
971500 -- (-650.781) [-646.419] (-643.705) (-643.786) * (-639.516) (-646.429) (-644.863) [-632.842] -- 0:00:05
972000 -- (-645.528) [-643.173] (-642.774) (-648.839) * (-640.983) [-636.186] (-635.764) (-644.678) -- 0:00:05
972500 -- [-639.702] (-640.852) (-638.453) (-650.456) * (-638.402) (-643.324) (-638.091) [-641.829] -- 0:00:05
973000 -- (-644.234) (-643.388) [-636.594] (-650.428) * (-642.904) (-642.558) [-644.091] (-641.703) -- 0:00:05
973500 -- [-636.332] (-649.205) (-641.810) (-646.494) * (-639.140) (-637.445) [-638.690] (-648.502) -- 0:00:05
974000 -- (-640.968) (-640.309) [-638.963] (-650.740) * (-648.057) (-635.462) (-640.482) [-640.006] -- 0:00:05
974500 -- [-640.156] (-641.304) (-640.983) (-647.713) * (-643.495) [-640.318] (-643.940) (-650.657) -- 0:00:05
975000 -- [-638.304] (-647.935) (-636.980) (-639.863) * (-645.651) (-637.255) [-639.389] (-637.758) -- 0:00:05
Average standard deviation of split frequencies: 0.009515
975500 -- (-642.239) (-643.468) [-642.166] (-646.064) * (-640.606) [-642.367] (-638.637) (-653.447) -- 0:00:04
976000 -- (-645.940) (-645.319) [-635.579] (-649.343) * [-649.732] (-642.919) (-641.581) (-646.136) -- 0:00:04
976500 -- (-645.010) (-638.871) [-633.595] (-642.860) * (-637.441) (-639.735) (-633.332) [-645.318] -- 0:00:04
977000 -- (-644.032) [-640.567] (-650.028) (-642.666) * (-643.099) [-638.702] (-643.144) (-640.623) -- 0:00:04
977500 -- (-647.404) (-637.414) (-644.226) [-641.680] * (-636.759) (-637.190) [-641.214] (-643.430) -- 0:00:04
978000 -- (-649.829) (-648.662) (-638.907) [-638.179] * (-643.608) (-642.050) (-635.548) [-639.011] -- 0:00:04
978500 -- (-641.556) (-638.491) (-641.291) [-639.017] * (-645.165) (-641.797) [-633.614] (-641.389) -- 0:00:04
979000 -- (-646.448) (-646.863) [-637.204] (-639.992) * (-642.755) (-638.640) [-638.800] (-641.785) -- 0:00:04
979500 -- [-641.870] (-642.898) (-650.830) (-644.516) * (-649.862) (-640.907) (-635.352) [-641.133] -- 0:00:04
980000 -- (-637.238) (-640.804) [-646.115] (-643.205) * (-652.475) (-637.210) [-632.949] (-644.157) -- 0:00:04
Average standard deviation of split frequencies: 0.009181
980500 -- [-638.683] (-648.230) (-637.157) (-641.307) * (-638.896) [-639.492] (-639.868) (-639.170) -- 0:00:03
981000 -- (-649.579) (-646.293) (-640.319) [-640.455] * (-645.983) [-644.116] (-641.789) (-640.178) -- 0:00:03
981500 -- (-636.269) (-640.240) [-640.715] (-646.718) * (-643.816) [-646.730] (-639.609) (-640.148) -- 0:00:03
982000 -- (-637.047) [-637.160] (-649.573) (-642.111) * (-638.578) [-639.050] (-654.935) (-649.639) -- 0:00:03
982500 -- [-639.418] (-644.587) (-640.328) (-632.578) * (-639.889) [-634.685] (-634.222) (-642.675) -- 0:00:03
983000 -- (-639.878) (-641.894) [-646.389] (-637.054) * (-640.326) (-638.593) [-641.073] (-646.077) -- 0:00:03
983500 -- [-639.498] (-636.603) (-636.231) (-643.864) * (-650.722) (-638.473) [-638.651] (-648.164) -- 0:00:03
984000 -- (-645.205) [-635.040] (-640.040) (-637.209) * [-640.806] (-640.847) (-641.218) (-643.663) -- 0:00:03
984500 -- (-645.218) (-643.453) [-633.603] (-650.332) * (-653.337) (-636.546) (-644.505) [-640.076] -- 0:00:03
985000 -- (-639.559) (-639.432) (-639.585) [-642.699] * (-651.486) (-641.001) (-637.324) [-642.522] -- 0:00:03
Average standard deviation of split frequencies: 0.009036
985500 -- [-644.006] (-645.404) (-638.472) (-637.963) * (-646.870) [-641.043] (-637.020) (-644.494) -- 0:00:02
986000 -- [-641.412] (-640.249) (-643.281) (-644.976) * (-641.227) (-639.896) [-638.981] (-639.387) -- 0:00:02
986500 -- (-640.601) (-639.318) [-642.011] (-637.854) * [-639.519] (-644.634) (-644.675) (-636.392) -- 0:00:02
987000 -- (-638.048) (-632.793) [-644.920] (-648.478) * (-640.468) (-643.068) [-643.585] (-647.483) -- 0:00:02
987500 -- (-642.037) [-633.810] (-639.413) (-641.991) * (-636.708) (-646.538) (-646.007) [-639.329] -- 0:00:02
988000 -- (-637.869) (-637.833) (-640.459) [-636.483] * [-637.903] (-643.806) (-639.741) (-635.324) -- 0:00:02
988500 -- (-655.791) (-640.995) [-638.252] (-646.683) * (-646.381) (-645.475) [-636.678] (-642.820) -- 0:00:02
989000 -- (-645.291) (-646.111) [-640.851] (-646.599) * (-646.646) [-638.480] (-646.155) (-641.786) -- 0:00:02
989500 -- (-641.879) [-647.373] (-642.210) (-634.635) * [-636.653] (-635.651) (-641.933) (-642.940) -- 0:00:02
990000 -- [-638.591] (-642.790) (-647.748) (-635.236) * [-643.295] (-639.848) (-642.466) (-640.251) -- 0:00:02
Average standard deviation of split frequencies: 0.009327
990500 -- (-644.920) [-638.497] (-640.686) (-644.781) * (-643.484) (-638.599) [-649.314] (-641.429) -- 0:00:01
991000 -- (-652.268) (-640.917) [-636.906] (-647.205) * [-638.844] (-635.695) (-648.275) (-639.861) -- 0:00:01
991500 -- (-643.050) (-645.880) [-633.547] (-637.959) * (-647.728) [-636.439] (-645.994) (-638.168) -- 0:00:01
992000 -- (-640.873) (-635.046) [-642.706] (-639.764) * (-648.931) (-636.873) (-645.545) [-636.298] -- 0:00:01
992500 -- (-642.619) (-651.210) (-645.135) [-643.678] * (-647.224) (-633.980) [-639.178] (-639.478) -- 0:00:01
993000 -- (-639.344) (-642.302) (-640.129) [-639.841] * (-644.207) (-642.294) (-640.677) [-636.483] -- 0:00:01
993500 -- (-638.652) [-640.880] (-644.396) (-642.139) * (-643.367) (-645.138) [-640.677] (-644.356) -- 0:00:01
994000 -- (-637.012) [-638.328] (-636.909) (-643.297) * (-641.218) (-635.066) (-644.505) [-643.534] -- 0:00:01
994500 -- (-643.392) (-639.100) [-638.541] (-648.072) * (-644.253) [-638.984] (-643.658) (-648.196) -- 0:00:01
995000 -- (-642.076) (-636.661) [-640.375] (-644.194) * (-641.953) (-643.734) [-642.275] (-642.980) -- 0:00:01
Average standard deviation of split frequencies: 0.009135
995500 -- (-647.945) (-639.629) [-642.255] (-647.872) * (-642.807) (-643.299) [-647.763] (-638.017) -- 0:00:00
996000 -- (-639.538) (-644.766) (-652.827) [-641.335] * (-646.235) (-639.458) [-643.806] (-643.132) -- 0:00:00
996500 -- (-643.115) [-637.079] (-653.095) (-653.059) * (-642.288) (-640.927) [-641.787] (-644.747) -- 0:00:00
997000 -- (-639.730) [-634.423] (-635.971) (-649.075) * (-647.490) (-648.804) (-643.974) [-635.883] -- 0:00:00
997500 -- (-644.019) [-640.167] (-647.225) (-643.068) * (-645.879) [-633.546] (-648.449) (-636.468) -- 0:00:00
998000 -- (-647.895) (-647.484) (-647.164) [-637.200] * (-653.318) (-638.305) (-639.320) [-639.585] -- 0:00:00
998500 -- (-649.410) (-637.534) (-649.974) [-638.237] * (-640.679) (-643.809) (-639.454) [-641.594] -- 0:00:00
999000 -- (-644.651) (-644.265) (-636.185) [-643.897] * (-646.633) (-644.806) [-641.677] (-639.280) -- 0:00:00
999500 -- (-641.946) [-640.388] (-638.871) (-643.255) * (-643.001) (-636.779) [-633.593] (-644.921) -- 0:00:00
1000000 -- (-640.792) [-637.659] (-637.812) (-640.393) * [-648.660] (-639.750) (-642.442) (-649.804) -- 0:00:00
Average standard deviation of split frequencies: 0.009998
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -640.791725 -- 14.512377
Chain 1 -- -640.791723 -- 14.512377
Chain 2 -- -637.658575 -- 11.252342
Chain 2 -- -637.658571 -- 11.252342
Chain 3 -- -637.811970 -- 15.848325
Chain 3 -- -637.811969 -- 15.848325
Chain 4 -- -640.392570 -- 12.056294
Chain 4 -- -640.392570 -- 12.056294
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -648.659686 -- 16.382389
Chain 1 -- -648.659687 -- 16.382389
Chain 2 -- -639.750285 -- 14.913325
Chain 2 -- -639.750288 -- 14.913325
Chain 3 -- -642.441869 -- 12.416218
Chain 3 -- -642.441863 -- 12.416218
Chain 4 -- -649.804431 -- 13.999934
Chain 4 -- -649.804431 -- 13.999934
Analysis completed in 3 mins 24 seconds
Analysis used 204.35 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -628.45
Likelihood of best state for "cold" chain of run 2 was -628.45
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
60.6 % ( 54 %) Dirichlet(Revmat{all})
76.8 % ( 65 %) Slider(Revmat{all})
39.8 % ( 23 %) Dirichlet(Pi{all})
36.8 % ( 23 %) Slider(Pi{all})
52.0 % ( 36 %) Multiplier(Alpha{1,2})
48.0 % ( 24 %) Multiplier(Alpha{3})
67.1 % ( 42 %) Slider(Pinvar{all})
16.5 % ( 12 %) ExtSPR(Tau{all},V{all})
7.7 % ( 14 %) ExtTBR(Tau{all},V{all})
27.5 % ( 26 %) NNI(Tau{all},V{all})
32.8 % ( 40 %) ParsSPR(Tau{all},V{all})
27.0 % ( 20 %) Multiplier(V{all})
48.8 % ( 48 %) Nodeslider(V{all})
26.5 % ( 30 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
61.5 % ( 44 %) Dirichlet(Revmat{all})
76.6 % ( 70 %) Slider(Revmat{all})
39.2 % ( 40 %) Dirichlet(Pi{all})
37.5 % ( 22 %) Slider(Pi{all})
51.8 % ( 28 %) Multiplier(Alpha{1,2})
48.0 % ( 28 %) Multiplier(Alpha{3})
67.2 % ( 38 %) Slider(Pinvar{all})
16.2 % ( 15 %) ExtSPR(Tau{all},V{all})
7.9 % ( 8 %) ExtTBR(Tau{all},V{all})
27.6 % ( 22 %) NNI(Tau{all},V{all})
32.9 % ( 28 %) ParsSPR(Tau{all},V{all})
27.1 % ( 23 %) Multiplier(V{all})
48.8 % ( 39 %) Nodeslider(V{all})
26.5 % ( 32 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.79 0.60 0.45
2 | 166601 0.80 0.63
3 | 166403 166555 0.82
4 | 167008 166790 166643
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.79 0.60 0.45
2 | 166679 0.80 0.63
3 | 166421 166405 0.82
4 | 166678 166665 167152
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/97/CG18428-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/97/CG18428-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/97/CG18428-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -638.22
| 2 |
| |
| 11*2 2 1 1 2 1 |
| 1 2 2 1 1 1 1 2 |
| 21 1 2 2 2 1 11* 2 1 1|
| 2 2 11 1 2 2 2 2 1 11 2 |
| 1221 1 1 2 1 1 22 |
| 2 1* 2 * 1 2 2 * 2 12|
| 1 1 2 1 2 2 * 2 11 1 * 1 2 1 |
|1 1 * 1 1 12* 22 2 1 2 |
| 2 1 1 |
| 2 1 1 |
| 1 2 2 2 |
|2 2 2 2 |
| 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -641.96
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/97/CG18428-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/97/CG18428-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/97/CG18428-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -636.04 -647.53
2 -636.06 -647.43
--------------------------------------
TOTAL -636.05 -647.48
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/97/CG18428-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/97/CG18428-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/97/CG18428-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.974838 0.037378 0.635684 1.359396 0.956569 1303.88 1376.33 1.000
r(A<->C){all} 0.062701 0.001248 0.001924 0.129022 0.057431 629.69 745.17 1.000
r(A<->G){all} 0.255102 0.006239 0.110713 0.413127 0.246868 412.99 453.43 1.000
r(A<->T){all} 0.123934 0.004326 0.010409 0.248683 0.116122 314.82 354.42 1.000
r(C<->G){all} 0.031451 0.000353 0.000132 0.066491 0.028339 972.63 1008.08 1.000
r(C<->T){all} 0.480777 0.009057 0.305363 0.662836 0.478004 350.34 443.64 1.000
r(G<->T){all} 0.046034 0.000979 0.000202 0.105632 0.039774 757.16 861.43 1.000
pi(A){all} 0.251260 0.000715 0.201453 0.305140 0.250715 1180.53 1246.57 1.000
pi(C){all} 0.289399 0.000775 0.236963 0.344295 0.288946 1122.45 1178.87 1.000
pi(G){all} 0.335334 0.000823 0.281282 0.392391 0.335209 1079.53 1178.75 1.000
pi(T){all} 0.124007 0.000374 0.087764 0.162542 0.123069 1043.47 1171.88 1.001
alpha{1,2} 0.066606 0.001071 0.001156 0.118569 0.069193 1009.59 1131.88 1.000
alpha{3} 2.018898 0.560860 0.770862 3.513536 1.896984 1364.33 1398.53 1.000
pinvar{all} 0.298303 0.009336 0.101346 0.479317 0.302789 1213.02 1293.17 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/97/CG18428-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/97/CG18428-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/97/CG18428-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/97/CG18428-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
Key to taxon bipartitions (saved to file "/opt/ADOPS/97/CG18428-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
--------------
1 -- .*******
2 -- .*......
3 -- ..*.....
4 -- ...*....
5 -- ....*...
6 -- .....*..
7 -- ......*.
8 -- .......*
9 -- .....***
10 -- ...*****
11 -- .**.....
12 -- .....*.*
13 -- ...*.***
14 -- ....****
15 -- ...**...
16 -- ......**
17 -- ..******
--------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/97/CG18428-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
9 3002 1.000000 0.000000 1.000000 1.000000 2
10 2986 0.994670 0.001884 0.993338 0.996003 2
11 2523 0.840440 0.009893 0.833444 0.847435 2
12 1970 0.656229 0.012248 0.647568 0.664890 2
13 1075 0.358095 0.022141 0.342438 0.373751 2
14 1046 0.348434 0.012248 0.339773 0.357095 2
15 881 0.293471 0.009893 0.286476 0.300466 2
16 736 0.245170 0.014133 0.235177 0.255163 2
17 312 0.103931 0.007537 0.098601 0.109260 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/97/CG18428-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.012230 0.000146 0.000001 0.037069 0.008588 1.000 2
length{all}[2] 0.016211 0.000163 0.000004 0.041092 0.013110 1.000 2
length{all}[3] 0.015463 0.000151 0.000011 0.038791 0.012287 1.000 2
length{all}[4] 0.031215 0.000614 0.000031 0.078213 0.025552 1.000 2
length{all}[5] 0.096884 0.001801 0.024193 0.180193 0.090924 1.000 2
length{all}[6] 0.167971 0.004907 0.054874 0.305961 0.156485 1.000 2
length{all}[7] 0.077435 0.002018 0.008559 0.166814 0.069335 1.001 2
length{all}[8] 0.104755 0.002529 0.019097 0.200992 0.096224 1.000 2
length{all}[9] 0.256878 0.007897 0.100749 0.428503 0.243403 1.001 2
length{all}[10] 0.093827 0.001720 0.026705 0.182494 0.087929 1.000 2
length{all}[11] 0.022657 0.000251 0.000046 0.052638 0.018994 1.000 2
length{all}[12] 0.054812 0.001706 0.000018 0.134183 0.045087 1.002 2
length{all}[13] 0.031063 0.000580 0.000003 0.079180 0.025577 0.999 2
length{all}[14] 0.032887 0.000717 0.000033 0.085876 0.026068 1.000 2
length{all}[15] 0.032522 0.000758 0.000011 0.087281 0.025631 0.999 2
length{all}[16] 0.043531 0.001284 0.000153 0.113466 0.034771 1.000 2
length{all}[17] 0.013257 0.000139 0.000076 0.032979 0.010517 1.004 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009998
Maximum standard deviation of split frequencies = 0.022141
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.004
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------------------------------------------ C4 (4)
| |
| |------------------------------------------------------ C5 (5)
| |
|--------99-------+ /------------------ C6 (6)
+ | /--------66-------+
| | | \------------------ C8 (8)
| \-------100-------+
| \------------------------------------ C7 (7)
|
| /------------------ C2 (2)
\--------------------------84-------------------------+
\------------------ C3 (3)
Phylogram (based on average branch lengths):
/- C1 (1)
|
| /--- C4 (4)
| |
| |------------ C5 (5)
| |
|-----------+ /--------------------- C6 (6)
+ | /-----+
| | | \------------- C8 (8)
| \--------------------------------+
| \--------- C7 (7)
|
| /- C2 (2)
\--+
\- C3 (3)
|------------| 0.100 expected changes per site
Calculating tree probabilities...
Credible sets of trees (38 trees sampled):
50 % credible set contains 3 trees
90 % credible set contains 12 trees
95 % credible set contains 16 trees
99 % credible set contains 24 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 8 ls = 234
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Sequences read..
Counting site patterns.. 0:00
63 patterns at 78 / 78 sites (100.0%), 0:00
Counting codons..
224 bytes for distance
61488 bytes for conP
8568 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, (4, 5, ((6, 8), 7)), (2, 3)); MP score: 65
153720 bytes for conP, adjusted
0.005951 0.106505 0.066692 0.127164 0.286851 0.034787 0.098880 0.156507 0.086179 0.020107 0.018422 0.007425 0.300000 1.300000
ntime & nrate & np: 12 2 14
Bounds (np=14):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 14
lnL0 = -728.343482
Iterating by ming2
Initial: fx= 728.343482
x= 0.00595 0.10650 0.06669 0.12716 0.28685 0.03479 0.09888 0.15651 0.08618 0.02011 0.01842 0.00742 0.30000 1.30000
1 h-m-p 0.0000 0.0001 155.7438 ++ 726.598523 m 0.0001 19 | 1/14
2 h-m-p 0.0000 0.0003 433.9521 +YCYCCCC 717.699239 6 0.0003 48 | 1/14
3 h-m-p 0.0000 0.0000 1053.3699 +YYYCCC 716.033914 5 0.0000 73 | 1/14
4 h-m-p 0.0000 0.0002 608.1603 +YYYYYCC 711.020192 6 0.0001 98 | 1/14
5 h-m-p 0.0007 0.0034 62.7225 +YYCCC 706.261555 4 0.0024 122 | 1/14
6 h-m-p 0.0001 0.0006 444.3883 YCCCCC 703.306200 5 0.0003 148 | 1/14
7 h-m-p 0.0003 0.0015 352.4212 +YYYYCYCCCC 686.878784 9 0.0012 179 | 1/14
8 h-m-p 0.0000 0.0000 5934.4551 +YYYYCCC 680.163427 6 0.0000 205 | 1/14
9 h-m-p 0.0002 0.0011 211.2540 YCYCCCC 677.690787 6 0.0005 232 | 1/14
10 h-m-p 0.0012 0.0061 45.1175 CYCCCC 675.905249 5 0.0020 258 | 1/14
11 h-m-p 0.0008 0.0038 68.5567 YCYCCC 673.488275 5 0.0018 283 | 1/14
12 h-m-p 0.0004 0.0018 53.5898 YCCCCC 672.551380 5 0.0008 309 | 0/14
13 h-m-p 0.0000 0.0002 264.8231 CCCC 672.062885 3 0.0001 332 | 0/14
14 h-m-p 0.0012 0.0059 14.7397 +YYYCCC 668.929929 5 0.0043 357 | 0/14
15 h-m-p 0.0005 0.0027 23.4962 +YYCCC 666.907093 4 0.0019 381 | 0/14
16 h-m-p 0.0014 0.0071 21.6464 +YYCCCC 661.237572 5 0.0049 407 | 0/14
17 h-m-p 0.0528 0.2862 2.0094 +YYYYC 640.103814 4 0.2062 429 | 0/14
18 h-m-p 0.1098 0.5492 1.3171 YYCCC 633.487682 4 0.1468 452 | 0/14
19 h-m-p 0.2418 1.2092 0.1873 YCYCCC 630.123103 5 0.6600 477 | 0/14
20 h-m-p 0.1305 0.6523 0.2875 CYCCC 628.909646 4 0.2094 515 | 0/14
21 h-m-p 0.3079 8.0000 0.1955 +YCYCCC 623.214325 5 2.2655 555 | 0/14
22 h-m-p 0.7273 3.6365 0.1388 +YCYCCC 618.739171 5 2.1454 595 | 0/14
23 h-m-p 0.3125 1.5627 0.1280 +CYC 617.318579 2 1.2347 630 | 0/14
24 h-m-p 1.6000 8.0000 0.0430 CYCC 616.712229 3 2.0958 666 | 0/14
25 h-m-p 0.1115 0.5574 0.1225 ++ 616.297409 m 0.5574 697 | 1/14
26 h-m-p 0.3069 1.9457 0.2222 YCCCC 615.814449 4 0.6404 735 | 1/14
27 h-m-p 1.5784 7.8918 0.0521 YCCC 615.510167 3 0.9579 770 | 1/14
28 h-m-p 1.4732 8.0000 0.0339 ++ 613.965157 m 8.0000 800 | 1/14
29 h-m-p 1.3759 6.9476 0.1969 CCCC 613.126868 3 1.7043 836 | 1/14
30 h-m-p 1.6000 8.0000 0.1029 YCCC 612.685574 3 2.4530 871 | 1/14
31 h-m-p 1.6000 8.0000 0.0919 YCCC 612.394714 3 3.2676 906 | 1/14
32 h-m-p 1.6000 8.0000 0.0787 YC 612.099129 1 3.4845 937 | 1/14
33 h-m-p 1.6000 8.0000 0.0618 YC 611.813991 1 3.4887 968 | 1/14
34 h-m-p 1.6000 8.0000 0.0272 CYC 611.694274 2 1.5559 1001 | 1/14
35 h-m-p 0.9483 8.0000 0.0446 +CCC 611.597332 2 4.6588 1036 | 1/14
36 h-m-p 1.4770 8.0000 0.1406 YCCC 611.413982 3 2.8930 1071 | 1/14
37 h-m-p 0.9193 4.5965 0.0431 YCCC 611.243340 3 1.9108 1106 | 1/14
38 h-m-p 1.6000 8.0000 0.0412 YC 610.951469 1 3.7787 1137 | 1/14
39 h-m-p 1.6000 8.0000 0.0780 +YCCC 610.426765 3 4.2926 1173 | 1/14
40 h-m-p 1.1702 5.8508 0.1244 CCCCC 610.048161 4 1.8783 1211 | 1/14
41 h-m-p 1.6000 8.0000 0.1087 YCCC 609.377412 3 3.2774 1246 | 1/14
42 h-m-p 1.6000 8.0000 0.0930 YCCC 608.298797 3 3.5590 1281 | 1/14
43 h-m-p 0.9256 5.5597 0.3577 CCCCC 607.664372 4 1.3729 1319 | 1/14
44 h-m-p 1.6000 8.0000 0.0456 CCC 607.070711 2 2.4320 1353 | 1/14
45 h-m-p 1.6000 8.0000 0.0578 +YCC 605.907831 2 4.4478 1387 | 1/14
46 h-m-p 1.3330 8.0000 0.1928 CC 605.174769 1 1.6268 1419 | 1/14
47 h-m-p 0.8454 7.7754 0.3710 CCCC 604.876074 3 1.0134 1455 | 1/14
48 h-m-p 1.6000 8.0000 0.0622 YCC 604.844403 2 1.1710 1488 | 1/14
49 h-m-p 1.6000 8.0000 0.0263 CC 604.834769 1 1.6865 1520 | 1/14
50 h-m-p 1.6000 8.0000 0.0011 ++ 604.787031 m 8.0000 1550 | 1/14
51 h-m-p 0.7042 8.0000 0.0130 +CCC 604.610282 2 3.4908 1585 | 1/14
52 h-m-p 1.6000 8.0000 0.0131 +YCCC 604.234016 3 5.0214 1621 | 1/14
53 h-m-p 1.4407 8.0000 0.0458 ++ 602.340147 m 8.0000 1651 | 1/14
54 h-m-p 0.2359 1.1797 0.1764 +YYYCCC 601.035527 5 0.8456 1689 | 1/14
55 h-m-p 1.5160 8.0000 0.0984 +YCCCC 596.599445 4 4.6484 1727 | 1/14
56 h-m-p 0.2715 1.3576 0.0754 +YCYCCC 595.737948 5 0.7482 1766 | 1/14
57 h-m-p 0.2311 1.8226 0.2442 CCCC 595.453076 3 0.2082 1802 | 1/14
58 h-m-p 1.5416 7.7532 0.0330 YYC 595.276785 2 1.3397 1834 | 1/14
59 h-m-p 1.6000 8.0000 0.0171 CCC 595.191198 2 1.3974 1868 | 1/14
60 h-m-p 1.6000 8.0000 0.0124 CC 595.150599 1 1.4265 1900 | 1/14
61 h-m-p 1.6000 8.0000 0.0066 CC 595.143487 1 1.3971 1932 | 1/14
62 h-m-p 1.6000 8.0000 0.0026 YC 595.143392 1 1.1709 1963 | 1/14
63 h-m-p 1.6000 8.0000 0.0002 C 595.143390 0 1.2932 1993 | 1/14
64 h-m-p 1.6000 8.0000 0.0000 Y 595.143390 0 1.1335 2023 | 1/14
65 h-m-p 1.6000 8.0000 0.0000 Y 595.143390 0 0.9868 2053 | 1/14
66 h-m-p 1.6000 8.0000 0.0000 -Y 595.143390 0 0.1000 2084 | 1/14
67 h-m-p 0.0533 8.0000 0.0000 Y 595.143390 0 0.0533 2114 | 1/14
68 h-m-p 0.2871 8.0000 0.0000 -----Y 595.143390 0 0.0001 2149
Out..
lnL = -595.143390
2150 lfun, 2150 eigenQcodon, 25800 P(t)
Time used: 0:08
Model 1: NearlyNeutral
TREE # 1
(1, (4, 5, ((6, 8), 7)), (2, 3)); MP score: 65
0.005951 0.106505 0.066692 0.127164 0.286851 0.034787 0.098880 0.156507 0.086179 0.020107 0.018422 0.007425 2.600020 0.513725 0.554455
ntime & nrate & np: 12 2 15
Bounds (np=15):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 4.251567
np = 15
lnL0 = -654.212498
Iterating by ming2
Initial: fx= 654.212498
x= 0.00595 0.10650 0.06669 0.12716 0.28685 0.03479 0.09888 0.15651 0.08618 0.02011 0.01842 0.00742 2.60002 0.51372 0.55445
1 h-m-p 0.0000 0.0001 112.7398 ++ 653.303455 m 0.0001 20 | 1/15
2 h-m-p 0.0001 0.0007 110.0112 +CCYC 650.943157 3 0.0006 45 | 1/15
3 h-m-p 0.0001 0.0003 669.6069 +CYCCC 645.340920 4 0.0003 72 | 1/15
4 h-m-p 0.0001 0.0005 511.8490 +YYYYCC 637.291198 5 0.0004 97 | 1/15
5 h-m-p 0.0000 0.0001 1404.9775 ++ 630.479403 m 0.0001 115 | 1/15
6 h-m-p 0.0000 0.0000 277.8652
h-m-p: 2.79789878e-20 1.39894939e-19 2.77865205e+02 630.479403
.. | 1/15
7 h-m-p 0.0000 0.0010 2006.1499 ++YCYCCC 611.010150 5 0.0001 158 | 1/15
8 h-m-p 0.0002 0.0009 155.3411 +YCYCCCC 596.713528 6 0.0007 187 | 1/15
9 h-m-p 0.0003 0.0014 112.0157 +YYYYYY 590.151877 5 0.0011 211 | 1/15
10 h-m-p 0.0001 0.0007 72.0599 YCYCCC 589.579688 5 0.0003 237 | 1/15
11 h-m-p 0.0006 0.0039 34.4390 +YCCCC 588.812966 4 0.0016 263 | 1/15
12 h-m-p 0.0003 0.0017 86.4958 CCCC 588.467415 3 0.0004 287 | 1/15
13 h-m-p 0.0007 0.0035 27.2950 CCC 588.326438 2 0.0007 309 | 1/15
14 h-m-p 0.0015 0.0241 12.8399 CCC 588.249791 2 0.0014 331 | 1/15
15 h-m-p 0.0007 0.0041 24.3913 YYC 588.193510 2 0.0006 351 | 1/15
16 h-m-p 0.0040 0.0528 3.7793 YCC 588.175044 2 0.0030 372 | 1/15
17 h-m-p 0.0145 0.1707 0.7801 YC 588.171271 1 0.0062 391 | 1/15
18 h-m-p 0.0048 0.2681 1.0063 YC 588.163297 1 0.0082 424 | 1/15
19 h-m-p 0.0095 0.1544 0.8691 +YYC 588.107627 2 0.0339 445 | 1/15
20 h-m-p 0.0084 0.0826 3.5314 CCC 588.054569 2 0.0100 481 | 1/15
21 h-m-p 0.3614 7.4261 0.0976 CCC 588.017402 2 0.3988 503 | 1/15
22 h-m-p 0.4372 8.0000 0.0891 +YC 587.997571 1 1.1420 537 | 1/15
23 h-m-p 1.6000 8.0000 0.0164 ++ 587.916425 m 8.0000 569 | 1/15
24 h-m-p 1.6000 8.0000 0.0689 CCCC 587.799426 3 1.9829 607 | 1/15
25 h-m-p 1.3835 6.9173 0.0146 CCCC 587.705448 3 1.6418 645 | 1/15
26 h-m-p 0.6613 8.0000 0.0363 CC 587.694351 1 0.8150 679 | 1/15
27 h-m-p 1.6000 8.0000 0.0063 YC 587.693766 1 0.7944 712 | 1/15
28 h-m-p 1.6000 8.0000 0.0008 Y 587.693763 0 0.8391 744 | 1/15
29 h-m-p 1.6000 8.0000 0.0000 Y 587.693763 0 0.8315 776 | 1/15
30 h-m-p 1.3186 8.0000 0.0000 Y 587.693763 0 0.6827 808 | 1/15
31 h-m-p 1.6000 8.0000 0.0000 ----Y 587.693763 0 0.0016 844
Out..
lnL = -587.693763
845 lfun, 2535 eigenQcodon, 20280 P(t)
Time used: 0:13
Model 2: PositiveSelection
TREE # 1
(1, (4, 5, ((6, 8), 7)), (2, 3)); MP score: 65
initial w for M2:NSpselection reset.
0.005951 0.106505 0.066692 0.127164 0.286851 0.034787 0.098880 0.156507 0.086179 0.020107 0.018422 0.007425 2.637130 1.605788 0.590611 0.100545 2.327473
ntime & nrate & np: 12 3 17
Bounds (np=17):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 5.081113
np = 17
lnL0 = -628.350954
Iterating by ming2
Initial: fx= 628.350954
x= 0.00595 0.10650 0.06669 0.12716 0.28685 0.03479 0.09888 0.15651 0.08618 0.02011 0.01842 0.00742 2.63713 1.60579 0.59061 0.10054 2.32747
1 h-m-p 0.0000 0.0001 146.5923 ++ 626.246459 m 0.0001 22 | 1/17
2 h-m-p 0.0001 0.0007 206.9216 ++ 616.959047 m 0.0007 42 | 1/17
3 h-m-p 0.0000 0.0000 134.1043
h-m-p: 2.84239808e-21 1.42119904e-20 1.34104336e+02 616.959047
.. | 1/17
4 h-m-p 0.0000 0.0071 355.7811 +YYYCC 615.584774 4 0.0001 85 | 1/17
5 h-m-p 0.0005 0.0054 41.5295 +CYYYCC 612.135029 5 0.0035 113 | 1/17
6 h-m-p 0.0007 0.0034 217.0311 YCCCC 606.437741 4 0.0017 140 | 1/17
7 h-m-p 0.0010 0.0113 371.1322 YCCCC 605.750615 4 0.0001 167 | 1/17
8 h-m-p 0.0007 0.0037 49.4850 +YYYCCC 603.667385 5 0.0027 195 | 1/17
9 h-m-p 0.0019 0.0096 50.9228 +CYCCC 598.741393 4 0.0080 223 | 1/17
10 h-m-p 0.0022 0.0110 80.5600 YCCCC 595.113797 4 0.0055 250 | 1/17
11 h-m-p 0.0086 0.0430 15.2069 CCCC 594.037937 3 0.0142 276 | 1/17
12 h-m-p 0.0052 0.0262 10.8688 YCCCC 593.647450 4 0.0100 303 | 1/17
13 h-m-p 0.0091 0.0742 11.9932 CCCC 593.202179 3 0.0134 329 | 1/17
14 h-m-p 0.0317 0.1828 5.0640 YYCC 592.832558 3 0.0276 353 | 1/17
15 h-m-p 0.0399 0.1996 3.1939 +YYCCCC 591.264651 5 0.1226 382 | 1/17
16 h-m-p 0.0022 0.0109 24.8975 YCYCCC 590.678807 5 0.0061 410 | 1/17
17 h-m-p 0.0130 0.0650 3.4269 YCCC 590.348920 3 0.0337 435 | 1/17
18 h-m-p 0.0141 0.1488 8.1718 +YYCCC 589.010869 4 0.0460 462 | 1/17
19 h-m-p 0.2590 7.3216 1.4518 YCCC 587.999122 3 0.4625 487 | 1/17
20 h-m-p 0.3417 1.7087 0.8421 CCCCC 587.428003 4 0.4100 515 | 1/17
21 h-m-p 0.4491 3.1547 0.7689 CCCC 587.032703 3 0.4859 557 | 1/17
22 h-m-p 0.5839 5.2286 0.6398 CYC 586.716546 2 0.6782 596 | 1/17
23 h-m-p 0.6528 3.4198 0.6646 CCCC 586.417396 3 0.8392 638 | 1/17
24 h-m-p 1.1924 5.9620 0.3607 YCC 586.351611 2 0.6689 677 | 1/17
25 h-m-p 0.7507 8.0000 0.3215 CC 586.285489 1 1.1849 715 | 1/17
26 h-m-p 1.2835 8.0000 0.2968 CCC 586.228614 2 1.7331 755 | 1/17
27 h-m-p 1.2554 8.0000 0.4097 YCC 586.153403 2 2.2312 794 | 1/17
28 h-m-p 1.6000 8.0000 0.2693 CC 586.136902 1 1.3642 832 | 1/17
29 h-m-p 1.6000 8.0000 0.1841 CC 586.126517 1 2.1121 870 | 1/17
30 h-m-p 1.6000 8.0000 0.2012 CCC 586.119751 2 2.0241 910 | 1/17
31 h-m-p 1.6000 8.0000 0.1663 CC 586.117218 1 1.4215 948 | 1/17
32 h-m-p 1.5092 8.0000 0.1567 YC 586.112437 1 3.3210 985 | 1/17
33 h-m-p 1.6000 8.0000 0.1784 +CC 586.098901 1 5.9172 1024 | 1/17
34 h-m-p 1.6000 8.0000 0.4451 YYC 586.090819 2 1.2756 1062 | 1/17
35 h-m-p 1.6000 8.0000 0.1315 YC 586.088052 1 1.1822 1099 | 1/17
36 h-m-p 1.6000 8.0000 0.0513 CC 586.085675 1 1.8955 1137 | 1/17
37 h-m-p 0.7432 8.0000 0.1309 YC 586.085232 1 1.3932 1174 | 1/17
38 h-m-p 1.4894 8.0000 0.1225 +YC 586.084728 1 4.7983 1212 | 1/17
39 h-m-p 1.5821 8.0000 0.3714 CC 586.084284 1 2.0732 1250 | 1/17
40 h-m-p 1.6000 8.0000 0.3212 YC 586.084027 1 3.1379 1287 | 1/17
41 h-m-p 1.6000 8.0000 0.3475 C 586.083943 0 2.1805 1323 | 1/17
42 h-m-p 1.6000 8.0000 0.3202 YC 586.083905 1 2.9458 1360 | 1/17
43 h-m-p 1.6000 8.0000 0.3740 C 586.083890 0 2.3958 1396 | 1/17
44 h-m-p 1.6000 8.0000 0.3412 C 586.083884 0 2.2395 1432 | 1/17
45 h-m-p 1.6000 8.0000 0.3713 C 586.083881 0 2.2003 1468 | 1/17
46 h-m-p 1.6000 8.0000 0.3726 C 586.083880 0 2.1387 1504 | 1/17
47 h-m-p 1.6000 8.0000 0.3578 C 586.083879 0 2.5147 1540 | 1/17
48 h-m-p 1.6000 8.0000 0.3528 C 586.083879 0 2.4066 1576 | 1/17
49 h-m-p 1.6000 8.0000 0.3492 Y 586.083879 0 2.6140 1612 | 1/17
50 h-m-p 1.6000 8.0000 0.3497 C 586.083879 0 2.4464 1648 | 1/17
51 h-m-p 1.6000 8.0000 0.3437 Y 586.083879 0 2.5618 1684 | 1/17
52 h-m-p 1.6000 8.0000 0.3471 C 586.083879 0 2.5150 1720 | 1/17
53 h-m-p 1.6000 8.0000 0.3306 C 586.083879 0 2.4090 1756 | 1/17
54 h-m-p 1.6000 8.0000 0.3757 Y 586.083879 0 2.9561 1792 | 1/17
55 h-m-p 1.6000 8.0000 0.2567 C 586.083879 0 1.7520 1828 | 1/17
56 h-m-p 0.7814 8.0000 0.5755 +Y 586.083879 0 3.1257 1865 | 1/17
57 h-m-p 1.6000 8.0000 0.5254 C 586.083879 0 1.6000 1901 | 1/17
58 h-m-p 1.6000 8.0000 0.0411 Y 586.083879 0 1.6000 1937 | 1/17
59 h-m-p 1.6000 8.0000 0.0216 Y 586.083879 0 1.6000 1973 | 1/17
60 h-m-p 0.1171 8.0000 0.2952 -C 586.083879 0 0.0087 2010 | 1/17
61 h-m-p 1.6000 8.0000 0.0005 --C 586.083879 0 0.0289 2048 | 1/17
62 h-m-p 0.0160 8.0000 0.0092 -----Y 586.083879 0 0.0000 2089 | 1/17
63 h-m-p 0.0160 8.0000 0.0000 --C 586.083879 0 0.0003 2127 | 1/17
64 h-m-p 0.0160 8.0000 0.0003 -------------.. | 1/17
65 h-m-p 0.0160 8.0000 0.0000 ------------- | 1/17
66 h-m-p 0.0160 8.0000 0.0000 -------------
Out..
lnL = -586.083879
2269 lfun, 9076 eigenQcodon, 81684 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -598.125767 S = -577.090222 -13.945391
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 63 patterns 0:36
did 20 / 63 patterns 0:36
did 30 / 63 patterns 0:36
did 40 / 63 patterns 0:36
did 50 / 63 patterns 0:36
did 60 / 63 patterns 0:36
did 63 / 63 patterns 0:36
Time used: 0:36
Model 3: discrete
TREE # 1
(1, (4, 5, ((6, 8), 7)), (2, 3)); MP score: 65
0.005951 0.106505 0.066692 0.127164 0.286851 0.034787 0.098880 0.156507 0.086179 0.020107 0.018422 0.007425 2.876656 0.346772 0.201601 0.019329 0.040182 0.061853
ntime & nrate & np: 12 4 18
Bounds (np=18):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 13.579735
np = 18
lnL0 = -596.838675
Iterating by ming2
Initial: fx= 596.838675
x= 0.00595 0.10650 0.06669 0.12716 0.28685 0.03479 0.09888 0.15651 0.08618 0.02011 0.01842 0.00742 2.87666 0.34677 0.20160 0.01933 0.04018 0.06185
1 h-m-p 0.0000 0.0001 109.5433 ++ 595.975278 m 0.0001 41 | 1/18
2 h-m-p 0.0001 0.0003 126.1297 ++ 594.531329 m 0.0003 80 | 2/18
3 h-m-p 0.0001 0.0005 225.0083 +YCCC 593.198161 3 0.0003 124 | 2/18
4 h-m-p 0.0001 0.0006 64.3906 +YCCC 592.736854 3 0.0004 167 | 2/18
5 h-m-p 0.0017 0.0084 11.0667 CCCC 592.625083 3 0.0019 210 | 2/18
6 h-m-p 0.0007 0.0037 4.8933 +YC 592.599106 1 0.0024 249 | 1/18
7 h-m-p 0.0009 0.0266 13.2772 YCC 592.587851 2 0.0004 289 | 1/18
8 h-m-p 0.0010 0.0050 2.4562 ++ 592.572064 m 0.0050 327 | 2/18
9 h-m-p 0.0033 0.0394 3.7401 CYC 592.559556 2 0.0031 368 | 2/18
10 h-m-p 0.0021 0.0106 3.2207 YC 592.544600 1 0.0045 406 | 1/18
11 h-m-p 0.0005 0.0026 17.6688 CCC 592.527052 2 0.0008 447 | 1/18
12 h-m-p 0.0006 0.0031 7.3613 ++ 592.484621 m 0.0031 485 | 2/18
13 h-m-p 0.0023 0.0121 9.7774 YC 592.447268 1 0.0042 524 | 1/18
14 h-m-p 0.0000 0.0002 335.5351 YC 592.446335 1 0.0000 562 | 1/18
15 h-m-p 0.0053 0.1056 1.3615 YC 592.437494 1 0.0127 601 | 1/18
16 h-m-p 0.0031 0.2923 5.5442 ++CCCC 592.281521 3 0.0589 647 | 1/18
17 h-m-p 0.0029 0.0439 111.8296 +YYCCC 591.792749 4 0.0090 692 | 1/18
18 h-m-p 0.0213 0.1066 2.9784 CC 591.784434 1 0.0063 732 | 1/18
19 h-m-p 0.0037 1.4747 5.0454 +++YCCC 590.897775 3 0.4398 778 | 1/18
20 h-m-p 1.2771 6.3856 0.3517 YCCCC 590.097185 4 2.4950 823 | 1/18
21 h-m-p 0.5962 8.0000 1.4720 CYCC 589.785838 3 0.7136 866 | 1/18
22 h-m-p 0.2343 1.1714 0.7327 CCCCC 589.627555 4 0.3142 912 | 1/18
23 h-m-p 0.7961 4.7996 0.2892 CCCC 589.320986 3 1.1751 956 | 1/18
24 h-m-p 1.1251 8.0000 0.3020 YC 589.053406 1 2.3422 995 | 1/18
25 h-m-p 0.5614 2.8072 0.2476 +YC 588.663910 1 1.8973 1035 | 1/18
26 h-m-p 0.5713 2.8564 0.2515 +YCC 588.076498 2 2.4408 1077 | 1/18
27 h-m-p 0.0109 0.0545 0.8419 ++ 588.024875 m 0.0545 1115 | 2/18
28 h-m-p 0.0267 8.0000 1.7190 +++YYC 586.872347 2 1.3637 1158 | 2/18
29 h-m-p 1.6000 8.0000 0.8626 YCCC 586.605644 3 0.7716 1200 | 2/18
30 h-m-p 0.5863 8.0000 1.1352 +YCC 586.335921 2 1.6596 1241 | 2/18
31 h-m-p 1.6000 8.0000 0.7802 YCCC 586.138711 3 3.3113 1283 | 2/18
32 h-m-p 1.6000 8.0000 0.7697 CYC 586.097169 2 1.3794 1323 | 2/18
33 h-m-p 1.6000 8.0000 0.5016 YC 586.088001 1 1.0733 1361 | 2/18
34 h-m-p 1.2581 8.0000 0.4279 CC 586.084234 1 1.5153 1400 | 2/18
35 h-m-p 1.6000 8.0000 0.0822 C 586.083910 0 1.6000 1437 | 2/18
36 h-m-p 1.6000 8.0000 0.0103 C 586.083887 0 1.4045 1474 | 2/18
37 h-m-p 1.6000 8.0000 0.0039 C 586.083885 0 1.5025 1511 | 2/18
38 h-m-p 1.6000 8.0000 0.0005 C 586.083885 0 2.2633 1548 | 1/18
39 h-m-p 1.6000 8.0000 0.0005 ++ 586.083884 m 8.0000 1585 | 1/18
40 h-m-p 1.3444 8.0000 0.0030 +C 586.083880 0 5.5212 1624 | 1/18
41 h-m-p 1.6000 8.0000 0.0030 C 586.083879 0 1.6763 1662 | 1/18
42 h-m-p 1.6000 8.0000 0.0007 C 586.083879 0 1.3796 1700 | 1/18
43 h-m-p 1.6000 8.0000 0.0001 C 586.083879 0 1.3384 1738 | 1/18
44 h-m-p 1.6000 8.0000 0.0000 C 586.083879 0 2.1640 1776 | 1/18
45 h-m-p 1.6000 8.0000 0.0000 -C 586.083879 0 0.1000 1815 | 1/18
46 h-m-p 0.1074 8.0000 0.0000 Y 586.083879 0 0.0268 1853 | 1/18
47 h-m-p 0.0160 8.0000 0.0000 -C 586.083879 0 0.0010 1892
Out..
lnL = -586.083879
1893 lfun, 7572 eigenQcodon, 68148 P(t)
Time used: 0:54
Model 7: beta
TREE # 1
(1, (4, 5, ((6, 8), 7)), (2, 3)); MP score: 65
0.005951 0.106505 0.066692 0.127164 0.286851 0.034787 0.098880 0.156507 0.086179 0.020107 0.018422 0.007425 2.876654 0.834343 1.457743
ntime & nrate & np: 12 1 15
Bounds (np=15):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 6.595449
np = 15
lnL0 = -622.168639
Iterating by ming2
Initial: fx= 622.168639
x= 0.00595 0.10650 0.06669 0.12716 0.28685 0.03479 0.09888 0.15651 0.08618 0.02011 0.01842 0.00742 2.87665 0.83434 1.45774
1 h-m-p 0.0000 0.0001 109.1236 ++ 621.280844 m 0.0001 35 | 1/15
2 h-m-p 0.0001 0.0013 81.5904 +CYCCC 619.591183 4 0.0008 77 | 1/15
3 h-m-p 0.0002 0.0009 182.9843 +YCCC 618.088348 3 0.0005 115 | 1/15
4 h-m-p 0.0002 0.0011 147.3097 +YYYCCCC 615.189855 6 0.0008 157 | 1/15
5 h-m-p 0.0009 0.0044 130.4136 ++ 597.016070 m 0.0044 189 | 1/15
6 h-m-p 0.0003 0.0013 118.1197 CCCCC 596.242616 4 0.0003 229 | 1/15
7 h-m-p 0.0024 0.0121 14.6865 CCCC 595.992822 3 0.0025 267 | 1/15
8 h-m-p 0.0027 0.0537 13.7182 +CCCC 595.045338 3 0.0144 306 | 1/15
9 h-m-p 0.0040 0.0200 22.4170 CCC 594.554227 2 0.0053 342 | 1/15
10 h-m-p 0.0066 0.0491 17.8602 YCCC 594.365617 3 0.0029 379 | 1/15
11 h-m-p 0.0069 0.0439 7.4566 YCC 594.248763 2 0.0047 414 | 1/15
12 h-m-p 0.0124 0.1137 2.8342 CCC 594.083371 2 0.0140 450 | 1/15
13 h-m-p 0.0097 0.0486 3.0820 YCCC 593.688137 3 0.0169 487 | 1/15
14 h-m-p 0.0097 0.0812 5.3547 CYC 593.443929 2 0.0109 522 | 1/15
15 h-m-p 0.1653 1.8357 0.3528 +CYYCCC 591.523881 5 1.1828 564 | 1/15
16 h-m-p 1.2374 6.1872 0.0197 CCC 591.400155 2 1.4017 600 | 1/15
17 h-m-p 0.6795 8.0000 0.0407 CC 591.389603 1 0.9387 634 | 1/15
18 h-m-p 1.6000 8.0000 0.0231 YC 591.387135 1 1.1456 667 | 1/15
19 h-m-p 1.6000 8.0000 0.0091 YC 591.386793 1 0.8387 700 | 1/15
20 h-m-p 1.6000 8.0000 0.0021 C 591.386673 0 1.3962 732 | 1/15
21 h-m-p 1.1452 8.0000 0.0025 C 591.386588 0 1.3508 764 | 1/15
22 h-m-p 1.0961 8.0000 0.0031 YC 591.386511 1 1.8427 797 | 1/15
23 h-m-p 1.2335 8.0000 0.0047 CC 591.386439 1 1.7843 831 | 1/15
24 h-m-p 1.6000 8.0000 0.0041 C 591.386378 0 2.1461 863 | 1/15
25 h-m-p 1.5703 8.0000 0.0055 +YC 591.386236 1 4.6778 897 | 1/15
26 h-m-p 1.6000 8.0000 0.0128 C 591.386129 0 1.7518 929 | 1/15
27 h-m-p 1.6000 8.0000 0.0006 Y 591.386125 0 1.2361 961 | 1/15
28 h-m-p 1.6000 8.0000 0.0001 Y 591.386125 0 1.2353 993 | 1/15
29 h-m-p 1.6000 8.0000 0.0000 Y 591.386125 0 0.9523 1025 | 1/15
30 h-m-p 1.6000 8.0000 0.0000 Y 591.386125 0 0.4000 1057 | 1/15
31 h-m-p 0.6290 8.0000 0.0000 ----C 591.386125 0 0.0006 1093
Out..
lnL = -591.386125
1094 lfun, 12034 eigenQcodon, 131280 P(t)
Time used: 1:29
Model 8: beta&w>1
TREE # 1
(1, (4, 5, ((6, 8), 7)), (2, 3)); MP score: 65
initial w for M8:NSbetaw>1 reset.
0.005951 0.106505 0.066692 0.127164 0.286851 0.034787 0.098880 0.156507 0.086179 0.020107 0.018422 0.007425 2.631555 0.900000 1.127456 1.446685 2.067456
ntime & nrate & np: 12 2 17
Bounds (np=17):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 5.055931
np = 17
lnL0 = -635.149396
Iterating by ming2
Initial: fx= 635.149396
x= 0.00595 0.10650 0.06669 0.12716 0.28685 0.03479 0.09888 0.15651 0.08618 0.02011 0.01842 0.00742 2.63156 0.90000 1.12746 1.44668 2.06746
1 h-m-p 0.0000 0.0001 135.0756 ++ 633.616122 m 0.0001 39 | 1/17
2 h-m-p 0.0001 0.0006 189.7820 ++ 628.418143 m 0.0006 76 | 1/17
3 h-m-p 0.0000 0.0000 107.9621
h-m-p: 0.00000000e+00 0.00000000e+00 1.07962084e+02 628.418143
.. | 1/17
4 h-m-p 0.0000 0.0021 421.0987 +CYCCC 627.233567 4 0.0000 153 | 1/17
5 h-m-p 0.0003 0.0019 41.9803 +YCCCC 626.415726 4 0.0009 197 | 1/17
6 h-m-p 0.0002 0.0010 61.7606 ++ 625.325034 m 0.0010 233 | 1/17
7 h-m-p 0.0002 0.0008 224.5824 +YYCCC 623.243776 4 0.0006 276 | 1/17
8 h-m-p 0.0002 0.0010 397.6437 +YCYCCC 619.324670 5 0.0006 321 | 1/17
9 h-m-p 0.0003 0.0014 601.3957 +YYYCYYCCC 599.712283 8 0.0012 369 | 1/17
10 h-m-p 0.0000 0.0001 1219.8710 CYCCCC 599.309412 5 0.0000 414 | 1/17
11 h-m-p 0.0006 0.0029 27.2477 YCC 599.204449 2 0.0004 453 | 1/17
12 h-m-p 0.0004 0.0040 27.9956 +YYCC 598.871583 3 0.0016 494 | 1/17
13 h-m-p 0.0004 0.0131 120.7559 ++YCCC 596.232718 3 0.0038 537 | 1/17
14 h-m-p 0.0044 0.0221 21.9929 CCCC 595.600110 3 0.0059 579 | 1/17
15 h-m-p 0.0047 0.0283 27.4845 CCCC 594.975695 3 0.0052 621 | 1/17
16 h-m-p 0.0030 0.0150 21.8491 CCCCC 594.533607 4 0.0047 665 | 1/17
17 h-m-p 0.0103 0.0515 5.8686 CCCCC 594.239292 4 0.0131 709 | 1/17
18 h-m-p 0.0253 0.2512 3.0345 +YYYYCC 591.926725 5 0.0986 752 | 1/17
19 h-m-p 0.0566 0.2829 0.7803 YCCCC 590.488262 4 0.1467 795 | 1/17
20 h-m-p 0.1328 6.1844 0.8617 +YCCC 588.944534 3 0.8694 837 | 1/17
21 h-m-p 1.3077 8.0000 0.5729 CCCCC 588.170797 4 1.5757 881 | 1/17
22 h-m-p 1.4098 8.0000 0.6403 CYCCC 587.793052 4 1.1208 924 | 1/17
23 h-m-p 1.6000 8.0000 0.2565 YCC 587.608686 2 3.0414 963 | 1/17
24 h-m-p 1.6000 8.0000 0.2281 +YCCC 587.448741 3 4.0618 1005 | 1/17
25 h-m-p 1.6000 8.0000 0.2322 CCC 587.415836 2 1.6504 1045 | 1/17
26 h-m-p 1.6000 8.0000 0.0952 +YC 587.371794 1 4.7470 1083 | 1/17
27 h-m-p 1.6000 8.0000 0.0444 YCCC 587.346276 3 2.8483 1124 | 1/17
28 h-m-p 1.6000 8.0000 0.0691 +YC 587.281369 1 7.0400 1162 | 1/17
29 h-m-p 1.3160 8.0000 0.3697 ++ 587.120511 m 8.0000 1198 | 1/17
30 h-m-p 1.6000 8.0000 0.4267 CCCC 587.023269 3 1.9733 1240 | 1/17
31 h-m-p 1.1414 8.0000 0.7377 ++ 586.880093 m 8.0000 1276 | 1/17
32 h-m-p 1.6000 8.0000 1.0875 CYC 586.742539 2 1.7355 1315 | 1/17
33 h-m-p 1.0351 8.0000 1.8234 +YC 586.613230 1 2.6560 1353 | 1/17
34 h-m-p 1.6000 8.0000 2.3917 CCC 586.561205 2 2.1383 1393 | 1/17
35 h-m-p 1.6000 8.0000 1.8623 YCC 586.527864 2 3.2222 1432 | 1/17
36 h-m-p 1.6000 8.0000 2.3793 +YC 586.487131 1 4.0612 1470 | 1/17
37 h-m-p 1.6000 8.0000 3.4297 YCC 586.449066 2 2.8196 1509 | 1/17
38 h-m-p 1.6000 8.0000 3.8215 YCC 586.415102 2 3.4004 1548 | 1/17
39 h-m-p 1.4985 7.4926 4.4002 +YCCC 586.377830 3 4.2320 1590 | 1/17
40 h-m-p 0.5644 2.8221 5.0893 ++ 586.321146 m 2.8221 1626 | 2/17
41 h-m-p 0.5925 2.9626 1.0340 CCC 586.306602 2 0.1921 1666 | 2/17
42 h-m-p 0.0511 1.4371 3.8840 +YCYCCC 586.236623 5 0.4888 1710 | 2/17
43 h-m-p 1.6000 8.0000 0.3548 CYY 586.213715 2 1.5543 1748 | 2/17
44 h-m-p 0.9134 8.0000 0.6037 YCC 586.207350 2 0.5406 1786 | 2/17
45 h-m-p 1.6000 8.0000 0.0560 CCC 586.200120 2 1.8237 1825 | 2/17
46 h-m-p 1.6000 8.0000 0.0356 CY 586.197501 1 1.4432 1862 | 2/17
47 h-m-p 1.6000 8.0000 0.0145 C 586.196924 0 1.5271 1897 | 2/17
48 h-m-p 1.6000 8.0000 0.0043 C 586.196807 0 1.3093 1932 | 2/17
49 h-m-p 1.6000 8.0000 0.0019 C 586.196794 0 1.4989 1967 | 2/17
50 h-m-p 1.6000 8.0000 0.0004 C 586.196793 0 1.7197 2002 | 2/17
51 h-m-p 1.6000 8.0000 0.0003 C 586.196792 0 1.9145 2037 | 2/17
52 h-m-p 1.6000 8.0000 0.0001 Y 586.196792 0 0.9449 2072 | 2/17
53 h-m-p 1.6000 8.0000 0.0000 Y 586.196792 0 0.6551 2107 | 2/17
54 h-m-p 1.4477 8.0000 0.0000 -C 586.196792 0 0.0905 2143
Out..
lnL = -586.196792
2144 lfun, 25728 eigenQcodon, 283008 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -600.315997 S = -577.056371 -16.881747
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 63 patterns 2:46
did 20 / 63 patterns 2:46
did 30 / 63 patterns 2:47
did 40 / 63 patterns 2:47
did 50 / 63 patterns 2:47
did 60 / 63 patterns 2:47
did 63 / 63 patterns 2:47
Time used: 2:47
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=8, Len=78
D_melanogaster_CG18428-PC MNSKSHAPETPEEYQRRQSQIRKEVDPVTGRVRLIKGDSEVLEEIVTKER
D_sechellia_CG18428-PC MNSKSHAPETPEEYQRRQSQIRKEVDPVTGRVRLIKGDSEVLEEIVTKER
D_simulans_CG18428-PC MNSKSHAPETPEEYQRRQSQIRKEVDPVTGRVRLIKGDSEVLEEIVTKER
D_yakuba_CG18428-PC MNSKSHAPETPEEYQRRQSQIRREVDPVTGRVRLIKGDSEVLEEIVTKER
D_erecta_CG18428-PC MNSKSHAPETPEEYQRRQSQMRREVDPVTGRVRLIKGDSEVLEEIVTKER
D_biarmipes_CG18428-PC MNSKSHAPETPEEYQRRQSQIRREVDPVTGRVRIIKGDSEVLEEIVTKER
D_rhopaloa_CG18428-PC MNSKSHAPETPEEYQRRQSQIRREVDPVTGRVRLIKGDSEVLEEIVTKER
D_elegans_CG18428-PC MNSKSHAPETPEEYQRRQSQIRREVDPVTGRVRLIKGDSEVLEEIVTKER
********************:*:**********:****************
D_melanogaster_CG18428-PC HLEINKKATRGDGEFYEARSLDAAKRRK
D_sechellia_CG18428-PC HLEINKKATRGDGEFYETRSLNAAKRRK
D_simulans_CG18428-PC HLEINKKATRGDGEFYEARSLNAAKRRK
D_yakuba_CG18428-PC HMEINKKATRGDGEFYEARSLDAAKRRK
D_erecta_CG18428-PC HLEINKKATRGDGDFYEARSLDAAKRRK
D_biarmipes_CG18428-PC HQEINKKATRGDGEFYEARSLDAARRRK
D_rhopaloa_CG18428-PC HVEINKKATRGDGEFYEARSLDAARRRK
D_elegans_CG18428-PC HVEINKKATRGDGEFYEARSLDAARRRK
* ***********:***:***:**:***
>D_melanogaster_CG18428-PC ATGAATAGCAAATCACATGCCCCGGAAACTCCAGAGGAATACCAGCGCCG TCAGAGCCAGATCCGCAAAGAGGTGGACCCGGTGACGGGTCGCGTCCGGC TCATCAAAGGCGACAGTGAGGTGCTGGAAGAGATTGTGACCAAAGAGCGC CACCTGGAGATCAACAAGAAGGCCACCCGCGGTGATGGAGAGTTCTACGA AGCCAGATCTCTGGACGCCGCCAAGCGTCGCAAA >D_sechellia_CG18428-PC ATGAATAGCAAATCACATGCCCCGGAAACTCCAGAGGAATACCAGCGCCG TCAGAGCCAGATCCGCAAAGAGGTGGACCCGGTGACGGGCCGCGTCCGGC TCATCAAAGGCGACAGTGAGGTGCTGGAAGAGATTGTGACCAAAGAGCGC CACCTGGAGATCAACAAGAAGGCCACCCGCGGTGATGGAGAGTTCTACGA AACCAGATCTCTGAACGCCGCCAAGCGTCGCAAA >D_simulans_CG18428-PC ATGAATAGCAAATCACATGCTCCGGAAACTCCAGAGGAATACCAGCGCCG TCAGAGCCAGATCCGCAAAGAGGTGGACCCGGTGACGGGCCGCGTCCGGC TCATCAAAGGCGACAGTGAGGTGCTGGAAGAGATTGTGACCAAAGAGCGC CACCTGGAGATCAACAAGAAGGCCACCCGCGGTGATGGAGAGTTCTACGA AGCCAGATCTCTGAACGCCGCCAAGCGTCGCAAA >D_yakuba_CG18428-PC ATGAATAGCAAATCGCATGCACCGGAAACTCCAGAGGAATACCAGCGCCG TCAGAGCCAGATCCGCAGAGAGGTGGACCCGGTAACGGGTCGCGTCCGGC TCATCAAGGGCGACAGTGAGGTGCTGGAAGAGATTGTGACCAAGGAGCGC CACATGGAGATCAATAAAAAGGCCACCCGCGGCGATGGAGAGTTCTATGA AGCCAGATCTCTGGATGCCGCCAAGCGTCGCAAA >D_erecta_CG18428-PC ATGAATAGCAAATCGCATGCACCGGAAACTCCAGAGGAATACCAGCGCCG TCAGAGCCAGATGCGCAGGGAGGTTGATCCGGTCACGGGTCGCGTCCGGC TCATCAAAGGCGACAGTGAGGTACTGGAAGAGATTGTGACCAAGGAGCGC CACTTGGAGATCAACAAAAAGGCCACCCGCGGCGATGGAGACTTCTACGA AGCTAGATCTCTGGATGCCGCCAAGCGTCGCAAA >D_biarmipes_CG18428-PC ATGAACAGCAAATCCCATGCACCGGAGACTCCGGAGGAGTACCAGCGACG CCAGAGCCAGATCCGCAGGGAGGTGGATCCGGTCACGGGACGCGTGCGCA TCATCAAGGGCGACAGCGAGGTGCTGGAGGAGATTGTGACCAAGGAGCGC CACCAGGAGATCAACAAGAAGGCCACCCGCGGCGACGGCGAGTTCTACGA GGCCAGATCCCTGGACGCCGCCAGGCGACGCAAA >D_rhopaloa_CG18428-PC ATGAACAGCAAATCGCACGCACCGGAAACTCCAGAGGAGTACCAGCGCCG CCAGAGCCAGATCCGAAGGGAGGTGGACCCGGTCACTGGACGCGTCCGCC TCATCAAGGGCGACAGCGAAGTGCTGGAGGAGATTGTGACCAAGGAGCGC CACGTAGAGATCAACAAGAAGGCCACCCGCGGCGACGGCGAGTTCTATGA GGCCAGATCTCTAGACGCCGCCAGGCGTCGCAAA >D_elegans_CG18428-PC ATGAACAGCAAATCGCACGCACCGGAAACTCCGGAGGAGTACCAGCGCCG CCAGAGCCAAATCCGCAGGGAAGTGGATCCGGTGACGGGACGCGTGCGCC TCATTAAGGGCGACAGCGAGGTGCTGGAGGAGATCGTGACCAAGGAGCGC CACGTTGAGATCAACAAGAAGGCCACCCGCGGCGACGGCGAGTTTTACGA GGCCAGATCTCTAGACGCCGCCAGGCGTCGCAAA
>D_melanogaster_CG18428-PC MNSKSHAPETPEEYQRRQSQIRKEVDPVTGRVRLIKGDSEVLEEIVTKER HLEINKKATRGDGEFYEARSLDAAKRRK >D_sechellia_CG18428-PC MNSKSHAPETPEEYQRRQSQIRKEVDPVTGRVRLIKGDSEVLEEIVTKER HLEINKKATRGDGEFYETRSLNAAKRRK >D_simulans_CG18428-PC MNSKSHAPETPEEYQRRQSQIRKEVDPVTGRVRLIKGDSEVLEEIVTKER HLEINKKATRGDGEFYEARSLNAAKRRK >D_yakuba_CG18428-PC MNSKSHAPETPEEYQRRQSQIRREVDPVTGRVRLIKGDSEVLEEIVTKER HMEINKKATRGDGEFYEARSLDAAKRRK >D_erecta_CG18428-PC MNSKSHAPETPEEYQRRQSQMRREVDPVTGRVRLIKGDSEVLEEIVTKER HLEINKKATRGDGDFYEARSLDAAKRRK >D_biarmipes_CG18428-PC MNSKSHAPETPEEYQRRQSQIRREVDPVTGRVRIIKGDSEVLEEIVTKER HQEINKKATRGDGEFYEARSLDAARRRK >D_rhopaloa_CG18428-PC MNSKSHAPETPEEYQRRQSQIRREVDPVTGRVRLIKGDSEVLEEIVTKER HVEINKKATRGDGEFYEARSLDAARRRK >D_elegans_CG18428-PC MNSKSHAPETPEEYQRRQSQIRREVDPVTGRVRLIKGDSEVLEEIVTKER HVEINKKATRGDGEFYEARSLDAARRRK
#NEXUS
[ID: 3463337272]
begin taxa;
dimensions ntax=8;
taxlabels
D_melanogaster_CG18428-PC
D_sechellia_CG18428-PC
D_simulans_CG18428-PC
D_yakuba_CG18428-PC
D_erecta_CG18428-PC
D_biarmipes_CG18428-PC
D_rhopaloa_CG18428-PC
D_elegans_CG18428-PC
;
end;
begin trees;
translate
1 D_melanogaster_CG18428-PC,
2 D_sechellia_CG18428-PC,
3 D_simulans_CG18428-PC,
4 D_yakuba_CG18428-PC,
5 D_erecta_CG18428-PC,
6 D_biarmipes_CG18428-PC,
7 D_rhopaloa_CG18428-PC,
8 D_elegans_CG18428-PC
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.008587561,(4:0.02555171,5:0.0909236,((6:0.1564851,8:0.09622413)0.656:0.04508715,7:0.06933488)1.000:0.2434026)0.995:0.08792918,(2:0.01310976,3:0.01228675)0.840:0.01899379);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.008587561,(4:0.02555171,5:0.0909236,((6:0.1564851,8:0.09622413):0.04508715,7:0.06933488):0.2434026):0.08792918,(2:0.01310976,3:0.01228675):0.01899379);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/97/CG18428-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/97/CG18428-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/97/CG18428-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -636.04 -647.53
2 -636.06 -647.43
--------------------------------------
TOTAL -636.05 -647.48
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/97/CG18428-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/97/CG18428-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/97/CG18428-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.974838 0.037378 0.635684 1.359396 0.956569 1303.88 1376.33 1.000
r(A<->C){all} 0.062701 0.001248 0.001924 0.129022 0.057431 629.69 745.17 1.000
r(A<->G){all} 0.255102 0.006239 0.110713 0.413127 0.246868 412.99 453.43 1.000
r(A<->T){all} 0.123934 0.004326 0.010409 0.248683 0.116122 314.82 354.42 1.000
r(C<->G){all} 0.031451 0.000353 0.000132 0.066491 0.028339 972.63 1008.08 1.000
r(C<->T){all} 0.480777 0.009057 0.305363 0.662836 0.478004 350.34 443.64 1.000
r(G<->T){all} 0.046034 0.000979 0.000202 0.105632 0.039774 757.16 861.43 1.000
pi(A){all} 0.251260 0.000715 0.201453 0.305140 0.250715 1180.53 1246.57 1.000
pi(C){all} 0.289399 0.000775 0.236963 0.344295 0.288946 1122.45 1178.87 1.000
pi(G){all} 0.335334 0.000823 0.281282 0.392391 0.335209 1079.53 1178.75 1.000
pi(T){all} 0.124007 0.000374 0.087764 0.162542 0.123069 1043.47 1171.88 1.001
alpha{1,2} 0.066606 0.001071 0.001156 0.118569 0.069193 1009.59 1131.88 1.000
alpha{3} 2.018898 0.560860 0.770862 3.513536 1.896984 1364.33 1398.53 1.000
pinvar{all} 0.298303 0.009336 0.101346 0.479317 0.302789 1213.02 1293.17 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/97/CG18428-PC/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 8 ls = 78
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 1 1 1 1 1 0 | Tyr TAT 0 0 0 1 0 0 | Cys TGT 0 0 0 0 0 0
TTC 1 1 1 1 1 1 | TCC 0 0 0 0 0 2 | TAC 2 2 2 1 2 2 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 1 0 | TCG 0 0 0 1 1 0 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 0 0 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 2 2 2 2 2 0
CTC 1 1 1 1 1 0 | CCC 0 0 0 0 0 0 | CAC 1 1 1 1 1 1 | CGC 6 6 6 6 6 7
CTA 0 0 0 0 0 0 | CCA 1 1 1 1 1 0 | Gln CAA 0 0 0 0 0 0 | CGA 0 0 0 0 0 2
CTG 3 3 3 2 2 2 | CCG 2 2 2 2 2 3 | CAG 3 3 3 3 3 4 | CGG 1 1 1 1 1 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 1 1 1 1 1 1 | Asn AAT 1 1 1 2 1 0 | Ser AGT 1 1 1 1 1 0
ATC 3 3 3 3 2 4 | ACC 2 3 2 2 2 2 | AAC 1 2 2 0 1 2 | AGC 2 2 2 2 2 3
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 5 5 5 3 4 2 | Arg AGA 1 1 1 2 1 1
Met ATG 1 1 1 2 2 1 | ACG 1 1 1 1 1 1 | AAG 3 3 3 4 3 4 | AGG 0 0 0 0 1 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 1 0 | Ala GCT 0 0 1 0 1 0 | Asp GAT 1 1 1 2 3 1 | Gly GGT 2 1 1 1 1 0
GTC 1 1 1 1 2 1 | GCC 5 4 4 4 3 4 | GAC 3 2 2 2 2 3 | GGC 1 2 2 2 2 3
GTA 0 0 0 1 1 0 | GCA 0 0 0 1 1 1 | Glu GAA 4 4 4 4 4 0 | GGA 1 1 1 1 1 1
GTG 4 4 4 3 1 4 | GCG 0 0 0 0 0 0 | GAG 7 7 7 7 6 11 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
----------------------------------------------------------------------
Phe TTT 0 1 | Ser TCT 1 1 | Tyr TAT 1 0 | Cys TGT 0 0
TTC 1 0 | TCC 0 0 | TAC 1 2 | TGC 0 0
Leu TTA 0 0 | TCA 0 0 | *** TAA 0 0 | *** TGA 0 0
TTG 0 0 | TCG 1 1 | TAG 0 0 | Trp TGG 0 0
----------------------------------------------------------------------
Leu CTT 0 0 | Pro CCT 0 0 | His CAT 0 0 | Arg CGT 1 1
CTC 1 1 | CCC 0 0 | CAC 2 2 | CGC 7 8
CTA 1 1 | CCA 1 0 | Gln CAA 0 1 | CGA 1 0
CTG 1 1 | CCG 2 3 | CAG 3 2 | CGG 0 0
----------------------------------------------------------------------
Ile ATT 1 1 | Thr ACT 2 1 | Asn AAT 0 0 | Ser AGT 0 0
ATC 3 3 | ACC 2 2 | AAC 2 2 | AGC 3 3
ATA 0 0 | ACA 0 0 | Lys AAA 2 2 | Arg AGA 1 1
Met ATG 1 1 | ACG 0 1 | AAG 4 4 | AGG 2 2
----------------------------------------------------------------------
Val GTT 0 1 | Ala GCT 0 0 | Asp GAT 0 1 | Gly GGT 0 0
GTC 2 0 | GCC 4 4 | GAC 4 3 | GGC 3 3
GTA 1 0 | GCA 1 1 | Glu GAA 2 2 | GGA 1 1
GTG 3 5 | GCG 0 0 | GAG 9 9 | GGG 0 0
----------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_CG18428-PC
position 1: T:0.06410 C:0.26923 A:0.29487 G:0.37179
position 2: T:0.19231 C:0.17949 A:0.41026 G:0.21795
position 3: T:0.14103 C:0.37179 A:0.16667 G:0.32051
Average T:0.13248 C:0.27350 A:0.29060 G:0.30342
#2: D_sechellia_CG18428-PC
position 1: T:0.06410 C:0.26923 A:0.32051 G:0.34615
position 2: T:0.19231 C:0.17949 A:0.41026 G:0.21795
position 3: T:0.12821 C:0.38462 A:0.16667 G:0.32051
Average T:0.12821 C:0.27778 A:0.29915 G:0.29487
#3: D_simulans_CG18428-PC
position 1: T:0.06410 C:0.26923 A:0.30769 G:0.35897
position 2: T:0.19231 C:0.17949 A:0.41026 G:0.21795
position 3: T:0.14103 C:0.37179 A:0.16667 G:0.32051
Average T:0.13248 C:0.27350 A:0.29487 G:0.29915
#4: D_yakuba_CG18428-PC
position 1: T:0.06410 C:0.25641 A:0.30769 G:0.37179
position 2: T:0.19231 C:0.17949 A:0.39744 G:0.23077
position 3: T:0.16667 C:0.33333 A:0.16667 G:0.33333
Average T:0.14103 C:0.25641 A:0.29060 G:0.31197
#5: D_erecta_CG18428-PC
position 1: T:0.07692 C:0.25641 A:0.29487 G:0.37179
position 2: T:0.19231 C:0.17949 A:0.39744 G:0.23077
position 3: T:0.17949 C:0.34615 A:0.16667 G:0.30769
Average T:0.14957 C:0.26068 A:0.28632 G:0.30342
#6: D_biarmipes_CG18428-PC
position 1: T:0.06410 C:0.25641 A:0.30769 G:0.37179
position 2: T:0.17949 C:0.17949 A:0.39744 G:0.24359
position 3: T:0.05128 C:0.44872 A:0.08974 G:0.41026
Average T:0.09829 C:0.29487 A:0.26496 G:0.34188
#7: D_rhopaloa_CG18428-PC
position 1: T:0.06410 C:0.25641 A:0.29487 G:0.38462
position 2: T:0.19231 C:0.17949 A:0.38462 G:0.24359
position 3: T:0.07692 C:0.44872 A:0.14103 G:0.33333
Average T:0.11111 C:0.29487 A:0.27350 G:0.32051
#8: D_elegans_CG18428-PC
position 1: T:0.06410 C:0.25641 A:0.29487 G:0.38462
position 2: T:0.19231 C:0.17949 A:0.38462 G:0.24359
position 3: T:0.08974 C:0.42308 A:0.11538 G:0.37179
Average T:0.11538 C:0.28632 A:0.26496 G:0.33333
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 1 | Ser S TCT 7 | Tyr Y TAT 2 | Cys C TGT 0
TTC 7 | TCC 2 | TAC 14 | TGC 0
Leu L TTA 0 | TCA 3 | *** * TAA 0 | *** * TGA 0
TTG 1 | TCG 4 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 0 | His H CAT 6 | Arg R CGT 12
CTC 7 | CCC 0 | CAC 10 | CGC 52
CTA 2 | CCA 6 | Gln Q CAA 1 | CGA 3
CTG 17 | CCG 18 | CAG 24 | CGG 5
------------------------------------------------------------------------------
Ile I ATT 8 | Thr T ACT 9 | Asn N AAT 6 | Ser S AGT 5
ATC 24 | ACC 17 | AAC 12 | AGC 19
ATA 0 | ACA 0 | Lys K AAA 28 | Arg R AGA 9
Met M ATG 10 | ACG 7 | AAG 28 | AGG 7
------------------------------------------------------------------------------
Val V GTT 2 | Ala A GCT 2 | Asp D GAT 10 | Gly G GGT 6
GTC 9 | GCC 32 | GAC 21 | GGC 18
GTA 3 | GCA 5 | Glu E GAA 24 | GGA 8
GTG 28 | GCG 0 | GAG 63 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.06571 C:0.26122 A:0.30288 G:0.37019
position 2: T:0.19071 C:0.17949 A:0.39904 G:0.23077
position 3: T:0.12179 C:0.39103 A:0.14744 G:0.33974
Average T:0.12607 C:0.27724 A:0.28312 G:0.31357
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_CG18428-PC
D_sechellia_CG18428-PC 0.6119 (0.0113 0.0184)
D_simulans_CG18428-PC 0.1505 (0.0056 0.0373) 0.3048 (0.0056 0.0184)
D_yakuba_CG18428-PC 0.0533 (0.0112 0.2106) 0.0961 (0.0226 0.2354) 0.0718 (0.0169 0.2354)
D_erecta_CG18428-PC 0.0587 (0.0169 0.2876) 0.0900 (0.0284 0.3151) 0.0718 (0.0226 0.3151) 0.0891 (0.0168 0.1891)
D_biarmipes_CG18428-PC 0.0345 (0.0227 0.6576) 0.0521 (0.0343 0.6576) 0.0432 (0.0284 0.6576) 0.0338 (0.0226 0.6686) 0.0423 (0.0283 0.6694)
D_rhopaloa_CG18428-PC 0.0260 (0.0170 0.6518) 0.0437 (0.0285 0.6518) 0.0348 (0.0227 0.6518) 0.0270 (0.0141 0.5215) 0.0341 (0.0226 0.6634) 0.0499 (0.0169 0.3398)
D_elegans_CG18428-PC 0.0212 (0.0169 0.7999) 0.0356 (0.0284 0.7999) 0.0283 (0.0227 0.7999) 0.0178 (0.0140 0.7880) 0.0323 (0.0255 0.7890) 0.0660 (0.0198 0.2994)-1.0000 (0.0000 0.3110)
Model 0: one-ratio
TREE # 1: (1, (4, 5, ((6, 8), 7)), (2, 3)); MP score: 65
lnL(ntime: 12 np: 14): -595.143390 +0.000000
9..1 9..10 10..4 10..5 10..11 11..12 12..6 12..8 11..7 9..13 13..2 13..3
0.000004 0.123252 0.061677 0.112297 0.314826 0.035460 0.184700 0.121364 0.097846 0.025505 0.013011 0.012332 2.600020 0.038658
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.10227
(1: 0.000004, (4: 0.061677, 5: 0.112297, ((6: 0.184700, 8: 0.121364): 0.035460, 7: 0.097846): 0.314826): 0.123252, (2: 0.013011, 3: 0.012332): 0.025505);
(D_melanogaster_CG18428-PC: 0.000004, (D_yakuba_CG18428-PC: 0.061677, D_erecta_CG18428-PC: 0.112297, ((D_biarmipes_CG18428-PC: 0.184700, D_elegans_CG18428-PC: 0.121364): 0.035460, D_rhopaloa_CG18428-PC: 0.097846): 0.314826): 0.123252, (D_sechellia_CG18428-PC: 0.013011, D_simulans_CG18428-PC: 0.012332): 0.025505);
Detailed output identifying parameters
kappa (ts/tv) = 2.60002
omega (dN/dS) = 0.03866
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.000 185.2 48.8 0.0387 0.0000 0.0000 0.0 0.0
9..10 0.123 185.2 48.8 0.0387 0.0066 0.1719 1.2 8.4
10..4 0.062 185.2 48.8 0.0387 0.0033 0.0860 0.6 4.2
10..5 0.112 185.2 48.8 0.0387 0.0061 0.1566 1.1 7.6
10..11 0.315 185.2 48.8 0.0387 0.0170 0.4391 3.1 21.4
11..12 0.035 185.2 48.8 0.0387 0.0019 0.0495 0.4 2.4
12..6 0.185 185.2 48.8 0.0387 0.0100 0.2576 1.8 12.6
12..8 0.121 185.2 48.8 0.0387 0.0065 0.1693 1.2 8.3
11..7 0.098 185.2 48.8 0.0387 0.0053 0.1365 1.0 6.7
9..13 0.026 185.2 48.8 0.0387 0.0014 0.0356 0.3 1.7
13..2 0.013 185.2 48.8 0.0387 0.0007 0.0181 0.1 0.9
13..3 0.012 185.2 48.8 0.0387 0.0007 0.0172 0.1 0.8
tree length for dN: 0.0594
tree length for dS: 1.5374
Time used: 0:08
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, (4, 5, ((6, 8), 7)), (2, 3)); MP score: 65
lnL(ntime: 12 np: 15): -587.693763 +0.000000
9..1 9..10 10..4 10..5 10..11 11..12 12..6 12..8 11..7 9..13 13..2 13..3
0.000004 0.131261 0.052541 0.122809 0.331659 0.040704 0.197284 0.123909 0.095592 0.025896 0.013212 0.012508 2.637130 0.984766 0.023320
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.14738
(1: 0.000004, (4: 0.052541, 5: 0.122809, ((6: 0.197284, 8: 0.123909): 0.040704, 7: 0.095592): 0.331659): 0.131261, (2: 0.013212, 3: 0.012508): 0.025896);
(D_melanogaster_CG18428-PC: 0.000004, (D_yakuba_CG18428-PC: 0.052541, D_erecta_CG18428-PC: 0.122809, ((D_biarmipes_CG18428-PC: 0.197284, D_elegans_CG18428-PC: 0.123909): 0.040704, D_rhopaloa_CG18428-PC: 0.095592): 0.331659): 0.131261, (D_sechellia_CG18428-PC: 0.013212, D_simulans_CG18428-PC: 0.012508): 0.025896);
Detailed output identifying parameters
kappa (ts/tv) = 2.63713
dN/dS (w) for site classes (K=2)
p: 0.98477 0.01523
w: 0.02332 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.000 185.1 48.9 0.0382 0.0000 0.0000 0.0 0.0
9..10 0.131 185.1 48.9 0.0382 0.0070 0.1830 1.3 8.9
10..4 0.053 185.1 48.9 0.0382 0.0028 0.0733 0.5 3.6
10..5 0.123 185.1 48.9 0.0382 0.0065 0.1712 1.2 8.4
10..11 0.332 185.1 48.9 0.0382 0.0177 0.4624 3.3 22.6
11..12 0.041 185.1 48.9 0.0382 0.0022 0.0568 0.4 2.8
12..6 0.197 185.1 48.9 0.0382 0.0105 0.2751 1.9 13.4
12..8 0.124 185.1 48.9 0.0382 0.0066 0.1728 1.2 8.4
11..7 0.096 185.1 48.9 0.0382 0.0051 0.1333 0.9 6.5
9..13 0.026 185.1 48.9 0.0382 0.0014 0.0361 0.3 1.8
13..2 0.013 185.1 48.9 0.0382 0.0007 0.0184 0.1 0.9
13..3 0.013 185.1 48.9 0.0382 0.0007 0.0174 0.1 0.9
Time used: 0:13
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, (4, 5, ((6, 8), 7)), (2, 3)); MP score: 65
check convergence..
lnL(ntime: 12 np: 17): -586.083879 +0.000000
9..1 9..10 10..4 10..5 10..11 11..12 12..6 12..8 11..7 9..13 13..2 13..3
0.000004 0.143160 0.048364 0.136288 0.368486 0.056708 0.212692 0.132568 0.095427 0.027163 0.013835 0.013126 2.876656 0.987157 0.000000 0.025173 4.351905
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.24782
(1: 0.000004, (4: 0.048364, 5: 0.136288, ((6: 0.212692, 8: 0.132568): 0.056708, 7: 0.095427): 0.368486): 0.143160, (2: 0.013835, 3: 0.013126): 0.027163);
(D_melanogaster_CG18428-PC: 0.000004, (D_yakuba_CG18428-PC: 0.048364, D_erecta_CG18428-PC: 0.136288, ((D_biarmipes_CG18428-PC: 0.212692, D_elegans_CG18428-PC: 0.132568): 0.056708, D_rhopaloa_CG18428-PC: 0.095427): 0.368486): 0.143160, (D_sechellia_CG18428-PC: 0.013835, D_simulans_CG18428-PC: 0.013126): 0.027163);
Detailed output identifying parameters
kappa (ts/tv) = 2.87666
dN/dS (w) for site classes (K=3)
p: 0.98716 0.00000 0.01284
w: 0.02517 1.00000 4.35191
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.000 184.4 49.6 0.0807 0.0000 0.0000 0.0 0.0
9..10 0.143 184.4 49.6 0.0807 0.0140 0.1733 2.6 8.6
10..4 0.048 184.4 49.6 0.0807 0.0047 0.0585 0.9 2.9
10..5 0.136 184.4 49.6 0.0807 0.0133 0.1650 2.5 8.2
10..11 0.368 184.4 49.6 0.0807 0.0360 0.4460 6.6 22.1
11..12 0.057 184.4 49.6 0.0807 0.0055 0.0686 1.0 3.4
12..6 0.213 184.4 49.6 0.0807 0.0208 0.2574 3.8 12.8
12..8 0.133 184.4 49.6 0.0807 0.0130 0.1605 2.4 8.0
11..7 0.095 184.4 49.6 0.0807 0.0093 0.1155 1.7 5.7
9..13 0.027 184.4 49.6 0.0807 0.0027 0.0329 0.5 1.6
13..2 0.014 184.4 49.6 0.0807 0.0014 0.0167 0.2 0.8
13..3 0.013 184.4 49.6 0.0807 0.0013 0.0159 0.2 0.8
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG18428-PC)
Pr(w>1) post mean +- SE for w
52 L 1.000** 4.352
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG18428-PC)
Pr(w>1) post mean +- SE for w
52 L 0.850 5.257 +- 3.010
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.060 0.099 0.118 0.121 0.117 0.111 0.103 0.096 0.090 0.084
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.010 0.988
sum of density on p0-p1 = 1.000000
Time used: 0:36
Model 3: discrete (3 categories)
TREE # 1: (1, (4, 5, ((6, 8), 7)), (2, 3)); MP score: 65
lnL(ntime: 12 np: 18): -586.083879 +0.000000
9..1 9..10 10..4 10..5 10..11 11..12 12..6 12..8 11..7 9..13 13..2 13..3
0.000004 0.143160 0.048364 0.136288 0.368486 0.056708 0.212692 0.132568 0.095427 0.027163 0.013835 0.013126 2.876654 0.000016 0.987141 0.025164 0.025173 4.351902
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.24782
(1: 0.000004, (4: 0.048364, 5: 0.136288, ((6: 0.212692, 8: 0.132568): 0.056708, 7: 0.095427): 0.368486): 0.143160, (2: 0.013835, 3: 0.013126): 0.027163);
(D_melanogaster_CG18428-PC: 0.000004, (D_yakuba_CG18428-PC: 0.048364, D_erecta_CG18428-PC: 0.136288, ((D_biarmipes_CG18428-PC: 0.212692, D_elegans_CG18428-PC: 0.132568): 0.056708, D_rhopaloa_CG18428-PC: 0.095427): 0.368486): 0.143160, (D_sechellia_CG18428-PC: 0.013835, D_simulans_CG18428-PC: 0.013126): 0.027163);
Detailed output identifying parameters
kappa (ts/tv) = 2.87665
dN/dS (w) for site classes (K=3)
p: 0.00002 0.98714 0.01284
w: 0.02516 0.02517 4.35190
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.000 184.4 49.6 0.0807 0.0000 0.0000 0.0 0.0
9..10 0.143 184.4 49.6 0.0807 0.0140 0.1733 2.6 8.6
10..4 0.048 184.4 49.6 0.0807 0.0047 0.0585 0.9 2.9
10..5 0.136 184.4 49.6 0.0807 0.0133 0.1650 2.5 8.2
10..11 0.368 184.4 49.6 0.0807 0.0360 0.4460 6.6 22.1
11..12 0.057 184.4 49.6 0.0807 0.0055 0.0686 1.0 3.4
12..6 0.213 184.4 49.6 0.0807 0.0208 0.2574 3.8 12.8
12..8 0.133 184.4 49.6 0.0807 0.0130 0.1605 2.4 8.0
11..7 0.095 184.4 49.6 0.0807 0.0093 0.1155 1.7 5.7
9..13 0.027 184.4 49.6 0.0807 0.0027 0.0329 0.5 1.6
13..2 0.014 184.4 49.6 0.0807 0.0014 0.0167 0.2 0.8
13..3 0.013 184.4 49.6 0.0807 0.0013 0.0159 0.2 0.8
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG18428-PC)
Pr(w>1) post mean +- SE for w
52 L 1.000** 4.352
Time used: 0:54
Model 7: beta (10 categories)
TREE # 1: (1, (4, 5, ((6, 8), 7)), (2, 3)); MP score: 65
lnL(ntime: 12 np: 15): -591.386125 +0.000000
9..1 9..10 10..4 10..5 10..11 11..12 12..6 12..8 11..7 9..13 13..2 13..3
0.000004 0.127208 0.058015 0.117796 0.323405 0.037190 0.189106 0.122697 0.097654 0.025771 0.013108 0.012514 2.631555 0.125465 2.370059
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.12447
(1: 0.000004, (4: 0.058015, 5: 0.117796, ((6: 0.189106, 8: 0.122697): 0.037190, 7: 0.097654): 0.323405): 0.127208, (2: 0.013108, 3: 0.012514): 0.025771);
(D_melanogaster_CG18428-PC: 0.000004, (D_yakuba_CG18428-PC: 0.058015, D_erecta_CG18428-PC: 0.117796, ((D_biarmipes_CG18428-PC: 0.189106, D_elegans_CG18428-PC: 0.122697): 0.037190, D_rhopaloa_CG18428-PC: 0.097654): 0.323405): 0.127208, (D_sechellia_CG18428-PC: 0.013108, D_simulans_CG18428-PC: 0.012514): 0.025771);
Detailed output identifying parameters
kappa (ts/tv) = 2.63156
Parameters in M7 (beta):
p = 0.12547 q = 2.37006
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00001 0.00007 0.00055 0.00271 0.01036 0.03332 0.09768 0.30371
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.000 185.1 48.9 0.0448 0.0000 0.0000 0.0 0.0
9..10 0.127 185.1 48.9 0.0448 0.0078 0.1736 1.4 8.5
10..4 0.058 185.1 48.9 0.0448 0.0035 0.0792 0.7 3.9
10..5 0.118 185.1 48.9 0.0448 0.0072 0.1607 1.3 7.9
10..11 0.323 185.1 48.9 0.0448 0.0198 0.4413 3.7 21.6
11..12 0.037 185.1 48.9 0.0448 0.0023 0.0507 0.4 2.5
12..6 0.189 185.1 48.9 0.0448 0.0116 0.2581 2.1 12.6
12..8 0.123 185.1 48.9 0.0448 0.0075 0.1674 1.4 8.2
11..7 0.098 185.1 48.9 0.0448 0.0060 0.1333 1.1 6.5
9..13 0.026 185.1 48.9 0.0448 0.0016 0.0352 0.3 1.7
13..2 0.013 185.1 48.9 0.0448 0.0008 0.0179 0.1 0.9
13..3 0.013 185.1 48.9 0.0448 0.0008 0.0171 0.1 0.8
Time used: 1:29
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, (4, 5, ((6, 8), 7)), (2, 3)); MP score: 65
lnL(ntime: 12 np: 17): -586.196792 +0.000000
9..1 9..10 10..4 10..5 10..11 11..12 12..6 12..8 11..7 9..13 13..2 13..3
0.000004 0.143152 0.048385 0.136300 0.368259 0.056709 0.212450 0.132548 0.095422 0.027163 0.013833 0.013130 2.880508 0.987158 2.644790 99.000000 4.372858
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.24736
(1: 0.000004, (4: 0.048385, 5: 0.136300, ((6: 0.212450, 8: 0.132548): 0.056709, 7: 0.095422): 0.368259): 0.143152, (2: 0.013833, 3: 0.013130): 0.027163);
(D_melanogaster_CG18428-PC: 0.000004, (D_yakuba_CG18428-PC: 0.048385, D_erecta_CG18428-PC: 0.136300, ((D_biarmipes_CG18428-PC: 0.212450, D_elegans_CG18428-PC: 0.132548): 0.056709, D_rhopaloa_CG18428-PC: 0.095422): 0.368259): 0.143152, (D_sechellia_CG18428-PC: 0.013833, D_simulans_CG18428-PC: 0.013130): 0.027163);
Detailed output identifying parameters
kappa (ts/tv) = 2.88051
Parameters in M8 (beta&w>1):
p0 = 0.98716 p = 2.64479 q = 99.00000
(p1 = 0.01284) w = 4.37286
dN/dS (w) for site classes (K=11)
p: 0.09872 0.09872 0.09872 0.09872 0.09872 0.09872 0.09872 0.09872 0.09872 0.09872 0.01284
w: 0.00640 0.01088 0.01441 0.01775 0.02117 0.02487 0.02912 0.03436 0.04170 0.05606 4.37286
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.000 184.4 49.6 0.0815 0.0000 0.0000 0.0 0.0
9..10 0.143 184.4 49.6 0.0815 0.0141 0.1729 2.6 8.6
10..4 0.048 184.4 49.6 0.0815 0.0048 0.0584 0.9 2.9
10..5 0.136 184.4 49.6 0.0815 0.0134 0.1646 2.5 8.2
10..11 0.368 184.4 49.6 0.0815 0.0362 0.4447 6.7 22.0
11..12 0.057 184.4 49.6 0.0815 0.0056 0.0685 1.0 3.4
12..6 0.212 184.4 49.6 0.0815 0.0209 0.2565 3.9 12.7
12..8 0.133 184.4 49.6 0.0815 0.0130 0.1601 2.4 7.9
11..7 0.095 184.4 49.6 0.0815 0.0094 0.1152 1.7 5.7
9..13 0.027 184.4 49.6 0.0815 0.0027 0.0328 0.5 1.6
13..2 0.014 184.4 49.6 0.0815 0.0014 0.0167 0.3 0.8
13..3 0.013 184.4 49.6 0.0815 0.0013 0.0159 0.2 0.8
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG18428-PC)
Pr(w>1) post mean +- SE for w
52 L 1.000** 4.373
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG18428-PC)
Pr(w>1) post mean +- SE for w
52 L 0.961* 5.788 +- 2.781
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.999
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.001 0.005 0.023 0.066 0.148 0.282 0.475
ws: 0.056 0.099 0.120 0.124 0.119 0.112 0.104 0.096 0.089 0.082
Time used: 2:47
Model 1: NearlyNeutral -587.693763
Model 2: PositiveSelection -586.083879
Model 0: one-ratio -595.14339
Model 3: discrete -586.083879
Model 7: beta -591.386125
Model 8: beta&w>1 -586.196792
Model 0 vs 1 14.899253999999928
Model 2 vs 1 3.219767999999931
Model 8 vs 7 10.378666000000067
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG18428-PC)
Pr(w>1) post mean +- SE for w
52 L 1.000** 4.373
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG18428-PC)
Pr(w>1) post mean +- SE for w
52 L 0.961* 5.788 +- 2.781
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
