--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Sat Dec 03 00:07:16 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/96/CG1840-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -742.50 -751.52
2 -742.57 -752.69
--------------------------------------
TOTAL -742.54 -752.27
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.465374 0.014658 0.267025 0.716394 0.444457 1027.48 1154.69 1.000
r(A<->C){all} 0.206571 0.005772 0.070171 0.359691 0.198798 463.96 656.87 1.000
r(A<->G){all} 0.070161 0.000967 0.020661 0.135151 0.065027 866.38 899.90 1.000
r(A<->T){all} 0.122038 0.004655 0.001412 0.248251 0.114263 503.14 651.14 1.000
r(C<->G){all} 0.016854 0.000217 0.000003 0.045159 0.012710 984.58 995.18 1.000
r(C<->T){all} 0.576538 0.007704 0.414927 0.751283 0.578010 535.87 563.71 1.000
r(G<->T){all} 0.007838 0.000062 0.000006 0.023058 0.005387 1083.84 1085.55 1.000
pi(A){all} 0.201540 0.000395 0.163875 0.240629 0.200672 810.85 1060.95 1.000
pi(C){all} 0.209482 0.000392 0.170932 0.248240 0.209206 1250.45 1323.77 1.000
pi(G){all} 0.377836 0.000626 0.326531 0.424200 0.377303 1241.45 1327.41 1.001
pi(T){all} 0.211143 0.000401 0.172406 0.251682 0.210190 1255.58 1314.12 1.000
alpha{1,2} 0.057268 0.002017 0.000103 0.143223 0.048292 1477.05 1489.02 1.000
alpha{3} 1.482187 0.472265 0.409050 2.820119 1.352726 1324.18 1383.16 1.000
pinvar{all} 0.343644 0.014084 0.094017 0.557037 0.354884 1412.63 1451.10 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -687.73277
Model 2: PositiveSelection -683.687084
Model 0: one-ratio -688.917886
Model 3: discrete -683.687084
Model 7: beta -688.1768
Model 8: beta&w>1 -683.70777
Model 0 vs 1 2.3702319999999872
Model 2 vs 1 8.091371999999865
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG1840-PA)
Pr(w>1) post mean +- SE for w
96 R 1.000** 39.997
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG1840-PA)
Pr(w>1) post mean +- SE for w
96 R 0.958* 6.725 +- 2.906
Model 8 vs 7 8.93805999999995
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG1840-PA)
Pr(w>1) post mean +- SE for w
96 R 1.000** 40.034
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG1840-PA)
Pr(w>1) post mean +- SE for w
96 R 0.975* 5.992 +- 2.950
>C1
MAYVDQNGRLWEKRPWDLRRVLDTFVGIWFAVKQLLASFLSPFTGNDSNG
DNSRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGSGYRGGGLRPNRR
IGRIPPPSQSCNAGGCCG
>C2
MAYVDQYGRLWEKRPWDLKRVLDIFVGIWFAVKQLFASFLSPFTGNDSNG
DNFRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGYRGGGLRPNPRIG
RIPPPSQSCSAGGCCGoo
>C3
MAYVDQYGRLWEKRPWDLKRVLDIFVGIWFAVKQLFASFLSPFTGNDSNG
DNFRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGGGYRGGGLRPNKR
IGRIPPPSQSCSAGGCCG
>C4
MAYVDQNGRLWEKRPWDLRRVLAIFVGIWFAIKQLFASFLSPFTGNDNNG
DNSRRGSGWGSSSWGGGGGGGGGGGGGGGGGGGGGGYGGGGLRPNRRIGR
IPPPSQSCSAGGCCGooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=121
C1 MAYVDQNGRLWEKRPWDLRRVLDTFVGIWFAVKQLLASFLSPFTGNDSNG
C2 MAYVDQYGRLWEKRPWDLKRVLDIFVGIWFAVKQLFASFLSPFTGNDSNG
C3 MAYVDQYGRLWEKRPWDLKRVLDIFVGIWFAVKQLFASFLSPFTGNDSNG
C4 MAYVDQNGRLWEKRPWDLRRVLAIFVGIWFAIKQLFASFLSPFTGNDNNG
****** ***********:*** *******:***:***********.**
C1 DNSRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGSGYRGGGLRPNRR
C2 DNFRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGG--YRGGGLRPNPR
C3 DNFRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGGGYRGGGLRPNKR
C4 DNSRRGSGWGSSSWGGGGGGGGGGGGGGGGGGG-GGG--YGGGGLRPNRR
** ***.************************** *** * ******* *
C1 IGRIPPPSQSCNAGGCCG---
C2 IGRIPPPSQSCSAGGCCGoo-
C3 IGRIPPPSQSCSAGGCCG---
C4 IGRIPPPSQSCSAGGCCGooo
***********.******
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [1942]--->[1910]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.198 Mb, Max= 30.388 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MAYVDQNGRLWEKRPWDLRRVLDTFVGIWFAVKQLLASFLSPFTGNDSNG
DNSRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGSGYRGGGLRPNRR
IGRIPPPSQSCNAGGCCG---
>C2
MAYVDQYGRLWEKRPWDLKRVLDIFVGIWFAVKQLFASFLSPFTGNDSNG
DNFRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGG--YRGGGLRPNPR
IGRIPPPSQSCSAGGCCGoo-
>C3
MAYVDQYGRLWEKRPWDLKRVLDIFVGIWFAVKQLFASFLSPFTGNDSNG
DNFRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGGGYRGGGLRPNKR
IGRIPPPSQSCSAGGCCG---
>C4
MAYVDQNGRLWEKRPWDLRRVLAIFVGIWFAIKQLFASFLSPFTGNDNNG
DNSRRGSGWGSSSWGGGGGGGGGGGGGGGGGGG-GGG--YGGGGLRPNRR
IGRIPPPSQSCSAGGCCGooo
FORMAT of file /tmp/tmp4226681104109443730aln Not Supported[FATAL:T-COFFEE]
>C1
MAYVDQNGRLWEKRPWDLRRVLDTFVGIWFAVKQLLASFLSPFTGNDSNG
DNSRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGSGYRGGGLRPNRR
IGRIPPPSQSCNAGGCCG---
>C2
MAYVDQYGRLWEKRPWDLKRVLDIFVGIWFAVKQLFASFLSPFTGNDSNG
DNFRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGG--YRGGGLRPNPR
IGRIPPPSQSCSAGGCCGoo-
>C3
MAYVDQYGRLWEKRPWDLKRVLDIFVGIWFAVKQLFASFLSPFTGNDSNG
DNFRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGGGYRGGGLRPNKR
IGRIPPPSQSCSAGGCCG---
>C4
MAYVDQNGRLWEKRPWDLRRVLAIFVGIWFAIKQLFASFLSPFTGNDNNG
DNSRRGSGWGSSSWGGGGGGGGGGGGGGGGGGG-GGG--YGGGGLRPNRR
IGRIPPPSQSCSAGGCCGooo
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:121 S:90 BS:121
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# PW_SEQ_DISTANCES
BOT 0 1 93.97 C1 C2 93.97
TOP 1 0 93.97 C2 C1 93.97
BOT 0 2 93.22 C1 C3 93.22
TOP 2 0 93.22 C3 C1 93.22
BOT 0 3 93.04 C1 C4 93.04
TOP 3 0 93.04 C4 C1 93.04
BOT 1 2 99.14 C2 C3 99.14
TOP 2 1 99.14 C3 C2 99.14
BOT 1 3 92.31 C2 C4 92.31
TOP 3 1 92.31 C4 C2 92.31
BOT 2 3 92.17 C3 C4 92.17
TOP 3 2 92.17 C4 C3 92.17
AVG 0 C1 * 93.41
AVG 1 C2 * 95.14
AVG 2 C3 * 94.84
AVG 3 C4 * 92.51
TOT TOT * 93.97
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCGTACGTCGATCAAAATGGTCGTCTGTGGGAGAAACGTCCATGGGA
C2 ATGGCGTACGTCGATCAATATGGTCGTCTGTGGGAGAAACGTCCTTGGGA
C3 ATGGCGTACGTCGATCAATATGGTCGTCTGTGGGAGAAACGTCCTTGGGA
C4 ATGGCGTACGTCGATCAAAATGGTCGCCTATGGGAGAAACGTCCTTGGGA
******************:******* **.**************:*****
C1 CTTGAGACGAGTTTTGGACACATTCGTGGGTATATGGTTCGCCGTCAAAC
C2 CTTGAAACGAGTTTTGGACATATTCGTGGGTATATGGTTCGCCGTCAAAC
C3 CTTGAAACGAGTTTTGGACATATTCGTGGGTATATGGTTCGCCGTCAAAC
C4 CTTGAGACGGGTTTTGGCCATCTTCGTGGGTATATGGTTTGCCATCAAGC
*****.***.*******.** .***************** ***.****.*
C1 AGTTGCTTGCATCGTTCCTGTCTCCATTCACTGGAAATGATAGCAACGGA
C2 AGTTGTTTGCATCGTTCCTGTCTCCATTCACTGGAAATGATAGCAACGGA
C3 AGTTGTTTGCATCGTTCCTGTCTCCATTCACTGGAAATGATAGCAACGGA
C4 AGTTGTTTGCATCGTTCCTGTCTCCATTCACTGGAAATGATAACAACGGA
***** ************************************.*******
C1 GATAACTCCCGTCGAGGAAATGGATGGGGAAGTAGTAGCTGGGGCGGAGG
C2 GATAACTTCCGTCGAGGAAATGGATGGGGAAGTAGCAGCTGGGGTGGAGG
C3 GATAACTTCCGTCGAGGAAATGGATGGGGAAGTAGCAGCTGGGGTGGAGG
C4 GACAACTCCCGTCGAGGAAGCGGATGGGGAAGTAGCAGCTGGGGCGGAGG
** **** ***********. ************** ******** *****
C1 GGGCGGTGGTGGTGGCGGCGGAGGCGGTGGCGGCGGAGGCGGTGGCGGAG
C2 GGGCGGTGGTGGTGGCGGTGGTGGTGGTGGCGGAGGTGGTGGCGGTGGCG
C3 GGGCGGTGGTGGCGGCGGTGGCGGTGGTGGCGGAGGTGGTGGCGGTGGCG
C4 CGGAGGAGGAGGTGGTGGTGGTGGTGGAGGTGGAGGCGGTGGAGGAGGA-
**.**:**:** ** ** ** ** **:** **.** ** ** ** **.
C1 GCGGAGGCGGTAGCGGTTATCGCGGAGGTGGATTAAGGCCTAATCGACGA
C2 GCGGAGGTGGA------TATCGCGGAGGCGGATTAAGGCCTAACCCACGA
C3 GTGGCGGCGGCGGTGGATATCGCGGAGGCGGATTAAGGCCTAACAAACGA
C4 --GGAGGTGGA------TATGGCGGAGGCGGATTAAGGCCCAACCGACGA
**.** ** *** ******* *********** ** . ****
C1 ATTGGGCGCATTCCGCCCCCCTCCCAATCCTGCAATGCCGGAGGATGCTG
C2 ATTGGGCGCATTCCGCCCCCCTCCCAATCCTGCAGTGCCGGAGGATGCTG
C3 ATTGGGCGCATTCCGCCCCCCTCCCAATCCTGCAGTGCCGGAGGATGCTG
C4 ATTGGGCGCATACCGCCGCCCTCCCAATCCTGTAGTGCTGGAGGATGCTG
***********:***** ************** *.*** ***********
C1 CGGC---------
C2 CGGC---------
C3 CGGC---------
C4 CGGC---------
****
>C1
ATGGCGTACGTCGATCAAAATGGTCGTCTGTGGGAGAAACGTCCATGGGA
CTTGAGACGAGTTTTGGACACATTCGTGGGTATATGGTTCGCCGTCAAAC
AGTTGCTTGCATCGTTCCTGTCTCCATTCACTGGAAATGATAGCAACGGA
GATAACTCCCGTCGAGGAAATGGATGGGGAAGTAGTAGCTGGGGCGGAGG
GGGCGGTGGTGGTGGCGGCGGAGGCGGTGGCGGCGGAGGCGGTGGCGGAG
GCGGAGGCGGTAGCGGTTATCGCGGAGGTGGATTAAGGCCTAATCGACGA
ATTGGGCGCATTCCGCCCCCCTCCCAATCCTGCAATGCCGGAGGATGCTG
CGGC---------
>C2
ATGGCGTACGTCGATCAATATGGTCGTCTGTGGGAGAAACGTCCTTGGGA
CTTGAAACGAGTTTTGGACATATTCGTGGGTATATGGTTCGCCGTCAAAC
AGTTGTTTGCATCGTTCCTGTCTCCATTCACTGGAAATGATAGCAACGGA
GATAACTTCCGTCGAGGAAATGGATGGGGAAGTAGCAGCTGGGGTGGAGG
GGGCGGTGGTGGTGGCGGTGGTGGTGGTGGCGGAGGTGGTGGCGGTGGCG
GCGGAGGTGGA------TATCGCGGAGGCGGATTAAGGCCTAACCCACGA
ATTGGGCGCATTCCGCCCCCCTCCCAATCCTGCAGTGCCGGAGGATGCTG
CGGC---------
>C3
ATGGCGTACGTCGATCAATATGGTCGTCTGTGGGAGAAACGTCCTTGGGA
CTTGAAACGAGTTTTGGACATATTCGTGGGTATATGGTTCGCCGTCAAAC
AGTTGTTTGCATCGTTCCTGTCTCCATTCACTGGAAATGATAGCAACGGA
GATAACTTCCGTCGAGGAAATGGATGGGGAAGTAGCAGCTGGGGTGGAGG
GGGCGGTGGTGGCGGCGGTGGCGGTGGTGGCGGAGGTGGTGGCGGTGGCG
GTGGCGGCGGCGGTGGATATCGCGGAGGCGGATTAAGGCCTAACAAACGA
ATTGGGCGCATTCCGCCCCCCTCCCAATCCTGCAGTGCCGGAGGATGCTG
CGGC---------
>C4
ATGGCGTACGTCGATCAAAATGGTCGCCTATGGGAGAAACGTCCTTGGGA
CTTGAGACGGGTTTTGGCCATCTTCGTGGGTATATGGTTTGCCATCAAGC
AGTTGTTTGCATCGTTCCTGTCTCCATTCACTGGAAATGATAACAACGGA
GACAACTCCCGTCGAGGAAGCGGATGGGGAAGTAGCAGCTGGGGCGGAGG
CGGAGGAGGAGGTGGTGGTGGTGGTGGAGGTGGAGGCGGTGGAGGAGGA-
--GGAGGTGGA------TATGGCGGAGGCGGATTAAGGCCCAACCGACGA
ATTGGGCGCATACCGCCGCCCTCCCAATCCTGTAGTGCTGGAGGATGCTG
CGGC---------
>C1
MAYVDQNGRLWEKRPWDLRRVLDTFVGIWFAVKQLLASFLSPFTGNDSNG
DNSRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGSGYRGGGLRPNRR
IGRIPPPSQSCNAGGCCG
>C2
MAYVDQYGRLWEKRPWDLKRVLDIFVGIWFAVKQLFASFLSPFTGNDSNG
DNFRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGooYRGGGLRPNPR
IGRIPPPSQSCSAGGCCG
>C3
MAYVDQYGRLWEKRPWDLKRVLDIFVGIWFAVKQLFASFLSPFTGNDSNG
DNFRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGGGYRGGGLRPNKR
IGRIPPPSQSCSAGGCCG
>C4
MAYVDQNGRLWEKRPWDLRRVLAIFVGIWFAIKQLFASFLSPFTGNDNNG
DNSRRGSGWGSSSWGGGGGGGGGGGGGGGGGGGoGGGooYGGGGLRPNRR
IGRIPPPSQSCSAGGCCG
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 4 taxa and 363 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1480723495
Setting output file names to "/opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 415415018
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 6353865116
Seed = 440696255
Swapseed = 1480723495
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.35 % Dirichlet(Revmat{all})
1.35 % Slider(Revmat{all})
1.35 % Dirichlet(Pi{all})
1.35 % Slider(Pi{all})
2.70 % Multiplier(Alpha{1,2})
2.70 % Multiplier(Alpha{3})
2.70 % Slider(Pinvar{all})
13.51 % NNI(Tau{all},V{all})
13.51 % ParsSPR(Tau{all},V{all})
40.54 % Multiplier(V{all})
13.51 % Nodeslider(V{all})
5.41 % TLMultiplier(V{all})
Division 1 has 13 unique site patterns
Division 2 has 15 unique site patterns
Division 3 has 31 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -875.309402 -- -26.620141
Chain 2 -- -872.168366 -- -26.620141
Chain 3 -- -875.309402 -- -26.620141
Chain 4 -- -872.168366 -- -26.620141
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -875.309402 -- -26.620141
Chain 2 -- -858.895636 -- -26.620141
Chain 3 -- -858.895636 -- -26.620141
Chain 4 -- -872.168366 -- -26.620141
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-875.309] (-872.168) (-875.309) (-872.168) * [-875.309] (-858.896) (-858.896) (-872.168)
500 -- (-785.873) (-783.692) (-785.669) [-779.746] * [-784.714] (-790.211) (-788.290) (-790.241) -- 0:00:00
1000 -- [-776.234] (-770.899) (-776.029) (-771.319) * [-767.708] (-787.117) (-783.438) (-783.018) -- 0:00:00
1500 -- (-780.113) (-767.645) (-774.399) [-775.015] * (-760.825) (-780.961) [-761.450] (-777.207) -- 0:11:05
2000 -- (-778.673) (-761.054) (-771.846) [-764.036] * (-761.030) (-771.203) [-752.446] (-769.107) -- 0:08:19
2500 -- (-765.644) (-756.097) (-759.520) [-762.419] * [-752.079] (-766.051) (-748.637) (-761.387) -- 0:06:39
3000 -- (-756.301) (-757.661) [-752.519] (-760.085) * [-750.562] (-764.468) (-749.537) (-764.445) -- 0:05:32
3500 -- (-757.056) (-754.194) [-756.273] (-761.629) * [-748.718] (-760.046) (-750.261) (-754.875) -- 0:04:44
4000 -- (-755.179) [-752.215] (-751.230) (-758.964) * (-743.899) (-752.288) [-750.628] (-754.225) -- 0:04:09
4500 -- [-747.724] (-744.127) (-743.642) (-751.185) * (-748.416) (-753.443) [-749.170] (-754.507) -- 0:03:41
5000 -- (-754.742) (-745.060) (-744.893) [-750.593] * (-751.657) (-740.724) [-748.545] (-754.611) -- 0:03:19
Average standard deviation of split frequencies: 0.157135
5500 -- (-756.649) (-744.705) [-742.518] (-752.428) * (-741.375) [-744.325] (-743.931) (-754.266) -- 0:03:00
6000 -- [-751.888] (-743.252) (-745.630) (-748.027) * (-743.092) [-743.011] (-744.735) (-746.661) -- 0:02:45
6500 -- (-745.771) (-743.870) (-748.115) [-748.987] * (-739.365) (-747.675) (-751.306) [-745.414] -- 0:02:32
7000 -- (-753.651) [-745.989] (-743.672) (-750.763) * (-743.387) [-745.660] (-748.934) (-750.371) -- 0:02:21
7500 -- (-746.865) (-743.653) (-747.701) [-748.373] * [-742.636] (-749.081) (-751.494) (-749.721) -- 0:02:12
8000 -- (-756.663) (-750.111) [-746.839] (-742.369) * (-743.343) (-747.371) [-747.138] (-755.974) -- 0:02:04
8500 -- (-742.149) (-746.598) (-749.647) [-743.109] * [-742.616] (-747.869) (-743.145) (-748.981) -- 0:01:56
9000 -- (-747.265) [-749.519] (-748.270) (-745.007) * (-741.047) (-748.783) [-747.113] (-746.419) -- 0:01:50
9500 -- (-746.450) (-744.956) (-747.358) [-746.711] * (-741.547) (-748.865) (-743.633) [-744.282] -- 0:03:28
10000 -- (-744.567) (-747.123) (-744.517) [-745.353] * [-740.850] (-747.874) (-742.951) (-745.024) -- 0:03:18
Average standard deviation of split frequencies: 0.044194
10500 -- (-743.526) (-753.047) (-748.276) [-745.075] * (-747.556) (-749.411) (-744.554) [-744.461] -- 0:03:08
11000 -- (-753.278) (-746.642) [-748.484] (-746.853) * (-747.730) (-745.254) (-746.719) [-740.930] -- 0:02:59
11500 -- (-744.871) [-744.656] (-742.671) (-745.149) * (-753.292) (-750.032) (-742.961) [-741.148] -- 0:02:51
12000 -- (-744.528) [-744.047] (-747.979) (-746.509) * (-747.197) (-746.176) (-740.542) [-740.599] -- 0:02:44
12500 -- [-746.082] (-742.609) (-745.566) (-743.400) * (-746.403) (-747.121) [-741.469] (-747.548) -- 0:02:38
13000 -- (-749.676) (-744.047) (-743.605) [-749.047] * (-752.167) [-747.551] (-745.017) (-744.865) -- 0:02:31
13500 -- (-746.388) (-743.958) (-750.806) [-745.704] * (-747.480) (-749.549) (-745.202) [-744.570] -- 0:02:26
14000 -- [-743.746] (-745.404) (-744.976) (-740.339) * (-753.542) (-749.270) [-744.506] (-746.688) -- 0:02:20
14500 -- (-745.838) (-744.591) (-742.665) [-742.762] * (-744.217) (-748.078) (-750.501) [-741.071] -- 0:02:15
15000 -- (-746.051) [-743.635] (-747.007) (-752.280) * (-744.660) (-747.237) (-746.109) [-742.011] -- 0:02:11
Average standard deviation of split frequencies: 0.029463
15500 -- (-751.615) (-740.911) [-745.670] (-747.646) * [-745.472] (-746.153) (-748.940) (-751.725) -- 0:02:07
16000 -- (-749.865) (-743.366) [-743.114] (-746.238) * [-743.548] (-746.568) (-747.664) (-743.260) -- 0:02:03
16500 -- [-743.924] (-744.616) (-744.189) (-745.559) * (-742.900) (-748.746) [-748.880] (-744.531) -- 0:01:59
17000 -- (-746.020) (-747.443) (-745.498) [-743.488] * (-747.445) (-751.103) (-753.306) [-746.126] -- 0:01:55
17500 -- (-751.898) (-742.800) (-743.766) [-740.651] * [-743.189] (-749.083) (-746.125) (-744.786) -- 0:01:52
18000 -- [-745.606] (-748.331) (-747.828) (-746.910) * (-743.593) (-742.533) (-743.211) [-749.087] -- 0:01:49
18500 -- (-743.954) [-745.371] (-743.827) (-750.312) * [-743.280] (-746.066) (-746.781) (-745.809) -- 0:01:46
19000 -- (-746.939) (-747.795) [-749.106] (-743.921) * (-748.957) (-743.197) [-745.197] (-744.387) -- 0:01:43
19500 -- (-742.480) (-744.879) [-738.966] (-748.222) * (-744.653) (-744.565) [-746.669] (-751.132) -- 0:02:30
20000 -- (-743.389) (-743.532) [-740.598] (-753.527) * [-743.597] (-750.004) (-749.001) (-745.853) -- 0:02:27
Average standard deviation of split frequencies: 0.045620
20500 -- (-744.862) [-743.632] (-738.985) (-749.715) * [-741.864] (-747.696) (-751.177) (-745.329) -- 0:02:23
21000 -- [-742.051] (-745.527) (-748.242) (-749.941) * (-740.199) (-746.684) (-746.855) [-746.154] -- 0:02:19
21500 -- (-745.368) [-745.696] (-745.785) (-745.426) * (-743.524) (-747.805) (-745.126) [-748.472] -- 0:02:16
22000 -- (-741.489) (-748.687) [-741.621] (-746.380) * (-743.560) (-742.086) (-744.924) [-743.183] -- 0:02:13
22500 -- (-741.250) (-748.628) (-744.176) [-742.352] * (-744.273) (-750.333) (-744.672) [-746.603] -- 0:02:10
23000 -- (-739.874) [-741.723] (-745.458) (-746.316) * [-743.418] (-749.525) (-746.338) (-749.823) -- 0:02:07
23500 -- [-739.842] (-748.114) (-743.290) (-744.919) * [-743.326] (-744.008) (-748.484) (-747.651) -- 0:02:04
24000 -- [-745.669] (-749.848) (-742.976) (-747.649) * [-744.972] (-742.785) (-745.837) (-751.012) -- 0:02:02
24500 -- [-743.534] (-749.352) (-746.133) (-745.679) * (-744.933) (-747.560) [-744.996] (-747.799) -- 0:01:59
25000 -- (-742.933) (-748.478) [-745.656] (-744.306) * (-748.275) (-747.942) (-748.642) [-747.900] -- 0:01:57
Average standard deviation of split frequencies: 0.063458
25500 -- (-746.365) (-742.627) (-754.560) [-742.792] * [-743.052] (-744.921) (-749.225) (-751.312) -- 0:01:54
26000 -- (-744.782) (-739.576) (-751.307) [-746.936] * (-745.347) (-746.034) [-746.751] (-747.022) -- 0:01:52
26500 -- [-751.540] (-749.945) (-745.946) (-751.272) * [-745.749] (-746.230) (-747.837) (-745.013) -- 0:01:50
27000 -- (-754.338) (-749.100) [-745.290] (-747.872) * [-749.175] (-745.045) (-744.860) (-749.069) -- 0:01:48
27500 -- (-751.658) (-752.513) (-744.545) [-746.968] * [-742.239] (-748.707) (-748.928) (-744.166) -- 0:01:46
28000 -- (-746.547) [-750.098] (-744.049) (-750.767) * (-742.407) (-746.235) (-752.811) [-749.696] -- 0:01:44
28500 -- (-748.143) (-752.754) [-743.911] (-752.001) * (-743.234) (-746.211) [-746.570] (-744.779) -- 0:01:42
29000 -- (-742.898) (-748.251) (-743.433) [-755.078] * [-743.898] (-746.532) (-746.929) (-745.176) -- 0:02:13
29500 -- (-746.334) (-751.920) [-740.208] (-752.200) * [-747.106] (-748.531) (-749.235) (-749.287) -- 0:02:11
30000 -- [-741.593] (-745.989) (-743.570) (-754.559) * [-742.277] (-749.212) (-748.397) (-741.237) -- 0:02:09
Average standard deviation of split frequencies: 0.053802
30500 -- (-740.836) [-745.059] (-742.964) (-754.289) * [-746.564] (-744.712) (-751.681) (-747.452) -- 0:02:07
31000 -- [-740.736] (-742.082) (-747.763) (-752.043) * (-750.498) [-738.805] (-749.512) (-752.064) -- 0:02:05
31500 -- (-744.760) (-749.058) [-746.339] (-746.075) * [-744.717] (-741.709) (-751.174) (-745.854) -- 0:02:02
32000 -- (-746.827) (-748.670) (-741.402) [-740.906] * [-743.729] (-747.258) (-749.616) (-750.793) -- 0:02:01
32500 -- [-743.873] (-749.030) (-742.775) (-744.621) * [-743.657] (-747.027) (-755.598) (-744.614) -- 0:01:59
33000 -- (-745.457) [-748.671] (-745.404) (-740.186) * (-745.961) [-746.088] (-748.339) (-747.562) -- 0:01:57
33500 -- [-740.822] (-750.657) (-743.215) (-744.493) * (-742.269) (-742.582) [-741.106] (-749.233) -- 0:01:55
34000 -- (-746.637) [-743.117] (-742.429) (-751.349) * [-745.095] (-746.157) (-739.923) (-743.127) -- 0:01:53
34500 -- (-748.320) [-741.476] (-742.780) (-745.946) * (-746.320) (-747.647) (-745.211) [-747.627] -- 0:01:51
35000 -- (-745.480) (-742.622) [-748.689] (-748.365) * (-753.769) (-747.197) [-747.754] (-746.756) -- 0:01:50
Average standard deviation of split frequencies: 0.006547
35500 -- (-746.527) (-744.100) (-749.983) [-741.529] * (-755.516) (-744.037) [-742.347] (-745.168) -- 0:01:48
36000 -- (-749.763) (-750.631) [-746.467] (-745.386) * (-747.544) [-743.745] (-747.391) (-743.802) -- 0:01:47
36500 -- (-748.014) (-749.097) [-743.747] (-749.212) * [-744.796] (-745.173) (-746.494) (-749.190) -- 0:01:45
37000 -- [-742.162] (-746.661) (-751.031) (-744.988) * (-741.620) [-743.034] (-748.036) (-746.939) -- 0:01:44
37500 -- (-757.382) [-745.363] (-745.307) (-745.220) * [-745.695] (-746.353) (-745.404) (-746.035) -- 0:01:42
38000 -- (-747.383) [-742.439] (-742.953) (-747.071) * (-746.811) [-747.164] (-746.838) (-751.939) -- 0:01:41
38500 -- (-747.426) [-742.343] (-749.875) (-745.029) * (-750.020) (-744.523) [-749.825] (-742.514) -- 0:01:39
39000 -- (-745.868) (-743.213) [-746.063] (-741.167) * (-749.648) [-747.018] (-753.485) (-746.592) -- 0:02:03
39500 -- (-748.161) [-742.617] (-749.409) (-744.846) * (-753.274) [-748.598] (-742.175) (-745.763) -- 0:02:01
40000 -- (-741.563) (-742.211) (-743.094) [-745.684] * [-749.596] (-748.369) (-741.511) (-746.129) -- 0:02:00
Average standard deviation of split frequencies: 0.011592
40500 -- (-752.959) (-744.906) (-746.160) [-746.864] * (-748.466) (-746.920) (-744.315) [-742.929] -- 0:01:58
41000 -- [-748.261] (-741.755) (-747.480) (-745.182) * (-746.412) (-746.692) (-744.841) [-748.738] -- 0:01:56
41500 -- [-746.807] (-748.664) (-745.296) (-750.166) * [-746.938] (-748.532) (-746.847) (-746.576) -- 0:01:55
42000 -- (-744.575) (-747.465) [-742.329] (-747.500) * (-742.758) [-746.717] (-745.065) (-748.879) -- 0:01:54
42500 -- (-746.769) [-742.883] (-744.484) (-752.828) * [-748.036] (-750.185) (-744.059) (-744.609) -- 0:01:52
43000 -- (-742.328) (-743.965) [-742.132] (-747.034) * (-748.124) [-745.701] (-748.775) (-743.368) -- 0:01:51
43500 -- (-748.122) (-746.046) (-746.521) [-743.532] * (-746.024) [-743.169] (-747.213) (-745.114) -- 0:01:49
44000 -- (-746.837) (-744.490) (-745.947) [-747.441] * [-748.027] (-741.651) (-741.043) (-745.235) -- 0:01:48
44500 -- (-741.505) [-741.832] (-747.710) (-747.885) * (-747.404) (-745.136) [-744.694] (-744.430) -- 0:01:47
45000 -- (-746.907) (-743.092) (-746.708) [-743.670] * (-745.743) (-744.587) (-742.275) [-741.991] -- 0:01:46
Average standard deviation of split frequencies: 0.046116
45500 -- (-743.593) (-745.027) (-748.784) [-744.355] * (-747.426) (-752.327) [-741.920] (-745.463) -- 0:01:44
46000 -- [-743.058] (-741.446) (-746.417) (-742.370) * [-750.328] (-749.427) (-738.685) (-741.360) -- 0:01:43
46500 -- (-745.961) (-744.909) [-744.772] (-751.040) * (-741.193) [-746.016] (-742.830) (-743.094) -- 0:01:42
47000 -- (-743.484) [-748.557] (-749.219) (-745.100) * (-747.438) (-747.592) [-745.101] (-757.042) -- 0:01:41
47500 -- [-742.902] (-745.560) (-749.005) (-745.690) * [-742.623] (-749.663) (-745.665) (-748.312) -- 0:01:40
48000 -- [-743.146] (-746.401) (-743.194) (-741.568) * (-741.724) (-751.766) (-743.775) [-750.524] -- 0:01:39
48500 -- (-744.375) (-743.557) [-747.435] (-740.623) * [-747.779] (-746.320) (-742.519) (-756.565) -- 0:01:57
49000 -- [-741.023] (-744.163) (-745.540) (-741.685) * (-744.794) (-744.064) [-741.097] (-746.483) -- 0:01:56
49500 -- (-744.040) (-746.433) [-742.831] (-743.849) * (-752.994) [-743.300] (-745.579) (-747.597) -- 0:01:55
50000 -- [-743.789] (-749.336) (-746.100) (-742.148) * (-755.314) (-742.490) (-747.061) [-744.746] -- 0:01:54
Average standard deviation of split frequencies: 0.051172
50500 -- [-741.612] (-744.171) (-744.052) (-748.470) * [-746.526] (-747.112) (-748.780) (-744.808) -- 0:01:52
51000 -- (-742.827) (-743.122) (-742.304) [-746.260] * (-745.389) (-747.107) (-744.009) [-749.126] -- 0:01:51
51500 -- (-748.974) [-743.412] (-744.542) (-744.582) * (-753.251) [-742.379] (-747.315) (-747.804) -- 0:01:50
52000 -- (-744.307) (-747.159) (-748.624) [-748.966] * (-754.335) (-744.011) [-742.721] (-747.803) -- 0:01:49
52500 -- (-749.695) [-744.222] (-745.983) (-745.469) * (-746.214) (-742.763) (-746.659) [-753.977] -- 0:01:48
53000 -- (-746.704) [-742.053] (-754.795) (-749.199) * [-741.839] (-742.590) (-744.564) (-748.137) -- 0:01:47
53500 -- (-747.108) (-750.629) (-747.070) [-744.799] * (-744.167) (-743.808) (-741.890) [-749.447] -- 0:01:46
54000 -- (-746.369) [-746.724] (-753.246) (-746.837) * [-741.725] (-742.348) (-744.716) (-748.214) -- 0:01:45
54500 -- (-746.453) (-744.384) (-750.309) [-745.575] * [-746.282] (-750.689) (-741.500) (-745.928) -- 0:01:44
55000 -- (-748.285) (-749.243) (-743.558) [-747.121] * [-743.427] (-742.219) (-749.541) (-759.402) -- 0:01:43
Average standard deviation of split frequencies: 0.046299
55500 -- (-747.680) (-747.456) [-745.601] (-745.416) * (-743.614) (-753.402) (-754.033) [-743.115] -- 0:01:42
56000 -- (-743.109) (-746.622) [-742.658] (-747.766) * [-743.252] (-753.137) (-745.896) (-744.365) -- 0:01:41
56500 -- (-741.248) (-749.702) [-748.676] (-745.238) * (-749.664) (-750.177) (-747.449) [-740.984] -- 0:01:40
57000 -- (-745.747) (-750.403) [-744.785] (-741.118) * (-743.208) (-754.374) [-743.870] (-743.938) -- 0:01:39
57500 -- (-743.322) (-748.945) [-746.662] (-747.416) * (-744.859) (-750.150) (-746.248) [-744.259] -- 0:01:38
58000 -- (-748.663) [-747.216] (-745.225) (-739.987) * [-748.042] (-751.099) (-745.680) (-741.967) -- 0:01:37
58500 -- (-746.351) (-747.127) [-743.380] (-748.130) * (-751.746) [-745.514] (-745.413) (-747.269) -- 0:01:52
59000 -- [-745.459] (-747.296) (-747.042) (-741.458) * [-743.572] (-752.767) (-744.777) (-741.122) -- 0:01:51
59500 -- (-747.970) (-748.583) (-745.952) [-744.422] * (-752.795) (-750.555) (-748.856) [-743.937] -- 0:01:50
60000 -- (-748.099) [-748.929] (-742.417) (-744.057) * (-745.577) [-744.291] (-742.793) (-744.096) -- 0:01:49
Average standard deviation of split frequencies: 0.054393
60500 -- (-743.273) (-742.249) (-743.472) [-754.712] * (-752.130) [-744.300] (-747.237) (-741.889) -- 0:01:48
61000 -- (-744.820) [-744.188] (-748.319) (-744.539) * [-743.866] (-743.855) (-748.906) (-747.685) -- 0:01:47
61500 -- (-746.417) (-749.953) [-746.105] (-746.690) * (-739.151) (-742.501) (-743.982) [-743.648] -- 0:01:46
62000 -- (-754.278) (-749.242) (-740.449) [-748.069] * (-751.447) (-747.179) (-746.461) [-746.279] -- 0:01:45
62500 -- [-745.654] (-747.170) (-746.884) (-749.725) * (-747.242) [-743.805] (-747.871) (-752.255) -- 0:01:45
63000 -- (-744.479) [-743.571] (-741.428) (-749.431) * (-750.321) [-748.051] (-749.297) (-748.922) -- 0:01:44
63500 -- [-741.331] (-745.366) (-745.701) (-749.151) * (-746.263) [-742.969] (-746.273) (-745.125) -- 0:01:43
64000 -- (-747.602) [-751.220] (-747.375) (-744.284) * [-744.549] (-745.548) (-744.752) (-743.591) -- 0:01:42
64500 -- [-746.188] (-743.789) (-744.412) (-747.307) * [-746.724] (-743.797) (-744.056) (-742.375) -- 0:01:41
65000 -- (-747.471) [-744.371] (-745.066) (-753.205) * (-745.401) (-747.265) [-741.624] (-740.909) -- 0:01:40
Average standard deviation of split frequencies: 0.067854
65500 -- (-749.718) (-742.915) (-743.149) [-747.581] * (-744.303) (-750.406) [-748.298] (-744.755) -- 0:01:39
66000 -- (-744.320) (-746.808) (-748.091) [-743.908] * [-743.300] (-742.374) (-747.558) (-740.220) -- 0:01:39
66500 -- (-754.238) [-744.075] (-743.107) (-752.181) * [-748.451] (-744.878) (-745.518) (-744.969) -- 0:01:38
67000 -- (-744.082) (-743.286) [-740.618] (-753.703) * (-743.912) [-745.492] (-746.842) (-750.549) -- 0:01:37
67500 -- (-747.940) (-740.956) [-745.369] (-752.144) * [-755.129] (-743.593) (-744.388) (-745.721) -- 0:01:36
68000 -- (-741.369) (-743.482) [-741.346] (-749.922) * (-746.280) (-745.237) (-747.408) [-741.801] -- 0:01:35
68500 -- (-751.003) (-742.946) [-742.718] (-758.901) * (-744.128) [-748.542] (-745.056) (-743.045) -- 0:01:48
69000 -- (-744.190) (-744.093) [-746.791] (-756.783) * (-746.725) (-742.076) (-751.934) [-744.272] -- 0:01:47
69500 -- [-743.578] (-746.149) (-742.888) (-749.683) * (-750.500) (-744.354) [-747.255] (-750.690) -- 0:01:47
70000 -- (-742.225) (-747.399) [-748.078] (-750.873) * (-752.144) (-740.421) [-745.046] (-749.259) -- 0:01:46
Average standard deviation of split frequencies: 0.043360
70500 -- (-749.559) (-755.593) (-742.823) [-745.761] * [-745.896] (-744.008) (-746.212) (-742.572) -- 0:01:45
71000 -- (-740.981) (-750.327) [-744.397] (-744.028) * (-754.316) (-744.505) (-744.016) [-741.329] -- 0:01:44
71500 -- [-746.361] (-746.797) (-748.429) (-748.921) * (-750.979) [-741.604] (-743.035) (-747.786) -- 0:01:43
72000 -- [-746.571] (-748.658) (-743.094) (-741.163) * [-750.502] (-747.894) (-741.253) (-743.922) -- 0:01:43
72500 -- [-746.148] (-742.393) (-744.591) (-746.723) * (-751.453) (-751.258) [-742.179] (-744.748) -- 0:01:42
73000 -- (-745.622) (-744.258) (-743.076) [-747.518] * (-749.596) (-751.323) (-744.501) [-743.634] -- 0:01:41
73500 -- [-746.193] (-749.104) (-749.135) (-743.057) * [-746.616] (-747.276) (-747.302) (-744.735) -- 0:01:40
74000 -- (-750.854) (-750.754) (-749.302) [-744.686] * (-755.683) [-749.098] (-745.171) (-750.849) -- 0:01:40
74500 -- (-753.303) [-743.821] (-745.944) (-746.298) * (-746.674) (-750.107) [-742.539] (-745.865) -- 0:01:39
75000 -- (-748.008) (-748.384) (-746.430) [-745.432] * (-745.086) (-744.046) [-749.540] (-749.046) -- 0:01:38
Average standard deviation of split frequencies: 0.046520
75500 -- (-748.179) (-743.113) (-750.770) [-746.062] * (-746.148) (-745.027) (-753.967) [-749.553] -- 0:01:37
76000 -- [-750.175] (-752.440) (-744.293) (-744.447) * (-743.891) (-747.899) (-746.384) [-747.163] -- 0:01:37
76500 -- (-743.207) (-744.847) (-753.167) [-744.561] * (-741.054) (-744.510) [-748.963] (-743.777) -- 0:01:36
77000 -- (-747.153) (-746.048) [-745.931] (-746.553) * [-743.556] (-745.552) (-750.496) (-743.424) -- 0:01:35
77500 -- (-745.715) (-744.499) [-747.234] (-743.541) * (-742.744) (-744.449) [-743.114] (-749.887) -- 0:01:35
78000 -- (-751.715) (-755.760) (-750.219) [-744.678] * [-744.694] (-749.368) (-747.434) (-740.639) -- 0:01:46
78500 -- (-754.831) (-752.008) (-750.771) [-744.012] * (-748.075) (-743.981) (-749.304) [-746.308] -- 0:01:45
79000 -- (-751.220) (-747.901) [-754.084] (-744.573) * (-745.996) (-745.472) (-744.658) [-745.775] -- 0:01:44
79500 -- [-741.724] (-747.428) (-745.865) (-747.650) * (-750.046) (-748.840) [-743.422] (-746.108) -- 0:01:44
80000 -- [-754.691] (-747.498) (-747.080) (-741.415) * (-747.010) (-751.114) (-747.110) [-746.478] -- 0:01:43
Average standard deviation of split frequencies: 0.037985
80500 -- (-742.767) [-746.831] (-753.405) (-741.884) * [-749.916] (-752.335) (-744.675) (-746.100) -- 0:01:42
81000 -- (-745.242) (-744.901) (-748.499) [-744.942] * (-748.308) (-745.298) (-747.665) [-743.058] -- 0:01:42
81500 -- (-742.058) (-745.095) (-752.215) [-743.621] * (-748.001) (-749.320) [-743.002] (-745.448) -- 0:01:41
82000 -- [-739.443] (-744.862) (-746.073) (-741.624) * (-749.388) [-747.748] (-748.723) (-745.278) -- 0:01:40
82500 -- (-739.044) (-743.575) (-746.880) [-742.828] * [-746.244] (-744.475) (-748.606) (-744.356) -- 0:01:40
83000 -- (-742.998) (-742.393) [-745.572] (-744.902) * (-743.282) (-743.338) (-754.208) [-745.335] -- 0:01:39
83500 -- [-746.854] (-742.169) (-742.787) (-743.559) * (-743.499) (-746.221) [-750.901] (-748.388) -- 0:01:38
84000 -- (-754.060) [-745.137] (-742.783) (-744.677) * [-746.838] (-741.164) (-756.398) (-747.166) -- 0:01:38
84500 -- [-743.228] (-744.866) (-744.191) (-744.420) * (-742.530) [-744.539] (-746.762) (-750.130) -- 0:01:37
85000 -- [-740.308] (-744.397) (-748.345) (-746.724) * (-744.118) (-741.099) [-744.667] (-751.266) -- 0:01:36
Average standard deviation of split frequencies: 0.036543
85500 -- (-747.620) (-745.393) [-742.976] (-748.477) * [-743.253] (-745.529) (-747.788) (-743.902) -- 0:01:36
86000 -- [-747.246] (-747.293) (-745.147) (-748.310) * (-748.122) [-749.800] (-751.134) (-744.428) -- 0:01:35
86500 -- (-744.743) (-743.958) [-740.627] (-757.308) * (-746.468) [-745.477] (-749.477) (-751.363) -- 0:01:35
87000 -- [-745.792] (-749.825) (-744.225) (-750.721) * (-743.972) (-744.251) [-745.284] (-748.483) -- 0:01:34
87500 -- [-742.397] (-743.958) (-747.766) (-747.285) * (-740.911) [-744.831] (-748.098) (-744.473) -- 0:01:33
88000 -- (-746.561) (-749.837) (-744.263) [-753.490] * (-743.299) [-740.473] (-744.777) (-740.932) -- 0:01:43
88500 -- [-742.955] (-744.120) (-748.004) (-756.069) * [-743.878] (-743.571) (-744.707) (-743.644) -- 0:01:42
89000 -- (-744.125) (-743.366) (-742.194) [-751.768] * (-743.625) (-743.538) [-742.014] (-744.495) -- 0:01:42
89500 -- (-745.323) (-739.661) [-744.137] (-745.764) * (-741.925) (-748.768) [-743.977] (-744.792) -- 0:01:41
90000 -- (-744.817) (-746.763) (-746.583) [-748.270] * (-744.588) [-745.667] (-743.812) (-743.763) -- 0:01:41
Average standard deviation of split frequencies: 0.054593
90500 -- [-745.400] (-749.724) (-757.183) (-748.362) * [-744.661] (-749.511) (-742.433) (-749.716) -- 0:01:40
91000 -- (-754.350) (-746.459) [-745.327] (-743.934) * (-747.840) [-745.065] (-742.064) (-748.242) -- 0:01:39
91500 -- [-745.659] (-742.127) (-742.275) (-747.654) * (-758.901) (-745.065) [-743.034] (-751.125) -- 0:01:39
92000 -- (-747.639) [-742.719] (-746.402) (-748.563) * (-749.861) [-742.158] (-744.217) (-748.159) -- 0:01:38
92500 -- (-746.236) (-741.900) [-743.331] (-742.260) * [-745.738] (-750.676) (-744.335) (-753.119) -- 0:01:38
93000 -- (-750.748) (-753.006) [-746.602] (-749.831) * [-745.488] (-752.411) (-744.092) (-753.447) -- 0:01:37
93500 -- (-743.578) [-745.191] (-747.482) (-746.302) * (-746.737) (-745.117) [-744.941] (-748.531) -- 0:01:36
94000 -- (-746.504) (-744.564) [-745.129] (-740.964) * (-742.651) (-747.804) [-744.084] (-744.864) -- 0:01:36
94500 -- (-747.081) (-747.795) [-742.080] (-742.228) * (-742.294) (-744.927) [-743.719] (-743.508) -- 0:01:35
95000 -- [-746.119] (-744.766) (-745.424) (-743.774) * (-745.627) [-743.985] (-743.237) (-746.571) -- 0:01:35
Average standard deviation of split frequencies: 0.066291
95500 -- (-743.935) (-743.430) [-743.398] (-745.192) * [-742.393] (-745.005) (-743.733) (-742.585) -- 0:01:34
96000 -- [-742.662] (-742.080) (-744.918) (-745.607) * (-748.918) (-748.967) [-741.431] (-742.808) -- 0:01:34
96500 -- (-743.718) [-745.480] (-763.202) (-746.647) * (-744.549) [-748.895] (-751.948) (-743.657) -- 0:01:33
97000 -- (-744.031) (-747.680) [-749.620] (-745.196) * [-743.775] (-748.688) (-751.105) (-747.910) -- 0:01:33
97500 -- (-746.443) (-745.645) (-744.196) [-747.887] * [-746.096] (-749.476) (-747.837) (-757.637) -- 0:01:32
98000 -- (-746.779) (-744.860) [-744.420] (-746.263) * (-751.551) (-742.389) (-750.566) [-749.311] -- 0:01:41
98500 -- (-751.800) (-747.017) (-746.036) [-743.711] * (-744.737) (-743.943) (-748.870) [-752.586] -- 0:01:40
99000 -- (-743.228) [-741.227] (-742.792) (-744.466) * (-739.766) (-750.757) [-747.011] (-745.821) -- 0:01:40
99500 -- (-744.322) (-739.284) [-741.349] (-744.842) * (-743.623) (-744.624) [-746.132] (-748.961) -- 0:01:39
100000 -- (-747.393) [-742.181] (-742.675) (-743.118) * [-740.835] (-747.311) (-751.360) (-746.025) -- 0:01:39
Average standard deviation of split frequencies: 0.046828
100500 -- (-741.815) (-744.677) [-743.533] (-744.198) * (-744.781) [-741.388] (-750.041) (-743.810) -- 0:01:38
101000 -- [-743.749] (-745.823) (-744.443) (-747.516) * (-741.753) (-748.231) (-746.936) [-742.637] -- 0:01:37
101500 -- (-749.234) (-761.379) (-742.833) [-748.522] * (-741.831) (-743.573) (-746.786) [-749.969] -- 0:01:37
102000 -- [-743.236] (-754.694) (-741.234) (-749.654) * (-742.687) [-740.795] (-740.503) (-744.912) -- 0:01:36
102500 -- (-742.768) (-747.163) [-744.640] (-746.790) * (-745.188) (-741.818) [-746.692] (-744.761) -- 0:01:36
103000 -- (-741.737) (-747.954) [-757.299] (-745.959) * (-744.048) [-748.567] (-748.016) (-747.863) -- 0:01:35
103500 -- (-744.852) (-746.600) (-741.302) [-744.127] * (-740.690) (-751.424) (-748.154) [-741.603] -- 0:01:35
104000 -- (-747.497) (-751.959) (-747.114) [-743.852] * (-743.657) (-751.147) (-748.948) [-750.251] -- 0:01:34
104500 -- (-744.003) (-746.132) (-744.869) [-744.511] * (-747.290) (-749.112) [-744.463] (-742.745) -- 0:01:34
105000 -- (-749.518) [-744.469] (-744.913) (-740.095) * (-741.240) (-749.752) (-749.839) [-746.233] -- 0:01:33
Average standard deviation of split frequencies: 0.046696
105500 -- (-751.338) (-743.270) (-743.582) [-748.900] * (-746.813) (-745.253) (-753.180) [-740.959] -- 0:01:33
106000 -- (-756.768) [-741.465] (-742.600) (-750.204) * (-743.333) (-754.937) [-744.096] (-742.513) -- 0:01:32
106500 -- (-745.907) [-743.324] (-748.327) (-741.497) * [-748.973] (-748.059) (-750.535) (-749.499) -- 0:01:32
107000 -- (-756.348) (-742.192) [-746.026] (-744.189) * [-746.029] (-746.125) (-743.290) (-745.693) -- 0:01:31
107500 -- (-751.171) [-743.987] (-749.967) (-746.423) * (-741.367) (-746.108) [-743.758] (-749.498) -- 0:01:39
108000 -- (-745.819) [-743.760] (-746.674) (-741.338) * [-740.794] (-742.592) (-745.782) (-751.048) -- 0:01:39
108500 -- (-744.077) [-744.694] (-744.871) (-748.573) * (-741.910) [-744.633] (-745.527) (-749.965) -- 0:01:38
109000 -- (-744.001) [-749.845] (-753.596) (-742.807) * [-742.330] (-742.262) (-745.229) (-748.814) -- 0:01:38
109500 -- [-741.894] (-747.589) (-742.249) (-747.894) * (-742.177) [-745.685] (-749.521) (-744.208) -- 0:01:37
110000 -- (-747.113) (-743.422) [-743.725] (-748.969) * (-744.056) (-742.009) [-752.400] (-748.503) -- 0:01:37
Average standard deviation of split frequencies: 0.044727
110500 -- (-742.343) [-744.060] (-744.794) (-740.052) * (-743.680) [-742.500] (-744.045) (-752.238) -- 0:01:36
111000 -- (-744.556) (-745.769) (-744.673) [-744.851] * [-746.907] (-752.976) (-744.930) (-749.859) -- 0:01:36
111500 -- (-757.426) (-744.854) [-742.252] (-743.125) * [-744.119] (-746.707) (-749.912) (-743.761) -- 0:01:35
112000 -- (-752.813) (-744.012) [-748.378] (-745.574) * (-747.474) (-751.650) [-748.642] (-749.344) -- 0:01:35
112500 -- (-748.659) (-743.990) (-748.210) [-745.526] * (-747.225) (-748.658) (-745.351) [-747.317] -- 0:01:34
113000 -- (-752.100) (-747.964) [-742.156] (-744.915) * (-746.360) (-742.490) [-746.333] (-747.227) -- 0:01:34
113500 -- (-752.221) [-744.480] (-744.697) (-748.847) * (-747.033) (-742.558) [-744.118] (-750.217) -- 0:01:33
114000 -- (-745.676) (-745.847) [-742.694] (-752.218) * (-748.894) (-743.112) (-741.246) [-747.187] -- 0:01:33
114500 -- (-748.014) (-744.416) [-750.017] (-749.432) * (-745.269) [-744.859] (-740.148) (-751.082) -- 0:01:32
115000 -- (-751.131) (-743.729) (-743.947) [-743.394] * (-750.341) [-744.408] (-742.175) (-745.129) -- 0:01:32
Average standard deviation of split frequencies: 0.028447
115500 -- (-745.395) (-751.670) [-743.618] (-742.833) * (-745.162) (-750.368) [-747.834] (-742.946) -- 0:01:31
116000 -- (-747.663) (-745.705) (-746.998) [-743.161] * (-749.431) (-746.148) [-749.473] (-744.812) -- 0:01:31
116500 -- (-746.413) (-740.755) [-744.175] (-751.452) * (-752.184) [-745.095] (-740.901) (-745.159) -- 0:01:31
117000 -- (-748.206) (-739.784) (-751.526) [-748.787] * [-747.968] (-743.669) (-743.966) (-745.439) -- 0:01:30
117500 -- (-756.592) [-743.348] (-749.436) (-743.790) * (-751.420) [-749.317] (-745.781) (-744.776) -- 0:01:37
118000 -- (-757.644) [-743.057] (-749.695) (-753.128) * [-746.606] (-751.236) (-750.695) (-746.244) -- 0:01:37
118500 -- (-742.102) (-743.516) [-748.817] (-748.332) * (-743.873) (-750.909) (-757.946) [-744.033] -- 0:01:36
119000 -- (-747.678) (-745.658) [-742.134] (-742.024) * (-744.201) (-746.805) (-753.179) [-741.820] -- 0:01:36
119500 -- (-746.920) [-743.825] (-740.449) (-742.202) * (-744.072) (-747.499) (-748.823) [-746.882] -- 0:01:35
120000 -- (-744.272) (-744.013) [-739.960] (-742.937) * [-744.521] (-743.260) (-747.536) (-747.919) -- 0:01:35
Average standard deviation of split frequencies: 0.007813
120500 -- [-743.230] (-745.663) (-744.603) (-743.541) * (-749.038) (-750.390) [-745.175] (-746.493) -- 0:01:34
121000 -- (-748.977) [-746.218] (-742.495) (-749.952) * [-742.638] (-747.922) (-746.835) (-746.542) -- 0:01:34
121500 -- (-747.276) [-742.161] (-746.590) (-754.003) * (-741.501) (-752.712) [-745.273] (-749.408) -- 0:01:33
122000 -- (-746.394) (-745.492) [-749.540] (-743.961) * (-746.965) (-751.461) [-745.875] (-751.753) -- 0:01:33
122500 -- (-747.507) (-749.729) [-742.959] (-744.099) * (-748.638) [-747.853] (-747.264) (-745.606) -- 0:01:33
123000 -- (-746.541) (-756.813) [-743.010] (-749.065) * (-748.342) (-748.698) (-748.279) [-745.216] -- 0:01:32
123500 -- (-751.162) (-750.248) [-742.536] (-745.822) * (-754.591) (-753.159) [-746.665] (-745.816) -- 0:01:32
124000 -- (-754.909) (-752.999) (-745.214) [-747.792] * [-753.946] (-748.500) (-747.763) (-752.572) -- 0:01:31
124500 -- [-756.735] (-752.243) (-744.074) (-747.935) * (-745.868) (-745.339) [-741.728] (-755.749) -- 0:01:31
125000 -- (-747.935) (-747.073) [-750.229] (-745.655) * (-748.271) [-746.732] (-750.416) (-748.024) -- 0:01:31
Average standard deviation of split frequencies: 0.003741
125500 -- (-743.517) (-749.237) (-744.620) [-743.624] * (-747.920) (-743.302) [-745.802] (-743.878) -- 0:01:30
126000 -- [-746.763] (-748.276) (-744.578) (-749.821) * (-744.951) [-745.876] (-743.438) (-747.044) -- 0:01:30
126500 -- (-746.576) (-748.321) (-741.046) [-747.483] * (-741.932) (-753.961) (-746.334) [-747.595] -- 0:01:29
127000 -- (-744.390) (-745.895) [-744.872] (-751.846) * (-748.853) [-746.100] (-744.694) (-748.131) -- 0:01:29
127500 -- (-745.648) (-753.913) [-746.012] (-745.938) * (-745.119) (-746.856) (-753.810) [-748.554] -- 0:01:35
128000 -- (-745.087) (-751.334) (-748.386) [-748.659] * [-746.704] (-741.782) (-751.842) (-744.506) -- 0:01:35
128500 -- (-740.115) [-754.447] (-740.978) (-747.079) * [-738.866] (-743.304) (-751.144) (-748.898) -- 0:01:34
129000 -- (-740.945) [-748.571] (-743.545) (-750.771) * (-742.304) [-745.393] (-751.280) (-754.957) -- 0:01:34
129500 -- (-743.494) (-745.694) [-743.627] (-748.237) * (-744.551) [-742.417] (-748.314) (-750.044) -- 0:01:34
130000 -- (-740.401) (-748.440) [-746.466] (-747.676) * [-743.998] (-741.357) (-743.537) (-746.891) -- 0:01:33
Average standard deviation of split frequencies: 0.007215
130500 -- [-742.677] (-749.246) (-743.302) (-754.145) * (-746.650) (-744.780) [-744.375] (-744.838) -- 0:01:33
131000 -- (-743.258) (-748.490) [-742.124] (-746.663) * [-747.616] (-745.241) (-748.103) (-745.637) -- 0:01:32
131500 -- [-745.366] (-744.729) (-745.374) (-758.553) * (-741.855) [-745.993] (-741.122) (-740.614) -- 0:01:32
132000 -- [-747.067] (-744.097) (-746.861) (-751.675) * (-743.571) [-742.326] (-745.621) (-743.202) -- 0:01:32
132500 -- (-748.642) (-744.828) (-744.104) [-741.441] * (-743.759) [-749.715] (-742.859) (-747.998) -- 0:01:31
133000 -- (-745.800) [-743.382] (-748.782) (-746.925) * [-744.583] (-749.478) (-749.212) (-746.926) -- 0:01:31
133500 -- (-742.655) [-742.347] (-753.524) (-741.714) * (-743.889) [-749.747] (-746.867) (-742.648) -- 0:01:30
134000 -- (-745.074) (-743.855) (-747.406) [-744.017] * (-745.313) (-748.615) [-743.446] (-748.430) -- 0:01:30
134500 -- (-744.642) [-746.805] (-753.045) (-743.765) * (-742.968) [-742.933] (-745.313) (-750.991) -- 0:01:30
135000 -- (-745.716) (-750.073) (-756.817) [-741.020] * [-742.640] (-745.940) (-747.259) (-748.234) -- 0:01:29
Average standard deviation of split frequencies: 0.016176
135500 -- (-743.788) [-745.522] (-741.173) (-740.759) * (-742.490) [-745.426] (-746.513) (-747.822) -- 0:01:29
136000 -- [-749.019] (-744.570) (-741.433) (-744.457) * (-741.970) (-748.576) [-745.930] (-748.119) -- 0:01:28
136500 -- (-744.447) (-744.838) (-745.403) [-748.106] * [-740.930] (-748.349) (-743.552) (-744.191) -- 0:01:28
137000 -- (-745.660) (-743.586) (-747.295) [-750.532] * (-742.700) (-746.627) [-742.617] (-746.028) -- 0:01:28
137500 -- (-745.878) (-746.901) [-744.613] (-743.563) * (-748.325) [-747.627] (-741.700) (-747.241) -- 0:01:34
138000 -- (-754.149) [-746.057] (-748.789) (-749.884) * (-747.962) [-745.314] (-745.593) (-748.657) -- 0:01:33
138500 -- (-746.326) (-746.811) (-746.247) [-750.442] * (-745.906) [-742.855] (-747.018) (-745.709) -- 0:01:33
139000 -- (-749.143) (-751.789) [-746.323] (-748.361) * (-745.281) [-747.623] (-744.377) (-745.835) -- 0:01:32
139500 -- (-746.145) [-752.028] (-753.336) (-750.992) * (-745.686) (-743.241) (-747.064) [-747.940] -- 0:01:32
140000 -- [-739.854] (-744.412) (-750.018) (-753.915) * (-753.953) (-742.485) [-743.527] (-747.965) -- 0:01:32
Average standard deviation of split frequencies: 0.015639
140500 -- (-744.303) (-744.974) [-749.580] (-749.188) * (-743.364) (-742.771) (-746.126) [-743.893] -- 0:01:31
141000 -- [-740.545] (-743.282) (-748.270) (-742.152) * (-745.959) [-741.440] (-749.912) (-750.537) -- 0:01:31
141500 -- [-744.324] (-743.923) (-751.169) (-743.985) * [-745.554] (-743.922) (-745.938) (-746.333) -- 0:01:31
142000 -- (-746.259) (-746.905) [-746.395] (-746.014) * (-754.971) (-741.561) [-744.038] (-751.279) -- 0:01:30
142500 -- (-742.599) (-745.137) [-745.421] (-743.932) * (-748.551) [-739.776] (-742.366) (-747.204) -- 0:01:30
143000 -- [-744.131] (-744.902) (-740.666) (-747.938) * (-746.791) [-748.269] (-745.987) (-748.130) -- 0:01:29
143500 -- (-743.483) (-749.740) (-749.072) [-748.508] * (-751.560) (-752.543) [-745.880] (-757.769) -- 0:01:29
144000 -- (-744.023) (-749.032) [-742.273] (-746.451) * (-748.676) (-749.159) (-746.784) [-742.898] -- 0:01:29
144500 -- (-748.633) (-745.362) [-745.604] (-745.597) * (-749.359) (-747.328) (-742.998) [-746.900] -- 0:01:28
145000 -- (-749.472) (-749.515) (-747.237) [-741.478] * (-744.014) [-746.631] (-742.346) (-747.263) -- 0:01:28
Average standard deviation of split frequencies: 0.015068
145500 -- [-747.814] (-745.649) (-748.389) (-747.582) * (-748.729) [-742.770] (-749.168) (-750.352) -- 0:01:28
146000 -- (-745.302) [-743.098] (-747.657) (-749.306) * (-749.959) (-744.782) [-743.786] (-742.366) -- 0:01:27
146500 -- (-742.777) [-745.716] (-742.682) (-744.046) * [-754.740] (-744.214) (-752.028) (-744.707) -- 0:01:27
147000 -- (-746.687) (-743.579) [-742.993] (-750.778) * (-748.531) (-745.644) [-750.050] (-746.379) -- 0:01:27
147500 -- [-746.292] (-745.639) (-741.909) (-742.112) * [-749.249] (-748.970) (-743.809) (-748.073) -- 0:01:32
148000 -- (-744.427) [-746.078] (-752.654) (-743.612) * (-744.178) (-745.409) (-746.166) [-747.721] -- 0:01:32
148500 -- (-743.443) (-744.812) [-745.984] (-752.161) * (-744.103) [-744.306] (-749.590) (-746.560) -- 0:01:31
149000 -- [-740.562] (-742.931) (-747.722) (-745.976) * (-750.688) (-745.810) [-746.443] (-743.714) -- 0:01:31
149500 -- (-747.035) (-749.547) (-748.450) [-744.711] * [-742.064] (-748.591) (-747.256) (-745.246) -- 0:01:31
150000 -- (-746.361) [-743.043] (-748.430) (-742.850) * (-747.190) [-744.371] (-742.575) (-746.429) -- 0:01:30
Average standard deviation of split frequencies: 0.018773
150500 -- (-748.344) (-746.012) (-742.936) [-741.778] * (-746.593) (-743.628) (-747.357) [-760.036] -- 0:01:30
151000 -- (-745.741) [-747.924] (-744.169) (-748.705) * (-747.968) (-742.091) [-745.993] (-747.891) -- 0:01:29
151500 -- (-749.943) (-749.424) (-740.148) [-745.780] * (-746.462) [-742.789] (-749.505) (-743.578) -- 0:01:29
152000 -- (-745.328) (-752.611) (-746.732) [-742.544] * (-748.492) (-750.911) (-753.775) [-741.401] -- 0:01:29
152500 -- (-744.933) (-745.166) [-746.136] (-744.461) * (-747.439) (-743.779) (-753.901) [-739.608] -- 0:01:28
153000 -- (-745.398) (-744.626) [-745.321] (-748.116) * [-747.985] (-741.672) (-752.199) (-745.602) -- 0:01:28
153500 -- (-745.940) (-745.908) [-748.938] (-747.669) * (-745.797) (-741.388) [-746.494] (-741.017) -- 0:01:28
154000 -- (-743.520) [-740.186] (-744.650) (-743.785) * (-747.299) [-744.932] (-747.670) (-742.983) -- 0:01:27
154500 -- [-746.593] (-744.246) (-744.487) (-748.967) * (-754.395) (-743.139) (-754.191) [-742.641] -- 0:01:27
155000 -- (-745.827) [-751.653] (-747.802) (-745.131) * (-743.338) [-740.356] (-745.077) (-747.841) -- 0:01:27
Average standard deviation of split frequencies: 0.018131
155500 -- (-746.349) (-743.242) (-747.880) [-744.870] * (-742.485) [-743.763] (-742.842) (-744.108) -- 0:01:26
156000 -- (-746.520) (-741.913) (-743.195) [-745.964] * (-746.945) [-745.571] (-749.636) (-745.780) -- 0:01:26
156500 -- (-740.975) (-741.354) [-745.688] (-746.332) * [-748.451] (-747.082) (-745.656) (-751.132) -- 0:01:26
157000 -- [-745.223] (-744.487) (-746.435) (-744.733) * (-747.273) (-748.236) (-745.870) [-748.110] -- 0:01:25
157500 -- [-742.365] (-743.499) (-742.005) (-747.247) * (-742.615) (-750.246) (-748.299) [-743.128] -- 0:01:30
158000 -- (-752.063) (-746.220) (-745.531) [-741.896] * (-744.586) (-748.988) (-750.933) [-754.246] -- 0:01:30
158500 -- [-747.334] (-747.370) (-742.227) (-748.448) * [-743.918] (-748.943) (-740.761) (-744.946) -- 0:01:30
159000 -- (-753.887) (-744.473) [-745.572] (-750.842) * (-750.534) (-746.905) (-742.176) [-743.960] -- 0:01:29
159500 -- (-743.794) [-744.687] (-748.370) (-747.903) * (-744.490) (-745.989) (-745.850) [-744.221] -- 0:01:29
160000 -- [-743.326] (-745.912) (-742.152) (-745.471) * (-743.503) [-744.707] (-748.198) (-744.930) -- 0:01:29
Average standard deviation of split frequencies: 0.013692
160500 -- (-744.827) [-748.165] (-744.010) (-740.483) * [-746.468] (-752.605) (-746.835) (-747.859) -- 0:01:28
161000 -- (-743.238) [-741.877] (-749.801) (-745.220) * (-747.342) (-745.890) (-748.215) [-747.274] -- 0:01:28
161500 -- (-738.940) [-749.267] (-745.918) (-745.896) * (-746.860) (-745.644) [-748.638] (-747.402) -- 0:01:28
162000 -- (-744.834) [-747.358] (-741.826) (-744.962) * [-741.713] (-746.019) (-750.191) (-745.226) -- 0:01:27
162500 -- (-750.707) (-743.192) [-742.486] (-741.773) * (-745.865) (-751.710) [-745.094] (-749.693) -- 0:01:27
163000 -- [-749.082] (-742.686) (-745.636) (-740.045) * (-745.432) [-753.501] (-745.047) (-746.261) -- 0:01:27
163500 -- (-747.630) (-748.496) (-742.277) [-743.291] * (-747.392) (-748.698) [-745.368] (-745.948) -- 0:01:26
164000 -- (-754.648) (-742.507) (-742.938) [-744.287] * (-744.029) (-747.674) [-747.643] (-752.243) -- 0:01:26
164500 -- (-748.612) [-744.318] (-741.587) (-746.582) * (-742.931) [-749.607] (-747.327) (-758.110) -- 0:01:26
165000 -- (-745.212) (-751.830) [-744.718] (-746.580) * [-741.752] (-756.604) (-750.491) (-747.391) -- 0:01:26
Average standard deviation of split frequencies: 0.013252
165500 -- [-747.423] (-747.707) (-744.001) (-747.700) * (-745.429) (-753.930) (-749.349) [-747.493] -- 0:01:25
166000 -- [-745.532] (-743.542) (-744.452) (-743.633) * (-743.806) (-742.729) (-748.445) [-743.406] -- 0:01:25
166500 -- (-748.765) (-746.736) (-745.597) [-747.000] * (-742.911) [-747.220] (-746.704) (-749.582) -- 0:01:25
167000 -- (-745.869) (-751.760) (-743.582) [-744.607] * (-750.605) (-744.805) (-744.486) [-743.153] -- 0:01:24
167500 -- [-740.838] (-752.302) (-746.140) (-747.150) * [-742.049] (-743.017) (-747.625) (-742.053) -- 0:01:29
168000 -- [-742.893] (-757.643) (-743.093) (-745.198) * (-744.229) (-740.163) (-751.404) [-742.233] -- 0:01:29
168500 -- (-741.736) [-750.962] (-745.171) (-741.906) * (-742.585) [-744.973] (-746.537) (-741.197) -- 0:01:28
169000 -- (-745.047) (-742.866) (-747.472) [-741.236] * [-746.549] (-747.395) (-744.904) (-745.321) -- 0:01:28
169500 -- [-744.401] (-742.693) (-748.336) (-743.569) * (-745.610) (-749.085) (-747.870) [-747.251] -- 0:01:28
170000 -- (-745.850) [-746.072] (-752.757) (-744.618) * [-746.325] (-747.137) (-749.503) (-746.870) -- 0:01:27
Average standard deviation of split frequencies: 0.014731
170500 -- (-748.149) (-739.910) (-747.192) [-744.802] * (-747.715) (-748.588) [-742.755] (-753.610) -- 0:01:27
171000 -- (-743.481) [-740.939] (-743.267) (-747.769) * (-742.876) (-741.631) (-741.325) [-745.363] -- 0:01:27
171500 -- (-746.547) (-743.728) (-743.021) [-744.061] * (-747.430) [-739.874] (-743.267) (-746.238) -- 0:01:26
172000 -- (-747.499) [-739.615] (-742.492) (-746.391) * (-750.702) (-741.026) (-744.317) [-748.557] -- 0:01:26
172500 -- (-748.499) (-745.033) (-744.064) [-748.687] * (-745.838) (-743.783) (-747.059) [-748.665] -- 0:01:26
173000 -- (-749.051) (-743.906) [-744.707] (-743.421) * [-742.050] (-747.841) (-751.431) (-747.291) -- 0:01:26
173500 -- (-748.050) (-748.454) [-741.985] (-746.335) * (-746.626) (-741.009) (-746.827) [-744.026] -- 0:01:25
174000 -- [-744.750] (-745.785) (-746.168) (-742.564) * (-749.950) (-744.881) (-750.140) [-745.322] -- 0:01:25
174500 -- [-744.025] (-745.320) (-743.522) (-749.115) * [-741.216] (-746.013) (-751.792) (-744.915) -- 0:01:25
175000 -- (-747.359) (-742.390) (-750.023) [-745.200] * (-744.501) (-743.524) [-747.031] (-744.154) -- 0:01:24
Average standard deviation of split frequencies: 0.019642
175500 -- (-749.687) (-745.079) [-739.478] (-743.667) * [-741.757] (-740.860) (-745.420) (-746.150) -- 0:01:24
176000 -- (-749.396) (-750.628) [-742.992] (-744.973) * (-747.479) [-745.543] (-747.884) (-743.253) -- 0:01:24
176500 -- (-746.984) (-753.307) (-748.304) [-750.017] * (-747.487) (-746.745) [-746.489] (-743.934) -- 0:01:23
177000 -- (-754.087) (-754.855) (-747.808) [-746.642] * [-742.012] (-742.000) (-749.084) (-743.366) -- 0:01:23
177500 -- [-746.338] (-755.984) (-745.146) (-741.732) * [-743.970] (-744.789) (-750.113) (-740.912) -- 0:01:28
178000 -- (-747.066) (-748.127) [-746.628] (-747.021) * (-748.258) (-746.515) (-750.805) [-745.477] -- 0:01:27
178500 -- (-749.445) [-743.442] (-749.977) (-746.642) * (-746.827) [-745.957] (-754.207) (-748.204) -- 0:01:27
179000 -- (-748.643) (-742.043) (-746.178) [-749.554] * (-745.882) (-747.615) [-749.366] (-752.814) -- 0:01:27
179500 -- [-742.258] (-745.345) (-743.798) (-746.193) * (-742.637) [-743.885] (-758.726) (-743.113) -- 0:01:26
180000 -- (-747.494) (-742.573) (-748.550) [-746.551] * (-744.870) [-746.823] (-753.013) (-748.756) -- 0:01:26
Average standard deviation of split frequencies: 0.024353
180500 -- [-744.302] (-746.710) (-745.678) (-743.402) * (-743.359) [-740.355] (-757.513) (-745.700) -- 0:01:26
181000 -- (-749.978) (-752.586) (-749.770) [-746.288] * (-746.831) [-745.937] (-752.378) (-743.972) -- 0:01:25
181500 -- [-744.314] (-748.707) (-745.940) (-747.201) * (-743.583) [-748.417] (-751.704) (-742.192) -- 0:01:25
182000 -- (-741.806) (-755.405) [-745.500] (-743.938) * [-745.416] (-748.824) (-750.862) (-740.586) -- 0:01:25
182500 -- (-745.569) (-750.649) [-744.887] (-743.673) * (-742.229) (-754.217) (-747.478) [-742.971] -- 0:01:25
183000 -- (-743.518) (-741.317) (-745.349) [-741.233] * (-748.808) (-748.688) (-754.514) [-743.486] -- 0:01:24
183500 -- (-744.717) (-745.712) (-743.391) [-740.730] * [-740.273] (-751.691) (-751.167) (-746.271) -- 0:01:24
184000 -- [-746.078] (-745.070) (-748.147) (-748.270) * [-740.374] (-741.881) (-745.846) (-749.633) -- 0:01:24
184500 -- (-750.628) (-743.146) (-747.738) [-751.384] * (-742.714) [-740.713] (-746.796) (-741.005) -- 0:01:23
185000 -- (-745.647) [-747.929] (-749.795) (-747.085) * [-744.680] (-744.656) (-748.075) (-741.537) -- 0:01:23
Average standard deviation of split frequencies: 0.016896
185500 -- (-747.442) [-742.329] (-749.601) (-744.778) * (-742.515) (-742.233) (-751.702) [-746.276] -- 0:01:23
186000 -- (-746.770) (-743.587) [-747.166] (-741.919) * (-745.934) (-741.760) (-751.545) [-746.032] -- 0:01:23
186500 -- (-748.907) [-743.462] (-743.748) (-743.501) * [-745.859] (-743.991) (-746.329) (-742.409) -- 0:01:22
187000 -- (-748.780) (-745.480) [-742.883] (-741.537) * (-750.760) (-740.063) [-744.702] (-742.881) -- 0:01:26
187500 -- (-744.103) [-747.728] (-744.991) (-744.792) * (-755.906) [-742.514] (-747.753) (-742.932) -- 0:01:26
188000 -- [-743.894] (-746.604) (-744.545) (-746.504) * (-752.420) (-745.121) (-748.320) [-743.149] -- 0:01:26
188500 -- (-750.291) [-751.072] (-747.683) (-742.906) * (-746.550) [-748.176] (-746.633) (-744.958) -- 0:01:26
189000 -- (-744.863) (-745.579) (-745.215) [-743.156] * (-740.896) (-751.029) [-749.416] (-742.625) -- 0:01:25
189500 -- (-742.976) (-749.583) [-742.912] (-743.287) * (-740.469) (-747.162) (-745.285) [-745.008] -- 0:01:25
190000 -- (-751.099) (-749.544) (-748.647) [-745.883] * (-743.671) (-748.161) [-747.534] (-746.209) -- 0:01:25
Average standard deviation of split frequencies: 0.018131
190500 -- (-747.668) (-753.299) [-745.258] (-743.818) * (-743.057) (-742.579) [-744.231] (-749.585) -- 0:01:24
191000 -- (-750.745) (-747.516) [-749.026] (-744.288) * (-741.537) [-739.666] (-739.665) (-745.715) -- 0:01:24
191500 -- [-746.465] (-747.365) (-744.172) (-743.391) * (-749.021) (-745.005) [-742.222] (-748.739) -- 0:01:24
192000 -- (-749.017) (-742.447) (-748.039) [-745.438] * (-741.466) (-743.682) (-745.338) [-743.865] -- 0:01:24
192500 -- (-743.156) [-747.200] (-747.355) (-748.822) * (-749.012) (-747.960) (-751.231) [-745.818] -- 0:01:23
193000 -- (-743.107) (-744.548) [-748.270] (-748.520) * (-750.869) (-748.575) (-750.567) [-745.497] -- 0:01:23
193500 -- (-744.184) (-743.374) (-749.597) [-741.459] * [-747.199] (-749.774) (-748.899) (-750.135) -- 0:01:23
194000 -- [-744.030] (-742.666) (-748.590) (-755.147) * (-745.791) (-749.645) (-749.892) [-748.392] -- 0:01:23
194500 -- [-743.946] (-746.051) (-747.005) (-740.498) * (-747.976) (-752.731) [-745.956] (-745.277) -- 0:01:22
195000 -- (-741.657) (-746.237) [-746.463] (-744.281) * [-744.685] (-748.252) (-745.869) (-744.252) -- 0:01:22
Average standard deviation of split frequencies: 0.017638
195500 -- (-747.962) (-748.127) [-747.425] (-747.720) * (-744.483) [-746.765] (-755.520) (-743.818) -- 0:01:22
196000 -- (-746.195) [-741.801] (-750.323) (-751.917) * (-744.055) (-747.217) [-744.356] (-744.798) -- 0:01:22
196500 -- (-745.303) [-748.656] (-754.390) (-748.600) * (-748.011) [-742.366] (-747.459) (-739.353) -- 0:01:21
197000 -- (-743.514) (-752.770) (-756.552) [-742.738] * (-748.494) [-741.629] (-744.143) (-744.622) -- 0:01:25
197500 -- [-745.755] (-747.843) (-754.517) (-741.097) * (-746.714) (-747.614) [-746.312] (-747.374) -- 0:01:25
198000 -- (-750.142) (-748.868) (-757.158) [-740.061] * [-749.046] (-744.998) (-740.637) (-745.017) -- 0:01:25
198500 -- [-743.393] (-746.211) (-757.740) (-742.106) * (-745.547) [-746.394] (-753.023) (-747.694) -- 0:01:24
199000 -- [-739.762] (-743.606) (-753.225) (-746.585) * (-744.508) [-748.872] (-748.776) (-745.143) -- 0:01:24
199500 -- (-747.125) (-746.507) (-751.525) [-745.893] * (-748.215) (-757.605) [-743.195] (-747.999) -- 0:01:24
200000 -- (-745.950) (-747.359) [-748.715] (-746.953) * [-742.698] (-746.166) (-743.957) (-742.533) -- 0:01:24
Average standard deviation of split frequencies: 0.027016
200500 -- [-743.795] (-748.926) (-747.895) (-743.388) * (-747.761) (-747.974) (-747.228) [-741.708] -- 0:01:23
201000 -- (-739.814) (-745.573) [-742.843] (-742.760) * (-748.605) (-747.037) [-747.036] (-745.115) -- 0:01:23
201500 -- [-741.406] (-747.928) (-748.125) (-743.849) * (-747.629) [-745.510] (-750.216) (-744.974) -- 0:01:23
202000 -- (-744.288) [-745.398] (-751.935) (-745.511) * [-744.826] (-744.072) (-748.434) (-750.386) -- 0:01:22
202500 -- [-742.953] (-743.214) (-746.574) (-748.040) * [-746.546] (-741.336) (-742.920) (-746.855) -- 0:01:22
203000 -- (-750.130) [-743.783] (-746.304) (-744.311) * [-743.922] (-742.622) (-743.113) (-750.010) -- 0:01:22
203500 -- (-743.962) [-743.850] (-755.602) (-746.929) * (-745.186) [-744.625] (-745.661) (-746.009) -- 0:01:22
204000 -- (-750.366) [-742.565] (-749.356) (-744.538) * (-745.681) (-747.501) [-743.248] (-747.661) -- 0:01:21
204500 -- (-742.811) [-743.263] (-752.602) (-747.326) * (-744.949) (-748.743) [-745.429] (-744.597) -- 0:01:21
205000 -- (-753.042) [-747.383] (-745.392) (-740.947) * (-743.557) (-747.124) [-745.455] (-743.389) -- 0:01:21
Average standard deviation of split frequencies: 0.027460
205500 -- (-749.832) (-744.661) (-745.078) [-740.231] * (-748.920) [-742.761] (-743.566) (-746.361) -- 0:01:21
206000 -- [-742.351] (-740.447) (-745.556) (-743.763) * (-749.900) [-744.149] (-742.665) (-751.251) -- 0:01:20
206500 -- (-746.669) [-741.700] (-742.027) (-740.999) * (-741.957) [-741.265] (-742.572) (-750.097) -- 0:01:20
207000 -- (-745.401) [-742.832] (-745.711) (-745.049) * (-740.545) (-745.143) [-741.808] (-742.845) -- 0:01:24
207500 -- (-747.202) (-745.400) (-748.635) [-742.720] * [-745.200] (-746.524) (-742.882) (-742.326) -- 0:01:24
208000 -- [-747.192] (-743.138) (-743.363) (-741.577) * (-744.918) [-749.098] (-750.372) (-746.604) -- 0:01:23
208500 -- (-752.631) (-750.384) (-743.035) [-747.108] * (-749.626) (-754.941) (-741.842) [-749.399] -- 0:01:23
209000 -- (-740.038) (-748.778) [-740.479] (-747.019) * (-746.664) (-747.963) [-743.859] (-743.995) -- 0:01:23
209500 -- (-751.073) [-745.240] (-743.783) (-750.283) * (-754.704) [-743.496] (-742.083) (-743.224) -- 0:01:23
210000 -- [-741.587] (-744.966) (-744.206) (-748.515) * (-755.397) (-744.448) (-743.669) [-742.505] -- 0:01:22
Average standard deviation of split frequencies: 0.022377
210500 -- (-746.564) (-746.573) [-744.153] (-747.902) * [-754.128] (-749.662) (-743.716) (-742.374) -- 0:01:22
211000 -- (-743.658) (-744.320) [-744.813] (-749.190) * [-742.851] (-742.617) (-744.211) (-745.384) -- 0:01:22
211500 -- [-743.312] (-743.504) (-750.472) (-748.577) * (-748.827) (-743.589) (-742.278) [-742.215] -- 0:01:22
212000 -- (-746.088) [-742.347] (-743.222) (-749.295) * (-752.299) [-742.482] (-746.572) (-747.292) -- 0:01:21
212500 -- (-745.498) (-745.538) [-741.186] (-751.022) * (-744.214) (-749.284) (-747.621) [-745.479] -- 0:01:21
213000 -- [-748.912] (-744.787) (-743.638) (-744.753) * (-741.793) [-746.657] (-742.105) (-747.008) -- 0:01:21
213500 -- (-745.383) [-746.985] (-744.871) (-755.841) * [-742.385] (-745.928) (-752.834) (-748.989) -- 0:01:21
214000 -- (-745.362) (-749.273) (-745.228) [-749.629] * [-740.044] (-757.641) (-744.222) (-743.970) -- 0:01:20
214500 -- (-752.418) [-744.034] (-750.952) (-749.779) * [-741.085] (-746.946) (-747.764) (-741.580) -- 0:01:20
215000 -- (-756.875) (-748.113) (-746.487) [-746.898] * [-740.330] (-745.552) (-748.932) (-745.692) -- 0:01:20
Average standard deviation of split frequencies: 0.020733
215500 -- (-755.530) (-745.644) [-747.531] (-748.726) * (-745.917) (-749.879) [-744.172] (-743.085) -- 0:01:20
216000 -- (-763.905) (-748.901) [-744.074] (-751.548) * (-746.719) (-750.339) (-744.368) [-746.858] -- 0:01:19
216500 -- (-768.342) (-742.614) (-747.224) [-747.157] * [-742.348] (-754.029) (-742.898) (-740.018) -- 0:01:23
217000 -- (-762.824) (-744.016) [-748.539] (-745.644) * [-742.889] (-748.654) (-745.978) (-759.718) -- 0:01:22
217500 -- (-755.495) (-748.283) (-748.217) [-747.728] * (-747.649) (-748.127) (-748.916) [-741.781] -- 0:01:22
218000 -- (-751.313) [-747.124] (-745.651) (-744.230) * (-747.670) (-752.383) [-742.203] (-749.332) -- 0:01:22
218500 -- [-752.822] (-742.118) (-744.215) (-751.468) * (-744.115) [-748.865] (-745.012) (-744.558) -- 0:01:22
219000 -- (-756.711) [-743.376] (-743.147) (-746.919) * [-747.496] (-745.435) (-744.055) (-749.014) -- 0:01:22
219500 -- (-748.738) [-740.025] (-743.819) (-746.390) * (-744.288) (-747.114) (-743.093) [-743.024] -- 0:01:21
220000 -- (-748.074) (-745.184) [-743.881] (-745.562) * (-748.847) (-749.447) [-745.077] (-741.759) -- 0:01:21
Average standard deviation of split frequencies: 0.021363
220500 -- (-747.626) (-740.445) (-751.435) [-740.814] * (-746.213) (-748.949) [-742.588] (-747.857) -- 0:01:21
221000 -- (-751.456) [-745.867] (-746.316) (-745.924) * [-746.006] (-749.502) (-748.263) (-745.778) -- 0:01:21
221500 -- (-752.631) (-741.689) [-741.905] (-750.203) * (-744.399) [-745.172] (-750.121) (-745.874) -- 0:01:20
222000 -- (-742.970) (-742.909) [-741.579] (-750.777) * (-745.771) [-745.559] (-750.256) (-761.753) -- 0:01:20
222500 -- (-748.434) (-743.114) [-742.983] (-751.245) * (-745.913) [-746.459] (-747.285) (-751.795) -- 0:01:20
223000 -- (-751.912) (-749.954) (-747.258) [-744.969] * (-744.650) (-745.921) (-746.301) [-748.004] -- 0:01:20
223500 -- (-749.093) (-747.522) (-747.913) [-741.718] * (-746.768) (-743.571) [-748.972] (-745.464) -- 0:01:19
224000 -- (-750.241) [-747.336] (-740.508) (-749.298) * (-745.369) (-741.887) [-747.880] (-748.814) -- 0:01:19
224500 -- (-752.444) (-743.757) [-744.246] (-745.517) * [-746.365] (-741.422) (-742.731) (-748.062) -- 0:01:19
225000 -- (-751.572) [-748.934] (-748.821) (-742.812) * (-743.946) (-744.902) [-748.713] (-751.903) -- 0:01:19
Average standard deviation of split frequencies: 0.019468
225500 -- (-746.459) (-747.566) (-742.209) [-742.256] * (-746.567) [-741.420] (-754.089) (-751.287) -- 0:01:18
226000 -- (-743.065) (-744.084) [-744.364] (-745.143) * (-743.804) (-750.925) (-746.247) [-740.123] -- 0:01:18
226500 -- [-741.799] (-743.423) (-745.424) (-748.962) * (-743.932) (-745.543) (-746.843) [-743.136] -- 0:01:21
227000 -- [-743.829] (-742.485) (-754.884) (-744.605) * (-741.473) [-745.671] (-746.521) (-741.974) -- 0:01:21
227500 -- [-746.676] (-745.954) (-744.561) (-754.755) * (-744.193) [-745.849] (-743.939) (-744.438) -- 0:01:21
228000 -- (-744.197) [-748.457] (-744.290) (-743.056) * [-748.793] (-743.249) (-743.643) (-743.570) -- 0:01:21
228500 -- (-745.005) (-749.513) (-741.086) [-749.576] * (-750.159) (-750.529) [-744.365] (-742.991) -- 0:01:21
229000 -- (-745.629) (-746.234) (-745.246) [-744.119] * (-743.669) (-740.196) (-749.478) [-739.523] -- 0:01:20
229500 -- (-750.258) (-745.200) (-745.883) [-740.918] * (-747.898) (-742.988) [-749.299] (-741.356) -- 0:01:20
230000 -- (-742.340) [-744.232] (-741.518) (-742.068) * (-751.324) [-745.223] (-745.728) (-744.237) -- 0:01:20
Average standard deviation of split frequencies: 0.019074
230500 -- (-743.355) (-750.740) [-741.906] (-748.448) * (-747.500) (-743.093) [-744.166] (-743.881) -- 0:01:20
231000 -- (-747.554) (-749.792) [-742.502] (-748.956) * (-748.241) (-748.202) [-746.692] (-743.278) -- 0:01:19
231500 -- (-748.733) (-749.271) [-742.595] (-749.957) * [-747.533] (-747.367) (-744.465) (-745.142) -- 0:01:19
232000 -- (-747.128) (-746.937) (-746.464) [-744.118] * [-749.204] (-751.650) (-743.646) (-749.717) -- 0:01:19
232500 -- (-744.027) [-744.544] (-748.045) (-745.224) * [-745.090] (-745.362) (-741.151) (-743.318) -- 0:01:19
233000 -- (-743.266) (-745.691) (-743.751) [-746.797] * [-750.675] (-742.451) (-747.469) (-746.424) -- 0:01:19
233500 -- (-747.538) [-749.271] (-742.820) (-741.424) * (-749.371) (-751.590) [-743.617] (-745.123) -- 0:01:18
234000 -- (-740.464) [-745.277] (-748.367) (-748.141) * (-746.793) [-748.556] (-748.941) (-744.468) -- 0:01:18
234500 -- (-743.905) (-748.876) (-748.423) [-741.291] * (-742.786) [-749.080] (-748.894) (-743.897) -- 0:01:18
235000 -- [-744.940] (-744.366) (-749.286) (-747.398) * [-745.465] (-754.606) (-747.833) (-746.080) -- 0:01:18
Average standard deviation of split frequencies: 0.019975
235500 -- (-744.619) (-748.569) (-753.005) [-746.225] * (-744.230) (-752.733) (-746.223) [-746.619] -- 0:01:17
236000 -- (-746.463) (-753.807) (-747.628) [-742.002] * (-749.151) (-747.673) [-741.561] (-745.978) -- 0:01:20
236500 -- (-742.374) (-754.786) (-746.829) [-747.156] * (-747.773) (-742.902) [-743.175] (-749.094) -- 0:01:20
237000 -- [-743.418] (-756.715) (-754.413) (-746.576) * (-743.559) [-748.308] (-746.870) (-746.888) -- 0:01:20
237500 -- (-749.516) (-745.917) (-750.097) [-743.697] * [-747.966] (-746.627) (-747.919) (-747.803) -- 0:01:20
238000 -- (-747.838) [-746.063] (-750.240) (-743.201) * [-741.000] (-744.595) (-743.244) (-748.302) -- 0:01:20
238500 -- (-744.941) [-746.029] (-749.122) (-748.840) * [-745.330] (-748.608) (-741.042) (-749.246) -- 0:01:19
239000 -- [-744.378] (-745.745) (-747.919) (-749.035) * (-745.064) [-745.630] (-744.127) (-744.816) -- 0:01:19
239500 -- (-744.987) (-748.972) [-746.955] (-753.015) * [-748.089] (-743.235) (-748.528) (-742.709) -- 0:01:19
240000 -- [-746.246] (-743.047) (-746.178) (-747.931) * (-748.199) [-744.446] (-748.097) (-744.170) -- 0:01:19
Average standard deviation of split frequencies: 0.019587
240500 -- [-745.903] (-754.364) (-745.728) (-751.265) * (-747.911) (-747.770) (-743.909) [-745.062] -- 0:01:18
241000 -- [-750.056] (-750.656) (-747.191) (-747.081) * (-743.026) [-746.361] (-746.379) (-744.870) -- 0:01:18
241500 -- [-745.521] (-745.387) (-745.357) (-755.122) * [-746.567] (-748.521) (-747.117) (-749.582) -- 0:01:18
242000 -- (-745.678) (-745.712) [-746.551] (-754.800) * [-743.196] (-755.335) (-744.677) (-742.644) -- 0:01:18
242500 -- (-742.671) (-747.837) [-744.175] (-746.601) * (-744.445) (-747.610) [-741.704] (-748.491) -- 0:01:18
243000 -- (-746.364) [-742.186] (-746.263) (-742.238) * [-746.393] (-744.928) (-746.273) (-744.106) -- 0:01:17
243500 -- (-739.571) (-750.192) [-741.805] (-744.264) * (-746.241) (-742.254) (-743.974) [-747.921] -- 0:01:17
244000 -- [-740.829] (-750.152) (-741.700) (-744.237) * (-747.646) (-747.497) [-751.309] (-750.805) -- 0:01:17
244500 -- (-746.464) [-755.060] (-744.182) (-744.048) * (-745.870) [-746.657] (-749.976) (-744.759) -- 0:01:17
245000 -- [-742.145] (-748.063) (-745.346) (-741.855) * (-747.033) (-740.473) (-746.231) [-743.988] -- 0:01:17
Average standard deviation of split frequencies: 0.021079
245500 -- (-743.715) (-748.387) [-747.908] (-742.527) * (-746.717) [-746.148] (-745.733) (-747.110) -- 0:01:19
246000 -- (-745.677) (-754.898) (-744.390) [-743.372] * (-745.023) (-746.828) (-743.001) [-742.853] -- 0:01:19
246500 -- (-745.646) [-753.065] (-746.400) (-740.623) * [-744.028] (-743.084) (-746.965) (-742.549) -- 0:01:19
247000 -- (-743.711) (-752.032) (-744.610) [-741.327] * (-744.517) (-742.823) [-741.433] (-745.601) -- 0:01:19
247500 -- (-746.604) [-747.452] (-744.161) (-743.036) * [-740.731] (-751.534) (-751.752) (-747.690) -- 0:01:19
248000 -- (-745.497) (-746.097) (-753.707) [-742.572] * (-745.275) (-745.157) [-743.149] (-745.805) -- 0:01:18
248500 -- (-740.723) (-749.134) (-745.705) [-743.652] * (-741.994) [-742.700] (-743.273) (-742.012) -- 0:01:18
249000 -- (-743.433) (-749.665) [-750.472] (-747.950) * [-746.119] (-746.319) (-746.786) (-743.994) -- 0:01:18
249500 -- (-750.940) (-745.133) [-741.790] (-750.299) * (-752.450) [-744.543] (-745.327) (-743.397) -- 0:01:18
250000 -- (-741.259) [-742.348] (-742.996) (-743.288) * (-749.439) (-746.496) [-747.349] (-744.313) -- 0:01:18
Average standard deviation of split frequencies: 0.025388
250500 -- (-744.634) [-744.343] (-742.032) (-748.238) * (-745.286) [-746.246] (-744.484) (-743.566) -- 0:01:17
251000 -- (-744.727) (-751.924) (-748.700) [-743.397] * (-742.692) (-740.487) (-747.617) [-743.516] -- 0:01:17
251500 -- (-743.902) (-750.702) [-746.822] (-744.169) * (-749.156) [-744.768] (-756.774) (-744.561) -- 0:01:17
252000 -- [-746.932] (-744.904) (-748.473) (-747.680) * (-747.825) (-752.106) [-746.888] (-747.261) -- 0:01:17
252500 -- [-745.436] (-742.164) (-744.182) (-744.254) * (-747.533) (-745.418) [-746.079] (-744.619) -- 0:01:16
253000 -- (-744.949) (-743.149) [-746.381] (-742.772) * (-746.348) (-750.251) [-747.495] (-743.133) -- 0:01:16
253500 -- (-741.679) [-743.606] (-750.132) (-744.720) * (-747.472) [-741.816] (-741.339) (-745.060) -- 0:01:16
254000 -- (-745.183) (-747.429) (-745.875) [-743.034] * [-740.791] (-742.048) (-750.674) (-749.363) -- 0:01:16
254500 -- [-745.478] (-746.610) (-743.459) (-740.516) * (-751.083) [-742.966] (-745.571) (-754.170) -- 0:01:16
255000 -- [-740.341] (-742.521) (-746.162) (-742.077) * (-748.426) [-744.647] (-748.981) (-742.712) -- 0:01:15
Average standard deviation of split frequencies: 0.030383
255500 -- (-742.120) (-747.985) [-741.632] (-744.062) * (-745.947) (-741.801) (-747.795) [-744.036] -- 0:01:18
256000 -- (-743.509) (-745.086) [-744.975] (-747.481) * (-745.089) (-745.803) (-749.195) [-742.775] -- 0:01:18
256500 -- [-741.247] (-755.137) (-742.346) (-749.139) * (-749.145) [-746.951] (-748.282) (-745.678) -- 0:01:18
257000 -- [-740.566] (-758.017) (-747.778) (-756.358) * [-742.876] (-750.416) (-750.074) (-746.496) -- 0:01:18
257500 -- [-741.757] (-746.899) (-744.353) (-747.643) * (-745.602) (-743.923) (-745.755) [-745.940] -- 0:01:17
258000 -- (-749.638) (-748.754) [-748.569] (-741.118) * (-749.134) (-741.863) [-742.437] (-745.714) -- 0:01:17
258500 -- [-738.888] (-748.909) (-745.997) (-742.623) * [-748.691] (-750.825) (-746.163) (-749.192) -- 0:01:17
259000 -- [-747.100] (-749.113) (-744.171) (-750.462) * (-742.827) (-743.583) [-740.880] (-748.048) -- 0:01:17
259500 -- (-742.493) (-746.329) (-743.514) [-745.246] * (-745.129) (-741.908) (-744.430) [-744.779] -- 0:01:17
260000 -- (-744.411) (-749.011) (-743.209) [-744.090] * (-743.217) (-747.182) [-746.616] (-746.486) -- 0:01:16
Average standard deviation of split frequencies: 0.037978
260500 -- (-740.890) (-750.698) [-752.101] (-756.073) * [-749.176] (-755.206) (-749.745) (-741.042) -- 0:01:16
261000 -- [-744.277] (-752.988) (-748.250) (-744.294) * (-740.200) (-746.499) (-757.361) [-744.413] -- 0:01:16
261500 -- (-739.602) [-756.691] (-747.313) (-744.315) * (-751.701) (-746.870) [-746.479] (-744.767) -- 0:01:16
262000 -- (-743.677) (-751.014) (-748.034) [-746.993] * (-756.791) [-745.585] (-749.674) (-745.592) -- 0:01:16
262500 -- (-748.158) [-749.939] (-748.160) (-748.447) * (-754.603) [-742.686] (-743.080) (-748.882) -- 0:01:15
263000 -- (-741.938) (-743.917) (-743.618) [-744.378] * (-751.053) [-746.483] (-748.271) (-744.938) -- 0:01:15
263500 -- (-744.202) (-748.841) [-745.931] (-746.870) * [-746.314] (-744.445) (-749.690) (-750.991) -- 0:01:15
264000 -- [-744.064] (-750.586) (-747.949) (-750.004) * (-750.720) [-745.447] (-747.460) (-748.859) -- 0:01:15
264500 -- (-745.853) [-751.356] (-754.707) (-744.877) * (-746.541) (-749.691) [-745.933] (-751.430) -- 0:01:15
265000 -- [-740.120] (-743.468) (-744.778) (-746.245) * [-748.342] (-749.563) (-750.571) (-744.627) -- 0:01:14
Average standard deviation of split frequencies: 0.037216
265500 -- [-743.187] (-747.670) (-742.999) (-751.506) * (-740.813) (-746.123) [-749.909] (-744.097) -- 0:01:17
266000 -- [-744.118] (-750.304) (-752.314) (-746.899) * (-746.037) (-756.320) [-744.103] (-757.568) -- 0:01:17
266500 -- (-747.363) (-748.767) [-746.602] (-745.999) * [-747.085] (-756.997) (-749.620) (-752.246) -- 0:01:17
267000 -- (-746.203) (-744.024) [-742.712] (-745.538) * [-747.741] (-750.226) (-749.340) (-748.502) -- 0:01:16
267500 -- (-747.085) (-748.602) (-741.286) [-742.931] * (-740.377) (-751.423) (-741.253) [-750.786] -- 0:01:16
268000 -- (-747.365) (-750.414) (-741.939) [-742.970] * [-742.578] (-750.302) (-747.837) (-746.115) -- 0:01:16
268500 -- [-744.679] (-744.143) (-741.376) (-753.509) * (-744.059) (-750.167) [-743.081] (-745.581) -- 0:01:16
269000 -- (-746.974) [-744.800] (-743.742) (-756.566) * (-746.836) (-752.622) [-743.540] (-744.616) -- 0:01:16
269500 -- (-745.734) [-743.572] (-745.521) (-747.951) * (-747.900) [-748.809] (-746.427) (-747.644) -- 0:01:15
270000 -- (-745.684) (-746.083) [-746.521] (-740.434) * (-748.309) (-744.366) [-743.359] (-742.090) -- 0:01:15
Average standard deviation of split frequencies: 0.038316
270500 -- (-748.795) (-741.468) (-744.900) [-743.194] * (-748.969) (-742.016) [-745.320] (-742.460) -- 0:01:15
271000 -- [-745.101] (-748.800) (-742.362) (-745.907) * (-743.353) [-745.065] (-755.461) (-745.346) -- 0:01:15
271500 -- (-747.144) (-746.361) (-747.619) [-741.155] * (-749.185) [-745.855] (-745.480) (-750.104) -- 0:01:15
272000 -- [-744.709] (-749.138) (-745.136) (-740.541) * [-745.266] (-744.488) (-743.803) (-745.969) -- 0:01:14
272500 -- (-742.244) (-742.543) [-742.214] (-750.290) * [-744.126] (-745.214) (-748.390) (-743.961) -- 0:01:14
273000 -- (-743.030) [-744.215] (-744.732) (-746.421) * [-743.256] (-741.788) (-746.868) (-742.385) -- 0:01:14
273500 -- (-743.443) (-744.453) (-752.218) [-747.940] * (-750.339) (-745.811) (-750.258) [-748.972] -- 0:01:14
274000 -- [-745.419] (-748.696) (-747.209) (-743.775) * (-745.504) (-745.759) [-745.181] (-746.396) -- 0:01:14
274500 -- [-750.190] (-747.809) (-749.710) (-742.885) * (-750.590) (-742.948) (-749.656) [-745.213] -- 0:01:14
275000 -- (-744.500) (-744.594) (-748.763) [-744.878] * [-747.720] (-742.426) (-746.212) (-746.184) -- 0:01:16
Average standard deviation of split frequencies: 0.032452
275500 -- (-742.187) [-743.413] (-743.400) (-743.561) * (-750.774) [-743.366] (-740.930) (-750.941) -- 0:01:16
276000 -- (-746.702) [-745.042] (-746.510) (-741.791) * (-746.112) (-744.212) (-742.477) [-747.939] -- 0:01:16
276500 -- (-751.641) [-745.596] (-743.384) (-746.851) * (-746.966) (-748.399) (-742.010) [-746.830] -- 0:01:15
277000 -- (-744.799) [-746.679] (-742.380) (-749.195) * (-748.010) (-750.355) (-742.210) [-743.056] -- 0:01:15
277500 -- (-744.633) [-746.763] (-741.677) (-748.876) * (-744.206) (-743.074) [-743.198] (-746.594) -- 0:01:15
278000 -- (-752.631) (-744.203) [-749.551] (-743.647) * [-752.386] (-742.115) (-749.244) (-747.496) -- 0:01:15
278500 -- (-741.236) (-751.856) [-746.122] (-745.372) * [-747.711] (-742.382) (-747.946) (-745.532) -- 0:01:15
279000 -- (-740.796) (-750.077) [-742.049] (-742.819) * (-745.538) (-746.026) [-746.100] (-751.009) -- 0:01:14
279500 -- [-744.405] (-751.423) (-746.574) (-740.748) * (-751.284) [-742.011] (-744.334) (-744.953) -- 0:01:14
280000 -- (-738.990) (-742.816) (-742.616) [-745.545] * [-743.137] (-751.939) (-748.123) (-741.753) -- 0:01:14
Average standard deviation of split frequencies: 0.033592
280500 -- (-739.603) [-747.304] (-740.623) (-745.548) * (-743.976) [-745.911] (-743.158) (-747.122) -- 0:01:14
281000 -- (-742.422) (-745.647) [-742.830] (-744.930) * (-746.013) (-751.181) [-741.978] (-747.331) -- 0:01:14
281500 -- (-744.929) (-742.330) (-747.056) [-750.174] * (-746.108) (-744.204) [-743.460] (-745.817) -- 0:01:14
282000 -- (-743.246) (-748.775) (-746.163) [-746.287] * (-740.068) (-744.908) (-745.323) [-747.566] -- 0:01:13
282500 -- (-743.090) (-747.462) (-742.302) [-748.300] * [-743.534] (-744.851) (-742.844) (-739.931) -- 0:01:13
283000 -- (-746.583) (-751.517) [-741.025] (-748.707) * [-745.187] (-753.826) (-745.958) (-744.858) -- 0:01:13
283500 -- (-752.768) [-747.659] (-743.360) (-745.869) * (-744.418) (-756.915) [-744.282] (-746.923) -- 0:01:13
284000 -- (-744.639) [-745.157] (-743.541) (-745.470) * (-743.622) (-753.976) (-741.023) [-744.684] -- 0:01:13
284500 -- (-745.266) (-745.212) [-747.775] (-744.443) * (-747.305) (-750.539) [-743.228] (-747.833) -- 0:01:15
285000 -- (-746.960) (-744.014) [-747.947] (-745.240) * [-743.425] (-749.086) (-743.757) (-750.944) -- 0:01:15
Average standard deviation of split frequencies: 0.034614
285500 -- (-741.753) (-742.673) (-747.156) [-741.729] * [-741.484] (-746.972) (-743.548) (-745.850) -- 0:01:15
286000 -- (-743.777) (-741.157) (-744.387) [-743.577] * (-747.343) (-745.803) (-752.458) [-741.833] -- 0:01:14
286500 -- (-744.174) (-746.821) (-745.475) [-741.531] * (-740.693) (-753.107) [-744.121] (-744.532) -- 0:01:14
287000 -- [-748.933] (-746.137) (-748.046) (-742.429) * (-745.335) (-747.069) [-745.097] (-744.186) -- 0:01:14
287500 -- (-748.001) (-753.494) [-744.872] (-744.836) * (-748.347) (-745.954) (-740.623) [-740.986] -- 0:01:14
288000 -- [-741.108] (-745.704) (-746.835) (-741.412) * [-747.299] (-743.713) (-744.834) (-743.703) -- 0:01:14
288500 -- [-745.653] (-744.442) (-747.778) (-749.387) * (-751.526) (-749.545) (-741.199) [-742.984] -- 0:01:13
289000 -- (-743.762) [-745.729] (-741.625) (-743.945) * (-740.535) [-759.498] (-747.550) (-743.392) -- 0:01:13
289500 -- (-744.389) [-742.172] (-741.281) (-745.754) * (-750.253) (-749.202) [-745.311] (-743.340) -- 0:01:13
290000 -- (-753.928) (-740.456) [-744.225] (-745.675) * [-750.298] (-751.891) (-748.129) (-743.740) -- 0:01:13
Average standard deviation of split frequencies: 0.036491
290500 -- (-754.950) [-743.766] (-748.087) (-744.132) * (-749.717) (-754.850) (-746.549) [-739.791] -- 0:01:13
291000 -- (-750.296) (-746.107) [-740.446] (-745.024) * (-751.161) [-752.146] (-760.597) (-746.819) -- 0:01:13
291500 -- (-750.964) (-743.951) [-749.560] (-746.555) * [-750.398] (-750.979) (-755.850) (-741.791) -- 0:01:12
292000 -- (-748.262) (-744.479) (-747.175) [-745.143] * (-750.985) (-756.294) [-746.628] (-741.910) -- 0:01:12
292500 -- (-746.639) (-744.721) (-743.761) [-742.359] * [-743.971] (-750.268) (-744.028) (-746.758) -- 0:01:12
293000 -- (-742.101) [-743.788] (-742.316) (-748.983) * (-743.797) [-745.212] (-748.182) (-746.018) -- 0:01:12
293500 -- (-751.468) (-741.819) [-743.758] (-747.336) * (-747.765) (-749.081) [-747.342] (-740.833) -- 0:01:12
294000 -- (-745.277) (-748.187) [-740.816] (-749.542) * [-745.054] (-750.616) (-751.476) (-746.129) -- 0:01:12
294500 -- (-745.767) (-744.259) (-748.171) [-745.030] * (-747.082) [-742.285] (-741.485) (-747.112) -- 0:01:14
295000 -- (-746.135) (-745.206) (-741.849) [-748.695] * [-746.731] (-755.295) (-745.225) (-744.945) -- 0:01:14
Average standard deviation of split frequencies: 0.035037
295500 -- (-745.146) [-741.782] (-741.632) (-744.533) * (-748.779) (-750.566) (-749.653) [-745.915] -- 0:01:13
296000 -- (-744.851) (-741.947) [-745.418] (-745.273) * (-752.805) (-742.959) [-744.518] (-752.215) -- 0:01:13
296500 -- [-747.323] (-749.062) (-739.647) (-748.399) * (-747.212) (-754.529) (-749.064) [-746.944] -- 0:01:13
297000 -- (-748.442) [-744.915] (-748.840) (-748.369) * (-749.014) (-746.789) [-746.865] (-750.850) -- 0:01:13
297500 -- (-745.840) (-741.650) [-742.088] (-746.996) * (-749.239) (-744.604) (-742.984) [-746.205] -- 0:01:13
298000 -- (-744.157) (-752.489) [-744.413] (-744.034) * [-746.445] (-748.583) (-741.883) (-742.214) -- 0:01:13
298500 -- (-745.602) (-757.874) (-750.799) [-746.352] * (-752.284) [-744.728] (-752.268) (-745.266) -- 0:01:12
299000 -- [-744.578] (-754.712) (-746.534) (-745.432) * (-747.855) [-741.826] (-745.231) (-751.781) -- 0:01:12
299500 -- (-745.056) (-751.001) (-751.904) [-745.922] * [-748.513] (-741.144) (-746.299) (-745.326) -- 0:01:12
300000 -- [-744.126] (-751.066) (-743.604) (-747.632) * (-746.022) (-744.591) (-745.116) [-743.727] -- 0:01:12
Average standard deviation of split frequencies: 0.025870
300500 -- [-742.797] (-748.466) (-741.579) (-742.968) * [-747.134] (-745.969) (-745.466) (-745.580) -- 0:01:12
301000 -- (-741.244) (-744.745) (-748.454) [-747.475] * (-745.228) [-740.190] (-744.009) (-742.939) -- 0:01:11
301500 -- (-742.267) [-742.514] (-749.921) (-748.846) * (-749.939) (-747.799) [-747.674] (-742.864) -- 0:01:11
302000 -- (-744.936) [-742.683] (-744.101) (-743.605) * (-745.922) (-749.869) [-743.016] (-745.113) -- 0:01:11
302500 -- (-742.000) [-742.747] (-756.522) (-742.717) * [-746.512] (-749.691) (-750.222) (-744.173) -- 0:01:11
303000 -- [-743.778] (-741.977) (-745.347) (-740.201) * (-747.154) (-744.754) (-744.037) [-743.508] -- 0:01:11
303500 -- (-746.007) [-740.866] (-748.349) (-747.779) * [-746.276] (-746.033) (-749.614) (-744.897) -- 0:01:11
304000 -- (-747.586) [-744.308] (-748.126) (-743.603) * (-748.033) (-745.119) (-759.717) [-747.426] -- 0:01:13
304500 -- (-750.372) [-744.034] (-748.920) (-743.964) * (-742.593) (-746.158) (-743.625) [-743.964] -- 0:01:13
305000 -- (-745.320) [-747.219] (-743.656) (-742.526) * (-746.207) (-744.109) (-746.395) [-745.466] -- 0:01:12
Average standard deviation of split frequencies: 0.027730
305500 -- [-751.302] (-756.651) (-749.417) (-743.363) * [-749.958] (-745.316) (-740.353) (-746.742) -- 0:01:12
306000 -- (-741.930) [-743.944] (-745.686) (-747.510) * [-741.125] (-741.009) (-741.898) (-749.890) -- 0:01:12
306500 -- (-748.031) (-746.917) [-741.453] (-749.168) * [-743.388] (-743.352) (-741.657) (-741.906) -- 0:01:12
307000 -- (-745.407) [-745.274] (-741.517) (-746.150) * (-744.352) [-744.265] (-745.265) (-743.773) -- 0:01:12
307500 -- [-740.618] (-746.149) (-747.174) (-741.761) * (-749.163) [-746.356] (-741.302) (-745.246) -- 0:01:12
308000 -- [-742.629] (-749.215) (-747.833) (-742.184) * (-752.537) (-748.964) (-746.513) [-749.533] -- 0:01:11
308500 -- (-744.261) (-749.026) (-744.967) [-750.873] * (-748.544) (-748.591) (-745.972) [-745.182] -- 0:01:11
309000 -- [-745.584] (-741.642) (-755.088) (-743.403) * (-752.757) [-744.855] (-747.007) (-744.126) -- 0:01:11
309500 -- (-746.930) (-745.583) [-744.502] (-742.341) * (-749.577) (-743.151) (-744.933) [-744.630] -- 0:01:11
310000 -- (-749.625) (-749.995) (-743.623) [-745.024] * (-752.110) (-745.210) (-746.110) [-743.224] -- 0:01:11
Average standard deviation of split frequencies: 0.028072
310500 -- (-757.483) (-742.848) (-745.718) [-742.251] * (-753.844) [-745.929] (-743.481) (-743.418) -- 0:01:11
311000 -- (-746.533) [-750.048] (-747.809) (-742.150) * (-750.430) [-750.021] (-747.433) (-746.225) -- 0:01:10
311500 -- (-749.403) (-742.242) [-749.730] (-744.431) * [-748.604] (-749.118) (-751.114) (-741.627) -- 0:01:10
312000 -- (-741.463) (-749.902) (-741.431) [-743.851] * (-746.800) (-743.605) [-750.564] (-750.035) -- 0:01:10
312500 -- (-747.486) [-740.980] (-747.097) (-742.596) * [-745.137] (-746.022) (-747.731) (-747.314) -- 0:01:10
313000 -- (-752.496) (-744.605) (-744.925) [-750.581] * (-745.170) (-744.568) (-748.645) [-745.239] -- 0:01:10
313500 -- (-748.800) (-742.184) (-743.345) [-744.877] * [-745.064] (-743.051) (-743.387) (-748.609) -- 0:01:10
314000 -- (-746.077) (-751.235) (-745.166) [-743.835] * [-742.522] (-744.600) (-745.598) (-744.857) -- 0:01:12
314500 -- (-744.859) (-750.336) (-745.749) [-745.960] * (-749.142) (-744.907) (-747.569) [-747.822] -- 0:01:11
315000 -- [-750.247] (-742.824) (-745.977) (-748.630) * [-756.154] (-748.832) (-739.974) (-742.956) -- 0:01:11
Average standard deviation of split frequencies: 0.026106
315500 -- (-747.372) (-750.033) [-746.639] (-745.218) * (-748.789) [-744.967] (-742.461) (-746.153) -- 0:01:11
316000 -- (-745.258) (-746.849) [-749.943] (-741.762) * [-749.354] (-749.082) (-744.227) (-745.193) -- 0:01:11
316500 -- (-744.581) [-747.772] (-750.572) (-744.464) * [-748.956] (-747.808) (-748.335) (-745.181) -- 0:01:11
317000 -- [-744.656] (-743.654) (-742.129) (-749.217) * (-745.366) (-747.316) (-748.071) [-744.167] -- 0:01:11
317500 -- (-748.189) [-741.652] (-744.969) (-751.666) * [-748.479] (-749.512) (-754.578) (-747.235) -- 0:01:10
318000 -- (-747.558) (-749.206) [-742.615] (-748.144) * (-746.472) (-753.883) (-742.350) [-740.669] -- 0:01:10
318500 -- (-743.350) [-746.348] (-745.847) (-746.845) * (-754.207) [-748.544] (-744.003) (-743.499) -- 0:01:10
319000 -- [-740.351] (-748.972) (-745.416) (-746.695) * (-750.536) [-743.768] (-746.286) (-751.253) -- 0:01:10
319500 -- (-750.888) [-740.831] (-743.191) (-749.353) * [-746.511] (-744.090) (-744.868) (-742.030) -- 0:01:10
320000 -- (-751.744) (-745.710) [-746.990] (-746.434) * [-746.033] (-740.986) (-745.413) (-744.160) -- 0:01:10
Average standard deviation of split frequencies: 0.022051
320500 -- (-749.074) [-741.582] (-745.210) (-742.037) * [-747.510] (-747.990) (-744.554) (-747.682) -- 0:01:09
321000 -- (-751.638) (-747.126) (-748.530) [-745.195] * (-747.101) [-742.716] (-741.720) (-750.614) -- 0:01:09
321500 -- (-746.656) (-742.859) [-743.735] (-745.801) * (-746.966) [-742.995] (-742.876) (-743.411) -- 0:01:09
322000 -- (-742.812) (-751.355) [-741.676] (-743.089) * [-745.227] (-746.453) (-742.121) (-746.623) -- 0:01:09
322500 -- (-739.670) [-741.906] (-749.919) (-748.301) * (-741.181) (-749.198) (-738.971) [-741.666] -- 0:01:09
323000 -- [-742.563] (-747.418) (-744.701) (-748.396) * (-747.135) (-741.582) (-740.919) [-747.508] -- 0:01:09
323500 -- (-745.113) [-747.477] (-751.070) (-755.745) * (-745.595) (-741.537) [-745.967] (-746.166) -- 0:01:11
324000 -- (-743.803) (-744.599) [-747.201] (-746.466) * (-745.711) [-748.357] (-747.345) (-745.081) -- 0:01:10
324500 -- (-743.329) (-743.610) [-744.858] (-749.640) * (-745.798) (-752.280) (-745.356) [-747.222] -- 0:01:10
325000 -- [-741.923] (-745.255) (-747.573) (-747.867) * (-747.219) (-747.830) [-740.570] (-748.602) -- 0:01:10
Average standard deviation of split frequencies: 0.023136
325500 -- (-744.773) [-745.410] (-748.480) (-745.639) * [-744.406] (-754.227) (-746.091) (-745.664) -- 0:01:10
326000 -- (-751.967) [-744.757] (-746.009) (-746.479) * (-746.420) (-749.243) [-742.845] (-751.494) -- 0:01:10
326500 -- (-746.777) (-741.026) [-746.544] (-748.173) * (-743.277) (-748.170) (-744.883) [-743.391] -- 0:01:10
327000 -- (-747.757) [-745.022] (-747.868) (-751.500) * (-749.694) (-744.719) (-741.814) [-741.860] -- 0:01:09
327500 -- (-748.927) [-742.933] (-744.684) (-765.732) * (-744.388) (-742.274) (-756.136) [-744.447] -- 0:01:09
328000 -- (-745.964) [-744.992] (-750.486) (-747.218) * (-741.049) [-742.565] (-751.456) (-742.332) -- 0:01:09
328500 -- (-747.595) (-745.481) (-747.628) [-747.242] * (-742.098) (-746.935) (-750.078) [-743.479] -- 0:01:09
329000 -- (-743.318) (-746.347) [-746.934] (-750.538) * [-745.458] (-747.136) (-749.687) (-742.229) -- 0:01:09
329500 -- (-746.884) [-742.061] (-754.400) (-743.055) * (-746.656) (-747.578) [-742.758] (-741.765) -- 0:01:09
330000 -- (-750.033) [-745.758] (-744.100) (-748.540) * (-750.585) [-740.011] (-745.260) (-744.336) -- 0:01:09
Average standard deviation of split frequencies: 0.022097
330500 -- (-754.390) (-741.211) [-746.416] (-747.665) * (-744.053) [-746.721] (-745.759) (-743.911) -- 0:01:08
331000 -- (-751.725) (-742.088) [-743.418] (-747.274) * [-743.516] (-746.213) (-749.904) (-744.743) -- 0:01:08
331500 -- (-750.122) [-743.523] (-747.378) (-746.301) * (-746.745) [-746.275] (-745.398) (-741.624) -- 0:01:08
332000 -- (-753.393) (-744.277) (-743.230) [-747.228] * (-745.597) (-740.830) (-744.683) [-750.384] -- 0:01:08
332500 -- (-749.269) [-751.453] (-749.783) (-747.971) * (-746.953) [-740.307] (-746.996) (-746.276) -- 0:01:08
333000 -- (-746.198) (-745.682) (-744.874) [-743.600] * (-743.692) (-749.216) [-744.846] (-742.277) -- 0:01:10
333500 -- [-748.692] (-741.799) (-746.324) (-743.342) * (-741.390) [-742.733] (-744.498) (-749.223) -- 0:01:09
334000 -- (-747.245) (-748.912) (-740.986) [-741.212] * (-742.519) [-741.242] (-747.028) (-742.420) -- 0:01:09
334500 -- (-746.168) (-746.068) [-744.698] (-748.917) * (-743.188) (-745.579) [-745.243] (-746.250) -- 0:01:09
335000 -- (-757.140) [-745.542] (-741.279) (-744.457) * (-744.070) (-744.970) (-744.745) [-748.350] -- 0:01:09
Average standard deviation of split frequencies: 0.021746
335500 -- (-740.134) [-745.076] (-744.229) (-746.083) * [-745.034] (-741.668) (-749.710) (-748.373) -- 0:01:09
336000 -- (-749.446) (-747.527) [-744.979] (-748.044) * (-754.820) [-743.803] (-748.312) (-746.557) -- 0:01:09
336500 -- (-746.928) [-746.210] (-743.611) (-745.187) * (-754.966) (-747.080) (-750.662) [-749.507] -- 0:01:09
337000 -- (-743.141) (-745.224) (-756.274) [-744.420] * (-749.147) [-743.631] (-751.656) (-750.977) -- 0:01:08
337500 -- (-744.928) [-746.441] (-751.847) (-745.899) * (-745.995) (-739.835) [-744.068] (-748.313) -- 0:01:08
338000 -- (-740.466) [-742.700] (-741.992) (-745.133) * (-743.867) (-746.859) (-748.410) [-746.410] -- 0:01:08
338500 -- (-748.669) [-744.966] (-743.003) (-743.214) * (-744.664) (-743.598) [-750.063] (-746.569) -- 0:01:08
339000 -- (-747.713) (-752.063) (-744.514) [-746.868] * [-745.966] (-745.305) (-749.188) (-743.750) -- 0:01:08
339500 -- (-744.795) (-747.416) [-744.600] (-744.127) * (-747.906) [-743.622] (-745.083) (-750.500) -- 0:01:08
340000 -- (-747.499) (-744.936) (-746.492) [-741.104] * (-744.622) [-744.558] (-748.540) (-744.018) -- 0:01:07
Average standard deviation of split frequencies: 0.022140
340500 -- (-743.840) [-745.616] (-744.726) (-747.285) * (-744.540) (-743.783) (-754.317) [-740.773] -- 0:01:07
341000 -- (-746.179) (-743.809) (-742.334) [-747.719] * (-745.886) (-752.544) [-746.679] (-743.498) -- 0:01:07
341500 -- (-746.299) [-746.058] (-746.593) (-743.549) * (-745.773) (-742.556) (-746.771) [-741.347] -- 0:01:07
342000 -- [-750.714] (-747.548) (-748.632) (-743.379) * (-746.982) (-746.518) (-745.598) [-745.513] -- 0:01:07
342500 -- (-743.782) [-746.206] (-745.583) (-748.493) * (-751.566) (-747.554) [-741.332] (-743.256) -- 0:01:09
343000 -- (-749.655) (-754.243) [-744.926] (-739.359) * [-743.204] (-745.772) (-746.098) (-747.994) -- 0:01:08
343500 -- (-745.302) (-745.925) (-750.407) [-742.949] * [-747.954] (-743.797) (-741.476) (-749.354) -- 0:01:08
344000 -- (-748.835) (-747.282) (-746.688) [-742.995] * (-747.377) [-744.118] (-744.899) (-754.358) -- 0:01:08
344500 -- [-747.134] (-743.129) (-749.914) (-742.123) * [-749.723] (-742.329) (-745.733) (-749.196) -- 0:01:08
345000 -- (-743.864) (-743.177) (-748.450) [-743.030] * (-747.913) (-743.073) (-743.670) [-744.986] -- 0:01:08
Average standard deviation of split frequencies: 0.025886
345500 -- (-749.392) (-747.512) [-743.535] (-741.300) * (-751.583) (-749.756) (-742.136) [-747.422] -- 0:01:08
346000 -- (-743.850) [-748.340] (-743.315) (-744.133) * (-752.915) (-749.334) (-744.186) [-743.563] -- 0:01:08
346500 -- (-746.622) [-744.158] (-741.141) (-748.319) * [-753.660] (-751.749) (-745.376) (-746.736) -- 0:01:07
347000 -- (-746.013) (-743.738) [-745.273] (-749.039) * (-749.745) (-750.416) (-743.562) [-745.523] -- 0:01:07
347500 -- [-748.207] (-746.342) (-746.908) (-746.391) * (-745.683) [-748.041] (-745.802) (-745.141) -- 0:01:07
348000 -- (-750.403) [-740.779] (-745.803) (-745.539) * [-742.774] (-745.472) (-742.410) (-742.346) -- 0:01:07
348500 -- (-744.407) (-747.337) (-744.212) [-745.543] * (-742.685) [-742.376] (-743.991) (-748.479) -- 0:01:07
349000 -- (-746.558) [-745.730] (-743.556) (-742.856) * (-748.514) [-743.256] (-749.947) (-745.296) -- 0:01:07
349500 -- (-744.467) (-744.561) [-744.568] (-744.855) * (-745.759) (-749.263) (-744.862) [-745.584] -- 0:01:07
350000 -- (-746.348) [-744.127] (-749.531) (-754.373) * [-746.115] (-748.790) (-750.193) (-745.908) -- 0:01:06
Average standard deviation of split frequencies: 0.026886
350500 -- (-748.657) [-744.920] (-742.694) (-743.640) * (-751.760) [-749.749] (-743.655) (-746.894) -- 0:01:06
351000 -- (-747.017) (-750.230) [-741.429] (-750.839) * (-743.670) (-747.727) [-750.065] (-743.328) -- 0:01:06
351500 -- (-746.545) (-747.489) [-742.051] (-749.540) * (-746.364) (-747.001) [-744.421] (-746.333) -- 0:01:06
352000 -- (-753.108) [-742.508] (-748.475) (-752.246) * (-744.338) [-744.915] (-744.755) (-745.990) -- 0:01:06
352500 -- (-747.430) (-742.291) [-740.746] (-754.120) * (-743.798) [-741.719] (-747.857) (-750.320) -- 0:01:07
353000 -- (-747.034) (-745.915) (-741.856) [-744.711] * (-744.056) (-752.454) (-748.538) [-747.312] -- 0:01:07
353500 -- [-748.755] (-753.633) (-741.365) (-745.179) * [-747.758] (-749.309) (-747.080) (-746.055) -- 0:01:07
354000 -- (-755.810) [-746.610] (-744.609) (-748.813) * (-751.951) (-747.694) (-749.027) [-746.666] -- 0:01:07
354500 -- (-747.088) (-743.253) [-740.636] (-747.874) * (-745.033) (-744.197) (-745.713) [-745.424] -- 0:01:07
355000 -- (-744.106) [-746.251] (-744.226) (-748.207) * [-747.412] (-752.365) (-750.790) (-741.143) -- 0:01:07
Average standard deviation of split frequencies: 0.023835
355500 -- (-749.518) [-746.802] (-750.537) (-745.118) * [-740.955] (-752.561) (-747.103) (-746.360) -- 0:01:07
356000 -- [-750.374] (-743.284) (-746.031) (-748.657) * [-741.572] (-758.001) (-751.949) (-747.886) -- 0:01:06
356500 -- (-746.819) [-742.723] (-751.833) (-747.002) * (-741.906) (-746.386) (-742.881) [-750.069] -- 0:01:06
357000 -- (-748.513) [-741.702] (-746.025) (-748.631) * (-745.342) [-744.516] (-748.204) (-748.759) -- 0:01:06
357500 -- (-750.928) (-741.586) (-746.836) [-743.030] * (-745.458) [-748.619] (-741.227) (-747.528) -- 0:01:06
358000 -- [-742.952] (-742.466) (-748.128) (-743.148) * (-743.246) [-751.156] (-743.266) (-746.989) -- 0:01:06
358500 -- (-746.111) (-748.242) (-745.299) [-740.045] * [-748.839] (-748.249) (-745.056) (-742.099) -- 0:01:06
359000 -- (-741.063) [-748.448] (-742.900) (-749.093) * (-743.750) [-749.277] (-746.403) (-747.830) -- 0:01:06
359500 -- [-742.986] (-742.268) (-745.130) (-748.588) * (-745.594) (-749.853) (-743.956) [-742.809] -- 0:01:05
360000 -- (-743.839) [-740.792] (-744.823) (-744.238) * (-758.005) (-743.425) (-743.267) [-747.981] -- 0:01:05
Average standard deviation of split frequencies: 0.022220
360500 -- (-749.089) (-746.317) [-747.719] (-744.621) * (-747.057) (-744.305) [-745.898] (-744.610) -- 0:01:05
361000 -- (-740.200) (-746.162) (-748.818) [-745.170] * (-748.688) [-744.073] (-750.495) (-744.519) -- 0:01:05
361500 -- [-744.307] (-745.681) (-755.514) (-746.389) * (-746.732) (-742.446) (-743.590) [-746.821] -- 0:01:05
362000 -- (-743.692) (-745.853) [-748.429] (-747.486) * (-751.904) (-750.643) (-743.453) [-747.461] -- 0:01:06
362500 -- (-744.574) (-751.258) [-747.927] (-744.851) * (-747.760) (-749.280) (-747.330) [-746.388] -- 0:01:06
363000 -- (-744.988) (-744.013) [-749.982] (-746.810) * [-747.214] (-748.226) (-746.178) (-748.737) -- 0:01:06
363500 -- [-742.975] (-742.938) (-748.338) (-747.357) * (-744.235) (-743.929) (-743.875) [-745.317] -- 0:01:06
364000 -- (-740.763) [-749.000] (-748.082) (-747.317) * (-750.097) (-749.095) (-744.558) [-744.982] -- 0:01:06
364500 -- (-739.640) (-747.043) [-740.523] (-745.001) * (-747.406) (-747.407) (-745.205) [-740.713] -- 0:01:06
365000 -- [-741.432] (-741.166) (-740.436) (-743.407) * (-747.598) [-744.756] (-746.795) (-749.310) -- 0:01:06
Average standard deviation of split frequencies: 0.023184
365500 -- (-748.606) [-743.866] (-743.680) (-743.951) * (-743.779) (-743.704) (-753.876) [-741.554] -- 0:01:05
366000 -- (-743.716) (-747.365) (-741.411) [-746.121] * [-741.499] (-745.953) (-745.878) (-748.925) -- 0:01:05
366500 -- (-741.286) (-743.412) (-746.754) [-744.432] * [-743.583] (-745.042) (-745.221) (-743.358) -- 0:01:05
367000 -- [-741.562] (-750.034) (-745.773) (-744.065) * (-745.748) (-749.326) [-743.142] (-746.470) -- 0:01:05
367500 -- (-740.724) (-743.708) [-744.500] (-743.556) * (-760.363) (-746.416) [-746.731] (-754.503) -- 0:01:05
368000 -- (-742.894) (-749.449) [-744.089] (-744.214) * (-757.150) [-742.397] (-743.476) (-754.158) -- 0:01:05
368500 -- [-743.021] (-749.497) (-744.854) (-739.338) * (-747.638) (-744.736) [-745.876] (-755.716) -- 0:01:05
369000 -- (-749.482) (-745.503) (-744.936) [-744.659] * (-752.516) (-744.855) [-751.441] (-741.478) -- 0:01:04
369500 -- (-745.558) [-743.548] (-747.539) (-742.911) * (-744.334) [-741.494] (-750.561) (-747.956) -- 0:01:04
370000 -- [-742.153] (-745.670) (-746.993) (-741.856) * (-744.535) (-751.863) (-746.701) [-742.171] -- 0:01:04
Average standard deviation of split frequencies: 0.028615
370500 -- (-746.488) (-745.750) [-742.581] (-745.998) * (-753.195) (-742.898) (-746.004) [-743.993] -- 0:01:04
371000 -- (-746.730) (-747.601) [-749.966] (-750.006) * (-750.476) [-744.534] (-744.234) (-742.285) -- 0:01:06
371500 -- (-741.830) (-746.692) [-744.608] (-743.785) * (-751.505) (-744.858) [-747.217] (-743.095) -- 0:01:05
372000 -- (-744.351) [-744.357] (-746.252) (-748.349) * (-747.916) (-743.385) [-749.819] (-751.435) -- 0:01:05
372500 -- (-741.692) (-742.171) [-744.902] (-748.302) * (-744.878) (-746.544) (-755.412) [-745.946] -- 0:01:05
373000 -- (-741.964) (-743.375) [-756.877] (-751.508) * [-755.856] (-748.094) (-757.294) (-755.125) -- 0:01:05
373500 -- (-744.384) [-744.527] (-744.820) (-747.489) * [-749.352] (-743.811) (-743.978) (-746.310) -- 0:01:05
374000 -- (-745.201) (-748.040) [-745.367] (-742.855) * [-746.698] (-744.458) (-741.923) (-747.347) -- 0:01:05
374500 -- (-743.107) (-747.007) [-746.049] (-745.524) * (-750.211) (-745.722) (-747.708) [-742.557] -- 0:01:05
375000 -- (-743.630) (-747.668) (-745.824) [-744.002] * (-746.234) [-743.810] (-752.098) (-748.037) -- 0:01:05
Average standard deviation of split frequencies: 0.029463
375500 -- (-744.557) (-744.814) (-745.761) [-743.167] * (-748.868) (-742.210) [-742.962] (-744.393) -- 0:01:04
376000 -- [-746.571] (-742.674) (-743.691) (-743.903) * (-761.393) (-758.481) (-744.459) [-746.284] -- 0:01:04
376500 -- (-742.290) (-741.989) [-745.887] (-741.108) * (-746.710) [-746.770] (-749.855) (-754.782) -- 0:01:04
377000 -- (-750.359) (-742.902) (-744.999) [-744.805] * (-747.057) (-742.368) [-745.059] (-750.128) -- 0:01:04
377500 -- [-746.873] (-744.745) (-747.539) (-744.061) * (-742.771) [-743.504] (-746.627) (-750.075) -- 0:01:04
378000 -- (-756.644) (-745.381) (-744.263) [-743.797] * (-745.104) (-746.031) [-744.940] (-751.538) -- 0:01:04
378500 -- [-745.970] (-746.535) (-754.567) (-746.981) * [-743.975] (-743.043) (-747.636) (-746.833) -- 0:01:04
379000 -- (-743.378) [-743.192] (-747.322) (-745.288) * [-747.702] (-752.639) (-740.721) (-748.268) -- 0:01:03
379500 -- (-743.600) [-742.539] (-747.101) (-744.715) * (-756.697) (-749.995) [-744.120] (-743.533) -- 0:01:03
380000 -- [-745.711] (-743.022) (-757.231) (-748.225) * (-757.688) (-746.850) [-742.358] (-742.729) -- 0:01:03
Average standard deviation of split frequencies: 0.031578
380500 -- (-744.600) [-743.780] (-749.418) (-747.759) * (-746.314) (-742.781) [-749.194] (-745.912) -- 0:01:03
381000 -- (-747.716) (-740.643) (-745.289) [-745.868] * (-747.509) (-750.051) [-745.500] (-748.881) -- 0:01:04
381500 -- (-750.233) (-745.542) (-750.367) [-752.374] * [-745.755] (-742.999) (-745.921) (-755.680) -- 0:01:04
382000 -- [-751.106] (-743.021) (-745.735) (-755.866) * [-740.453] (-748.054) (-747.133) (-758.819) -- 0:01:04
382500 -- (-751.146) (-744.107) [-744.261] (-743.007) * (-745.797) (-754.650) [-746.231] (-752.857) -- 0:01:04
383000 -- [-749.152] (-750.731) (-750.277) (-748.168) * [-744.608] (-749.798) (-744.936) (-756.984) -- 0:01:04
383500 -- [-745.540] (-748.962) (-751.863) (-753.991) * (-749.183) [-748.469] (-747.329) (-750.837) -- 0:01:04
384000 -- (-744.824) (-746.354) [-747.205] (-752.229) * [-745.301] (-748.017) (-743.046) (-750.135) -- 0:01:04
384500 -- (-745.119) [-745.809] (-746.167) (-745.277) * (-742.465) [-747.828] (-743.522) (-748.392) -- 0:01:04
385000 -- (-744.828) [-745.784] (-749.346) (-744.188) * (-747.821) (-751.750) [-751.146] (-747.677) -- 0:01:03
Average standard deviation of split frequencies: 0.029921
385500 -- [-741.554] (-749.276) (-751.640) (-748.180) * [-748.407] (-747.832) (-744.836) (-753.864) -- 0:01:03
386000 -- (-752.791) (-750.163) [-746.928] (-751.932) * (-743.869) (-745.968) (-744.779) [-750.329] -- 0:01:03
386500 -- [-744.971] (-745.657) (-747.483) (-748.827) * [-746.871] (-744.448) (-744.476) (-755.485) -- 0:01:03
387000 -- (-755.399) [-744.890] (-750.815) (-747.275) * [-745.538] (-747.988) (-741.677) (-750.973) -- 0:01:03
387500 -- (-748.439) (-747.785) (-742.037) [-743.886] * [-745.253] (-747.695) (-741.294) (-745.711) -- 0:01:03
388000 -- [-744.432] (-749.664) (-745.168) (-745.094) * (-750.115) (-745.504) [-740.568] (-743.451) -- 0:01:03
388500 -- [-745.147] (-744.847) (-747.715) (-748.604) * (-751.061) (-747.793) [-743.721] (-745.718) -- 0:01:02
389000 -- (-744.508) (-755.464) [-741.530] (-742.552) * (-743.460) (-744.633) [-749.714] (-758.182) -- 0:01:02
389500 -- (-750.564) [-745.291] (-750.152) (-745.519) * (-742.372) (-745.497) [-748.153] (-744.136) -- 0:01:02
390000 -- [-744.654] (-749.721) (-752.923) (-746.133) * (-756.423) (-741.949) (-746.550) [-741.464] -- 0:01:02
Average standard deviation of split frequencies: 0.027753
390500 -- (-747.877) (-743.379) [-748.814] (-742.393) * (-749.011) (-743.823) (-753.173) [-745.471] -- 0:01:03
391000 -- (-747.585) (-744.780) (-745.695) [-744.859] * (-749.240) (-744.166) (-747.700) [-745.699] -- 0:01:03
391500 -- (-748.569) (-747.574) (-746.800) [-744.373] * (-746.552) (-743.018) [-753.101] (-745.958) -- 0:01:03
392000 -- (-747.955) [-741.396] (-748.263) (-743.125) * (-744.561) (-747.468) (-743.641) [-742.676] -- 0:01:03
392500 -- [-743.969] (-743.791) (-751.456) (-743.744) * (-746.423) [-752.016] (-747.005) (-742.978) -- 0:01:03
393000 -- (-754.635) (-752.044) [-743.424] (-745.032) * (-741.826) (-744.897) [-743.897] (-745.871) -- 0:01:03
393500 -- (-752.165) (-743.607) [-742.344] (-744.259) * (-743.908) (-746.075) [-743.787] (-746.873) -- 0:01:03
394000 -- (-752.027) (-753.051) [-742.378] (-751.569) * (-741.023) (-751.352) (-745.604) [-741.590] -- 0:01:03
394500 -- (-755.748) (-761.382) (-744.946) [-743.768] * [-745.233] (-746.474) (-749.428) (-743.721) -- 0:01:02
395000 -- (-758.474) (-746.383) (-747.391) [-745.386] * (-750.054) (-742.939) [-745.755] (-744.773) -- 0:01:02
Average standard deviation of split frequencies: 0.027380
395500 -- (-753.719) [-749.322] (-748.088) (-756.866) * (-747.818) (-746.498) (-747.334) [-740.857] -- 0:01:02
396000 -- [-749.065] (-746.220) (-744.224) (-741.593) * (-745.491) (-747.795) [-745.119] (-747.213) -- 0:01:02
396500 -- (-750.018) (-746.355) [-743.303] (-743.558) * (-743.740) (-752.138) (-742.547) [-745.902] -- 0:01:02
397000 -- (-754.794) (-742.485) [-741.921] (-741.560) * (-751.058) [-753.259] (-744.784) (-747.256) -- 0:01:02
397500 -- (-749.623) [-747.992] (-742.508) (-750.349) * [-742.434] (-752.330) (-749.235) (-747.467) -- 0:01:02
398000 -- (-747.641) (-743.095) [-741.643] (-752.358) * [-744.100] (-751.178) (-743.741) (-745.249) -- 0:01:02
398500 -- (-750.815) (-747.513) [-747.009] (-742.571) * (-746.471) (-747.211) (-741.976) [-752.670] -- 0:01:01
399000 -- (-748.768) (-750.310) (-746.196) [-745.073] * (-744.592) (-744.920) (-745.994) [-746.667] -- 0:01:01
399500 -- [-753.594] (-750.988) (-744.844) (-745.740) * (-740.523) (-749.436) (-747.732) [-750.922] -- 0:01:01
400000 -- (-747.827) (-747.627) (-745.030) [-751.910] * [-743.949] (-753.446) (-751.778) (-745.649) -- 0:01:01
Average standard deviation of split frequencies: 0.024708
400500 -- (-750.775) [-744.511] (-742.624) (-747.977) * (-744.429) [-746.310] (-747.428) (-745.864) -- 0:01:02
401000 -- (-756.179) (-740.989) [-745.108] (-755.349) * (-748.242) [-741.256] (-746.353) (-745.270) -- 0:01:02
401500 -- (-755.773) (-745.229) [-740.740] (-749.480) * (-744.118) (-748.489) [-745.407] (-742.625) -- 0:01:02
402000 -- (-754.789) [-748.187] (-741.802) (-749.688) * (-747.890) (-746.564) (-746.263) [-747.703] -- 0:01:02
402500 -- (-753.428) (-750.812) [-742.809] (-746.973) * (-746.941) (-745.435) (-748.866) [-745.226] -- 0:01:02
403000 -- (-748.139) [-753.099] (-740.645) (-747.168) * (-744.899) (-751.638) (-747.976) [-743.473] -- 0:01:02
403500 -- [-752.099] (-752.518) (-740.448) (-744.400) * (-748.557) [-747.568] (-744.502) (-741.673) -- 0:01:02
404000 -- (-746.159) (-747.258) [-744.288] (-744.923) * (-747.197) (-741.927) (-746.376) [-742.133] -- 0:01:01
404500 -- (-751.737) [-742.235] (-750.603) (-748.526) * (-745.624) (-745.124) (-743.295) [-747.600] -- 0:01:01
405000 -- (-746.557) [-747.204] (-746.193) (-746.982) * (-745.842) (-742.175) [-745.568] (-743.262) -- 0:01:01
Average standard deviation of split frequencies: 0.023222
405500 -- (-741.318) (-744.082) (-742.514) [-742.878] * [-745.762] (-744.344) (-750.073) (-746.973) -- 0:01:01
406000 -- (-750.271) (-751.028) [-743.642] (-745.253) * [-744.754] (-749.649) (-748.609) (-746.467) -- 0:01:01
406500 -- (-745.632) [-745.253] (-750.300) (-747.407) * (-742.648) [-747.292] (-747.483) (-744.271) -- 0:01:01
407000 -- (-745.452) (-744.715) (-743.772) [-748.063] * [-750.507] (-744.353) (-745.732) (-745.649) -- 0:01:01
407500 -- (-748.925) (-742.462) [-747.857] (-748.787) * (-747.761) (-744.268) (-747.413) [-745.387] -- 0:01:01
408000 -- (-745.291) (-744.709) (-749.230) [-744.609] * (-748.211) (-743.986) [-746.009] (-741.224) -- 0:01:00
408500 -- [-746.566] (-745.680) (-745.774) (-745.870) * (-745.794) (-749.689) [-747.406] (-745.834) -- 0:01:00
409000 -- [-749.295] (-742.205) (-751.667) (-743.595) * (-754.069) (-742.857) [-744.976] (-745.136) -- 0:01:00
409500 -- [-744.927] (-747.404) (-755.239) (-746.539) * (-750.296) (-745.523) [-746.991] (-745.596) -- 0:01:00
410000 -- [-749.824] (-746.546) (-753.616) (-744.505) * (-750.271) (-742.454) [-749.114] (-747.563) -- 0:01:01
Average standard deviation of split frequencies: 0.020088
410500 -- (-748.623) (-749.883) (-747.168) [-745.082] * (-743.229) (-746.045) [-745.452] (-746.496) -- 0:01:01
411000 -- (-752.685) (-752.312) (-749.170) [-745.027] * (-745.334) [-745.530] (-746.396) (-749.692) -- 0:01:01
411500 -- (-745.275) [-743.784] (-749.231) (-748.891) * (-743.758) [-742.147] (-752.500) (-755.192) -- 0:01:01
412000 -- (-744.242) (-754.840) (-758.616) [-746.762] * [-745.702] (-748.638) (-748.041) (-745.177) -- 0:01:01
412500 -- (-748.272) (-751.518) (-748.498) [-745.915] * [-747.028] (-747.382) (-742.292) (-748.632) -- 0:01:01
413000 -- (-748.421) (-756.821) [-745.994] (-743.077) * (-744.562) (-747.868) (-741.756) [-744.998] -- 0:01:01
413500 -- [-746.131] (-748.357) (-746.374) (-748.132) * (-744.682) (-746.780) [-751.122] (-750.013) -- 0:01:00
414000 -- (-756.460) (-755.385) [-743.972] (-740.377) * (-742.807) [-747.542] (-743.690) (-743.123) -- 0:01:00
414500 -- (-746.263) (-750.605) [-743.295] (-752.320) * (-742.927) [-747.991] (-747.613) (-747.419) -- 0:01:00
415000 -- [-745.637] (-743.430) (-747.095) (-743.197) * (-743.335) [-739.402] (-748.863) (-749.964) -- 0:01:00
Average standard deviation of split frequencies: 0.018698
415500 -- (-752.550) (-753.070) [-741.243] (-742.591) * (-750.842) (-743.846) [-745.937] (-746.821) -- 0:01:00
416000 -- (-745.910) (-751.231) (-743.079) [-742.998] * (-750.051) (-746.362) (-744.914) [-741.495] -- 0:01:00
416500 -- [-751.647] (-747.848) (-748.633) (-743.824) * (-753.089) (-743.225) [-741.832] (-740.798) -- 0:01:00
417000 -- (-749.652) (-744.779) (-746.348) [-745.976] * [-744.558] (-740.560) (-753.472) (-743.765) -- 0:01:00
417500 -- (-743.226) (-746.240) (-750.057) [-743.394] * [-743.856] (-744.061) (-749.368) (-744.064) -- 0:00:59
418000 -- (-745.023) [-745.911] (-748.208) (-742.713) * [-744.323] (-748.916) (-760.284) (-741.202) -- 0:00:59
418500 -- (-742.869) (-751.900) [-741.492] (-742.385) * (-748.834) (-752.032) (-753.868) [-742.917] -- 0:00:59
419000 -- (-742.178) (-749.752) [-744.566] (-741.587) * (-750.900) (-743.419) (-750.508) [-745.247] -- 0:00:59
419500 -- (-751.481) (-749.516) (-748.279) [-743.087] * (-744.946) (-742.594) (-747.516) [-743.474] -- 0:00:59
420000 -- (-747.359) (-742.268) (-752.684) [-746.752] * (-742.747) (-744.103) (-749.280) [-742.218] -- 0:01:00
Average standard deviation of split frequencies: 0.021292
420500 -- (-747.757) (-748.130) (-744.869) [-749.501] * [-746.432] (-744.490) (-751.264) (-747.721) -- 0:01:00
421000 -- (-747.576) [-748.741] (-749.305) (-742.753) * (-747.701) [-747.743] (-751.176) (-746.493) -- 0:01:00
421500 -- (-744.025) [-745.248] (-747.913) (-745.071) * (-741.692) (-743.883) (-749.124) [-740.987] -- 0:01:00
422000 -- (-744.915) [-748.181] (-747.257) (-745.681) * [-749.033] (-746.293) (-746.412) (-745.814) -- 0:01:00
422500 -- (-745.595) (-742.816) [-747.754] (-745.965) * (-745.509) (-740.193) (-746.576) [-744.711] -- 0:01:00
423000 -- (-748.993) (-747.014) (-750.104) [-743.229] * (-743.590) (-746.977) (-743.471) [-745.629] -- 0:01:00
423500 -- (-755.734) (-747.220) [-743.475] (-744.255) * (-747.396) (-740.971) [-746.074] (-747.955) -- 0:00:59
424000 -- (-750.910) (-748.373) (-748.518) [-741.029] * [-741.952] (-741.710) (-749.488) (-753.716) -- 0:00:59
424500 -- (-746.122) (-748.448) (-751.977) [-744.243] * (-748.900) (-743.925) (-746.277) [-741.268] -- 0:00:59
425000 -- (-742.517) [-746.211] (-749.106) (-747.961) * [-743.413] (-754.215) (-749.033) (-747.028) -- 0:00:59
Average standard deviation of split frequencies: 0.020472
425500 -- [-743.327] (-749.173) (-747.610) (-748.873) * [-743.793] (-742.330) (-752.563) (-745.300) -- 0:00:59
426000 -- (-741.855) [-748.875] (-744.071) (-743.987) * [-742.103] (-743.193) (-753.732) (-749.741) -- 0:00:59
426500 -- (-750.099) [-744.441] (-747.088) (-752.447) * (-743.674) (-747.822) [-745.650] (-744.063) -- 0:00:59
427000 -- (-745.657) [-745.390] (-752.002) (-743.396) * [-741.591] (-744.803) (-742.966) (-745.144) -- 0:00:59
427500 -- (-744.061) [-742.908] (-743.782) (-744.075) * (-744.587) [-744.473] (-743.129) (-748.201) -- 0:00:58
428000 -- (-745.173) (-746.406) [-743.248] (-744.977) * (-739.616) (-746.655) [-741.354] (-743.196) -- 0:00:58
428500 -- (-742.280) (-745.009) (-744.626) [-746.819] * [-747.614] (-745.224) (-742.314) (-740.206) -- 0:00:58
429000 -- (-746.698) (-745.061) (-743.643) [-746.144] * (-748.780) (-749.995) (-740.625) [-742.060] -- 0:00:58
429500 -- (-752.062) (-750.028) [-745.668] (-746.506) * [-746.768] (-753.138) (-751.484) (-740.453) -- 0:00:59
430000 -- (-748.473) (-746.491) [-743.561] (-747.424) * (-745.379) (-748.591) [-740.027] (-745.196) -- 0:00:59
Average standard deviation of split frequencies: 0.025723
430500 -- (-751.535) (-745.133) (-742.313) [-745.608] * (-757.473) (-748.603) (-748.263) [-742.177] -- 0:00:59
431000 -- (-750.617) (-750.442) (-746.758) [-747.778] * [-749.856] (-744.133) (-747.294) (-745.472) -- 0:00:59
431500 -- (-758.994) (-743.027) (-754.906) [-746.919] * (-742.523) (-742.946) (-749.546) [-743.394] -- 0:00:59
432000 -- (-749.515) [-741.231] (-744.181) (-745.931) * [-746.584] (-742.809) (-747.905) (-742.241) -- 0:00:59
432500 -- (-747.306) (-744.230) [-748.535] (-741.350) * (-739.904) [-742.955] (-747.060) (-742.794) -- 0:00:59
433000 -- (-742.774) [-747.916] (-748.510) (-748.730) * (-745.046) (-747.890) [-750.939] (-744.610) -- 0:00:58
433500 -- (-745.521) (-744.076) [-746.919] (-745.148) * (-748.325) (-743.367) (-751.549) [-742.771] -- 0:00:58
434000 -- (-740.643) (-742.014) [-745.980] (-743.780) * [-745.303] (-746.583) (-749.190) (-742.569) -- 0:00:58
434500 -- (-745.985) [-740.863] (-753.433) (-746.261) * (-746.982) (-744.058) [-745.236] (-742.741) -- 0:00:58
435000 -- (-743.155) [-740.582] (-747.371) (-747.179) * [-743.616] (-742.362) (-747.879) (-744.726) -- 0:00:58
Average standard deviation of split frequencies: 0.028111
435500 -- (-751.770) [-740.011] (-746.802) (-747.640) * (-749.360) (-744.350) [-743.150] (-741.691) -- 0:00:58
436000 -- (-748.357) (-745.603) (-751.516) [-744.787] * (-747.099) (-744.930) [-744.561] (-745.569) -- 0:00:58
436500 -- [-744.903] (-745.803) (-742.972) (-748.198) * [-743.651] (-744.974) (-745.857) (-744.199) -- 0:00:58
437000 -- (-742.402) (-749.241) (-752.515) [-745.503] * (-749.723) [-743.435] (-742.803) (-743.063) -- 0:00:57
437500 -- (-745.798) [-747.418] (-745.471) (-747.388) * (-745.777) [-746.515] (-753.860) (-744.252) -- 0:00:57
438000 -- [-742.152] (-745.582) (-748.692) (-751.683) * (-748.019) (-748.895) (-747.515) [-743.586] -- 0:00:57
438500 -- (-746.338) (-744.260) [-743.239] (-742.833) * (-749.197) (-743.421) [-744.127] (-746.226) -- 0:00:57
439000 -- (-750.041) (-745.122) [-741.130] (-747.609) * (-753.263) (-754.926) (-752.490) [-747.506] -- 0:00:58
439500 -- (-745.685) (-745.410) [-746.550] (-747.891) * (-748.651) (-743.865) (-742.983) [-746.469] -- 0:00:58
440000 -- (-747.288) [-745.511] (-743.730) (-742.069) * (-751.056) [-746.084] (-746.882) (-746.054) -- 0:00:58
Average standard deviation of split frequencies: 0.025139
440500 -- (-744.088) (-746.901) (-745.924) [-740.509] * (-743.254) [-746.521] (-746.678) (-744.396) -- 0:00:58
441000 -- (-748.685) (-744.640) [-741.112] (-743.831) * [-742.916] (-745.429) (-744.211) (-745.313) -- 0:00:58
441500 -- (-744.984) (-744.654) (-748.109) [-741.910] * [-744.743] (-742.418) (-746.040) (-752.167) -- 0:00:58
442000 -- [-744.290] (-746.416) (-749.229) (-744.530) * (-746.879) [-743.816] (-743.719) (-753.449) -- 0:00:58
442500 -- (-745.072) (-743.827) (-748.478) [-745.692] * (-744.954) [-741.865] (-745.111) (-743.132) -- 0:00:57
443000 -- (-743.966) (-747.535) [-745.895] (-751.122) * [-745.251] (-744.230) (-743.439) (-742.745) -- 0:00:57
443500 -- (-749.333) (-754.437) [-746.628] (-745.665) * [-746.042] (-747.289) (-744.886) (-743.849) -- 0:00:57
444000 -- (-745.579) (-745.287) [-743.437] (-744.642) * (-745.981) [-748.956] (-746.308) (-748.858) -- 0:00:57
444500 -- (-748.568) (-744.228) (-746.570) [-743.778] * (-742.859) (-745.835) (-746.514) [-743.455] -- 0:00:57
445000 -- (-742.116) (-743.975) [-747.356] (-747.163) * (-746.028) (-748.890) (-746.348) [-742.278] -- 0:00:57
Average standard deviation of split frequencies: 0.022196
445500 -- (-748.370) (-745.167) [-743.747] (-743.038) * [-744.271] (-748.839) (-743.586) (-746.691) -- 0:00:57
446000 -- (-747.123) (-744.701) [-744.616] (-745.369) * (-742.716) (-746.262) (-745.112) [-747.060] -- 0:00:57
446500 -- [-753.712] (-744.144) (-749.078) (-746.831) * (-743.350) [-740.189] (-751.175) (-745.913) -- 0:00:57
447000 -- (-744.962) (-744.437) [-748.499] (-749.823) * (-746.106) (-745.197) (-745.877) [-745.082] -- 0:00:56
447500 -- (-745.283) [-746.556] (-745.944) (-743.926) * [-742.140] (-745.875) (-739.949) (-752.574) -- 0:00:56
448000 -- (-744.054) [-740.621] (-745.835) (-744.402) * (-749.856) [-744.431] (-747.446) (-743.296) -- 0:00:56
448500 -- (-755.178) (-743.801) [-743.802] (-745.229) * [-746.693] (-742.970) (-748.276) (-743.340) -- 0:00:56
449000 -- (-753.442) (-742.355) (-742.785) [-746.588] * (-744.460) [-744.234] (-753.253) (-745.759) -- 0:00:57
449500 -- (-753.532) (-746.295) [-740.304] (-744.842) * [-745.758] (-743.993) (-744.579) (-746.239) -- 0:00:57
450000 -- (-754.882) (-738.628) [-745.993] (-748.214) * (-747.086) (-756.240) [-743.471] (-743.334) -- 0:00:57
Average standard deviation of split frequencies: 0.019351
450500 -- (-752.491) (-742.088) [-745.041] (-743.907) * [-747.890] (-745.714) (-743.354) (-744.981) -- 0:00:57
451000 -- (-753.481) (-742.514) [-747.042] (-745.254) * (-745.082) [-743.020] (-743.607) (-742.972) -- 0:00:57
451500 -- (-756.265) (-742.351) (-749.781) [-744.322] * [-742.021] (-746.756) (-741.817) (-747.639) -- 0:00:57
452000 -- [-748.458] (-742.724) (-751.523) (-755.479) * (-742.398) [-751.766] (-743.699) (-751.855) -- 0:00:56
452500 -- (-747.184) [-744.210] (-748.408) (-750.917) * (-741.554) [-746.618] (-751.773) (-759.012) -- 0:00:56
453000 -- (-746.606) (-749.566) (-747.211) [-746.873] * [-743.409] (-748.176) (-741.689) (-751.296) -- 0:00:56
453500 -- (-745.899) [-745.982] (-745.845) (-741.872) * (-745.356) (-748.248) (-740.762) [-749.365] -- 0:00:56
454000 -- (-743.292) [-746.581] (-742.140) (-744.219) * (-744.100) (-750.818) (-743.352) [-743.518] -- 0:00:56
454500 -- (-739.693) (-748.823) [-743.456] (-743.219) * [-744.722] (-745.300) (-743.876) (-745.042) -- 0:00:56
455000 -- (-744.819) (-744.845) (-742.481) [-743.590] * (-752.525) (-755.190) (-743.144) [-745.536] -- 0:00:56
Average standard deviation of split frequencies: 0.018091
455500 -- [-743.586] (-740.243) (-744.119) (-748.052) * (-745.903) (-746.463) [-744.611] (-745.371) -- 0:00:56
456000 -- (-743.662) (-743.939) [-741.205] (-741.064) * (-745.840) [-745.549] (-740.747) (-746.338) -- 0:00:56
456500 -- [-743.873] (-744.852) (-744.379) (-744.804) * (-750.218) [-751.759] (-740.462) (-751.473) -- 0:00:55
457000 -- (-745.908) [-746.842] (-740.197) (-746.836) * (-743.353) [-744.348] (-740.331) (-743.092) -- 0:00:55
457500 -- (-742.760) (-742.933) [-740.845] (-745.146) * [-747.022] (-743.474) (-751.076) (-741.882) -- 0:00:55
458000 -- (-745.418) [-744.219] (-742.715) (-741.027) * (-749.938) (-743.695) [-750.156] (-749.209) -- 0:00:55
458500 -- (-744.933) (-743.478) [-742.068] (-752.789) * (-745.053) [-745.399] (-747.786) (-749.666) -- 0:00:56
459000 -- [-746.040] (-743.740) (-741.877) (-746.137) * [-747.222] (-744.981) (-744.555) (-743.376) -- 0:00:56
459500 -- (-751.392) [-743.500] (-746.750) (-748.215) * (-743.968) [-745.937] (-742.980) (-740.410) -- 0:00:56
460000 -- [-745.845] (-751.326) (-753.362) (-751.157) * (-743.129) [-747.553] (-746.258) (-745.553) -- 0:00:56
Average standard deviation of split frequencies: 0.018420
460500 -- (-752.079) (-748.555) [-743.151] (-742.360) * (-740.444) (-742.606) (-747.846) [-747.217] -- 0:00:56
461000 -- (-746.682) (-740.937) (-745.928) [-744.508] * (-741.880) (-750.689) [-749.784] (-743.873) -- 0:00:56
461500 -- (-744.465) [-739.698] (-747.889) (-747.533) * (-741.141) (-744.298) (-751.317) [-744.008] -- 0:00:56
462000 -- (-748.433) (-744.423) (-742.525) [-741.060] * (-752.384) [-744.949] (-750.108) (-749.775) -- 0:00:55
462500 -- (-749.600) (-742.676) [-753.893] (-743.818) * (-749.063) [-742.564] (-745.156) (-743.964) -- 0:00:55
463000 -- [-745.356] (-742.963) (-744.497) (-754.555) * (-748.335) [-747.809] (-746.165) (-752.148) -- 0:00:55
463500 -- [-746.080] (-748.009) (-744.361) (-746.225) * (-749.338) [-747.872] (-744.359) (-745.921) -- 0:00:55
464000 -- (-743.552) [-744.088] (-750.908) (-754.354) * (-745.837) (-747.954) (-746.644) [-747.819] -- 0:00:55
464500 -- (-743.658) (-745.964) [-746.001] (-747.989) * [-744.208] (-743.354) (-746.974) (-744.707) -- 0:00:55
465000 -- (-748.196) (-748.310) (-741.888) [-750.282] * (-742.426) (-744.669) (-742.900) [-745.954] -- 0:00:55
Average standard deviation of split frequencies: 0.018715
465500 -- [-743.738] (-746.725) (-745.183) (-749.132) * (-746.427) (-750.057) [-745.626] (-745.323) -- 0:00:55
466000 -- [-746.384] (-751.876) (-745.440) (-754.428) * (-743.055) (-742.541) (-745.986) [-743.841] -- 0:00:55
466500 -- [-747.746] (-747.378) (-743.130) (-746.427) * (-743.688) [-743.084] (-743.186) (-752.310) -- 0:00:54
467000 -- [-752.391] (-747.938) (-745.413) (-746.516) * (-743.754) [-740.006] (-743.386) (-745.803) -- 0:00:54
467500 -- (-750.008) [-743.654] (-746.662) (-752.507) * (-746.231) [-744.721] (-745.446) (-746.698) -- 0:00:54
468000 -- (-745.575) (-741.876) (-742.302) [-755.004] * (-750.859) (-745.572) [-740.540] (-750.218) -- 0:00:54
468500 -- (-752.563) (-749.031) [-750.289] (-753.593) * (-744.241) (-742.345) (-744.117) [-756.758] -- 0:00:55
469000 -- [-742.068] (-747.132) (-749.304) (-749.180) * (-744.481) [-743.868] (-747.292) (-749.152) -- 0:00:55
469500 -- (-743.634) (-750.500) (-750.222) [-751.726] * (-746.010) [-743.090] (-743.408) (-743.903) -- 0:00:55
470000 -- (-742.659) [-740.506] (-750.723) (-745.317) * [-745.567] (-752.537) (-739.885) (-745.099) -- 0:00:55
Average standard deviation of split frequencies: 0.017527
470500 -- (-745.099) [-741.799] (-748.406) (-745.331) * (-740.715) [-748.178] (-742.667) (-746.539) -- 0:00:55
471000 -- (-741.776) (-750.670) [-752.329] (-745.261) * [-746.042] (-750.258) (-747.702) (-747.718) -- 0:00:55
471500 -- [-745.443] (-745.057) (-749.521) (-747.818) * (-743.966) (-747.795) (-747.120) [-741.644] -- 0:00:54
472000 -- (-745.645) [-744.688] (-742.761) (-747.498) * (-749.771) [-744.296] (-745.573) (-743.520) -- 0:00:54
472500 -- (-748.566) [-744.758] (-741.864) (-744.944) * (-745.309) [-743.115] (-745.720) (-742.874) -- 0:00:54
473000 -- (-744.117) [-746.463] (-745.163) (-748.128) * (-749.936) (-742.202) (-744.200) [-744.211] -- 0:00:54
473500 -- (-745.768) (-741.981) [-752.131] (-749.557) * (-746.055) [-741.610] (-746.385) (-751.735) -- 0:00:54
474000 -- [-748.332] (-742.323) (-749.187) (-744.958) * (-748.628) (-744.425) [-743.764] (-750.910) -- 0:00:54
474500 -- (-745.130) (-742.202) (-745.941) [-744.363] * (-744.351) (-741.701) (-748.804) [-744.215] -- 0:00:54
475000 -- (-742.814) (-745.617) (-747.830) [-742.043] * (-742.352) (-745.599) (-748.283) [-742.586] -- 0:00:54
Average standard deviation of split frequencies: 0.016341
475500 -- [-743.754] (-744.679) (-743.809) (-744.727) * (-746.019) [-741.072] (-747.908) (-742.004) -- 0:00:54
476000 -- (-741.828) (-744.325) [-747.747] (-752.763) * (-748.583) [-743.088] (-747.334) (-743.112) -- 0:00:53
476500 -- (-748.565) (-742.013) (-748.216) [-742.979] * (-745.089) (-745.970) [-745.603] (-741.829) -- 0:00:53
477000 -- [-744.256] (-746.060) (-748.976) (-749.664) * (-743.932) [-742.345] (-744.238) (-745.426) -- 0:00:53
477500 -- (-742.734) [-743.407] (-747.152) (-746.924) * (-743.864) [-748.350] (-741.387) (-748.801) -- 0:00:53
478000 -- [-744.882] (-740.934) (-743.415) (-744.681) * [-745.826] (-743.485) (-744.899) (-747.575) -- 0:00:54
478500 -- (-741.154) (-748.646) (-738.558) [-753.850] * (-744.079) [-745.011] (-750.567) (-747.075) -- 0:00:54
479000 -- (-741.496) (-746.171) [-747.723] (-743.646) * (-751.655) (-748.701) (-744.508) [-743.696] -- 0:00:54
479500 -- (-743.834) [-746.063] (-746.306) (-749.300) * [-742.800] (-751.884) (-748.034) (-747.432) -- 0:00:54
480000 -- (-746.150) [-748.109] (-744.877) (-746.935) * (-743.934) (-750.347) [-743.956] (-742.381) -- 0:00:54
Average standard deviation of split frequencies: 0.017653
480500 -- (-745.336) (-745.874) [-746.186] (-744.459) * (-745.204) [-746.239] (-741.485) (-749.992) -- 0:00:54
481000 -- (-741.891) [-743.687] (-743.582) (-741.805) * (-747.863) (-745.769) (-747.942) [-742.592] -- 0:00:53
481500 -- [-746.952] (-746.354) (-751.440) (-748.002) * (-750.379) [-742.248] (-746.393) (-745.478) -- 0:00:53
482000 -- (-746.275) (-745.369) [-748.571] (-745.025) * (-747.924) [-742.736] (-748.125) (-747.012) -- 0:00:53
482500 -- (-749.825) [-744.395] (-744.508) (-746.037) * [-745.959] (-740.729) (-745.482) (-743.330) -- 0:00:53
483000 -- (-745.162) [-743.832] (-738.826) (-751.078) * (-745.760) (-742.995) (-751.541) [-744.675] -- 0:00:53
483500 -- (-748.593) (-742.042) [-747.827] (-743.633) * [-748.631] (-749.373) (-743.828) (-744.114) -- 0:00:53
484000 -- (-744.112) (-747.030) (-739.638) [-742.468] * (-748.309) [-741.511] (-741.485) (-741.774) -- 0:00:53
484500 -- [-749.874] (-745.367) (-751.312) (-740.662) * (-743.927) [-743.626] (-747.512) (-743.502) -- 0:00:53
485000 -- (-745.891) (-745.218) [-742.512] (-748.463) * (-743.060) (-745.835) (-750.609) [-744.298] -- 0:00:53
Average standard deviation of split frequencies: 0.015519
485500 -- (-745.946) (-749.301) [-745.200] (-748.698) * (-740.715) (-744.293) [-741.103] (-744.448) -- 0:00:52
486000 -- (-749.704) (-746.002) [-749.025] (-746.619) * [-741.626] (-746.619) (-745.771) (-744.788) -- 0:00:52
486500 -- (-751.488) (-749.732) [-745.511] (-748.609) * (-747.081) [-744.576] (-747.066) (-746.640) -- 0:00:52
487000 -- (-749.574) (-745.241) (-748.980) [-744.482] * (-746.050) [-745.807] (-745.187) (-747.104) -- 0:00:52
487500 -- (-748.221) [-745.319] (-743.967) (-746.345) * (-744.872) (-745.558) [-750.431] (-741.442) -- 0:00:52
488000 -- (-749.338) [-743.021] (-745.202) (-746.537) * (-744.709) [-748.919] (-746.913) (-746.279) -- 0:00:53
488500 -- (-751.284) (-742.728) (-744.782) [-745.891] * (-750.979) (-747.055) [-741.278] (-745.073) -- 0:00:53
489000 -- (-744.678) [-742.428] (-745.792) (-745.576) * [-747.060] (-748.957) (-747.838) (-749.648) -- 0:00:53
489500 -- [-745.792] (-742.850) (-743.882) (-745.050) * (-746.590) [-750.998] (-747.837) (-747.784) -- 0:00:53
490000 -- (-746.698) (-751.487) [-749.017] (-746.806) * (-745.302) (-744.573) [-750.339] (-746.091) -- 0:00:53
Average standard deviation of split frequencies: 0.014892
490500 -- (-745.335) (-745.551) (-746.603) [-750.543] * (-751.763) (-748.759) [-741.092] (-745.808) -- 0:00:52
491000 -- (-743.452) (-742.067) (-752.734) [-749.161] * (-755.437) [-747.519] (-743.450) (-746.493) -- 0:00:52
491500 -- (-741.539) [-740.406] (-750.679) (-746.038) * (-746.900) [-748.609] (-744.594) (-743.629) -- 0:00:52
492000 -- [-742.738] (-749.056) (-742.746) (-748.315) * (-743.770) [-752.026] (-747.994) (-745.299) -- 0:00:52
492500 -- [-746.061] (-743.756) (-744.971) (-744.654) * (-742.512) (-746.410) [-743.234] (-745.454) -- 0:00:52
493000 -- [-748.569] (-743.500) (-749.182) (-749.032) * [-744.225] (-746.092) (-745.557) (-741.649) -- 0:00:52
493500 -- (-742.737) [-744.698] (-747.574) (-750.658) * (-744.577) (-745.081) (-746.604) [-741.488] -- 0:00:52
494000 -- [-746.408] (-748.042) (-745.602) (-749.062) * [-747.752] (-742.272) (-746.974) (-744.013) -- 0:00:52
494500 -- [-748.959] (-744.307) (-746.115) (-753.013) * (-745.299) (-744.149) (-747.314) [-742.506] -- 0:00:52
495000 -- [-743.721] (-741.179) (-746.734) (-759.608) * (-744.585) (-748.528) (-748.192) [-743.104] -- 0:00:52
Average standard deviation of split frequencies: 0.013781
495500 -- (-750.123) (-748.557) [-743.673] (-756.826) * (-745.593) [-743.383] (-756.866) (-747.702) -- 0:00:51
496000 -- (-749.001) (-743.866) [-741.899] (-752.796) * (-746.462) (-743.626) (-750.053) [-745.334] -- 0:00:51
496500 -- (-749.489) (-743.785) (-752.052) [-744.524] * (-742.593) (-744.847) [-742.523] (-747.657) -- 0:00:51
497000 -- (-746.208) [-741.369] (-742.443) (-752.006) * (-742.027) (-750.099) (-748.204) [-743.730] -- 0:00:51
497500 -- (-749.495) (-744.207) (-745.532) [-748.089] * (-748.295) (-750.479) [-744.948] (-747.085) -- 0:00:52
498000 -- (-745.963) (-748.126) (-745.180) [-744.817] * (-745.995) (-745.327) [-746.830] (-752.571) -- 0:00:52
498500 -- (-748.248) [-744.254] (-742.051) (-745.541) * (-742.975) (-752.938) [-742.498] (-749.453) -- 0:00:52
499000 -- (-746.219) [-747.131] (-741.902) (-745.464) * (-752.376) (-748.172) [-745.576] (-745.579) -- 0:00:52
499500 -- (-746.307) (-746.979) [-742.405] (-741.470) * (-749.514) (-748.139) [-744.839] (-744.562) -- 0:00:52
500000 -- (-741.080) (-748.543) [-744.676] (-746.078) * [-749.903] (-747.817) (-742.839) (-751.841) -- 0:00:52
Average standard deviation of split frequencies: 0.013653
500500 -- [-745.786] (-747.681) (-747.982) (-742.871) * [-745.248] (-743.317) (-743.888) (-749.933) -- 0:00:51
501000 -- [-747.234] (-745.640) (-745.158) (-743.692) * [-745.728] (-744.149) (-745.956) (-750.283) -- 0:00:51
501500 -- (-748.456) (-746.210) [-743.655] (-739.841) * [-740.844] (-748.721) (-752.882) (-747.711) -- 0:00:51
502000 -- [-749.471] (-747.892) (-746.938) (-743.095) * (-748.864) [-746.010] (-751.945) (-741.922) -- 0:00:51
502500 -- [-749.298] (-746.800) (-743.718) (-751.604) * (-743.593) (-742.582) [-746.386] (-745.920) -- 0:00:51
503000 -- (-747.352) (-744.445) (-746.400) [-749.942] * (-746.926) [-757.421] (-740.826) (-746.541) -- 0:00:51
503500 -- [-742.919] (-743.527) (-757.433) (-753.333) * [-744.766] (-752.265) (-741.256) (-745.828) -- 0:00:51
504000 -- (-743.625) (-748.273) [-750.338] (-755.722) * (-745.706) (-744.031) [-743.028] (-745.058) -- 0:00:51
504500 -- (-743.319) (-751.488) [-746.857] (-748.799) * (-745.672) (-746.422) [-743.051] (-747.141) -- 0:00:51
505000 -- (-741.238) (-758.068) (-742.025) [-741.178] * (-746.516) (-747.630) (-743.135) [-748.706] -- 0:00:50
Average standard deviation of split frequencies: 0.016304
505500 -- (-744.210) (-749.902) [-743.169] (-742.020) * [-745.580] (-744.095) (-752.383) (-745.895) -- 0:00:50
506000 -- [-744.237] (-746.108) (-747.962) (-745.403) * (-745.396) (-748.422) [-743.649] (-745.269) -- 0:00:50
506500 -- [-745.149] (-745.848) (-742.987) (-742.251) * [-745.467] (-742.940) (-743.146) (-749.035) -- 0:00:50
507000 -- (-741.814) (-748.130) [-744.383] (-746.185) * (-744.202) (-745.699) (-744.173) [-742.087] -- 0:00:50
507500 -- (-744.126) (-751.752) [-742.029] (-746.894) * (-754.108) (-744.378) [-743.052] (-742.933) -- 0:00:51
508000 -- (-745.250) (-761.032) (-743.871) [-745.496] * (-752.859) (-747.949) [-746.450] (-745.807) -- 0:00:51
508500 -- (-750.755) (-748.665) (-751.636) [-742.171] * (-746.682) (-742.492) [-744.679] (-743.777) -- 0:00:51
509000 -- (-744.402) [-752.236] (-748.938) (-748.010) * [-745.103] (-743.197) (-742.724) (-750.400) -- 0:00:51
509500 -- (-743.551) (-747.666) [-748.159] (-742.984) * (-744.982) (-742.867) [-742.258] (-746.162) -- 0:00:51
510000 -- [-741.068] (-748.091) (-744.958) (-742.305) * (-747.343) [-744.288] (-743.482) (-742.888) -- 0:00:50
Average standard deviation of split frequencies: 0.016616
510500 -- [-744.131] (-747.139) (-749.249) (-745.703) * (-742.021) (-745.326) [-746.201] (-745.938) -- 0:00:50
511000 -- (-749.113) (-744.970) [-747.182] (-749.002) * (-742.776) [-741.640] (-752.729) (-743.835) -- 0:00:50
511500 -- (-749.296) (-744.157) (-742.608) [-746.415] * (-743.383) [-744.707] (-749.954) (-744.724) -- 0:00:50
512000 -- (-746.736) [-751.295] (-750.835) (-743.076) * (-742.453) (-743.504) [-748.735] (-746.489) -- 0:00:50
512500 -- (-744.830) (-748.419) (-746.865) [-747.814] * [-743.943] (-751.909) (-753.727) (-748.342) -- 0:00:50
513000 -- (-741.229) (-747.372) [-744.615] (-754.827) * (-749.097) (-743.656) [-747.898] (-752.416) -- 0:00:50
513500 -- (-745.191) (-749.704) (-747.225) [-744.583] * (-747.267) (-746.272) (-747.598) [-744.880] -- 0:00:50
514000 -- (-749.325) (-745.456) [-745.751] (-742.776) * (-745.360) (-742.411) (-746.417) [-745.677] -- 0:00:50
514500 -- (-743.993) [-745.735] (-743.747) (-753.763) * (-744.782) [-742.874] (-746.628) (-751.675) -- 0:00:50
515000 -- [-750.665] (-745.143) (-742.564) (-743.780) * (-748.190) (-740.512) [-743.264] (-743.889) -- 0:00:49
Average standard deviation of split frequencies: 0.015074
515500 -- (-747.140) (-744.941) [-740.696] (-745.544) * (-747.049) [-741.635] (-749.673) (-753.022) -- 0:00:49
516000 -- (-741.196) (-746.876) [-747.199] (-742.971) * (-749.778) [-742.792] (-749.732) (-743.473) -- 0:00:49
516500 -- (-751.190) (-748.648) (-745.831) [-738.573] * (-746.182) (-743.954) [-749.734] (-745.128) -- 0:00:49
517000 -- [-748.141] (-744.269) (-747.545) (-747.163) * (-748.517) (-744.483) [-743.937] (-743.011) -- 0:00:50
517500 -- (-741.680) [-744.648] (-745.714) (-747.191) * (-745.727) (-752.714) [-748.258] (-741.051) -- 0:00:50
518000 -- (-749.404) [-748.721] (-752.718) (-752.252) * (-743.136) (-750.119) (-745.033) [-747.895] -- 0:00:50
518500 -- [-747.565] (-751.235) (-743.788) (-746.609) * (-739.927) (-752.004) [-743.153] (-745.727) -- 0:00:50
519000 -- (-748.196) (-747.773) [-747.385] (-747.004) * (-748.174) (-750.885) [-747.053] (-747.382) -- 0:00:50
519500 -- [-745.009] (-745.012) (-743.725) (-747.964) * (-744.291) (-746.011) (-745.662) [-750.885] -- 0:00:49
520000 -- (-752.312) [-744.933] (-741.449) (-746.587) * [-743.959] (-756.411) (-742.972) (-749.706) -- 0:00:49
Average standard deviation of split frequencies: 0.010865
520500 -- [-747.602] (-747.775) (-743.303) (-748.601) * (-741.889) (-747.765) (-747.156) [-747.227] -- 0:00:49
521000 -- (-752.209) (-748.402) (-744.240) [-742.767] * (-748.895) (-744.824) [-746.654] (-746.443) -- 0:00:49
521500 -- (-750.331) (-746.348) [-745.146] (-747.908) * (-747.076) [-746.232] (-747.322) (-753.291) -- 0:00:49
522000 -- (-750.361) [-745.998] (-746.657) (-756.668) * (-741.728) [-747.732] (-743.134) (-744.185) -- 0:00:49
522500 -- (-750.204) (-748.035) [-748.895] (-748.260) * (-744.360) (-742.845) (-742.604) [-746.020] -- 0:00:49
523000 -- [-742.759] (-747.630) (-747.495) (-750.500) * (-753.833) (-751.745) (-746.389) [-743.486] -- 0:00:49
523500 -- (-747.199) [-746.222] (-744.869) (-751.933) * (-751.071) (-745.482) (-744.047) [-742.402] -- 0:00:49
524000 -- [-748.032] (-744.981) (-749.796) (-743.714) * [-747.362] (-742.829) (-744.862) (-745.746) -- 0:00:49
524500 -- (-748.939) (-742.562) [-744.420] (-749.179) * [-746.953] (-752.118) (-747.405) (-746.095) -- 0:00:48
525000 -- (-744.567) (-749.218) [-740.877] (-747.033) * (-752.794) (-744.742) [-746.689] (-748.192) -- 0:00:48
Average standard deviation of split frequencies: 0.011203
525500 -- (-741.646) (-749.058) (-743.437) [-741.508] * [-749.547] (-744.560) (-742.448) (-749.968) -- 0:00:48
526000 -- (-744.525) (-747.084) (-743.013) [-747.833] * (-753.992) [-741.130] (-744.947) (-749.580) -- 0:00:48
526500 -- (-741.080) (-747.967) [-745.482] (-742.757) * [-742.805] (-744.549) (-745.878) (-750.714) -- 0:00:48
527000 -- (-742.013) (-739.625) [-750.554] (-748.018) * (-740.906) (-747.951) (-750.752) [-746.284] -- 0:00:49
527500 -- (-745.533) (-754.129) (-749.382) [-744.972] * (-741.584) (-746.420) (-745.258) [-744.057] -- 0:00:49
528000 -- (-743.114) (-743.253) [-748.744] (-748.350) * (-742.369) [-744.078] (-746.548) (-744.311) -- 0:00:49
528500 -- (-747.184) (-747.936) (-745.180) [-748.958] * (-746.084) (-752.963) [-747.807] (-749.324) -- 0:00:49
529000 -- (-745.597) (-747.304) (-741.429) [-743.097] * (-745.081) [-742.843] (-747.902) (-751.643) -- 0:00:48
529500 -- (-744.329) [-744.357] (-739.770) (-739.716) * [-748.957] (-746.754) (-748.254) (-753.570) -- 0:00:48
530000 -- [-744.074] (-743.072) (-746.205) (-741.553) * (-747.396) (-740.734) [-749.426] (-753.924) -- 0:00:48
Average standard deviation of split frequencies: 0.010216
530500 -- (-746.043) (-743.541) (-743.657) [-747.986] * [-740.574] (-744.398) (-749.036) (-746.546) -- 0:00:48
531000 -- (-746.877) (-747.823) (-745.285) [-743.667] * (-741.828) [-746.188] (-752.928) (-748.322) -- 0:00:48
531500 -- (-744.013) (-751.528) (-747.175) [-742.988] * [-742.998] (-745.457) (-752.656) (-749.087) -- 0:00:48
532000 -- [-749.249] (-744.611) (-747.432) (-741.733) * (-739.655) [-750.193] (-747.906) (-744.409) -- 0:00:48
532500 -- (-743.508) (-746.072) [-747.931] (-743.986) * (-743.252) (-748.081) [-749.115] (-741.793) -- 0:00:48
533000 -- (-743.590) (-744.379) (-746.866) [-740.785] * [-741.996] (-750.435) (-749.117) (-746.024) -- 0:00:48
533500 -- (-749.837) [-742.063] (-745.206) (-745.597) * (-746.586) [-744.972] (-746.220) (-747.000) -- 0:00:48
534000 -- (-753.329) (-744.176) [-750.502] (-752.200) * (-743.640) [-740.632] (-753.071) (-750.087) -- 0:00:47
534500 -- [-743.955] (-745.152) (-753.456) (-756.793) * (-751.237) (-749.257) (-751.326) [-747.358] -- 0:00:47
535000 -- (-746.480) [-742.184] (-745.401) (-756.289) * (-742.508) (-752.121) [-746.662] (-744.241) -- 0:00:47
Average standard deviation of split frequencies: 0.010554
535500 -- (-750.832) (-744.551) (-742.990) [-746.075] * (-746.316) (-749.050) (-747.693) [-747.167] -- 0:00:47
536000 -- (-747.367) [-742.789] (-757.283) (-753.914) * (-741.914) (-746.302) [-750.484] (-749.356) -- 0:00:47
536500 -- [-745.903] (-741.793) (-752.422) (-748.244) * (-748.062) (-746.912) (-745.944) [-744.509] -- 0:00:47
537000 -- [-744.528] (-741.284) (-752.270) (-745.141) * (-743.004) (-741.618) (-740.395) [-747.067] -- 0:00:48
537500 -- (-743.978) [-747.320] (-749.735) (-749.534) * (-742.310) (-746.960) (-746.416) [-744.731] -- 0:00:48
538000 -- (-742.294) (-745.351) (-745.971) [-744.610] * (-740.956) [-748.761] (-743.339) (-744.962) -- 0:00:48
538500 -- (-744.975) [-742.683] (-740.530) (-751.144) * [-743.217] (-756.437) (-748.288) (-746.524) -- 0:00:47
539000 -- (-749.028) [-746.284] (-739.302) (-751.608) * (-740.592) (-743.576) [-744.306] (-744.611) -- 0:00:47
539500 -- (-742.285) (-750.378) [-741.296] (-749.173) * (-745.632) (-740.162) (-741.805) [-742.626] -- 0:00:47
540000 -- (-744.515) (-743.792) (-741.040) [-746.546] * (-746.545) [-744.124] (-744.876) (-753.119) -- 0:00:47
Average standard deviation of split frequencies: 0.009155
540500 -- (-744.965) (-748.614) [-745.418] (-744.576) * (-749.769) (-743.713) (-745.935) [-743.167] -- 0:00:47
541000 -- (-746.497) (-747.037) (-745.660) [-745.635] * (-743.463) (-748.960) [-743.989] (-748.405) -- 0:00:47
541500 -- (-749.761) (-752.094) [-745.580] (-749.405) * (-745.887) (-748.638) (-743.551) [-749.020] -- 0:00:47
542000 -- (-745.289) (-747.000) [-744.145] (-747.132) * (-748.828) (-746.517) [-740.934] (-745.011) -- 0:00:47
542500 -- (-743.443) [-745.767] (-747.213) (-743.962) * [-743.237] (-745.134) (-742.435) (-744.303) -- 0:00:47
543000 -- (-743.946) [-744.097] (-751.882) (-750.005) * (-743.319) [-749.449] (-750.844) (-744.036) -- 0:00:47
543500 -- (-749.069) (-746.127) (-750.388) [-742.750] * (-743.618) (-748.510) (-749.767) [-743.012] -- 0:00:47
544000 -- (-743.699) (-744.924) [-747.210] (-745.835) * (-747.499) [-746.777] (-753.614) (-748.395) -- 0:00:46
544500 -- [-740.970] (-743.534) (-748.567) (-746.518) * (-748.937) (-748.180) [-749.147] (-748.079) -- 0:00:46
545000 -- (-744.613) (-751.054) [-744.732] (-748.517) * (-749.506) (-747.832) [-751.047] (-745.007) -- 0:00:46
Average standard deviation of split frequencies: 0.005180
545500 -- (-750.006) (-753.931) [-751.457] (-746.816) * (-741.927) (-751.577) (-744.624) [-743.477] -- 0:00:46
546000 -- (-748.638) (-748.553) (-747.865) [-746.741] * (-745.658) [-750.021] (-749.218) (-745.342) -- 0:00:46
546500 -- [-748.833] (-749.461) (-745.261) (-743.535) * [-749.472] (-749.581) (-745.143) (-742.263) -- 0:00:46
547000 -- (-747.488) [-746.533] (-746.595) (-743.515) * (-747.888) (-747.653) [-742.234] (-740.398) -- 0:00:47
547500 -- (-749.134) (-749.982) [-745.722] (-749.445) * (-747.218) (-745.138) [-746.806] (-745.194) -- 0:00:47
548000 -- (-751.330) [-742.954] (-744.450) (-744.347) * [-744.918] (-742.586) (-743.560) (-740.941) -- 0:00:47
548500 -- (-747.486) [-745.576] (-747.842) (-745.913) * (-746.873) (-745.893) [-744.879] (-746.266) -- 0:00:46
549000 -- (-746.640) (-742.340) [-745.587] (-744.034) * (-742.209) (-745.546) [-747.379] (-748.097) -- 0:00:46
549500 -- (-742.929) (-742.535) (-746.040) [-745.211] * (-750.184) (-745.261) [-741.043] (-745.933) -- 0:00:46
550000 -- (-754.729) (-746.740) (-743.564) [-745.699] * [-745.885] (-748.502) (-745.178) (-746.307) -- 0:00:46
Average standard deviation of split frequencies: 0.005136
550500 -- [-746.122] (-748.088) (-742.998) (-743.788) * (-744.668) [-745.324] (-747.799) (-750.008) -- 0:00:46
551000 -- (-753.923) [-746.198] (-746.573) (-740.976) * (-746.551) (-742.943) (-746.910) [-744.585] -- 0:00:46
551500 -- (-744.906) (-743.781) [-743.844] (-742.701) * (-740.522) (-747.043) (-745.832) [-747.982] -- 0:00:46
552000 -- (-747.726) (-751.096) [-753.943] (-742.201) * (-741.185) [-740.766] (-749.858) (-748.887) -- 0:00:46
552500 -- (-744.408) (-746.996) [-744.047] (-745.757) * (-749.307) [-742.468] (-745.148) (-749.384) -- 0:00:46
553000 -- [-757.182] (-742.057) (-745.735) (-746.824) * (-750.000) (-744.085) [-746.553] (-742.903) -- 0:00:46
553500 -- [-749.580] (-744.040) (-744.133) (-744.990) * (-744.891) (-745.129) (-746.650) [-742.994] -- 0:00:45
554000 -- (-744.386) (-748.622) [-745.866] (-744.829) * [-747.273] (-742.977) (-752.880) (-747.636) -- 0:00:45
554500 -- (-744.572) (-750.313) [-742.590] (-756.340) * (-741.923) [-745.935] (-752.274) (-741.823) -- 0:00:45
555000 -- (-747.738) [-748.450] (-744.619) (-746.709) * [-745.149] (-741.844) (-750.976) (-747.200) -- 0:00:45
Average standard deviation of split frequencies: 0.005511
555500 -- (-749.342) (-745.752) (-744.299) [-743.570] * [-747.652] (-745.561) (-755.680) (-746.806) -- 0:00:45
556000 -- [-741.963] (-746.621) (-742.784) (-741.765) * (-743.865) (-744.369) [-747.503] (-746.700) -- 0:00:45
556500 -- (-747.755) (-743.929) (-742.177) [-746.821] * (-743.521) (-747.492) [-746.997] (-746.555) -- 0:00:46
557000 -- (-746.757) [-745.457] (-740.475) (-743.754) * (-745.287) (-745.515) [-742.211] (-746.430) -- 0:00:46
557500 -- [-744.439] (-746.774) (-748.432) (-742.606) * (-746.479) (-756.805) (-743.620) [-744.496] -- 0:00:46
558000 -- (-750.781) (-743.003) (-747.759) [-743.220] * (-740.278) [-743.144] (-748.459) (-742.396) -- 0:00:45
558500 -- (-750.965) (-742.583) (-757.643) [-740.854] * [-749.481] (-751.345) (-746.049) (-747.268) -- 0:00:45
559000 -- (-746.383) (-749.682) (-747.305) [-748.875] * (-741.473) [-747.199] (-753.068) (-744.393) -- 0:00:45
559500 -- (-748.497) (-746.743) (-747.780) [-743.629] * (-744.064) [-747.944] (-746.793) (-746.442) -- 0:00:45
560000 -- (-747.802) [-751.111] (-744.330) (-747.321) * (-746.136) (-743.709) (-742.867) [-746.129] -- 0:00:45
Average standard deviation of split frequencies: 0.009249
560500 -- [-743.985] (-750.027) (-749.492) (-743.778) * [-749.513] (-742.607) (-745.230) (-750.901) -- 0:00:45
561000 -- (-746.639) [-749.330] (-746.503) (-741.479) * [-740.923] (-751.883) (-750.681) (-746.363) -- 0:00:45
561500 -- (-753.149) [-744.999] (-749.846) (-740.802) * (-743.126) (-748.062) [-744.509] (-745.813) -- 0:00:45
562000 -- [-742.519] (-749.976) (-747.094) (-749.898) * (-745.571) (-751.108) (-743.511) [-748.667] -- 0:00:45
562500 -- (-744.589) [-741.058] (-745.902) (-749.369) * [-742.416] (-743.917) (-751.445) (-743.874) -- 0:00:45
563000 -- (-750.178) [-745.792] (-747.794) (-743.642) * [-740.742] (-748.658) (-747.506) (-746.629) -- 0:00:45
563500 -- (-752.232) (-740.040) (-745.845) [-742.464] * (-745.723) (-746.247) (-746.355) [-748.855] -- 0:00:44
564000 -- (-750.315) (-743.821) (-744.345) [-743.602] * [-742.548] (-747.213) (-740.658) (-749.243) -- 0:00:44
564500 -- (-746.455) [-741.360] (-747.736) (-750.532) * (-746.745) [-745.441] (-744.520) (-746.573) -- 0:00:44
565000 -- [-749.084] (-744.211) (-743.855) (-746.196) * [-740.091] (-749.035) (-745.023) (-747.366) -- 0:00:44
Average standard deviation of split frequencies: 0.008745
565500 -- [-749.043] (-749.942) (-752.928) (-745.055) * (-749.263) (-743.760) [-746.959] (-756.965) -- 0:00:44
566000 -- (-752.521) [-757.769] (-741.773) (-745.417) * (-743.718) (-742.679) [-745.771] (-753.954) -- 0:00:44
566500 -- (-746.044) (-752.953) (-747.911) [-744.153] * (-746.946) [-742.065] (-747.191) (-750.687) -- 0:00:45
567000 -- (-750.525) [-750.569] (-744.227) (-743.700) * (-742.034) (-748.430) (-748.185) [-744.073] -- 0:00:45
567500 -- (-750.730) [-745.927] (-749.607) (-747.691) * (-742.395) [-745.161] (-750.456) (-740.784) -- 0:00:44
568000 -- (-746.455) (-750.642) [-741.996] (-747.773) * (-743.300) [-748.137] (-745.936) (-742.536) -- 0:00:44
568500 -- [-740.099] (-747.536) (-742.869) (-749.932) * (-751.058) [-741.985] (-755.846) (-742.304) -- 0:00:44
569000 -- (-744.436) [-751.179] (-750.691) (-742.469) * (-750.587) [-745.856] (-755.293) (-749.170) -- 0:00:44
569500 -- [-745.324] (-751.038) (-747.926) (-747.196) * (-743.312) (-751.255) (-745.460) [-743.352] -- 0:00:44
570000 -- (-744.498) (-744.313) [-742.897] (-750.268) * [-744.107] (-753.712) (-745.335) (-742.259) -- 0:00:44
Average standard deviation of split frequencies: 0.007435
570500 -- (-741.157) (-745.029) (-747.313) [-741.947] * [-746.873] (-749.741) (-748.146) (-746.285) -- 0:00:44
571000 -- (-742.774) (-751.436) (-750.027) [-745.830] * (-744.262) (-750.595) [-745.247] (-745.502) -- 0:00:44
571500 -- [-742.210] (-768.153) (-747.349) (-746.339) * (-747.628) [-740.626] (-747.295) (-749.440) -- 0:00:44
572000 -- (-741.600) (-746.307) (-745.955) [-747.850] * (-744.900) (-747.733) [-743.466] (-747.737) -- 0:00:44
572500 -- (-746.198) (-743.754) [-742.884] (-747.428) * (-746.108) (-744.080) [-746.324] (-751.105) -- 0:00:44
573000 -- [-742.532] (-747.166) (-749.947) (-745.061) * [-750.253] (-751.235) (-745.496) (-749.497) -- 0:00:43
573500 -- (-745.489) (-747.460) (-746.788) [-742.805] * (-749.447) (-746.092) (-747.862) [-749.626] -- 0:00:43
574000 -- [-744.730] (-744.181) (-742.975) (-743.780) * (-754.543) (-745.038) [-743.854] (-746.806) -- 0:00:43
574500 -- [-742.273] (-744.734) (-740.879) (-744.710) * [-751.614] (-747.204) (-748.253) (-747.709) -- 0:00:43
575000 -- (-743.775) (-750.793) [-743.949] (-752.474) * (-750.896) [-745.852] (-744.835) (-748.110) -- 0:00:43
Average standard deviation of split frequencies: 0.004092
575500 -- (-742.119) [-743.593] (-754.023) (-747.299) * (-747.572) (-745.977) (-744.383) [-746.753] -- 0:00:43
576000 -- (-743.979) [-749.105] (-741.886) (-747.926) * [-749.474] (-748.417) (-742.559) (-744.413) -- 0:00:44
576500 -- (-748.341) (-743.136) (-743.294) [-747.757] * (-747.049) (-754.044) [-745.316] (-745.536) -- 0:00:44
577000 -- [-746.020] (-748.472) (-743.464) (-746.040) * (-748.637) [-751.021] (-757.531) (-742.792) -- 0:00:43
577500 -- (-745.693) (-751.100) [-748.617] (-746.838) * (-742.788) [-750.471] (-746.096) (-743.763) -- 0:00:43
578000 -- (-746.040) (-746.680) (-744.783) [-745.752] * [-748.091] (-745.310) (-748.165) (-748.595) -- 0:00:43
578500 -- (-752.338) [-746.684] (-742.826) (-745.771) * (-743.424) (-749.470) (-740.424) [-750.364] -- 0:00:43
579000 -- (-748.591) (-746.428) (-744.255) [-748.719] * (-744.291) (-750.644) (-747.849) [-745.006] -- 0:00:43
579500 -- [-742.013] (-750.034) (-743.896) (-742.455) * [-740.223] (-743.528) (-742.983) (-753.202) -- 0:00:43
580000 -- (-743.607) (-748.177) [-740.282] (-743.614) * (-742.539) (-745.129) [-746.651] (-747.027) -- 0:00:43
Average standard deviation of split frequencies: 0.007306
580500 -- (-742.305) (-752.457) (-741.997) [-747.730] * (-745.591) (-742.844) [-749.112] (-749.610) -- 0:00:43
581000 -- (-746.616) (-746.595) [-740.740] (-746.306) * (-748.000) [-745.577] (-755.076) (-740.531) -- 0:00:43
581500 -- [-741.089] (-743.565) (-746.115) (-745.725) * [-742.710] (-746.903) (-747.776) (-744.484) -- 0:00:43
582000 -- (-744.799) (-746.418) (-743.948) [-753.660] * (-747.252) [-743.215] (-741.849) (-744.209) -- 0:00:43
582500 -- (-751.378) (-747.443) [-741.966] (-748.613) * (-741.396) [-747.831] (-742.656) (-747.500) -- 0:00:43
583000 -- (-745.469) (-749.517) [-746.460] (-747.235) * (-751.829) [-746.074] (-744.972) (-749.575) -- 0:00:42
583500 -- (-745.433) (-748.649) [-740.931] (-747.874) * [-748.670] (-749.450) (-748.435) (-755.921) -- 0:00:42
584000 -- (-748.085) (-745.115) [-744.147] (-742.524) * (-745.077) [-742.550] (-746.844) (-749.492) -- 0:00:42
584500 -- (-747.961) (-750.181) (-745.109) [-748.881] * (-743.464) [-743.332] (-741.238) (-744.249) -- 0:00:42
585000 -- (-751.738) [-747.782] (-746.228) (-746.152) * (-751.136) [-741.060] (-744.315) (-744.320) -- 0:00:42
Average standard deviation of split frequencies: 0.006033
585500 -- (-750.471) (-747.652) [-748.536] (-749.216) * (-743.544) (-744.889) (-746.815) [-741.594] -- 0:00:42
586000 -- [-743.720] (-747.575) (-754.234) (-748.217) * (-741.649) [-740.824] (-746.623) (-743.266) -- 0:00:43
586500 -- [-742.608] (-746.531) (-745.913) (-744.938) * (-739.271) [-744.316] (-746.954) (-754.720) -- 0:00:43
587000 -- (-745.242) [-742.248] (-745.706) (-749.722) * [-752.180] (-748.068) (-748.920) (-742.724) -- 0:00:42
587500 -- [-746.223] (-743.791) (-744.012) (-746.866) * (-745.069) [-749.029] (-749.146) (-743.827) -- 0:00:42
588000 -- [-743.277] (-754.860) (-748.659) (-754.208) * (-743.474) (-746.934) [-751.737] (-749.111) -- 0:00:42
588500 -- (-750.371) [-740.411] (-752.523) (-752.944) * (-747.321) (-752.410) (-748.111) [-745.881] -- 0:00:42
589000 -- (-748.334) (-741.862) (-746.872) [-746.705] * (-742.401) [-747.162] (-745.394) (-742.947) -- 0:00:42
589500 -- (-751.694) [-744.747] (-746.149) (-748.738) * (-743.844) (-746.702) (-747.486) [-749.755] -- 0:00:42
590000 -- (-740.433) [-746.971] (-746.675) (-749.693) * [-741.686] (-746.470) (-752.331) (-749.329) -- 0:00:42
Average standard deviation of split frequencies: 0.004389
590500 -- [-741.465] (-745.892) (-747.300) (-749.633) * (-746.659) (-751.014) [-746.545] (-746.361) -- 0:00:42
591000 -- [-743.873] (-747.798) (-740.316) (-751.321) * (-743.650) (-748.799) (-749.821) [-747.453] -- 0:00:42
591500 -- (-746.468) [-741.752] (-741.059) (-747.650) * (-746.111) [-745.225] (-748.460) (-745.776) -- 0:00:42
592000 -- [-749.287] (-742.397) (-747.362) (-752.301) * (-745.336) [-751.494] (-747.862) (-742.127) -- 0:00:42
592500 -- [-744.052] (-746.438) (-741.394) (-751.536) * (-745.599) (-749.661) (-746.622) [-745.097] -- 0:00:41
593000 -- [-747.365] (-744.396) (-746.713) (-747.381) * (-744.573) (-750.798) [-742.779] (-742.364) -- 0:00:41
593500 -- (-746.776) (-745.539) [-742.221] (-748.518) * [-744.539] (-743.565) (-746.070) (-743.611) -- 0:00:41
594000 -- (-746.416) [-746.460] (-738.776) (-745.923) * (-744.541) (-743.548) (-750.076) [-748.326] -- 0:00:41
594500 -- (-749.406) (-746.792) (-747.751) [-746.189] * (-743.632) (-744.889) [-744.534] (-742.157) -- 0:00:41
595000 -- [-749.124] (-751.705) (-752.301) (-746.738) * (-743.078) (-747.164) (-751.784) [-743.611] -- 0:00:41
Average standard deviation of split frequencies: 0.004746
595500 -- (-744.920) (-747.278) [-750.141] (-745.712) * (-745.740) (-748.499) [-745.864] (-745.546) -- 0:00:42
596000 -- (-753.048) (-751.526) (-741.730) [-751.837] * (-748.452) (-745.374) [-741.579] (-741.365) -- 0:00:42
596500 -- (-750.817) (-745.931) (-752.898) [-751.596] * (-743.524) [-744.568] (-744.289) (-751.434) -- 0:00:41
597000 -- (-746.803) (-747.659) (-744.387) [-749.823] * (-741.070) [-744.947] (-747.170) (-744.442) -- 0:00:41
597500 -- (-744.905) (-744.403) [-742.704] (-750.278) * [-746.322] (-744.193) (-746.613) (-740.590) -- 0:00:41
598000 -- (-741.582) (-746.214) [-744.372] (-743.305) * (-751.381) [-742.361] (-751.935) (-750.968) -- 0:00:41
598500 -- [-745.428] (-745.978) (-747.145) (-740.854) * (-747.065) (-749.594) (-747.116) [-744.936] -- 0:00:41
599000 -- (-742.154) (-748.572) [-744.798] (-743.286) * (-745.247) [-744.257] (-749.134) (-742.669) -- 0:00:41
599500 -- (-741.585) [-744.299] (-746.067) (-742.973) * (-744.509) [-742.366] (-746.135) (-738.392) -- 0:00:41
600000 -- [-740.336] (-748.056) (-741.617) (-740.697) * (-748.446) [-745.369] (-742.469) (-748.114) -- 0:00:41
Average standard deviation of split frequencies: 0.005494
600500 -- (-744.762) (-747.214) [-748.086] (-745.906) * (-751.146) (-748.160) [-747.803] (-751.238) -- 0:00:41
601000 -- (-743.635) (-747.990) (-741.035) [-742.002] * (-751.937) (-745.515) (-745.450) [-741.811] -- 0:00:41
601500 -- (-740.190) [-749.520] (-745.804) (-741.628) * (-747.232) (-744.843) (-741.756) [-740.370] -- 0:00:41
602000 -- [-744.011] (-748.203) (-741.803) (-742.334) * [-750.973] (-743.301) (-748.446) (-740.810) -- 0:00:40
602500 -- (-750.874) (-744.294) [-745.424] (-743.266) * [-747.509] (-745.871) (-750.211) (-743.932) -- 0:00:40
603000 -- (-743.126) [-743.914] (-742.838) (-742.291) * (-744.574) (-748.588) (-746.846) [-743.132] -- 0:00:40
603500 -- (-750.033) [-748.526] (-741.506) (-743.221) * [-742.048] (-747.991) (-744.218) (-745.447) -- 0:00:40
604000 -- [-742.989] (-749.594) (-747.131) (-748.533) * (-749.535) [-744.287] (-740.419) (-744.918) -- 0:00:40
604500 -- [-746.636] (-745.272) (-749.657) (-744.428) * (-748.414) (-746.576) (-745.479) [-742.592] -- 0:00:40
605000 -- (-745.751) [-742.939] (-748.517) (-746.460) * (-745.401) (-746.607) [-744.249] (-740.682) -- 0:00:41
Average standard deviation of split frequencies: 0.005056
605500 -- (-746.458) (-746.135) [-745.260] (-741.778) * (-745.537) (-742.801) (-746.453) [-742.892] -- 0:00:41
606000 -- [-748.186] (-742.686) (-746.833) (-744.210) * (-751.595) (-745.466) [-754.352] (-742.535) -- 0:00:40
606500 -- (-752.532) (-743.061) (-745.006) [-743.828] * [-744.289] (-744.286) (-747.747) (-742.200) -- 0:00:40
607000 -- [-751.058] (-742.884) (-740.892) (-746.236) * (-748.648) [-743.916] (-745.818) (-740.944) -- 0:00:40
607500 -- (-742.470) (-748.766) [-740.873] (-742.563) * (-746.276) [-748.523] (-749.401) (-743.879) -- 0:00:40
608000 -- (-747.769) (-747.140) (-747.951) [-745.054] * (-742.531) (-747.346) [-743.782] (-751.006) -- 0:00:40
608500 -- (-744.026) (-748.335) (-740.680) [-745.425] * [-744.873] (-751.035) (-745.574) (-749.356) -- 0:00:40
609000 -- [-744.179] (-743.406) (-748.830) (-743.780) * (-746.425) (-746.306) (-749.168) [-746.763] -- 0:00:40
609500 -- (-743.233) (-744.985) [-749.619] (-741.404) * (-753.752) (-746.594) (-749.328) [-746.393] -- 0:00:40
610000 -- (-745.896) (-742.711) [-745.432] (-744.640) * (-747.233) (-749.748) [-745.505] (-740.620) -- 0:00:40
Average standard deviation of split frequencies: 0.006176
610500 -- (-748.913) (-746.337) (-741.475) [-742.143] * [-744.987] (-744.955) (-741.125) (-742.615) -- 0:00:40
611000 -- (-748.934) (-748.097) [-741.722] (-747.531) * (-740.839) [-744.717] (-747.760) (-743.761) -- 0:00:40
611500 -- (-749.302) (-744.217) [-741.139] (-751.573) * [-745.297] (-743.619) (-739.889) (-744.924) -- 0:00:40
612000 -- [-742.222] (-743.836) (-742.657) (-743.355) * (-753.322) [-742.734] (-747.375) (-745.601) -- 0:00:39
612500 -- (-741.489) [-748.892] (-746.104) (-745.790) * (-749.107) [-742.300] (-743.657) (-742.740) -- 0:00:39
613000 -- (-744.707) [-744.998] (-743.603) (-740.204) * (-748.114) (-743.312) (-743.084) [-745.825] -- 0:00:39
613500 -- (-749.104) [-741.257] (-749.718) (-743.666) * (-744.506) (-744.303) (-755.493) [-745.362] -- 0:00:39
614000 -- (-746.302) (-742.625) (-751.326) [-745.189] * (-742.792) (-748.179) (-745.314) [-740.822] -- 0:00:39
614500 -- (-746.393) [-743.273] (-743.038) (-743.300) * (-755.488) (-751.471) (-743.548) [-740.042] -- 0:00:39
615000 -- (-739.780) (-747.732) [-746.254] (-746.270) * (-745.509) (-742.873) (-741.363) [-744.489] -- 0:00:40
Average standard deviation of split frequencies: 0.006122
615500 -- (-742.452) [-746.167] (-747.346) (-746.340) * (-747.884) [-740.035] (-742.334) (-744.747) -- 0:00:39
616000 -- (-748.376) (-746.314) (-743.843) [-741.856] * (-742.532) (-743.041) (-749.093) [-743.447] -- 0:00:39
616500 -- (-749.413) (-742.095) [-745.939] (-742.723) * (-745.525) (-745.095) [-749.410] (-745.683) -- 0:00:39
617000 -- (-752.963) (-748.907) [-740.909] (-743.592) * (-756.568) (-744.942) [-747.391] (-745.723) -- 0:00:39
617500 -- (-743.906) (-740.864) [-743.103] (-739.188) * (-747.577) (-747.523) (-750.883) [-742.979] -- 0:00:39
618000 -- (-746.350) (-747.739) [-743.336] (-741.930) * [-743.736] (-748.062) (-748.372) (-750.747) -- 0:00:39
618500 -- [-744.615] (-742.601) (-746.998) (-745.924) * (-746.624) [-748.150] (-745.923) (-747.128) -- 0:00:39
619000 -- (-745.085) (-746.793) [-744.059] (-746.270) * [-749.071] (-748.765) (-748.205) (-748.927) -- 0:00:39
619500 -- [-748.815] (-747.478) (-745.576) (-745.088) * (-742.826) (-750.456) (-742.358) [-744.504] -- 0:00:39
620000 -- [-744.112] (-742.777) (-748.462) (-747.089) * (-748.871) [-750.448] (-746.467) (-742.952) -- 0:00:39
Average standard deviation of split frequencies: 0.005696
620500 -- [-747.746] (-741.982) (-747.298) (-743.107) * (-744.733) (-747.166) (-741.141) [-740.034] -- 0:00:39
621000 -- [-742.705] (-752.160) (-744.652) (-744.964) * (-742.018) (-747.663) (-742.357) [-744.655] -- 0:00:39
621500 -- (-741.407) (-746.736) [-742.842] (-741.536) * (-750.352) [-746.307] (-750.865) (-741.357) -- 0:00:38
622000 -- (-747.627) (-742.489) (-746.901) [-745.102] * [-745.995] (-745.861) (-746.992) (-743.613) -- 0:00:38
622500 -- (-748.825) (-746.563) (-745.464) [-748.230] * (-747.477) (-752.122) (-747.162) [-742.379] -- 0:00:38
623000 -- (-746.257) (-751.946) [-741.140] (-756.746) * (-744.273) (-750.114) (-745.705) [-742.466] -- 0:00:38
623500 -- [-741.935] (-748.706) (-745.172) (-745.526) * [-743.063] (-747.374) (-752.486) (-746.322) -- 0:00:38
624000 -- (-741.444) [-749.617] (-740.531) (-746.054) * (-747.582) [-747.990] (-750.130) (-746.262) -- 0:00:38
624500 -- (-751.651) (-749.460) [-743.770] (-749.372) * [-747.861] (-742.785) (-754.826) (-746.806) -- 0:00:39
625000 -- [-740.817] (-745.920) (-749.261) (-747.009) * (-742.532) (-745.615) (-743.193) [-746.971] -- 0:00:39
Average standard deviation of split frequencies: 0.004895
625500 -- [-748.553] (-748.260) (-752.031) (-747.153) * (-741.978) (-745.310) [-750.138] (-745.386) -- 0:00:38
626000 -- (-749.558) (-746.876) (-750.026) [-747.723] * (-751.920) (-750.343) [-741.474] (-746.746) -- 0:00:38
626500 -- (-746.100) (-741.787) [-746.447] (-744.371) * (-745.904) (-750.970) [-743.712] (-744.568) -- 0:00:38
627000 -- (-749.558) (-746.487) [-748.743] (-747.924) * [-748.311] (-743.797) (-747.784) (-750.383) -- 0:00:38
627500 -- (-745.831) (-744.312) [-748.285] (-749.171) * (-745.391) (-744.668) (-741.704) [-744.363] -- 0:00:38
628000 -- (-743.969) (-749.596) [-747.118] (-751.459) * (-746.597) (-748.867) [-742.725] (-746.224) -- 0:00:38
628500 -- [-753.010] (-743.214) (-743.308) (-743.586) * [-743.475] (-747.943) (-741.421) (-753.051) -- 0:00:38
629000 -- (-748.946) (-745.034) [-743.072] (-751.916) * (-746.389) (-740.714) [-741.348] (-746.834) -- 0:00:38
629500 -- (-746.797) (-750.800) (-752.803) [-741.985] * (-742.151) (-748.578) [-741.092] (-747.977) -- 0:00:38
630000 -- (-739.592) (-746.005) [-749.198] (-746.372) * [-743.020] (-745.203) (-745.766) (-742.597) -- 0:00:38
Average standard deviation of split frequencies: 0.005606
630500 -- [-742.350] (-747.311) (-744.174) (-748.072) * (-749.279) (-741.852) (-748.096) [-743.925] -- 0:00:38
631000 -- (-748.459) [-749.937] (-745.109) (-744.912) * (-746.994) (-750.161) [-741.489] (-743.664) -- 0:00:38
631500 -- (-745.734) [-744.643] (-747.863) (-745.135) * (-747.580) [-743.999] (-743.819) (-744.195) -- 0:00:37
632000 -- (-742.774) [-739.398] (-754.520) (-745.422) * (-743.125) (-750.326) (-746.888) [-745.167] -- 0:00:37
632500 -- (-752.042) (-742.152) (-747.525) [-748.866] * (-740.435) (-744.222) [-742.606] (-745.673) -- 0:00:37
633000 -- (-742.170) (-743.761) (-746.526) [-742.173] * (-742.622) (-744.917) [-747.396] (-743.607) -- 0:00:37
633500 -- [-743.727] (-743.366) (-746.640) (-746.215) * [-739.660] (-745.054) (-743.150) (-745.330) -- 0:00:37
634000 -- (-746.903) (-751.578) [-744.673] (-751.393) * [-744.155] (-742.756) (-743.609) (-750.383) -- 0:00:37
634500 -- (-753.192) (-743.794) (-747.447) [-744.648] * (-750.265) (-742.333) (-744.890) [-742.787] -- 0:00:38
635000 -- [-743.249] (-744.671) (-745.089) (-743.355) * (-742.710) (-752.619) [-744.596] (-742.856) -- 0:00:37
Average standard deviation of split frequencies: 0.005930
635500 -- (-744.172) (-747.423) [-746.467] (-739.761) * (-743.043) (-743.421) [-744.948] (-743.180) -- 0:00:37
636000 -- (-743.874) (-748.662) (-742.819) [-752.531] * (-743.521) [-744.228] (-744.841) (-748.110) -- 0:00:37
636500 -- (-743.179) [-744.658] (-749.671) (-742.889) * (-746.261) (-744.658) (-748.113) [-744.206] -- 0:00:37
637000 -- (-744.535) (-748.741) [-743.132] (-747.851) * [-749.288] (-755.084) (-748.257) (-743.827) -- 0:00:37
637500 -- (-743.984) (-746.144) [-746.591] (-751.604) * (-741.059) (-745.287) (-747.915) [-745.399] -- 0:00:37
638000 -- (-745.229) [-749.880] (-743.531) (-753.892) * (-743.900) (-744.795) (-758.035) [-744.626] -- 0:00:37
638500 -- [-741.398] (-748.065) (-742.708) (-745.625) * [-743.246] (-746.935) (-757.567) (-748.275) -- 0:00:37
639000 -- (-742.794) (-750.819) [-743.465] (-742.334) * (-754.453) (-741.853) [-751.747] (-749.669) -- 0:00:37
639500 -- [-740.853] (-750.435) (-746.219) (-743.959) * [-743.337] (-741.350) (-747.333) (-760.960) -- 0:00:37
640000 -- (-750.294) [-749.563] (-748.747) (-742.996) * (-745.661) (-746.132) (-750.048) [-742.494] -- 0:00:37
Average standard deviation of split frequencies: 0.005519
640500 -- (-749.799) (-743.234) (-742.996) [-742.197] * [-742.509] (-742.317) (-753.611) (-746.512) -- 0:00:37
641000 -- [-742.404] (-747.743) (-747.778) (-751.025) * (-745.755) (-743.459) (-748.102) [-745.438] -- 0:00:36
641500 -- (-754.572) [-747.289] (-744.841) (-752.936) * (-744.569) [-740.483] (-749.425) (-750.388) -- 0:00:36
642000 -- (-755.506) (-742.590) [-744.418] (-742.467) * (-743.836) [-746.609] (-749.589) (-747.636) -- 0:00:36
642500 -- (-754.230) (-744.162) (-744.552) [-750.194] * (-746.129) (-745.610) (-741.602) [-743.753] -- 0:00:36
643000 -- (-746.184) (-745.109) (-744.889) [-749.385] * (-744.939) (-742.174) (-740.862) [-743.301] -- 0:00:36
643500 -- (-744.215) (-746.163) [-743.082] (-740.425) * [-748.065] (-745.367) (-748.424) (-742.058) -- 0:00:36
644000 -- (-748.583) (-747.986) [-743.428] (-745.799) * (-746.245) (-744.640) [-742.455] (-745.761) -- 0:00:37
644500 -- (-749.987) (-747.597) (-744.232) [-741.880] * (-745.516) (-745.847) [-740.756] (-744.431) -- 0:00:36
645000 -- (-747.464) [-745.814] (-743.543) (-746.664) * (-751.113) [-746.283] (-749.074) (-746.324) -- 0:00:36
Average standard deviation of split frequencies: 0.005838
645500 -- (-751.415) (-746.710) (-741.325) [-739.225] * (-745.028) (-744.247) [-742.926] (-749.460) -- 0:00:36
646000 -- [-745.319] (-750.366) (-749.189) (-746.903) * (-747.944) [-743.019] (-745.324) (-746.831) -- 0:00:36
646500 -- (-745.010) (-748.024) (-744.561) [-746.870] * (-748.545) [-747.913] (-744.654) (-745.070) -- 0:00:36
647000 -- (-742.395) (-755.914) [-749.340] (-750.111) * (-743.919) (-743.401) [-747.931] (-754.891) -- 0:00:36
647500 -- (-744.290) (-752.936) (-744.808) [-745.354] * (-745.665) (-748.577) [-746.750] (-749.385) -- 0:00:36
648000 -- [-746.168] (-758.376) (-744.720) (-747.178) * (-745.901) [-744.160] (-745.960) (-748.898) -- 0:00:36
648500 -- (-743.644) (-751.795) [-742.235] (-746.988) * (-743.391) (-744.889) (-748.400) [-744.527] -- 0:00:36
649000 -- (-749.955) (-755.045) [-739.893] (-743.185) * (-745.805) [-747.682] (-745.002) (-740.795) -- 0:00:36
649500 -- [-745.643] (-749.334) (-740.076) (-746.980) * [-742.511] (-744.977) (-742.924) (-745.387) -- 0:00:36
650000 -- (-746.046) (-753.349) [-742.822] (-746.171) * (-744.809) (-746.154) [-745.704] (-747.057) -- 0:00:36
Average standard deviation of split frequencies: 0.005434
650500 -- (-749.093) [-744.194] (-749.229) (-753.578) * (-745.710) (-744.185) [-746.869] (-746.354) -- 0:00:35
651000 -- (-754.904) [-743.343] (-747.839) (-743.244) * [-742.859] (-748.620) (-749.327) (-745.557) -- 0:00:35
651500 -- (-756.755) (-742.442) (-746.536) [-748.985] * (-750.079) (-746.429) (-749.975) [-746.609] -- 0:00:35
652000 -- (-743.738) (-740.279) [-741.488] (-753.461) * (-752.320) (-742.256) (-746.928) [-740.690] -- 0:00:35
652500 -- (-750.974) (-746.196) (-741.702) [-745.570] * (-751.894) (-745.396) (-746.656) [-742.165] -- 0:00:35
653000 -- (-747.155) (-742.138) [-743.390] (-745.286) * (-747.638) (-746.173) (-746.189) [-741.154] -- 0:00:35
653500 -- [-745.203] (-746.035) (-750.953) (-748.621) * (-748.211) (-748.026) (-743.772) [-749.219] -- 0:00:35
654000 -- (-748.756) (-746.428) (-748.670) [-747.300] * (-743.047) (-744.000) [-742.971] (-744.201) -- 0:00:35
654500 -- (-754.747) (-749.609) (-756.008) [-740.661] * [-751.349] (-749.137) (-747.299) (-742.389) -- 0:00:35
655000 -- (-741.960) (-749.700) (-751.090) [-748.101] * (-742.574) (-747.771) [-740.188] (-754.465) -- 0:00:35
Average standard deviation of split frequencies: 0.005030
655500 -- [-746.680] (-747.813) (-754.165) (-743.125) * [-747.686] (-752.180) (-744.269) (-753.989) -- 0:00:35
656000 -- (-743.679) (-747.372) [-747.916] (-744.373) * [-747.321] (-749.598) (-750.294) (-743.831) -- 0:00:35
656500 -- (-745.868) (-744.228) (-747.830) [-743.082] * (-750.820) (-748.603) (-750.569) [-746.415] -- 0:00:35
657000 -- (-752.696) [-744.244] (-747.324) (-744.881) * [-744.611] (-753.694) (-747.426) (-745.658) -- 0:00:35
657500 -- (-749.678) (-744.388) (-749.201) [-745.080] * [-739.386] (-761.675) (-746.781) (-747.882) -- 0:00:35
658000 -- (-745.315) (-749.093) [-746.247] (-742.963) * [-740.079] (-752.545) (-745.437) (-747.200) -- 0:00:35
658500 -- [-746.813] (-744.919) (-747.467) (-745.792) * (-741.672) (-747.850) (-746.187) [-751.002] -- 0:00:35
659000 -- (-742.465) (-750.870) (-743.023) [-745.748] * [-746.530] (-747.843) (-742.868) (-744.159) -- 0:00:35
659500 -- (-749.742) [-743.916] (-747.337) (-746.625) * [-745.404] (-749.194) (-750.428) (-743.897) -- 0:00:35
660000 -- (-739.921) (-741.330) [-744.906] (-748.562) * (-749.189) (-744.311) [-747.543] (-746.513) -- 0:00:35
Average standard deviation of split frequencies: 0.005351
660500 -- (-744.460) [-743.368] (-744.102) (-743.872) * (-742.982) [-743.518] (-745.316) (-744.810) -- 0:00:34
661000 -- (-743.231) (-748.879) [-744.289] (-741.100) * (-752.483) (-748.156) [-744.176] (-750.543) -- 0:00:34
661500 -- [-742.248] (-746.250) (-748.725) (-742.332) * (-750.262) [-742.085] (-752.549) (-745.349) -- 0:00:34
662000 -- [-746.782] (-747.521) (-746.993) (-744.179) * [-740.788] (-740.760) (-751.137) (-749.883) -- 0:00:34
662500 -- (-743.926) (-746.494) (-747.679) [-740.976] * (-744.636) [-744.985] (-749.823) (-746.156) -- 0:00:34
663000 -- (-748.475) (-743.632) [-742.361] (-746.577) * [-742.704] (-745.322) (-743.752) (-747.084) -- 0:00:34
663500 -- [-743.431] (-749.368) (-743.326) (-744.671) * [-747.127] (-750.838) (-743.684) (-749.417) -- 0:00:34
664000 -- (-746.577) (-747.894) [-746.123] (-753.215) * (-748.815) (-749.827) (-748.217) [-740.562] -- 0:00:34
664500 -- (-745.669) (-753.162) (-743.103) [-743.892] * (-742.653) [-751.815] (-749.607) (-745.299) -- 0:00:34
665000 -- [-746.089] (-742.175) (-742.008) (-747.158) * [-745.826] (-748.422) (-748.346) (-747.398) -- 0:00:34
Average standard deviation of split frequencies: 0.005309
665500 -- (-742.046) (-748.066) [-745.029] (-743.425) * [-743.888] (-743.820) (-743.341) (-750.377) -- 0:00:34
666000 -- (-746.614) [-745.514] (-746.626) (-748.101) * (-744.675) (-745.878) (-750.116) [-747.875] -- 0:00:34
666500 -- [-743.266] (-749.074) (-748.272) (-753.833) * [-743.617] (-746.600) (-750.007) (-743.824) -- 0:00:34
667000 -- (-745.322) (-744.650) (-745.218) [-744.055] * [-743.868] (-753.544) (-748.182) (-754.049) -- 0:00:34
667500 -- (-743.432) [-747.526] (-744.952) (-748.985) * (-747.297) [-746.714] (-746.206) (-756.631) -- 0:00:34
668000 -- (-742.071) (-747.072) [-744.276] (-749.719) * [-743.927] (-744.483) (-752.335) (-744.914) -- 0:00:34
668500 -- (-749.973) (-745.537) [-745.088] (-749.747) * (-743.988) (-747.265) [-743.469] (-745.121) -- 0:00:34
669000 -- (-743.083) (-743.551) (-743.886) [-745.434] * [-746.796] (-749.161) (-740.380) (-747.805) -- 0:00:34
669500 -- (-751.847) [-743.160] (-747.581) (-750.212) * (-744.531) [-741.185] (-745.407) (-749.031) -- 0:00:34
670000 -- (-750.429) [-742.230] (-745.161) (-758.219) * (-741.473) (-745.166) (-752.454) [-748.007] -- 0:00:33
Average standard deviation of split frequencies: 0.005623
670500 -- (-752.094) (-748.777) [-745.837] (-747.453) * (-742.875) [-747.884] (-760.301) (-752.600) -- 0:00:33
671000 -- (-744.852) (-751.932) (-746.994) [-746.399] * (-743.621) (-744.798) [-746.870] (-749.981) -- 0:00:33
671500 -- (-748.610) (-750.526) (-752.292) [-747.424] * [-746.680] (-744.827) (-746.836) (-758.094) -- 0:00:33
672000 -- [-749.006] (-748.303) (-746.674) (-740.401) * (-744.836) [-741.907] (-750.386) (-744.196) -- 0:00:33
672500 -- (-748.150) (-745.324) [-745.348] (-745.107) * [-746.229] (-746.978) (-750.548) (-746.478) -- 0:00:33
673000 -- (-745.387) (-744.423) (-743.422) [-746.942] * [-745.660] (-743.550) (-747.512) (-749.973) -- 0:00:33
673500 -- [-747.573] (-743.939) (-742.711) (-747.389) * (-751.101) [-747.471] (-751.855) (-748.355) -- 0:00:33
674000 -- (-747.062) (-743.184) [-744.698] (-744.646) * (-745.914) (-743.874) [-745.173] (-749.177) -- 0:00:33
674500 -- (-745.190) (-744.505) (-744.993) [-742.556] * (-746.890) (-742.807) [-746.165] (-753.235) -- 0:00:33
675000 -- (-746.564) [-741.110] (-743.330) (-739.955) * [-741.965] (-746.871) (-755.455) (-747.294) -- 0:00:33
Average standard deviation of split frequencies: 0.007903
675500 -- (-751.700) (-742.273) (-745.872) [-740.681] * [-744.290] (-747.174) (-751.746) (-751.922) -- 0:00:33
676000 -- (-745.190) (-741.592) (-742.078) [-743.112] * (-747.485) (-744.923) (-746.942) [-744.909] -- 0:00:33
676500 -- (-747.845) (-742.738) (-747.223) [-745.888] * [-744.493] (-750.416) (-750.034) (-749.957) -- 0:00:33
677000 -- (-744.400) (-740.406) [-743.013] (-745.764) * (-749.027) [-742.607] (-750.800) (-746.910) -- 0:00:33
677500 -- (-749.277) (-743.940) [-748.088] (-743.830) * (-749.259) (-744.666) (-744.594) [-751.439] -- 0:00:33
678000 -- [-746.776] (-741.979) (-747.404) (-748.466) * (-744.363) (-749.739) (-748.565) [-746.931] -- 0:00:33
678500 -- (-748.656) (-744.514) [-746.568] (-756.861) * (-740.411) (-744.397) (-745.031) [-745.093] -- 0:00:33
679000 -- (-750.143) [-741.087] (-746.673) (-743.182) * [-745.796] (-749.667) (-748.811) (-747.239) -- 0:00:33
679500 -- (-750.186) [-741.538] (-742.116) (-744.399) * (-747.663) [-745.363] (-748.549) (-747.492) -- 0:00:33
680000 -- [-746.552] (-745.832) (-750.316) (-744.050) * [-746.950] (-748.890) (-744.155) (-742.550) -- 0:00:32
Average standard deviation of split frequencies: 0.005194
680500 -- (-751.537) (-743.057) (-751.879) [-744.598] * (-745.241) (-747.636) (-746.633) [-747.776] -- 0:00:32
681000 -- (-745.122) (-752.838) [-748.126] (-743.923) * [-742.966] (-749.712) (-743.970) (-744.748) -- 0:00:32
681500 -- (-743.690) (-749.106) [-744.135] (-743.786) * (-742.472) [-745.127] (-747.586) (-745.202) -- 0:00:32
682000 -- (-745.833) (-746.917) [-742.902] (-745.867) * (-745.844) (-750.800) [-746.693] (-743.628) -- 0:00:32
682500 -- (-745.260) (-742.568) (-747.674) [-746.459] * (-746.981) (-745.420) (-742.571) [-745.448] -- 0:00:32
683000 -- [-747.433] (-751.582) (-745.018) (-749.970) * [-743.346] (-743.579) (-739.374) (-749.092) -- 0:00:32
683500 -- (-743.914) (-745.104) (-750.639) [-744.437] * [-745.158] (-747.669) (-741.039) (-746.721) -- 0:00:32
684000 -- [-744.667] (-744.119) (-755.502) (-751.219) * (-746.584) (-745.123) (-748.993) [-748.038] -- 0:00:32
684500 -- [-742.179] (-744.835) (-749.748) (-745.778) * [-741.880] (-743.243) (-747.879) (-743.025) -- 0:00:32
685000 -- (-745.031) (-749.717) [-744.872] (-748.386) * (-745.431) (-743.753) [-745.799] (-747.676) -- 0:00:32
Average standard deviation of split frequencies: 0.005154
685500 -- (-752.613) [-745.909] (-742.575) (-744.536) * [-747.672] (-741.222) (-747.128) (-744.683) -- 0:00:32
686000 -- [-744.142] (-741.362) (-745.306) (-745.174) * (-743.882) (-742.701) (-740.383) [-747.366] -- 0:00:32
686500 -- (-742.963) [-747.408] (-745.127) (-749.728) * (-745.140) (-746.519) (-744.351) [-753.289] -- 0:00:32
687000 -- (-749.570) [-742.654] (-747.270) (-744.923) * (-752.764) [-743.349] (-741.790) (-750.072) -- 0:00:32
687500 -- (-750.749) (-741.818) (-745.150) [-753.497] * (-748.653) [-744.674] (-748.438) (-749.084) -- 0:00:32
688000 -- (-740.808) (-744.815) (-747.194) [-748.830] * (-752.219) [-746.669] (-750.034) (-742.989) -- 0:00:32
688500 -- (-743.164) (-744.217) [-742.686] (-746.972) * (-755.304) (-751.185) [-748.806] (-745.738) -- 0:00:32
689000 -- [-744.969] (-746.354) (-745.044) (-750.873) * (-747.747) (-744.878) [-741.554] (-748.342) -- 0:00:32
689500 -- [-743.040] (-749.653) (-751.826) (-747.903) * (-756.082) [-738.967] (-746.013) (-744.104) -- 0:00:31
690000 -- (-747.768) (-751.486) (-744.064) [-744.307] * (-748.928) (-744.065) (-747.280) [-746.661] -- 0:00:31
Average standard deviation of split frequencies: 0.004778
690500 -- [-742.304] (-744.250) (-740.353) (-746.758) * [-748.255] (-745.176) (-745.762) (-745.438) -- 0:00:31
691000 -- (-744.112) [-746.848] (-748.104) (-740.957) * (-748.448) [-742.778] (-748.035) (-745.805) -- 0:00:31
691500 -- [-745.003] (-742.427) (-744.174) (-749.067) * (-743.239) [-742.225] (-746.472) (-748.724) -- 0:00:31
692000 -- (-740.558) [-748.538] (-746.905) (-746.461) * (-751.009) (-740.681) [-749.558] (-745.300) -- 0:00:31
692500 -- [-747.240] (-748.324) (-742.112) (-745.704) * (-746.336) [-742.786] (-747.662) (-741.251) -- 0:00:31
693000 -- (-751.369) [-742.216] (-748.378) (-747.192) * (-747.446) (-740.996) (-751.139) [-743.630] -- 0:00:31
693500 -- (-741.902) (-751.004) [-749.519] (-747.655) * (-743.257) [-749.879] (-746.454) (-744.165) -- 0:00:31
694000 -- (-745.735) (-754.253) (-749.347) [-745.034] * [-749.935] (-746.052) (-747.063) (-749.081) -- 0:00:31
694500 -- (-743.137) (-746.356) (-750.291) [-742.918] * (-746.189) [-742.663] (-742.653) (-745.093) -- 0:00:31
695000 -- (-745.921) [-746.651] (-750.157) (-745.721) * (-750.498) (-748.636) (-744.117) [-745.633] -- 0:00:31
Average standard deviation of split frequencies: 0.004741
695500 -- [-747.004] (-752.222) (-748.097) (-742.061) * (-745.812) (-747.039) [-744.218] (-746.933) -- 0:00:31
696000 -- [-744.504] (-744.825) (-746.254) (-745.492) * (-744.552) (-749.111) (-752.077) [-740.716] -- 0:00:31
696500 -- (-745.091) (-747.918) [-746.090] (-748.406) * (-750.684) (-749.487) [-739.774] (-743.559) -- 0:00:31
697000 -- (-741.899) (-753.206) [-747.585] (-745.959) * [-741.804] (-742.294) (-745.188) (-750.746) -- 0:00:31
697500 -- (-743.881) (-741.449) [-745.435] (-747.777) * [-742.474] (-742.238) (-749.378) (-742.604) -- 0:00:31
698000 -- (-738.822) (-746.028) [-749.784] (-741.442) * (-739.530) (-743.017) (-747.687) [-742.795] -- 0:00:31
698500 -- (-745.517) [-744.806] (-747.282) (-747.387) * [-744.869] (-752.859) (-746.248) (-743.391) -- 0:00:31
699000 -- (-747.022) [-744.529] (-751.249) (-746.668) * (-749.462) [-751.722] (-749.766) (-746.607) -- 0:00:31
699500 -- (-752.572) (-743.952) (-745.892) [-747.810] * (-745.261) (-745.091) (-747.009) [-747.993] -- 0:00:30
700000 -- [-750.443] (-741.910) (-746.790) (-744.944) * [-751.562] (-745.793) (-750.347) (-750.211) -- 0:00:30
Average standard deviation of split frequencies: 0.006728
700500 -- (-748.027) (-750.023) (-743.652) [-744.053] * [-746.192] (-745.101) (-749.961) (-747.360) -- 0:00:30
701000 -- [-747.352] (-748.972) (-749.921) (-746.760) * (-749.684) (-744.214) (-741.758) [-750.699] -- 0:00:30
701500 -- (-744.919) [-752.283] (-741.337) (-750.906) * (-744.781) (-744.773) [-747.826] (-755.190) -- 0:00:30
702000 -- [-746.012] (-749.066) (-747.546) (-745.993) * [-742.481] (-743.963) (-743.003) (-742.178) -- 0:00:30
702500 -- (-745.923) [-744.755] (-749.440) (-744.506) * [-741.615] (-744.731) (-748.947) (-748.333) -- 0:00:30
703000 -- (-743.639) [-741.947] (-747.360) (-748.901) * (-742.366) [-743.906] (-746.347) (-747.125) -- 0:00:30
703500 -- (-741.447) (-747.009) [-746.382] (-753.308) * [-746.024] (-742.639) (-742.751) (-755.365) -- 0:00:30
704000 -- [-742.667] (-743.374) (-749.084) (-743.818) * [-747.179] (-748.549) (-749.408) (-746.436) -- 0:00:30
704500 -- (-746.190) (-742.679) (-754.347) [-743.168] * (-745.725) [-748.759] (-746.655) (-745.029) -- 0:00:30
705000 -- (-747.556) [-740.103] (-747.919) (-741.704) * (-746.641) (-749.006) (-741.206) [-750.267] -- 0:00:30
Average standard deviation of split frequencies: 0.006232
705500 -- (-745.715) [-744.529] (-754.524) (-744.744) * [-742.095] (-748.359) (-747.395) (-743.404) -- 0:00:30
706000 -- (-749.156) (-745.882) (-751.839) [-744.324] * (-743.478) (-748.555) [-744.629] (-743.377) -- 0:00:30
706500 -- (-745.785) (-741.308) (-745.753) [-739.253] * (-741.572) (-746.702) (-743.110) [-742.331] -- 0:00:30
707000 -- (-750.578) (-743.474) (-746.054) [-741.344] * (-746.411) [-747.308] (-744.627) (-748.167) -- 0:00:30
707500 -- (-743.193) (-748.464) (-749.643) [-741.907] * (-744.136) (-741.532) (-748.099) [-746.570] -- 0:00:30
708000 -- [-748.198] (-745.392) (-750.670) (-743.656) * [-745.673] (-746.365) (-745.458) (-746.391) -- 0:00:30
708500 -- [-747.602] (-742.552) (-748.758) (-745.922) * (-745.668) [-742.198] (-742.602) (-744.334) -- 0:00:30
709000 -- (-745.060) (-744.972) (-745.927) [-747.882] * (-741.831) (-745.152) [-746.978] (-748.475) -- 0:00:29
709500 -- (-742.775) (-743.637) (-746.925) [-745.726] * (-743.974) (-740.670) (-749.020) [-748.791] -- 0:00:29
710000 -- (-745.505) (-747.902) [-750.095] (-744.293) * [-747.615] (-745.330) (-746.732) (-749.048) -- 0:00:29
Average standard deviation of split frequencies: 0.006191
710500 -- (-740.936) (-757.082) [-744.574] (-747.216) * (-742.699) (-743.369) [-741.760] (-749.583) -- 0:00:29
711000 -- [-744.528] (-751.589) (-742.787) (-742.773) * (-746.418) [-744.873] (-747.208) (-748.792) -- 0:00:29
711500 -- (-747.320) (-748.011) [-749.861] (-742.360) * (-752.793) (-743.490) [-744.059] (-749.668) -- 0:00:29
712000 -- (-747.656) (-752.616) (-748.185) [-740.978] * [-747.417] (-744.003) (-744.406) (-745.115) -- 0:00:29
712500 -- (-744.611) (-748.078) [-741.072] (-748.306) * [-743.196] (-750.232) (-747.504) (-746.545) -- 0:00:29
713000 -- (-744.348) [-745.110] (-743.866) (-748.509) * (-740.360) (-746.143) [-745.763] (-744.107) -- 0:00:29
713500 -- (-742.938) (-743.664) [-739.603] (-749.783) * (-750.323) [-743.076] (-748.334) (-746.086) -- 0:00:29
714000 -- (-749.506) (-744.996) [-745.259] (-755.530) * [-742.218] (-754.727) (-748.915) (-745.922) -- 0:00:29
714500 -- (-752.176) (-748.247) [-747.525] (-750.201) * [-741.783] (-748.687) (-749.635) (-741.421) -- 0:00:29
715000 -- [-749.840] (-746.606) (-748.865) (-750.652) * (-740.451) [-745.976] (-744.368) (-741.594) -- 0:00:29
Average standard deviation of split frequencies: 0.004609
715500 -- [-744.323] (-746.005) (-741.392) (-753.957) * (-743.718) (-754.936) (-742.896) [-745.922] -- 0:00:29
716000 -- (-744.496) [-745.745] (-748.264) (-749.302) * (-745.831) (-749.097) (-744.851) [-743.582] -- 0:00:29
716500 -- (-749.813) (-741.156) [-744.074] (-756.109) * (-743.444) (-750.608) [-744.605] (-743.493) -- 0:00:29
717000 -- [-747.013] (-743.914) (-745.026) (-755.183) * (-745.407) (-745.727) (-743.081) [-750.417] -- 0:00:29
717500 -- (-748.268) [-742.653] (-742.158) (-746.546) * (-746.277) [-745.917] (-754.391) (-742.820) -- 0:00:29
718000 -- [-746.198] (-745.841) (-744.553) (-747.624) * [-758.319] (-746.302) (-751.802) (-750.599) -- 0:00:29
718500 -- (-743.254) (-743.744) [-740.758] (-751.405) * (-742.749) (-746.138) [-744.792] (-747.127) -- 0:00:28
719000 -- (-745.808) (-745.221) [-744.300] (-743.166) * (-745.046) (-752.373) [-744.615] (-749.749) -- 0:00:28
719500 -- (-747.829) (-745.926) [-747.044] (-743.737) * (-742.867) (-747.261) [-748.254] (-747.968) -- 0:00:28
720000 -- [-751.953] (-744.333) (-747.964) (-748.760) * [-741.296] (-743.788) (-747.617) (-746.842) -- 0:00:28
Average standard deviation of split frequencies: 0.004252
720500 -- (-742.700) (-747.769) (-748.002) [-744.983] * (-753.285) (-741.079) [-746.603] (-741.413) -- 0:00:28
721000 -- [-744.113] (-748.761) (-744.046) (-746.884) * (-744.918) (-746.577) (-744.711) [-747.588] -- 0:00:28
721500 -- (-748.370) (-746.140) [-743.538] (-755.861) * (-747.916) (-747.821) (-753.756) [-743.338] -- 0:00:28
722000 -- [-746.775] (-749.346) (-746.717) (-744.925) * (-745.023) (-747.111) (-747.833) [-744.103] -- 0:00:28
722500 -- (-746.997) [-742.134] (-747.388) (-748.501) * (-744.678) (-744.503) [-749.205] (-744.519) -- 0:00:28
723000 -- (-746.622) (-744.845) (-750.361) [-750.523] * (-751.353) (-743.183) (-747.925) [-743.135] -- 0:00:28
723500 -- (-742.301) (-746.233) [-744.017] (-746.856) * (-754.734) [-743.327] (-744.082) (-741.012) -- 0:00:28
724000 -- (-747.469) (-743.953) [-747.136] (-743.555) * (-750.090) (-746.348) (-744.174) [-741.271] -- 0:00:28
724500 -- (-745.783) [-742.185] (-752.118) (-751.230) * (-760.394) [-743.730] (-750.255) (-746.662) -- 0:00:28
725000 -- (-745.711) [-739.670] (-743.982) (-744.564) * (-754.916) (-748.188) [-745.447] (-742.061) -- 0:00:28
Average standard deviation of split frequencies: 0.003896
725500 -- (-747.058) (-749.508) (-748.920) [-748.283] * (-756.656) (-744.388) (-747.563) [-743.415] -- 0:00:28
726000 -- (-745.921) (-741.803) (-741.459) [-743.602] * (-750.416) (-743.558) (-750.786) [-741.089] -- 0:00:28
726500 -- (-743.452) (-745.772) [-743.702] (-745.771) * [-743.430] (-741.986) (-744.118) (-745.266) -- 0:00:28
727000 -- [-746.638] (-745.460) (-745.724) (-741.096) * (-748.789) [-743.234] (-752.440) (-745.151) -- 0:00:28
727500 -- [-744.943] (-741.449) (-751.334) (-742.361) * (-748.496) [-750.386] (-751.095) (-742.895) -- 0:00:28
728000 -- [-743.037] (-742.449) (-749.171) (-742.817) * [-741.678] (-744.374) (-748.114) (-745.121) -- 0:00:28
728500 -- [-742.124] (-744.464) (-747.843) (-746.740) * [-740.855] (-742.333) (-744.121) (-743.638) -- 0:00:27
729000 -- (-744.688) (-743.778) (-748.107) [-746.583] * [-741.173] (-748.338) (-744.635) (-741.844) -- 0:00:27
729500 -- (-758.026) (-741.948) [-749.268] (-748.091) * (-746.937) [-745.911] (-751.985) (-755.898) -- 0:00:27
730000 -- (-749.741) (-742.953) (-742.741) [-750.484] * [-747.221] (-751.119) (-742.874) (-750.614) -- 0:00:27
Average standard deviation of split frequencies: 0.003871
730500 -- (-750.439) (-746.478) [-744.422] (-740.607) * [-743.957] (-748.246) (-741.931) (-745.761) -- 0:00:27
731000 -- (-748.754) [-742.746] (-747.097) (-743.434) * (-743.380) (-744.482) (-742.910) [-746.140] -- 0:00:27
731500 -- (-743.171) (-745.925) (-743.119) [-743.664] * (-747.761) [-739.927] (-748.591) (-745.998) -- 0:00:27
732000 -- (-747.666) (-746.724) (-747.910) [-750.182] * (-747.910) [-745.970] (-744.878) (-754.597) -- 0:00:27
732500 -- (-745.529) [-749.245] (-748.564) (-744.232) * [-747.136] (-744.858) (-747.378) (-741.757) -- 0:00:27
733000 -- [-745.028] (-748.971) (-751.164) (-744.792) * (-747.657) (-746.338) [-745.930] (-746.295) -- 0:00:27
733500 -- (-747.492) (-751.761) (-753.287) [-744.903] * (-749.222) (-744.578) [-746.123] (-748.807) -- 0:00:27
734000 -- (-744.136) (-761.894) (-749.179) [-745.071] * [-748.652] (-742.724) (-745.057) (-742.685) -- 0:00:27
734500 -- [-739.499] (-753.954) (-744.430) (-746.245) * (-748.953) [-744.996] (-749.132) (-750.985) -- 0:00:27
735000 -- (-743.965) (-745.594) [-748.651] (-760.057) * (-739.952) (-748.334) (-747.856) [-746.224] -- 0:00:27
Average standard deviation of split frequencies: 0.004163
735500 -- (-743.245) [-746.399] (-748.602) (-746.126) * (-756.238) [-747.004] (-750.378) (-742.376) -- 0:00:27
736000 -- [-741.578] (-747.056) (-748.687) (-746.702) * (-742.654) (-744.137) [-750.795] (-747.246) -- 0:00:27
736500 -- [-743.383] (-748.028) (-746.384) (-744.778) * (-746.332) [-749.794] (-743.255) (-751.800) -- 0:00:27
737000 -- (-748.426) (-745.837) (-755.942) [-742.030] * [-743.072] (-752.537) (-751.637) (-746.684) -- 0:00:27
737500 -- (-742.868) (-743.663) (-748.428) [-740.901] * (-739.954) (-750.635) (-752.822) [-744.112] -- 0:00:27
738000 -- (-742.452) [-747.008] (-743.467) (-747.975) * [-740.946] (-747.791) (-745.466) (-746.730) -- 0:00:26
738500 -- (-740.922) [-741.059] (-749.753) (-746.125) * (-747.533) (-750.157) (-747.487) [-742.097] -- 0:00:26
739000 -- (-743.269) (-750.937) [-744.476] (-750.554) * (-744.120) (-756.292) (-746.421) [-750.102] -- 0:00:26
739500 -- (-743.989) [-747.262] (-743.261) (-754.882) * (-742.555) (-745.850) (-745.836) [-750.284] -- 0:00:26
740000 -- (-744.225) [-742.938] (-744.361) (-744.976) * (-744.767) (-742.363) (-743.449) [-744.867] -- 0:00:26
Average standard deviation of split frequencies: 0.003819
740500 -- (-742.388) [-743.095] (-750.339) (-742.778) * [-744.677] (-743.673) (-745.188) (-752.053) -- 0:00:26
741000 -- [-743.396] (-747.359) (-749.962) (-741.738) * [-743.252] (-750.802) (-749.955) (-743.427) -- 0:00:26
741500 -- [-751.387] (-742.584) (-748.171) (-745.977) * [-745.423] (-752.830) (-742.138) (-745.113) -- 0:00:26
742000 -- [-747.301] (-751.630) (-746.156) (-744.368) * (-751.664) (-753.862) [-742.546] (-744.951) -- 0:00:26
742500 -- [-747.931] (-748.541) (-744.539) (-749.640) * (-745.740) (-747.449) [-741.834] (-749.514) -- 0:00:26
743000 -- (-746.544) (-747.181) [-742.454] (-749.081) * [-742.622] (-747.097) (-744.649) (-744.194) -- 0:00:26
743500 -- (-746.332) (-745.143) (-745.139) [-749.737] * (-744.419) (-749.311) (-746.260) [-742.164] -- 0:00:26
744000 -- (-745.217) (-744.358) [-740.988] (-752.512) * (-740.106) (-750.396) [-747.651] (-744.403) -- 0:00:26
744500 -- [-743.824] (-746.597) (-739.337) (-751.426) * (-742.594) (-744.577) [-742.621] (-742.488) -- 0:00:26
745000 -- (-746.279) [-745.052] (-750.691) (-752.179) * (-749.162) (-746.882) (-743.465) [-743.642] -- 0:00:26
Average standard deviation of split frequencies: 0.003160
745500 -- (-748.378) (-741.980) (-740.638) [-744.057] * (-745.993) [-744.082] (-744.275) (-750.023) -- 0:00:26
746000 -- (-749.379) (-745.080) [-742.260] (-749.140) * (-746.754) [-745.542] (-745.703) (-746.187) -- 0:00:26
746500 -- (-748.023) [-746.998] (-752.125) (-745.765) * [-743.667] (-740.722) (-746.256) (-747.986) -- 0:00:26
747000 -- [-747.642] (-748.241) (-743.972) (-743.686) * (-744.104) (-746.218) [-746.543] (-751.455) -- 0:00:26
747500 -- (-749.551) [-745.136] (-745.206) (-747.420) * [-746.495] (-744.129) (-758.615) (-746.367) -- 0:00:26
748000 -- (-743.600) [-745.179] (-751.052) (-745.078) * (-745.935) (-751.183) (-743.817) [-742.948] -- 0:00:25
748500 -- (-744.269) [-746.047] (-749.070) (-747.029) * (-747.333) (-746.014) [-742.883] (-744.296) -- 0:00:25
749000 -- (-753.016) (-747.648) [-748.512] (-745.953) * (-751.513) (-751.328) (-746.283) [-753.680] -- 0:00:25
749500 -- (-745.091) [-746.545] (-746.139) (-746.385) * (-745.926) (-748.102) [-749.063] (-751.718) -- 0:00:25
750000 -- (-743.919) (-749.865) (-746.372) [-751.259] * (-744.565) [-746.109] (-748.169) (-752.944) -- 0:00:25
Average standard deviation of split frequencies: 0.002198
750500 -- (-744.206) (-750.205) (-751.227) [-745.068] * (-746.827) [-748.530] (-746.700) (-744.083) -- 0:00:25
751000 -- (-743.067) (-750.528) (-745.208) [-742.895] * [-746.886] (-745.693) (-747.653) (-743.911) -- 0:00:25
751500 -- (-747.546) [-745.252] (-740.524) (-741.181) * (-747.884) (-746.070) [-739.468] (-746.317) -- 0:00:25
752000 -- [-747.458] (-748.118) (-749.901) (-742.589) * [-741.991] (-747.000) (-743.581) (-746.181) -- 0:00:25
752500 -- [-741.250] (-742.241) (-745.193) (-753.045) * [-747.744] (-745.384) (-745.357) (-744.193) -- 0:00:25
753000 -- (-743.245) (-747.766) (-747.786) [-744.080] * (-747.642) [-743.699] (-749.289) (-745.449) -- 0:00:25
753500 -- (-750.056) [-743.194] (-742.790) (-749.795) * (-742.647) (-749.639) (-747.194) [-745.355] -- 0:00:25
754000 -- (-749.414) [-740.285] (-746.252) (-743.501) * (-744.071) (-742.229) (-750.300) [-743.834] -- 0:00:25
754500 -- (-739.700) [-745.629] (-743.308) (-749.803) * [-744.938] (-746.757) (-754.647) (-742.449) -- 0:00:25
755000 -- (-741.880) (-752.673) (-744.011) [-747.217] * (-744.621) (-757.897) [-749.228] (-746.160) -- 0:00:25
Average standard deviation of split frequencies: 0.002182
755500 -- [-746.912] (-747.535) (-749.407) (-749.434) * (-745.626) (-744.847) (-751.948) [-746.795] -- 0:00:25
756000 -- (-743.648) (-747.160) [-748.019] (-750.093) * (-749.310) (-745.378) [-743.565] (-748.455) -- 0:00:25
756500 -- (-749.246) (-748.521) [-748.733] (-748.139) * (-749.298) [-750.114] (-749.038) (-743.813) -- 0:00:25
757000 -- (-743.733) (-751.784) [-744.689] (-755.677) * (-743.765) (-754.128) (-742.659) [-740.399] -- 0:00:25
757500 -- [-741.822] (-750.232) (-744.260) (-764.319) * (-749.363) (-751.372) [-740.718] (-744.683) -- 0:00:24
758000 -- (-743.563) (-751.235) [-750.169] (-753.126) * (-751.847) (-748.929) [-743.807] (-744.243) -- 0:00:24
758500 -- (-747.413) (-753.569) (-747.693) [-745.080] * (-748.963) (-746.370) (-747.555) [-743.742] -- 0:00:24
759000 -- (-742.229) (-747.158) (-745.031) [-748.797] * (-745.046) [-745.263] (-744.607) (-748.107) -- 0:00:24
759500 -- (-747.002) (-746.260) [-743.428] (-742.175) * (-747.022) (-744.384) (-748.778) [-743.987] -- 0:00:24
760000 -- [-743.556] (-748.999) (-745.865) (-742.641) * [-745.403] (-744.153) (-753.858) (-742.109) -- 0:00:24
Average standard deviation of split frequencies: 0.001549
760500 -- (-745.774) [-743.699] (-749.331) (-755.581) * [-741.852] (-742.555) (-754.908) (-745.288) -- 0:00:24
761000 -- (-744.932) (-746.715) (-745.755) [-746.459] * (-747.499) (-744.786) [-741.612] (-743.757) -- 0:00:24
761500 -- (-750.171) (-749.174) [-745.861] (-742.801) * (-747.371) (-745.978) [-746.378] (-743.260) -- 0:00:24
762000 -- (-744.882) [-743.057] (-753.465) (-742.432) * [-753.212] (-746.005) (-743.430) (-742.540) -- 0:00:24
762500 -- (-744.839) [-740.839] (-751.932) (-743.471) * (-750.841) (-745.601) [-743.899] (-748.397) -- 0:00:24
763000 -- [-742.978] (-750.664) (-748.648) (-743.046) * (-749.608) (-757.319) (-741.012) [-740.025] -- 0:00:24
763500 -- (-748.498) (-745.601) [-742.649] (-743.204) * (-743.694) (-743.966) [-744.259] (-742.819) -- 0:00:24
764000 -- (-743.262) (-747.809) (-746.641) [-743.591] * (-743.961) (-747.080) (-741.436) [-742.990] -- 0:00:24
764500 -- (-744.968) (-743.816) [-744.997] (-746.486) * [-745.593] (-748.007) (-742.093) (-744.091) -- 0:00:24
765000 -- [-746.200] (-746.679) (-746.855) (-742.159) * (-744.139) [-746.345] (-741.037) (-747.284) -- 0:00:24
Average standard deviation of split frequencies: 0.001846
765500 -- (-745.754) (-743.544) (-756.003) [-747.800] * (-748.158) [-744.873] (-751.206) (-746.405) -- 0:00:24
766000 -- (-748.898) (-751.064) (-750.917) [-745.566] * [-740.772] (-743.838) (-745.985) (-740.891) -- 0:00:24
766500 -- (-752.631) [-748.028] (-750.040) (-741.588) * (-749.709) (-747.754) [-745.877] (-746.400) -- 0:00:24
767000 -- (-749.152) [-745.166] (-750.699) (-744.909) * (-743.923) [-745.275] (-745.885) (-743.359) -- 0:00:23
767500 -- (-743.790) [-745.043] (-750.020) (-745.291) * (-751.913) (-745.919) [-744.132] (-754.309) -- 0:00:23
768000 -- (-747.598) [-742.414] (-742.212) (-744.783) * (-751.944) [-745.458] (-745.051) (-746.714) -- 0:00:23
768500 -- (-748.539) (-745.069) (-746.613) [-741.093] * (-749.870) (-742.652) [-746.289] (-744.258) -- 0:00:23
769000 -- [-745.499] (-751.973) (-750.648) (-747.046) * [-754.986] (-747.166) (-745.152) (-743.741) -- 0:00:23
769500 -- [-747.874] (-745.995) (-748.126) (-747.987) * (-746.523) (-750.013) (-746.532) [-742.917] -- 0:00:23
770000 -- (-747.139) (-746.171) (-748.250) [-747.021] * (-745.168) (-746.908) [-743.039] (-749.081) -- 0:00:23
Average standard deviation of split frequencies: 0.001529
770500 -- (-747.255) [-745.119] (-745.862) (-748.285) * [-741.247] (-752.389) (-745.557) (-745.472) -- 0:00:23
771000 -- (-750.434) [-750.784] (-745.283) (-748.829) * (-745.162) (-748.099) (-751.038) [-742.308] -- 0:00:23
771500 -- (-744.722) [-752.336] (-740.429) (-751.038) * (-748.001) (-750.475) [-743.018] (-743.608) -- 0:00:23
772000 -- [-750.927] (-750.740) (-749.529) (-748.607) * (-747.621) (-753.491) (-743.687) [-744.983] -- 0:00:23
772500 -- (-748.455) (-745.746) (-756.970) [-742.960] * (-751.269) [-743.515] (-745.516) (-743.353) -- 0:00:23
773000 -- (-750.418) (-742.203) [-754.408] (-743.590) * (-746.879) [-744.622] (-740.576) (-751.426) -- 0:00:23
773500 -- [-742.502] (-744.534) (-751.158) (-745.264) * [-742.027] (-752.552) (-745.334) (-743.287) -- 0:00:23
774000 -- (-743.908) [-746.242] (-741.563) (-745.448) * [-747.194] (-747.371) (-750.196) (-746.101) -- 0:00:23
774500 -- [-746.475] (-744.114) (-741.400) (-747.566) * [-750.767] (-744.672) (-749.174) (-745.546) -- 0:00:23
775000 -- (-749.499) [-747.909] (-747.440) (-743.398) * (-741.649) (-750.570) (-744.589) [-750.618] -- 0:00:23
Average standard deviation of split frequencies: 0.002430
775500 -- [-745.641] (-742.151) (-744.235) (-746.002) * (-753.197) [-749.892] (-749.216) (-752.084) -- 0:00:23
776000 -- (-762.006) (-748.554) (-743.412) [-744.094] * (-742.553) [-751.483] (-745.192) (-751.597) -- 0:00:23
776500 -- [-747.286] (-743.859) (-747.084) (-745.778) * (-748.954) [-749.123] (-743.913) (-751.876) -- 0:00:23
777000 -- (-752.029) [-742.065] (-746.211) (-747.011) * (-746.888) (-744.868) [-743.167] (-752.983) -- 0:00:22
777500 -- (-747.616) (-746.555) [-746.108] (-754.245) * (-747.562) (-746.001) (-745.903) [-745.477] -- 0:00:22
778000 -- (-745.188) (-743.321) (-744.451) [-743.510] * (-744.883) (-748.242) (-754.302) [-742.416] -- 0:00:22
778500 -- (-754.138) (-743.096) (-747.421) [-741.811] * (-746.750) (-747.417) (-744.988) [-744.133] -- 0:00:22
779000 -- [-744.105] (-741.676) (-744.591) (-749.868) * (-745.007) (-743.632) (-754.090) [-745.219] -- 0:00:22
779500 -- [-745.278] (-742.117) (-743.087) (-748.047) * [-746.784] (-745.463) (-744.351) (-742.862) -- 0:00:22
780000 -- (-745.387) [-752.604] (-742.996) (-743.557) * [-746.140] (-748.212) (-744.122) (-744.152) -- 0:00:22
Average standard deviation of split frequencies: 0.002415
780500 -- (-748.236) [-746.176] (-742.503) (-745.539) * (-749.398) (-750.614) [-742.565] (-751.935) -- 0:00:22
781000 -- (-746.323) (-747.461) [-747.072] (-750.974) * (-749.534) (-746.415) [-742.016] (-748.283) -- 0:00:22
781500 -- (-743.724) (-745.376) (-742.983) [-749.119] * (-745.565) (-744.346) [-743.118] (-748.992) -- 0:00:22
782000 -- [-741.780] (-742.988) (-738.968) (-754.058) * (-744.155) [-739.557] (-742.606) (-751.033) -- 0:00:22
782500 -- (-745.625) (-742.518) [-745.880] (-747.955) * (-744.607) [-743.421] (-745.126) (-747.814) -- 0:00:22
783000 -- [-745.664] (-744.696) (-746.246) (-747.056) * (-750.667) (-750.468) [-746.410] (-745.212) -- 0:00:22
783500 -- (-745.447) [-744.021] (-744.944) (-744.914) * (-747.745) (-744.507) [-743.884] (-742.311) -- 0:00:22
784000 -- (-744.894) (-745.400) (-745.257) [-741.180] * (-743.682) (-747.015) [-740.272] (-750.704) -- 0:00:22
784500 -- [-743.081] (-745.040) (-745.361) (-745.336) * (-749.852) (-745.058) (-744.825) [-748.156] -- 0:00:22
785000 -- [-744.634] (-752.976) (-743.973) (-744.579) * (-749.134) (-752.741) (-747.051) [-740.556] -- 0:00:22
Average standard deviation of split frequencies: 0.002399
785500 -- [-748.309] (-747.318) (-741.912) (-740.688) * (-753.335) (-749.866) (-748.149) [-746.342] -- 0:00:22
786000 -- (-752.788) (-748.421) [-747.805] (-749.435) * (-749.546) (-751.221) (-751.824) [-746.219] -- 0:00:22
786500 -- (-752.605) [-749.885] (-742.208) (-744.884) * (-746.232) [-745.789] (-752.388) (-743.148) -- 0:00:21
787000 -- [-748.913] (-752.416) (-746.511) (-743.390) * (-750.739) (-752.534) (-749.321) [-745.276] -- 0:00:21
787500 -- [-752.093] (-750.354) (-748.993) (-748.063) * (-738.902) (-748.720) [-743.781] (-747.867) -- 0:00:21
788000 -- (-746.678) (-746.705) (-746.461) [-743.998] * [-742.622] (-742.193) (-747.149) (-744.472) -- 0:00:21
788500 -- (-751.371) (-750.042) (-751.654) [-743.065] * (-742.059) (-747.362) (-747.460) [-741.776] -- 0:00:21
789000 -- (-747.738) (-753.879) (-745.565) [-748.908] * (-747.565) (-741.472) (-744.256) [-744.431] -- 0:00:21
789500 -- (-751.166) (-748.434) (-748.783) [-747.293] * (-747.879) [-744.471] (-743.000) (-747.141) -- 0:00:21
790000 -- [-753.066] (-760.426) (-744.247) (-754.692) * (-741.462) [-743.342] (-745.520) (-746.757) -- 0:00:21
Average standard deviation of split frequencies: 0.002087
790500 -- [-743.564] (-757.178) (-745.447) (-742.172) * (-748.313) (-742.055) [-746.895] (-745.822) -- 0:00:21
791000 -- [-742.629] (-749.223) (-745.837) (-750.806) * [-748.946] (-742.530) (-743.463) (-744.026) -- 0:00:21
791500 -- (-747.619) (-751.362) (-744.689) [-745.098] * (-749.853) (-744.323) (-742.807) [-745.166] -- 0:00:21
792000 -- [-747.638] (-750.276) (-740.506) (-751.780) * (-739.998) (-744.384) (-751.713) [-742.289] -- 0:00:21
792500 -- (-754.318) (-746.351) [-742.750] (-749.589) * (-743.121) (-744.290) [-744.812] (-742.796) -- 0:00:21
793000 -- (-743.898) (-747.251) [-747.426] (-743.654) * [-742.340] (-743.286) (-740.079) (-741.131) -- 0:00:21
793500 -- [-743.027] (-750.183) (-741.912) (-741.922) * (-741.310) (-746.642) [-744.857] (-746.113) -- 0:00:21
794000 -- (-745.193) [-748.303] (-746.894) (-742.048) * (-750.329) (-752.642) (-747.550) [-745.342] -- 0:00:21
794500 -- [-741.856] (-745.542) (-743.767) (-753.780) * (-744.278) (-739.602) (-748.318) [-750.503] -- 0:00:21
795000 -- [-742.153] (-742.704) (-750.195) (-743.755) * (-750.240) (-745.144) [-743.231] (-749.214) -- 0:00:21
Average standard deviation of split frequencies: 0.002369
795500 -- [-752.052] (-748.112) (-749.966) (-746.097) * (-742.351) [-742.484] (-748.396) (-751.240) -- 0:00:21
796000 -- (-742.361) (-742.348) (-743.532) [-747.820] * (-748.364) (-742.284) (-748.180) [-753.470] -- 0:00:21
796500 -- [-742.933] (-745.063) (-744.677) (-751.966) * (-743.897) [-744.407] (-751.129) (-749.908) -- 0:00:20
797000 -- (-738.548) [-745.589] (-746.005) (-751.252) * (-746.533) (-748.502) (-743.360) [-744.826] -- 0:00:20
797500 -- [-744.554] (-742.273) (-747.682) (-755.715) * (-744.497) [-746.090] (-754.414) (-745.764) -- 0:00:20
798000 -- (-746.091) (-744.388) (-748.696) [-744.401] * (-747.334) [-745.238] (-747.681) (-741.716) -- 0:00:20
798500 -- (-750.132) [-746.181] (-744.560) (-743.939) * [-748.359] (-748.390) (-746.193) (-756.213) -- 0:00:20
799000 -- [-749.190] (-749.718) (-744.828) (-747.674) * (-747.619) [-740.230] (-751.062) (-745.728) -- 0:00:20
799500 -- [-746.639] (-745.654) (-744.379) (-753.712) * (-750.042) (-751.522) [-744.268] (-746.728) -- 0:00:20
800000 -- (-748.173) [-742.342] (-747.716) (-748.536) * (-747.618) (-744.796) (-747.348) [-740.638] -- 0:00:20
Average standard deviation of split frequencies: 0.002649
800500 -- [-749.414] (-747.186) (-747.142) (-744.942) * (-742.784) (-744.312) (-743.538) [-745.085] -- 0:00:20
801000 -- (-745.987) (-748.370) (-751.851) [-743.718] * (-748.716) (-742.535) [-743.405] (-741.694) -- 0:00:20
801500 -- [-746.774] (-746.888) (-744.527) (-745.243) * (-747.644) (-750.324) (-744.517) [-744.126] -- 0:00:20
802000 -- (-749.823) (-745.799) (-750.373) [-745.348] * [-748.937] (-749.365) (-743.434) (-745.143) -- 0:00:20
802500 -- (-747.204) (-747.891) (-750.255) [-743.484] * (-755.270) (-741.643) [-746.495] (-747.115) -- 0:00:20
803000 -- [-742.113] (-743.082) (-743.402) (-746.386) * [-753.235] (-741.980) (-759.110) (-746.220) -- 0:00:20
803500 -- (-750.133) [-740.997] (-746.104) (-743.906) * (-750.833) [-740.437] (-747.411) (-745.053) -- 0:00:20
804000 -- (-755.445) (-743.582) [-745.681] (-752.271) * [-748.275] (-752.116) (-750.304) (-742.348) -- 0:00:20
804500 -- [-744.311] (-747.782) (-741.293) (-747.749) * (-744.826) (-741.218) (-752.062) [-749.105] -- 0:00:20
805000 -- (-745.602) [-745.653] (-748.922) (-748.944) * (-748.348) [-744.525] (-747.363) (-749.331) -- 0:00:20
Average standard deviation of split frequencies: 0.004971
805500 -- (-743.991) [-743.424] (-742.054) (-755.869) * (-742.151) [-747.717] (-751.561) (-743.605) -- 0:00:20
806000 -- [-743.392] (-752.285) (-744.479) (-757.960) * (-743.183) (-744.170) (-759.436) [-744.004] -- 0:00:19
806500 -- [-742.217] (-744.188) (-746.821) (-753.061) * [-740.889] (-742.821) (-751.777) (-741.818) -- 0:00:19
807000 -- [-746.419] (-740.937) (-743.188) (-747.054) * (-743.472) (-746.519) (-751.408) [-746.342] -- 0:00:19
807500 -- (-748.011) (-745.777) [-748.713] (-747.408) * (-744.595) [-742.481] (-758.428) (-758.327) -- 0:00:19
808000 -- [-745.509] (-748.696) (-743.285) (-747.824) * [-744.024] (-746.692) (-753.549) (-744.870) -- 0:00:19
808500 -- (-744.690) [-745.895] (-742.330) (-756.225) * (-740.239) [-738.697] (-753.751) (-742.894) -- 0:00:19
809000 -- (-741.963) [-744.711] (-749.366) (-751.398) * [-740.670] (-743.812) (-750.720) (-744.574) -- 0:00:19
809500 -- (-746.734) (-749.804) (-746.831) [-751.310] * (-749.912) (-742.149) [-745.825] (-749.929) -- 0:00:19
810000 -- (-745.499) [-745.099] (-743.616) (-747.077) * [-747.164] (-748.014) (-747.242) (-743.735) -- 0:00:19
Average standard deviation of split frequencies: 0.004071
810500 -- (-746.537) (-744.799) [-743.676] (-746.312) * (-741.511) (-752.118) [-741.882] (-751.076) -- 0:00:19
811000 -- [-743.939] (-744.164) (-747.767) (-745.244) * (-746.219) (-745.436) [-742.963] (-751.704) -- 0:00:19
811500 -- [-745.372] (-750.908) (-751.866) (-741.542) * (-740.883) [-746.882] (-747.240) (-744.219) -- 0:00:19
812000 -- (-742.368) (-746.880) [-745.133] (-751.573) * [-744.604] (-744.908) (-748.072) (-747.975) -- 0:00:19
812500 -- (-744.693) (-744.938) (-750.561) [-743.997] * (-750.347) [-742.981] (-742.684) (-745.396) -- 0:00:19
813000 -- (-748.098) (-745.254) (-744.903) [-740.850] * (-740.292) (-745.217) [-741.906] (-749.117) -- 0:00:19
813500 -- [-747.340] (-745.709) (-748.037) (-742.321) * (-747.465) (-743.866) [-744.553] (-750.004) -- 0:00:19
814000 -- (-753.233) [-745.124] (-744.787) (-741.546) * (-743.783) (-748.975) (-749.137) [-746.649] -- 0:00:19
814500 -- (-746.905) (-746.937) (-747.627) [-744.565] * [-742.932] (-748.341) (-745.130) (-746.754) -- 0:00:19
815000 -- [-745.604] (-749.401) (-748.166) (-746.002) * (-743.517) (-742.448) [-742.080] (-747.886) -- 0:00:19
Average standard deviation of split frequencies: 0.002889
815500 -- (-746.114) [-740.606] (-746.706) (-746.775) * [-748.363] (-742.428) (-746.399) (-751.951) -- 0:00:19
816000 -- [-749.098] (-745.818) (-750.591) (-745.470) * [-744.671] (-744.628) (-749.393) (-743.468) -- 0:00:18
816500 -- (-747.755) (-748.046) (-745.946) [-745.637] * (-741.429) [-747.095] (-745.428) (-742.681) -- 0:00:18
817000 -- [-745.843] (-747.945) (-746.477) (-746.124) * (-746.279) (-741.322) (-744.265) [-746.151] -- 0:00:18
817500 -- [-743.411] (-746.051) (-741.014) (-752.712) * (-744.769) (-746.588) (-758.592) [-742.457] -- 0:00:18
818000 -- (-743.541) [-744.150] (-740.968) (-742.536) * [-743.560] (-743.462) (-753.153) (-746.464) -- 0:00:18
818500 -- [-745.046] (-744.114) (-744.210) (-745.948) * [-743.737] (-745.503) (-743.322) (-751.277) -- 0:00:18
819000 -- (-743.422) [-742.437] (-747.136) (-746.866) * (-750.943) [-744.189] (-741.999) (-751.720) -- 0:00:18
819500 -- [-739.737] (-743.889) (-756.965) (-748.370) * [-743.274] (-748.519) (-748.389) (-747.292) -- 0:00:18
820000 -- (-744.981) (-744.817) [-743.398] (-742.507) * [-743.805] (-746.168) (-739.047) (-745.131) -- 0:00:18
Average standard deviation of split frequencies: 0.003159
820500 -- [-742.933] (-746.236) (-749.372) (-743.916) * (-744.890) (-752.338) [-742.818] (-750.429) -- 0:00:18
821000 -- [-743.481] (-745.802) (-746.263) (-747.617) * (-746.243) (-749.028) [-740.131] (-744.855) -- 0:00:18
821500 -- (-749.205) (-743.084) (-745.998) [-744.899] * (-752.551) (-749.678) (-741.474) [-745.691] -- 0:00:18
822000 -- [-746.431] (-742.621) (-743.652) (-744.665) * (-752.330) (-745.517) (-741.457) [-746.813] -- 0:00:18
822500 -- (-741.269) [-740.694] (-751.331) (-747.628) * (-750.731) (-743.875) (-745.162) [-745.480] -- 0:00:18
823000 -- [-747.195] (-748.977) (-751.528) (-745.669) * (-750.649) (-746.497) [-740.362] (-744.517) -- 0:00:18
823500 -- (-744.423) (-746.895) [-743.846] (-752.404) * [-751.149] (-746.354) (-744.395) (-746.590) -- 0:00:18
824000 -- (-744.087) (-744.718) [-742.835] (-748.368) * (-746.351) [-744.929] (-743.448) (-748.317) -- 0:00:18
824500 -- (-750.472) (-749.343) [-749.044] (-749.697) * (-747.857) (-745.790) [-745.840] (-746.318) -- 0:00:18
825000 -- (-745.334) (-750.040) (-747.010) [-748.038] * (-755.770) [-742.933] (-750.982) (-745.274) -- 0:00:18
Average standard deviation of split frequencies: 0.001427
825500 -- [-748.783] (-748.809) (-745.825) (-749.432) * (-749.281) [-746.684] (-745.046) (-744.355) -- 0:00:17
826000 -- [-742.664] (-743.280) (-744.579) (-745.886) * [-744.556] (-743.039) (-745.489) (-747.455) -- 0:00:17
826500 -- (-744.387) (-744.098) (-750.373) [-745.805] * (-745.925) (-753.343) [-743.815] (-748.476) -- 0:00:17
827000 -- [-743.469] (-741.293) (-745.504) (-744.312) * (-744.469) (-742.600) [-742.966] (-749.444) -- 0:00:17
827500 -- (-743.647) [-743.185] (-746.116) (-744.096) * (-744.160) (-744.707) [-742.956] (-746.248) -- 0:00:17
828000 -- [-751.043] (-745.170) (-744.333) (-747.153) * [-744.628] (-744.014) (-744.078) (-747.570) -- 0:00:17
828500 -- (-748.390) (-745.242) [-744.912] (-743.647) * (-744.306) (-743.877) [-744.577] (-753.942) -- 0:00:17
829000 -- (-747.091) [-742.197] (-744.956) (-743.312) * [-747.033] (-747.072) (-742.148) (-745.355) -- 0:00:17
829500 -- [-742.446] (-742.619) (-746.435) (-750.633) * [-742.749] (-744.617) (-747.071) (-749.986) -- 0:00:17
830000 -- (-748.625) [-745.443] (-745.306) (-746.380) * (-743.037) (-741.066) [-745.245] (-744.733) -- 0:00:17
Average standard deviation of split frequencies: 0.001703
830500 -- [-747.441] (-742.429) (-742.986) (-746.485) * (-749.694) [-743.451] (-752.282) (-741.325) -- 0:00:17
831000 -- (-752.545) (-741.814) [-751.349] (-750.004) * (-743.022) (-751.725) [-743.973] (-743.336) -- 0:00:17
831500 -- [-744.252] (-744.438) (-746.538) (-758.173) * [-745.239] (-740.359) (-746.502) (-744.638) -- 0:00:17
832000 -- (-752.888) [-740.888] (-750.937) (-758.582) * [-750.484] (-745.994) (-746.827) (-744.358) -- 0:00:17
832500 -- (-748.386) [-745.027] (-750.810) (-753.163) * [-747.974] (-747.790) (-741.633) (-739.603) -- 0:00:17
833000 -- (-744.074) [-745.566] (-743.564) (-754.340) * [-742.309] (-742.804) (-742.730) (-747.659) -- 0:00:17
833500 -- [-743.831] (-740.921) (-754.549) (-746.556) * (-744.988) (-741.332) (-748.165) [-744.300] -- 0:00:17
834000 -- (-758.291) [-745.704] (-749.922) (-750.254) * [-743.561] (-745.641) (-743.783) (-743.167) -- 0:00:17
834500 -- (-750.633) [-742.627] (-752.251) (-749.407) * (-746.172) (-744.172) (-750.086) [-742.111] -- 0:00:17
835000 -- (-747.586) [-746.209] (-745.663) (-745.366) * (-748.934) [-746.605] (-745.906) (-746.828) -- 0:00:16
Average standard deviation of split frequencies: 0.001974
835500 -- (-751.544) (-744.309) (-746.450) [-746.430] * (-742.311) (-745.231) [-748.907] (-747.135) -- 0:00:16
836000 -- (-748.599) (-744.813) [-742.004] (-754.378) * (-742.610) [-753.186] (-753.554) (-745.419) -- 0:00:16
836500 -- (-744.276) [-750.443] (-744.269) (-748.551) * [-745.568] (-746.748) (-742.562) (-750.617) -- 0:00:16
837000 -- (-749.217) [-743.810] (-748.962) (-747.223) * (-746.065) [-748.991] (-745.686) (-758.225) -- 0:00:16
837500 -- (-744.159) [-741.946] (-744.862) (-753.281) * (-744.547) (-745.735) [-748.006] (-747.270) -- 0:00:16
838000 -- (-748.753) [-746.343] (-743.074) (-744.033) * (-742.238) (-754.728) (-742.391) [-749.071] -- 0:00:16
838500 -- (-752.270) (-747.142) [-748.236] (-746.794) * (-745.375) [-743.183] (-745.292) (-745.655) -- 0:00:16
839000 -- (-745.092) [-745.527] (-745.894) (-742.513) * (-750.725) [-747.968] (-741.955) (-741.518) -- 0:00:16
839500 -- (-750.471) [-742.562] (-741.260) (-742.893) * (-744.542) (-749.739) (-744.588) [-742.663] -- 0:00:16
840000 -- (-744.102) (-745.024) (-744.845) [-749.613] * (-743.481) (-747.346) (-743.794) [-743.331] -- 0:00:16
Average standard deviation of split frequencies: 0.002523
840500 -- (-748.490) (-742.754) [-740.544] (-751.261) * (-755.489) [-741.310] (-744.459) (-744.072) -- 0:00:16
841000 -- [-748.296] (-747.924) (-747.128) (-751.424) * (-746.767) (-742.380) (-746.837) [-744.023] -- 0:00:16
841500 -- [-745.230] (-747.886) (-744.133) (-753.543) * (-751.361) (-744.187) (-742.607) [-745.600] -- 0:00:16
842000 -- (-749.378) (-745.127) (-743.587) [-744.690] * (-755.148) (-744.668) [-739.772] (-744.391) -- 0:00:16
842500 -- [-743.888] (-741.653) (-746.551) (-743.168) * (-753.389) (-750.140) (-742.595) [-742.172] -- 0:00:16
843000 -- (-744.396) (-747.309) [-746.093] (-745.462) * (-750.429) [-740.830] (-744.769) (-748.052) -- 0:00:16
843500 -- [-740.027] (-743.335) (-750.062) (-745.421) * (-747.154) (-742.843) (-752.255) [-741.010] -- 0:00:16
844000 -- (-749.300) [-744.440] (-742.818) (-743.783) * (-754.458) (-749.179) (-747.526) [-746.012] -- 0:00:16
844500 -- (-744.712) (-750.714) [-744.580] (-744.484) * (-745.863) (-747.988) [-744.186] (-751.981) -- 0:00:16
845000 -- [-743.819] (-746.201) (-744.744) (-748.987) * (-748.733) (-743.966) [-747.885] (-750.311) -- 0:00:15
Average standard deviation of split frequencies: 0.002229
845500 -- (-749.419) [-743.995] (-749.761) (-746.544) * (-742.174) (-743.240) (-745.822) [-741.977] -- 0:00:15
846000 -- (-743.439) [-743.679] (-750.037) (-750.381) * (-741.937) (-744.612) (-743.040) [-743.862] -- 0:00:15
846500 -- (-756.790) (-746.675) (-749.018) [-745.311] * [-740.947] (-742.805) (-751.453) (-742.500) -- 0:00:15
847000 -- (-753.951) (-743.301) [-745.635] (-742.944) * [-750.201] (-749.809) (-752.200) (-744.794) -- 0:00:15
847500 -- (-756.825) (-746.700) [-745.840] (-745.738) * [-749.741] (-746.023) (-744.988) (-747.732) -- 0:00:15
848000 -- (-754.270) (-745.252) (-739.278) [-740.267] * (-742.695) (-744.247) [-748.573] (-744.221) -- 0:00:15
848500 -- [-743.060] (-744.067) (-744.146) (-741.918) * (-745.124) (-742.926) [-755.012] (-741.067) -- 0:00:15
849000 -- (-742.750) (-742.703) (-742.834) [-744.495] * (-746.833) (-742.757) [-749.461] (-747.128) -- 0:00:15
849500 -- (-746.249) [-744.039] (-743.664) (-741.769) * (-743.881) [-742.062] (-750.168) (-744.432) -- 0:00:15
850000 -- (-748.360) (-753.549) (-746.205) [-741.607] * [-743.472] (-744.637) (-747.041) (-749.167) -- 0:00:15
Average standard deviation of split frequencies: 0.002494
850500 -- (-749.035) (-743.471) (-743.041) [-742.953] * (-747.086) [-748.823] (-744.249) (-745.454) -- 0:00:15
851000 -- [-746.956] (-743.281) (-749.415) (-756.751) * (-742.017) (-743.106) (-742.061) [-740.434] -- 0:00:15
851500 -- (-747.537) (-753.478) (-744.796) [-740.880] * (-747.334) (-742.641) [-748.152] (-744.273) -- 0:00:15
852000 -- (-744.029) [-741.979] (-749.511) (-740.936) * [-746.877] (-742.897) (-745.269) (-746.237) -- 0:00:15
852500 -- (-749.394) (-746.028) [-746.425] (-746.453) * [-742.821] (-744.314) (-749.196) (-751.304) -- 0:00:15
853000 -- [-742.832] (-741.990) (-743.657) (-742.570) * (-741.115) [-741.479] (-747.605) (-751.019) -- 0:00:15
853500 -- [-749.021] (-745.461) (-747.415) (-743.639) * (-745.627) (-739.450) [-748.505] (-747.376) -- 0:00:15
854000 -- (-747.666) [-742.403] (-745.535) (-747.884) * (-742.305) (-745.594) (-747.143) [-748.742] -- 0:00:15
854500 -- (-747.749) (-743.233) (-745.194) [-747.075] * (-746.163) (-748.967) [-742.275] (-748.193) -- 0:00:14
855000 -- (-743.678) [-746.797] (-746.681) (-748.033) * [-746.691] (-743.796) (-744.801) (-744.857) -- 0:00:14
Average standard deviation of split frequencies: 0.002478
855500 -- [-743.147] (-742.537) (-752.033) (-745.522) * (-751.665) (-753.627) (-745.138) [-740.098] -- 0:00:14
856000 -- [-742.924] (-744.461) (-761.439) (-744.121) * [-744.328] (-751.231) (-743.154) (-745.535) -- 0:00:14
856500 -- (-742.586) (-749.329) (-765.931) [-744.408] * (-741.801) [-744.123] (-746.322) (-745.049) -- 0:00:14
857000 -- (-746.592) (-744.135) [-742.079] (-746.160) * (-746.090) (-742.509) [-746.838] (-747.517) -- 0:00:14
857500 -- (-746.526) [-746.110] (-743.454) (-744.735) * (-750.007) (-745.147) (-744.406) [-747.441] -- 0:00:14
858000 -- (-741.997) (-744.081) [-743.178] (-750.283) * (-744.526) [-748.261] (-747.523) (-744.336) -- 0:00:14
858500 -- (-744.196) (-742.567) [-745.331] (-749.548) * (-744.483) (-750.318) [-741.022] (-744.965) -- 0:00:14
859000 -- (-746.476) (-747.597) (-750.843) [-745.642] * (-746.589) [-745.026] (-744.854) (-741.972) -- 0:00:14
859500 -- (-744.140) (-752.997) [-743.643] (-742.428) * [-747.897] (-743.577) (-747.597) (-742.826) -- 0:00:14
860000 -- [-742.777] (-745.044) (-741.647) (-747.300) * [-747.756] (-744.388) (-750.722) (-749.456) -- 0:00:14
Average standard deviation of split frequencies: 0.002739
860500 -- [-741.866] (-744.031) (-745.144) (-744.368) * (-746.334) [-747.965] (-743.981) (-744.329) -- 0:00:14
861000 -- (-747.829) (-743.064) (-746.651) [-743.413] * (-747.276) (-751.658) [-742.620] (-744.418) -- 0:00:14
861500 -- (-748.399) (-748.263) (-753.056) [-742.263] * [-744.081] (-752.858) (-742.550) (-740.187) -- 0:00:14
862000 -- (-745.630) (-749.691) [-744.874] (-744.269) * (-748.097) [-743.245] (-748.984) (-741.614) -- 0:00:14
862500 -- (-750.571) (-758.697) [-743.083] (-746.443) * (-748.489) [-746.140] (-746.039) (-749.372) -- 0:00:14
863000 -- (-744.299) (-750.870) [-752.168] (-747.869) * (-748.273) (-751.398) (-748.828) [-743.386] -- 0:00:14
863500 -- (-744.910) [-747.300] (-750.521) (-742.768) * (-744.432) [-749.880] (-742.401) (-745.146) -- 0:00:14
864000 -- (-747.064) (-747.028) (-745.315) [-741.786] * (-743.239) (-743.207) [-745.393] (-744.821) -- 0:00:14
864500 -- (-746.351) (-747.765) (-746.533) [-743.194] * [-742.230] (-747.439) (-745.503) (-740.368) -- 0:00:13
865000 -- [-740.828] (-748.406) (-744.476) (-746.070) * (-752.664) (-743.602) (-750.322) [-743.616] -- 0:00:13
Average standard deviation of split frequencies: 0.002722
865500 -- (-747.234) (-743.726) (-749.227) [-742.266] * (-749.429) [-742.003] (-744.208) (-742.205) -- 0:00:13
866000 -- [-746.428] (-740.798) (-746.374) (-741.431) * (-745.679) (-748.812) [-740.749] (-742.113) -- 0:00:13
866500 -- (-748.873) [-742.411] (-746.083) (-744.607) * (-741.529) (-756.677) [-752.011] (-748.438) -- 0:00:13
867000 -- (-749.752) (-747.487) [-743.963] (-744.793) * [-749.470] (-751.150) (-742.414) (-747.536) -- 0:00:13
867500 -- [-740.894] (-749.574) (-743.623) (-744.747) * (-751.733) (-744.004) (-745.141) [-743.731] -- 0:00:13
868000 -- (-744.677) (-748.618) (-747.521) [-753.444] * (-749.996) (-744.594) [-743.938] (-742.651) -- 0:00:13
868500 -- (-745.519) (-753.595) (-742.912) [-745.832] * [-750.310] (-747.117) (-742.070) (-742.477) -- 0:00:13
869000 -- [-745.813] (-753.288) (-742.093) (-743.502) * [-746.748] (-745.252) (-745.094) (-742.790) -- 0:00:13
869500 -- [-744.432] (-754.493) (-744.142) (-746.642) * (-747.769) (-746.962) (-744.022) [-746.383] -- 0:00:13
870000 -- (-743.438) [-742.419] (-748.742) (-744.968) * (-753.928) (-749.137) (-745.111) [-739.465] -- 0:00:13
Average standard deviation of split frequencies: 0.002978
870500 -- (-747.744) [-744.635] (-745.701) (-747.499) * [-748.864] (-750.985) (-741.553) (-742.379) -- 0:00:13
871000 -- (-744.363) [-744.323] (-743.142) (-748.376) * (-752.599) (-747.881) (-746.848) [-745.718] -- 0:00:13
871500 -- [-741.954] (-747.973) (-744.410) (-743.203) * (-760.706) [-753.208] (-748.671) (-747.241) -- 0:00:13
872000 -- [-750.076] (-746.331) (-747.192) (-745.457) * (-752.433) [-747.989] (-743.755) (-744.860) -- 0:00:13
872500 -- (-744.059) (-749.642) [-752.656] (-746.729) * [-745.949] (-747.219) (-751.504) (-741.585) -- 0:00:13
873000 -- [-747.314] (-744.788) (-751.367) (-746.358) * (-761.444) (-751.363) (-742.762) [-746.799] -- 0:00:13
873500 -- (-745.793) (-742.637) [-749.880] (-750.516) * (-750.081) (-750.079) (-742.941) [-747.688] -- 0:00:13
874000 -- [-744.729] (-751.837) (-743.711) (-752.503) * (-754.986) [-744.123] (-742.360) (-744.998) -- 0:00:12
874500 -- (-746.422) (-742.187) [-748.019] (-744.445) * (-751.505) [-743.529] (-745.691) (-743.401) -- 0:00:12
875000 -- (-751.424) [-740.816] (-752.525) (-749.223) * (-746.857) (-746.439) [-743.633] (-746.329) -- 0:00:12
Average standard deviation of split frequencies: 0.004664
875500 -- (-745.299) [-742.285] (-743.955) (-747.498) * (-756.493) (-749.996) [-743.541] (-747.293) -- 0:00:12
876000 -- (-748.076) [-744.006] (-741.461) (-747.757) * (-745.997) (-751.049) (-743.337) [-746.044] -- 0:00:12
876500 -- (-747.606) [-741.889] (-750.042) (-751.080) * (-743.583) (-748.160) [-744.287] (-743.636) -- 0:00:12
877000 -- [-742.302] (-746.937) (-744.068) (-745.805) * (-749.482) [-748.122] (-752.164) (-745.281) -- 0:00:12
877500 -- [-744.812] (-750.232) (-748.286) (-745.426) * (-745.788) (-749.691) (-750.882) [-748.155] -- 0:00:12
878000 -- [-745.924] (-746.817) (-742.913) (-745.436) * (-745.243) (-755.325) (-741.429) [-748.077] -- 0:00:12
878500 -- (-748.802) (-744.643) [-745.952] (-751.237) * (-742.446) (-748.488) (-742.820) [-747.747] -- 0:00:12
879000 -- (-742.742) [-742.014] (-748.027) (-747.461) * (-744.684) (-747.725) [-741.966] (-742.180) -- 0:00:12
879500 -- (-746.030) [-740.245] (-748.831) (-750.427) * (-742.912) (-746.834) [-749.246] (-745.416) -- 0:00:12
880000 -- [-743.061] (-745.312) (-751.295) (-745.798) * [-747.468] (-746.396) (-743.797) (-742.486) -- 0:00:12
Average standard deviation of split frequencies: 0.005710
880500 -- (-747.386) (-752.189) (-741.203) [-746.401] * [-749.201] (-744.902) (-747.707) (-751.456) -- 0:00:12
881000 -- (-746.520) [-748.533] (-746.222) (-749.669) * (-746.960) [-744.781] (-748.436) (-742.905) -- 0:00:12
881500 -- (-756.451) (-751.054) [-743.139] (-750.393) * (-743.173) [-747.825] (-745.722) (-745.122) -- 0:00:12
882000 -- (-752.571) [-747.310] (-749.664) (-746.447) * (-747.640) (-747.085) (-749.328) [-743.714] -- 0:00:12
882500 -- (-748.001) (-742.633) [-741.604] (-748.612) * [-746.601] (-748.626) (-744.551) (-742.628) -- 0:00:12
883000 -- (-746.363) [-743.244] (-751.874) (-744.188) * (-740.301) (-742.813) (-747.692) [-742.130] -- 0:00:12
883500 -- (-743.214) [-744.993] (-742.798) (-745.192) * (-743.000) (-747.714) [-743.008] (-753.174) -- 0:00:11
884000 -- (-742.355) (-751.949) [-744.997] (-745.739) * (-746.064) (-746.563) (-747.695) [-752.032] -- 0:00:11
884500 -- [-744.992] (-752.445) (-749.153) (-744.113) * (-744.824) [-748.382] (-743.522) (-753.877) -- 0:00:11
885000 -- [-746.105] (-746.340) (-746.883) (-747.376) * [-743.814] (-745.751) (-751.937) (-746.787) -- 0:00:11
Average standard deviation of split frequencies: 0.006739
885500 -- (-745.218) (-747.889) [-748.563] (-751.455) * (-743.440) [-743.098] (-743.880) (-751.436) -- 0:00:11
886000 -- [-744.404] (-742.531) (-748.244) (-749.195) * (-750.681) [-745.604] (-747.134) (-751.045) -- 0:00:11
886500 -- [-745.152] (-745.591) (-746.262) (-742.706) * (-749.566) [-743.432] (-741.246) (-756.585) -- 0:00:11
887000 -- [-747.546] (-745.087) (-746.554) (-742.749) * (-748.479) (-747.631) [-743.107] (-751.915) -- 0:00:11
887500 -- (-743.719) [-745.611] (-742.328) (-752.452) * (-755.248) (-748.869) (-744.813) [-748.001] -- 0:00:11
888000 -- (-754.088) (-748.301) [-743.519] (-746.766) * (-750.756) [-746.617] (-746.953) (-746.896) -- 0:00:11
888500 -- (-744.439) (-741.013) (-741.210) [-740.310] * (-747.870) (-747.125) [-747.207] (-742.980) -- 0:00:11
889000 -- (-746.254) (-749.443) (-748.700) [-749.797] * (-751.059) (-750.401) (-745.523) [-744.041] -- 0:00:11
889500 -- (-746.694) (-744.299) (-749.732) [-741.422] * (-756.095) (-747.374) (-753.872) [-742.987] -- 0:00:11
890000 -- (-747.190) (-747.190) (-744.376) [-745.215] * (-749.019) (-747.328) [-747.435] (-748.393) -- 0:00:11
Average standard deviation of split frequencies: 0.006351
890500 -- (-748.230) (-745.535) [-743.636] (-745.761) * (-748.450) (-743.072) [-748.481] (-746.836) -- 0:00:11
891000 -- [-742.130] (-746.642) (-743.571) (-750.065) * [-747.591] (-746.320) (-743.792) (-746.991) -- 0:00:11
891500 -- (-744.458) (-749.810) (-752.001) [-746.726] * (-744.650) (-745.905) (-748.391) [-743.068] -- 0:00:11
892000 -- [-740.273] (-743.980) (-745.240) (-742.496) * [-742.260] (-746.329) (-754.671) (-743.654) -- 0:00:11
892500 -- (-743.754) (-742.361) [-742.581] (-748.639) * (-750.259) (-742.029) (-748.154) [-743.985] -- 0:00:11
893000 -- (-752.537) (-746.176) (-752.261) [-744.855] * [-744.178] (-741.654) (-744.351) (-743.786) -- 0:00:11
893500 -- (-747.938) (-749.738) [-744.887] (-747.619) * [-743.111] (-743.613) (-742.374) (-746.877) -- 0:00:10
894000 -- [-743.643] (-745.996) (-743.384) (-745.616) * (-743.915) [-744.194] (-744.401) (-740.680) -- 0:00:10
894500 -- (-744.982) (-742.396) [-743.129] (-746.187) * (-744.087) [-744.754] (-749.026) (-741.395) -- 0:00:10
895000 -- [-743.652] (-747.566) (-742.301) (-748.013) * (-741.562) (-747.079) [-742.703] (-745.608) -- 0:00:10
Average standard deviation of split frequencies: 0.006313
895500 -- (-742.185) (-745.254) (-744.051) [-742.599] * (-744.638) (-747.700) [-748.547] (-741.752) -- 0:00:10
896000 -- [-741.729] (-745.789) (-743.252) (-746.484) * (-750.112) (-750.575) [-746.892] (-748.639) -- 0:00:10
896500 -- [-743.438] (-747.751) (-745.395) (-747.764) * (-744.162) (-747.994) (-745.064) [-742.078] -- 0:00:10
897000 -- (-746.564) (-748.399) [-745.417] (-745.845) * (-750.541) (-743.897) (-749.740) [-744.733] -- 0:00:10
897500 -- (-752.653) [-747.662] (-748.131) (-746.387) * [-744.069] (-750.229) (-745.859) (-744.780) -- 0:00:10
898000 -- [-741.381] (-742.989) (-741.975) (-751.413) * [-744.502] (-745.984) (-744.979) (-750.408) -- 0:00:10
898500 -- [-742.636] (-748.349) (-745.165) (-746.439) * [-747.244] (-747.397) (-743.823) (-748.545) -- 0:00:10
899000 -- (-745.999) [-743.532] (-743.324) (-753.028) * (-749.557) (-744.473) (-745.724) [-745.588] -- 0:00:10
899500 -- (-742.209) (-743.316) (-744.704) [-746.027] * [-743.487] (-741.105) (-746.819) (-746.933) -- 0:00:10
900000 -- (-750.765) (-747.188) (-747.286) [-744.289] * (-745.730) (-746.032) (-745.376) [-742.336] -- 0:00:10
Average standard deviation of split frequencies: 0.005234
900500 -- (-745.462) (-747.944) [-746.981] (-744.771) * (-747.138) [-747.808] (-756.585) (-749.669) -- 0:00:10
901000 -- (-745.388) [-744.230] (-745.695) (-753.194) * (-741.247) [-747.318] (-741.498) (-748.433) -- 0:00:10
901500 -- [-749.753] (-744.350) (-743.278) (-744.821) * (-745.516) (-740.859) (-742.385) [-752.768] -- 0:00:10
902000 -- [-744.315] (-752.095) (-741.927) (-743.489) * (-745.196) (-759.487) (-750.541) [-743.914] -- 0:00:10
902500 -- (-750.696) (-745.984) [-748.651] (-746.663) * [-744.456] (-745.773) (-742.302) (-748.737) -- 0:00:10
903000 -- [-749.279] (-750.483) (-751.703) (-751.019) * [-747.317] (-740.816) (-747.035) (-739.672) -- 0:00:09
903500 -- (-751.683) (-746.395) (-750.785) [-739.475] * (-753.021) [-743.519] (-743.829) (-739.899) -- 0:00:09
904000 -- (-755.884) (-745.874) (-749.115) [-743.295] * [-747.040] (-748.028) (-746.456) (-749.582) -- 0:00:09
904500 -- [-747.501] (-755.180) (-750.608) (-747.330) * (-750.555) (-744.089) (-745.507) [-742.320] -- 0:00:09
905000 -- (-741.659) (-747.732) (-751.354) [-742.045] * (-747.396) (-749.962) [-745.767] (-748.082) -- 0:00:09
Average standard deviation of split frequencies: 0.006591
905500 -- (-744.357) (-747.789) [-749.251] (-746.481) * (-744.023) [-746.289] (-745.217) (-748.532) -- 0:00:09
906000 -- (-746.947) (-752.977) (-749.258) [-747.499] * [-742.042] (-748.443) (-747.933) (-749.739) -- 0:00:09
906500 -- (-741.344) (-742.230) [-746.407] (-749.648) * (-745.716) [-741.791] (-742.542) (-748.297) -- 0:00:09
907000 -- [-742.607] (-750.050) (-744.334) (-745.951) * [-742.492] (-747.564) (-747.654) (-747.657) -- 0:00:09
907500 -- [-740.704] (-750.598) (-750.036) (-742.740) * [-741.363] (-749.336) (-750.008) (-744.326) -- 0:00:09
908000 -- (-745.469) (-746.163) [-742.058] (-746.842) * [-744.298] (-746.973) (-744.290) (-743.247) -- 0:00:09
908500 -- (-744.570) (-748.929) (-744.725) [-748.705] * (-747.189) [-745.614] (-741.275) (-744.547) -- 0:00:09
909000 -- [-740.223] (-747.548) (-743.383) (-748.420) * (-752.422) (-751.345) [-745.356] (-745.931) -- 0:00:09
909500 -- (-744.186) [-740.491] (-743.135) (-754.063) * (-745.734) (-747.125) (-743.161) [-745.339] -- 0:00:09
910000 -- (-747.491) (-742.486) (-747.327) [-744.361] * (-751.048) (-743.177) (-743.253) [-746.238] -- 0:00:09
Average standard deviation of split frequencies: 0.005435
910500 -- (-750.415) [-742.110] (-754.259) (-742.922) * (-741.298) (-747.810) [-739.922] (-750.863) -- 0:00:09
911000 -- (-748.231) [-746.911] (-742.297) (-751.099) * (-746.834) (-747.297) (-747.362) [-740.000] -- 0:00:09
911500 -- (-749.363) (-741.815) [-748.226] (-745.273) * (-744.923) (-753.057) (-753.104) [-742.195] -- 0:00:09
912000 -- (-750.976) [-742.323] (-743.330) (-745.006) * (-745.382) (-756.884) (-757.052) [-741.929] -- 0:00:09
912500 -- (-753.670) (-746.905) (-745.252) [-745.910] * [-738.788] (-754.730) (-758.569) (-741.842) -- 0:00:09
913000 -- (-746.049) (-746.643) [-745.837] (-747.097) * (-740.703) (-747.906) [-749.669] (-742.061) -- 0:00:08
913500 -- (-755.203) (-746.007) (-744.252) [-741.332] * [-745.635] (-744.007) (-752.808) (-747.182) -- 0:00:08
914000 -- (-753.070) (-744.366) [-746.469] (-746.800) * (-749.295) [-742.021] (-757.955) (-746.536) -- 0:00:08
914500 -- (-754.152) [-747.532] (-746.206) (-741.119) * [-742.918] (-743.328) (-750.730) (-743.609) -- 0:00:08
915000 -- [-749.983] (-742.655) (-748.569) (-745.127) * (-745.013) (-750.736) (-742.729) [-740.920] -- 0:00:08
Average standard deviation of split frequencies: 0.004889
915500 -- (-751.992) (-746.519) [-743.154] (-748.321) * (-743.827) [-744.930] (-748.824) (-741.713) -- 0:00:08
916000 -- (-749.735) (-750.900) (-743.343) [-744.839] * (-756.333) (-743.150) [-744.959] (-745.879) -- 0:00:08
916500 -- (-747.887) (-748.652) [-741.247] (-745.890) * (-753.250) (-746.947) [-741.563] (-744.077) -- 0:00:08
917000 -- (-753.228) (-749.507) [-744.396] (-747.546) * (-752.613) (-742.046) (-745.995) [-750.726] -- 0:00:08
917500 -- (-755.671) (-749.870) (-743.284) [-751.106] * (-747.837) (-744.331) (-742.484) [-742.666] -- 0:00:08
918000 -- (-760.226) (-745.201) [-747.564] (-745.670) * [-754.389] (-744.349) (-744.779) (-746.162) -- 0:00:08
918500 -- (-752.240) (-746.324) [-744.583] (-745.674) * (-749.921) (-750.259) [-741.571] (-744.433) -- 0:00:08
919000 -- (-745.837) (-749.211) (-743.818) [-743.357] * [-751.291] (-744.349) (-748.679) (-747.306) -- 0:00:08
919500 -- (-748.478) (-748.929) [-743.486] (-746.777) * (-746.468) (-741.326) (-746.219) [-741.299] -- 0:00:08
920000 -- (-751.492) (-745.903) (-744.060) [-742.198] * (-744.076) (-747.828) [-745.830] (-747.699) -- 0:00:08
Average standard deviation of split frequencies: 0.004608
920500 -- (-747.539) [-750.592] (-743.384) (-741.260) * (-742.923) [-747.624] (-749.396) (-747.497) -- 0:00:08
921000 -- (-751.464) (-751.998) (-745.448) [-740.608] * (-754.356) (-748.288) [-748.995] (-746.560) -- 0:00:08
921500 -- (-750.866) (-745.177) (-745.375) [-739.785] * (-743.433) (-741.442) [-746.982] (-744.016) -- 0:00:08
922000 -- (-750.382) [-753.744] (-744.192) (-740.775) * (-744.098) (-743.784) [-741.056] (-747.301) -- 0:00:08
922500 -- [-745.218] (-742.630) (-744.882) (-745.614) * (-749.430) (-743.918) (-745.226) [-745.999] -- 0:00:07
923000 -- (-747.036) (-740.641) [-748.167] (-752.497) * [-745.306] (-744.313) (-746.140) (-745.098) -- 0:00:07
923500 -- (-749.734) [-742.609] (-747.598) (-751.602) * (-745.992) (-741.839) [-739.755] (-748.113) -- 0:00:07
924000 -- (-747.260) (-741.904) [-742.045] (-755.939) * (-747.538) [-742.696] (-750.390) (-744.724) -- 0:00:07
924500 -- (-748.334) (-743.589) (-741.028) [-751.017] * (-743.367) (-748.077) (-748.721) [-744.183] -- 0:00:07
925000 -- (-758.916) (-741.978) (-745.463) [-743.800] * [-743.970] (-743.512) (-744.633) (-740.487) -- 0:00:07
Average standard deviation of split frequencies: 0.005600
925500 -- (-752.539) (-746.497) [-744.601] (-746.673) * (-750.524) [-743.630] (-743.862) (-745.309) -- 0:00:07
926000 -- (-757.026) (-741.484) (-745.502) [-744.415] * (-745.065) (-744.334) (-742.973) [-747.861] -- 0:00:07
926500 -- (-751.069) (-746.057) [-742.058] (-748.230) * (-744.516) [-744.821] (-742.671) (-752.149) -- 0:00:07
927000 -- (-755.874) (-751.188) [-744.233] (-742.769) * (-747.952) (-747.669) (-747.709) [-744.845] -- 0:00:07
927500 -- (-751.929) [-749.772] (-743.364) (-746.555) * (-745.592) (-748.098) [-743.065] (-743.996) -- 0:00:07
928000 -- (-751.100) (-750.033) (-744.490) [-743.285] * (-741.378) (-750.341) [-745.881] (-751.874) -- 0:00:07
928500 -- (-746.509) (-750.416) [-747.656] (-744.724) * (-743.286) (-742.214) [-747.977] (-743.907) -- 0:00:07
929000 -- (-747.406) (-748.274) (-749.717) [-744.249] * (-752.807) (-743.430) [-740.505] (-743.164) -- 0:00:07
929500 -- (-746.598) (-748.285) [-747.556] (-744.176) * (-748.849) (-751.188) [-744.917] (-745.209) -- 0:00:07
930000 -- (-743.679) (-743.392) [-745.124] (-746.733) * (-741.117) (-747.205) (-745.667) [-745.100] -- 0:00:07
Average standard deviation of split frequencies: 0.006754
930500 -- (-743.250) (-744.915) [-745.297] (-752.136) * (-745.586) (-749.035) (-746.608) [-746.574] -- 0:00:07
931000 -- [-746.639] (-744.123) (-746.290) (-745.505) * (-740.458) (-746.200) [-744.564] (-742.432) -- 0:00:07
931500 -- (-743.143) [-743.077] (-748.094) (-747.498) * (-746.721) [-747.590] (-749.383) (-745.549) -- 0:00:07
932000 -- (-748.722) (-744.288) (-745.919) [-747.166] * (-751.124) [-746.563] (-749.128) (-747.392) -- 0:00:07
932500 -- (-745.565) [-745.542] (-745.070) (-748.270) * (-753.301) [-744.544] (-744.629) (-746.943) -- 0:00:06
933000 -- (-743.660) [-741.941] (-752.515) (-752.793) * (-754.039) (-750.751) [-750.419] (-743.526) -- 0:00:06
933500 -- [-741.215] (-744.180) (-750.274) (-748.973) * (-749.547) [-744.509] (-748.493) (-748.730) -- 0:00:06
934000 -- [-741.675] (-745.182) (-747.655) (-745.228) * [-749.434] (-757.910) (-742.852) (-744.117) -- 0:00:06
934500 -- (-745.008) (-746.723) (-753.154) [-743.196] * (-745.434) (-750.017) (-746.968) [-746.249] -- 0:00:06
935000 -- (-743.850) [-743.656] (-748.004) (-745.770) * [-751.944] (-752.760) (-747.350) (-745.689) -- 0:00:06
Average standard deviation of split frequencies: 0.005708
935500 -- (-746.362) (-746.881) (-744.008) [-743.998] * (-746.295) (-747.926) [-742.780] (-745.243) -- 0:00:06
936000 -- [-745.791] (-746.284) (-751.466) (-745.118) * (-745.504) (-745.168) [-742.597] (-743.728) -- 0:00:06
936500 -- (-744.957) [-745.968] (-751.347) (-746.359) * (-743.605) (-746.884) [-741.814] (-747.072) -- 0:00:06
937000 -- (-744.271) (-744.125) (-742.513) [-745.442] * [-745.682] (-748.877) (-752.179) (-745.465) -- 0:00:06
937500 -- (-752.642) [-741.618] (-744.139) (-742.643) * [-744.564] (-753.769) (-739.516) (-748.602) -- 0:00:06
938000 -- (-750.290) [-740.723] (-757.207) (-746.010) * (-744.345) (-743.963) (-747.981) [-745.414] -- 0:00:06
938500 -- (-751.333) (-742.582) (-751.839) [-747.702] * (-743.962) (-752.072) (-747.206) [-753.967] -- 0:00:06
939000 -- (-750.740) (-742.632) (-747.349) [-745.183] * (-741.062) (-744.160) (-745.111) [-742.453] -- 0:00:06
939500 -- (-748.005) (-746.158) [-741.397] (-743.550) * [-742.745] (-742.087) (-749.479) (-743.157) -- 0:00:06
940000 -- (-744.955) (-745.651) (-742.808) [-745.877] * [-745.539] (-745.752) (-752.131) (-745.832) -- 0:00:06
Average standard deviation of split frequencies: 0.006014
940500 -- [-748.978] (-741.513) (-749.937) (-743.896) * (-754.927) (-748.075) (-746.998) [-746.404] -- 0:00:06
941000 -- [-755.957] (-744.333) (-751.925) (-747.209) * (-746.117) [-746.278] (-742.824) (-748.479) -- 0:00:06
941500 -- [-745.913] (-744.702) (-747.167) (-749.947) * (-745.946) (-742.046) [-749.959] (-744.560) -- 0:00:06
942000 -- (-743.439) (-744.284) (-749.124) [-749.816] * (-747.040) (-748.266) [-743.309] (-744.240) -- 0:00:05
942500 -- (-746.112) (-748.619) [-743.088] (-742.445) * (-746.458) [-740.475] (-746.217) (-750.990) -- 0:00:05
943000 -- (-750.126) (-747.956) [-744.381] (-742.297) * (-751.194) [-748.252] (-744.258) (-751.719) -- 0:00:05
943500 -- (-744.141) (-749.406) [-749.733] (-747.617) * (-746.270) (-743.955) [-744.167] (-747.968) -- 0:00:05
944000 -- (-747.234) (-742.000) [-746.199] (-743.163) * (-751.395) [-746.727] (-746.656) (-746.910) -- 0:00:05
944500 -- (-742.031) [-746.635] (-743.326) (-747.926) * (-753.119) [-745.028] (-748.348) (-748.986) -- 0:00:05
945000 -- (-744.668) (-745.851) (-745.775) [-748.256] * (-756.452) (-745.969) [-745.023] (-745.013) -- 0:00:05
Average standard deviation of split frequencies: 0.003737
945500 -- [-741.582] (-745.113) (-742.773) (-747.475) * [-749.676] (-750.249) (-745.358) (-743.584) -- 0:00:05
946000 -- (-745.410) [-741.168] (-745.006) (-748.069) * (-743.651) (-751.804) (-746.126) [-746.800] -- 0:00:05
946500 -- (-749.953) (-741.410) [-746.434] (-744.764) * [-745.311] (-744.648) (-744.586) (-750.225) -- 0:00:05
947000 -- (-741.452) (-746.252) (-746.916) [-747.651] * (-742.528) (-751.577) [-744.711] (-746.238) -- 0:00:05
947500 -- [-743.698] (-747.384) (-743.598) (-751.829) * (-744.941) (-752.229) (-743.547) [-746.410] -- 0:00:05
948000 -- (-744.248) [-743.942] (-741.063) (-744.603) * (-742.439) (-753.742) [-740.875] (-746.187) -- 0:00:05
948500 -- (-745.682) (-743.726) (-743.841) [-745.304] * (-744.232) (-751.601) [-745.242] (-746.407) -- 0:00:05
949000 -- (-753.506) [-742.225] (-745.610) (-747.977) * (-751.904) (-749.591) [-745.161] (-748.334) -- 0:00:05
949500 -- (-749.611) [-741.724] (-749.053) (-745.894) * (-758.250) [-747.466] (-743.513) (-754.353) -- 0:00:05
950000 -- (-742.697) (-748.305) [-746.140] (-748.113) * (-753.850) (-744.898) [-742.442] (-743.480) -- 0:00:05
Average standard deviation of split frequencies: 0.003719
950500 -- (-746.918) [-746.425] (-742.701) (-751.046) * (-752.832) [-746.727] (-748.479) (-744.778) -- 0:00:05
951000 -- [-744.788] (-748.038) (-743.224) (-742.884) * (-749.047) (-753.806) [-744.054] (-743.626) -- 0:00:05
951500 -- (-742.377) (-748.136) (-745.761) [-742.621] * (-748.688) [-743.813] (-747.694) (-746.521) -- 0:00:04
952000 -- (-744.760) (-744.287) (-747.935) [-752.277] * (-746.786) [-745.935] (-746.469) (-750.200) -- 0:00:04
952500 -- [-740.432] (-743.473) (-745.479) (-752.785) * (-747.393) (-749.244) (-748.681) [-743.359] -- 0:00:04
953000 -- (-746.765) (-746.351) (-745.647) [-745.898] * (-742.730) (-746.536) [-748.861] (-745.419) -- 0:00:04
953500 -- (-742.247) (-745.226) (-752.472) [-740.707] * (-749.654) (-742.664) [-748.473] (-746.585) -- 0:00:04
954000 -- [-749.981] (-755.503) (-744.555) (-749.493) * [-743.474] (-752.573) (-750.867) (-742.973) -- 0:00:04
954500 -- (-753.849) (-745.737) (-742.062) [-746.271] * (-749.225) (-748.194) [-743.423] (-743.143) -- 0:00:04
955000 -- (-754.457) (-753.173) [-745.678] (-752.159) * (-752.280) (-742.118) (-749.670) [-741.110] -- 0:00:04
Average standard deviation of split frequencies: 0.003698
955500 -- (-743.896) (-742.438) [-746.999] (-752.993) * (-747.232) [-744.274] (-747.547) (-746.889) -- 0:00:04
956000 -- (-745.854) [-744.032] (-744.127) (-745.426) * (-744.899) [-742.197] (-751.342) (-747.225) -- 0:00:04
956500 -- (-747.602) [-744.410] (-746.661) (-745.375) * [-741.875] (-746.269) (-748.602) (-747.061) -- 0:00:04
957000 -- (-742.484) [-743.757] (-743.559) (-745.570) * (-747.481) [-748.660] (-755.675) (-754.434) -- 0:00:04
957500 -- (-745.955) (-748.818) [-740.591] (-742.875) * (-748.667) (-743.356) (-749.535) [-743.895] -- 0:00:04
958000 -- [-742.922] (-741.103) (-742.009) (-742.114) * (-751.360) (-741.076) (-746.150) [-742.653] -- 0:00:04
958500 -- (-750.323) (-748.410) (-748.261) [-744.252] * (-747.630) (-746.103) (-745.813) [-749.452] -- 0:00:04
959000 -- (-746.679) (-742.451) [-744.413] (-739.897) * (-745.639) [-744.060] (-743.631) (-750.572) -- 0:00:04
959500 -- (-745.638) (-746.291) [-743.203] (-741.544) * [-748.691] (-742.150) (-752.375) (-749.316) -- 0:00:04
960000 -- (-743.989) (-744.194) (-745.889) [-741.142] * (-748.441) (-744.519) [-744.779] (-742.158) -- 0:00:04
Average standard deviation of split frequencies: 0.003435
960500 -- (-751.942) (-743.423) (-749.712) [-743.938] * (-745.426) [-742.200] (-746.371) (-745.208) -- 0:00:04
961000 -- (-741.026) (-753.509) [-742.645] (-748.996) * (-744.735) (-747.864) (-748.254) [-748.829] -- 0:00:04
961500 -- (-742.847) (-749.731) (-743.925) [-742.213] * [-743.339] (-746.442) (-750.943) (-749.040) -- 0:00:03
962000 -- (-747.467) (-746.523) (-744.327) [-743.431] * (-749.576) [-744.483] (-750.714) (-747.898) -- 0:00:03
962500 -- (-744.515) (-747.780) [-745.232] (-745.106) * (-746.733) (-742.278) (-747.636) [-744.884] -- 0:00:03
963000 -- (-747.038) (-749.567) [-744.203] (-743.784) * (-745.209) (-750.034) (-742.498) [-741.783] -- 0:00:03
963500 -- (-748.055) (-748.607) (-750.912) [-745.718] * (-742.306) (-743.441) [-745.049] (-748.663) -- 0:00:03
964000 -- (-753.308) [-746.419] (-751.108) (-743.906) * (-744.620) (-740.700) [-743.623] (-746.347) -- 0:00:03
964500 -- (-745.246) (-749.102) [-738.786] (-743.260) * [-746.426] (-744.061) (-743.487) (-742.565) -- 0:00:03
965000 -- (-743.920) (-747.349) (-743.113) [-745.057] * (-746.095) (-745.672) (-743.952) [-742.630] -- 0:00:03
Average standard deviation of split frequencies: 0.003904
965500 -- (-749.394) (-753.354) (-746.531) [-746.253] * [-743.566] (-746.428) (-746.061) (-749.932) -- 0:00:03
966000 -- [-745.526] (-749.930) (-748.212) (-745.001) * (-750.969) (-749.269) (-749.873) [-745.693] -- 0:00:03
966500 -- (-748.213) [-749.855] (-744.232) (-751.164) * [-745.041] (-748.229) (-746.623) (-752.950) -- 0:00:03
967000 -- [-743.314] (-755.343) (-746.476) (-746.239) * [-743.078] (-746.281) (-744.020) (-741.985) -- 0:00:03
967500 -- (-743.075) (-745.295) [-743.853] (-746.721) * (-744.178) (-743.283) [-745.538] (-753.271) -- 0:00:03
968000 -- (-742.301) [-745.924] (-740.773) (-749.964) * (-744.778) (-744.658) [-740.186] (-747.877) -- 0:00:03
968500 -- (-747.862) (-749.280) (-742.042) [-745.041] * (-744.420) [-742.654] (-745.569) (-745.622) -- 0:00:03
969000 -- (-745.723) [-746.992] (-746.204) (-743.789) * (-742.482) (-748.269) [-744.976] (-754.119) -- 0:00:03
969500 -- (-743.421) (-749.657) (-746.851) [-741.594] * (-746.382) (-742.982) [-742.190] (-743.597) -- 0:00:03
970000 -- [-749.028] (-742.946) (-744.101) (-748.231) * (-744.146) [-745.367] (-749.274) (-744.725) -- 0:00:03
Average standard deviation of split frequencies: 0.004128
970500 -- (-746.501) [-741.486] (-743.087) (-742.775) * (-743.633) [-746.734] (-749.627) (-747.061) -- 0:00:03
971000 -- (-748.050) (-741.401) (-743.096) [-743.444] * (-747.873) (-743.349) (-751.223) [-746.559] -- 0:00:02
971500 -- (-751.954) (-738.531) (-745.378) [-741.662] * (-747.314) [-743.014] (-745.828) (-746.673) -- 0:00:02
972000 -- (-750.513) [-739.115] (-746.285) (-745.345) * (-748.718) [-743.168] (-745.649) (-745.603) -- 0:00:02
972500 -- (-749.498) (-741.527) (-744.957) [-744.536] * (-745.960) [-745.595] (-746.641) (-746.589) -- 0:00:02
973000 -- [-742.559] (-747.756) (-748.054) (-752.590) * (-746.748) (-745.611) (-749.595) [-741.721] -- 0:00:02
973500 -- [-749.578] (-750.589) (-744.013) (-743.445) * (-743.329) [-747.233] (-749.271) (-748.548) -- 0:00:02
974000 -- [-745.538] (-742.859) (-749.217) (-740.272) * (-748.413) [-745.936] (-750.608) (-745.631) -- 0:00:02
974500 -- (-745.464) (-744.284) [-744.864] (-746.407) * [-748.243] (-741.636) (-743.313) (-752.921) -- 0:00:02
975000 -- (-752.366) (-747.618) (-746.763) [-741.165] * (-744.405) [-744.309] (-746.766) (-749.389) -- 0:00:02
Average standard deviation of split frequencies: 0.005071
975500 -- (-753.194) (-741.286) (-745.682) [-742.712] * (-744.820) [-745.543] (-746.022) (-744.604) -- 0:00:02
976000 -- (-750.257) (-740.342) (-744.110) [-745.924] * (-742.752) [-744.735] (-747.980) (-742.814) -- 0:00:02
976500 -- [-743.119] (-746.884) (-744.911) (-746.180) * (-748.686) [-745.648] (-746.293) (-747.407) -- 0:00:02
977000 -- (-749.095) (-746.888) (-747.242) [-748.119] * (-749.856) (-742.214) [-744.861] (-746.938) -- 0:00:02
977500 -- (-744.369) (-747.225) [-746.632] (-742.130) * (-741.178) (-750.960) (-743.233) [-745.955] -- 0:00:02
978000 -- (-744.831) (-747.613) (-740.974) [-739.942] * (-741.492) [-749.016] (-751.867) (-741.709) -- 0:00:02
978500 -- (-742.896) (-748.985) (-742.739) [-743.434] * (-748.615) (-747.800) [-746.051] (-746.582) -- 0:00:02
979000 -- (-738.979) (-751.684) (-740.762) [-743.835] * (-746.146) (-745.650) [-742.829] (-742.556) -- 0:00:02
979500 -- (-744.526) (-744.620) (-745.182) [-745.638] * [-748.216] (-748.700) (-751.016) (-747.202) -- 0:00:02
980000 -- (-740.742) (-744.393) (-749.099) [-748.652] * (-740.737) [-755.696] (-744.260) (-743.948) -- 0:00:02
Average standard deviation of split frequencies: 0.004567
980500 -- [-745.285] (-741.651) (-745.314) (-749.998) * (-747.920) (-748.469) (-748.590) [-745.287] -- 0:00:02
981000 -- [-743.260] (-743.987) (-744.053) (-749.098) * (-740.880) (-750.682) (-744.175) [-744.548] -- 0:00:01
981500 -- (-753.446) [-747.515] (-747.836) (-744.071) * [-750.172] (-748.047) (-745.877) (-749.651) -- 0:00:01
982000 -- (-747.003) (-743.572) [-742.342] (-747.622) * (-759.205) [-745.595] (-745.548) (-747.135) -- 0:00:01
982500 -- [-744.897] (-747.433) (-753.898) (-750.045) * [-748.780] (-748.551) (-743.135) (-752.716) -- 0:00:01
983000 -- (-747.969) [-745.319] (-744.811) (-746.596) * (-749.178) [-742.974] (-748.071) (-752.665) -- 0:00:01
983500 -- [-750.234] (-744.382) (-750.721) (-742.710) * (-748.231) (-744.145) [-744.760] (-753.940) -- 0:00:01
984000 -- (-746.189) [-748.595] (-744.193) (-749.036) * (-746.990) [-743.517] (-745.387) (-754.391) -- 0:00:01
984500 -- [-746.706] (-744.676) (-744.664) (-745.046) * [-746.136] (-744.390) (-742.648) (-754.388) -- 0:00:01
985000 -- (-750.445) (-748.344) (-744.838) [-742.395] * (-751.105) (-747.568) (-746.173) [-749.328] -- 0:00:01
Average standard deviation of split frequencies: 0.004303
985500 -- (-749.218) [-744.067] (-744.216) (-755.059) * (-745.694) [-743.693] (-747.127) (-748.564) -- 0:00:01
986000 -- [-743.820] (-747.021) (-743.229) (-744.175) * (-750.333) (-743.248) [-742.098] (-744.300) -- 0:00:01
986500 -- (-744.213) [-741.703] (-743.518) (-741.707) * (-749.868) (-743.359) [-745.195] (-748.110) -- 0:00:01
987000 -- (-761.788) (-748.887) [-742.974] (-747.361) * (-748.339) (-744.729) [-742.165] (-748.630) -- 0:00:01
987500 -- (-753.864) [-743.766] (-745.561) (-756.610) * (-745.437) (-745.491) (-746.890) [-745.845] -- 0:00:01
988000 -- (-748.284) (-747.033) (-742.504) [-743.466] * (-743.252) (-749.095) [-743.522] (-745.499) -- 0:00:01
988500 -- (-745.410) (-745.484) [-741.416] (-748.306) * (-745.589) (-755.026) (-744.379) [-747.619] -- 0:00:01
989000 -- [-746.081] (-746.805) (-742.942) (-746.479) * [-743.915] (-743.929) (-744.318) (-748.355) -- 0:00:01
989500 -- (-740.924) (-744.707) (-748.508) [-747.112] * (-742.150) (-752.668) (-745.975) [-743.290] -- 0:00:01
990000 -- (-753.934) (-745.231) [-739.611] (-747.589) * [-749.649] (-755.314) (-746.663) (-746.335) -- 0:00:01
Average standard deviation of split frequencies: 0.004045
990500 -- (-747.494) [-745.737] (-744.225) (-749.619) * (-747.563) [-742.518] (-744.619) (-754.471) -- 0:00:00
991000 -- (-755.463) (-751.541) (-746.431) [-751.488] * (-749.644) (-743.842) [-746.997] (-742.404) -- 0:00:00
991500 -- [-749.480] (-744.266) (-746.857) (-747.523) * (-742.032) (-748.130) (-749.981) [-741.678] -- 0:00:00
992000 -- [-742.929] (-742.967) (-742.092) (-745.498) * (-742.882) (-741.887) (-746.778) [-750.923] -- 0:00:00
992500 -- [-742.729] (-746.742) (-748.477) (-752.315) * (-745.875) (-743.457) (-743.350) [-741.875] -- 0:00:00
993000 -- [-743.433] (-746.489) (-747.841) (-750.203) * (-748.769) (-746.764) (-751.458) [-748.277] -- 0:00:00
993500 -- [-743.583] (-747.254) (-745.283) (-747.773) * [-743.258] (-751.465) (-747.880) (-747.694) -- 0:00:00
994000 -- [-749.530] (-744.484) (-744.460) (-745.660) * (-744.580) (-751.454) (-745.067) [-745.806] -- 0:00:00
994500 -- [-749.148] (-747.002) (-744.651) (-746.191) * (-753.082) (-743.731) [-742.538] (-746.971) -- 0:00:00
995000 -- (-746.927) (-742.068) [-748.089] (-748.602) * (-750.807) (-747.602) [-743.045] (-746.267) -- 0:00:00
Average standard deviation of split frequencies: 0.003786
995500 -- [-748.790] (-749.195) (-745.101) (-751.486) * (-747.876) (-744.170) (-745.520) [-744.370] -- 0:00:00
996000 -- (-747.254) (-743.368) (-750.013) [-743.409] * (-746.613) (-747.493) (-743.943) [-744.553] -- 0:00:00
996500 -- (-745.655) (-743.461) [-744.457] (-744.893) * (-746.841) (-744.285) (-740.294) [-746.556] -- 0:00:00
997000 -- (-743.764) (-747.208) (-747.581) [-744.305] * (-745.253) (-746.896) [-746.113] (-751.028) -- 0:00:00
997500 -- (-745.421) (-749.987) [-750.995] (-743.038) * (-743.531) [-744.321] (-742.276) (-751.928) -- 0:00:00
998000 -- (-748.481) [-746.725] (-744.160) (-754.889) * (-745.048) (-744.963) (-743.791) [-747.196] -- 0:00:00
998500 -- (-755.174) (-747.282) (-743.110) [-744.954] * [-746.118] (-747.514) (-749.707) (-747.602) -- 0:00:00
999000 -- (-749.208) [-744.836] (-746.832) (-745.417) * (-744.355) (-742.133) (-748.516) [-744.464] -- 0:00:00
999500 -- (-745.412) [-740.954] (-748.804) (-743.688) * [-745.640] (-745.144) (-741.618) (-756.926) -- 0:00:00
1000000 -- (-750.739) (-758.467) (-750.389) [-742.977] * (-747.040) (-743.253) (-747.326) [-751.274] -- 0:00:00
Average standard deviation of split frequencies: 0.004004
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -750.738948 -- 12.487032
Chain 1 -- -750.738948 -- 12.487032
Chain 2 -- -758.467156 -- 11.403617
Chain 2 -- -758.467156 -- 11.403617
Chain 3 -- -750.388922 -- 11.675439
Chain 3 -- -750.388922 -- 11.675439
Chain 4 -- -742.976569 -- 9.292610
Chain 4 -- -742.976569 -- 9.292610
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -747.040444 -- 9.771695
Chain 1 -- -747.040444 -- 9.771695
Chain 2 -- -743.252993 -- 3.790863
Chain 2 -- -743.252993 -- 3.790863
Chain 3 -- -747.326237 -- 13.035872
Chain 3 -- -747.326237 -- 13.035872
Chain 4 -- -751.273565 -- 12.355702
Chain 4 -- -751.273563 -- 12.355702
Analysis completed in 1 mins 43 seconds
Analysis used 102.52 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -737.35
Likelihood of best state for "cold" chain of run 2 was -737.35
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
44.0 % ( 32 %) Dirichlet(Revmat{all})
64.6 % ( 49 %) Slider(Revmat{all})
32.1 % ( 32 %) Dirichlet(Pi{all})
33.0 % ( 22 %) Slider(Pi{all})
59.8 % ( 30 %) Multiplier(Alpha{1,2})
46.4 % ( 23 %) Multiplier(Alpha{3})
65.1 % ( 42 %) Slider(Pinvar{all})
30.2 % ( 32 %) NNI(Tau{all},V{all})
24.1 % ( 27 %) ParsSPR(Tau{all},V{all})
26.4 % ( 26 %) Multiplier(V{all})
40.7 % ( 37 %) Nodeslider(V{all})
26.4 % ( 34 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
44.4 % ( 31 %) Dirichlet(Revmat{all})
64.6 % ( 52 %) Slider(Revmat{all})
32.0 % ( 32 %) Dirichlet(Pi{all})
31.5 % ( 25 %) Slider(Pi{all})
60.0 % ( 28 %) Multiplier(Alpha{1,2})
46.9 % ( 29 %) Multiplier(Alpha{3})
64.9 % ( 43 %) Slider(Pinvar{all})
30.3 % ( 20 %) NNI(Tau{all},V{all})
24.0 % ( 18 %) ParsSPR(Tau{all},V{all})
26.3 % ( 30 %) Multiplier(V{all})
40.6 % ( 36 %) Nodeslider(V{all})
26.2 % ( 28 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.84 0.70 0.58
2 | 166931 0.86 0.72
3 | 166201 166470 0.86
4 | 166881 167441 166076
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.84 0.70 0.58
2 | 166368 0.85 0.72
3 | 166772 166484 0.87
4 | 166829 166704 166843
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -743.83
| 2 1 1 |
| 2 2 2 |
| 1 1 1 * 1 1 2 12 |
| 2 1 1 22 1 2 1 1 |
|112 11 2 2 12 11 2 2 12 2 1 |
|2 1 1 1 * 2 1 1122 221 22 2 |
| 1* 1 1 11 1 12211 * 1|
| 1 2 22 2 2 1 121 2|
| 2 2 1 2 1 *2 2 * 1 2 1 2 2 |
| 22 1 2 12 1 2 2 |
| 2 1 2 1 1 |
| 2 2 |
| |
| |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -747.18
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -742.50 -751.52
2 -742.57 -752.69
--------------------------------------
TOTAL -742.54 -752.27
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.465374 0.014658 0.267025 0.716394 0.444457 1027.48 1154.69 1.000
r(A<->C){all} 0.206571 0.005772 0.070171 0.359691 0.198798 463.96 656.87 1.000
r(A<->G){all} 0.070161 0.000967 0.020661 0.135151 0.065027 866.38 899.90 1.000
r(A<->T){all} 0.122038 0.004655 0.001412 0.248251 0.114263 503.14 651.14 1.000
r(C<->G){all} 0.016854 0.000217 0.000003 0.045159 0.012710 984.58 995.18 1.000
r(C<->T){all} 0.576538 0.007704 0.414927 0.751283 0.578010 535.87 563.71 1.000
r(G<->T){all} 0.007838 0.000062 0.000006 0.023058 0.005387 1083.84 1085.55 1.000
pi(A){all} 0.201540 0.000395 0.163875 0.240629 0.200672 810.85 1060.95 1.000
pi(C){all} 0.209482 0.000392 0.170932 0.248240 0.209206 1250.45 1323.77 1.000
pi(G){all} 0.377836 0.000626 0.326531 0.424200 0.377303 1241.45 1327.41 1.001
pi(T){all} 0.211143 0.000401 0.172406 0.251682 0.210190 1255.58 1314.12 1.000
alpha{1,2} 0.057268 0.002017 0.000103 0.143223 0.048292 1477.05 1489.02 1.000
alpha{3} 1.482187 0.472265 0.409050 2.820119 1.352726 1324.18 1383.16 1.000
pinvar{all} 0.343644 0.014084 0.094017 0.557037 0.354884 1412.63 1451.10 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
Key to taxon bipartitions (saved to file "/opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
----------
1 -- .***
2 -- .*..
3 -- ..*.
4 -- ...*
5 -- .**.
6 -- .*.*
----------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
5 2180 0.726183 0.006595 0.721519 0.730846 2
6 543 0.180879 0.001413 0.179880 0.181879 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.113996 0.001985 0.027128 0.198202 0.108531 1.000 2
length{all}[2] 0.011519 0.000101 0.000010 0.031393 0.008886 1.000 2
length{all}[3] 0.027614 0.000204 0.004116 0.056053 0.025687 1.000 2
length{all}[4] 0.278299 0.009126 0.128178 0.473462 0.261436 1.000 2
length{all}[5] 0.042257 0.001102 0.000013 0.107360 0.034549 1.000 2
length{all}[6] 0.013033 0.000113 0.000033 0.034970 0.009983 0.998 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.004004
Maximum standard deviation of split frequencies = 0.006595
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.000
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C4 (4)
+
| /------------------------------------ C2 (2)
\-----------------73----------------+
\------------------------------------ C3 (3)
Phylogram (based on average branch lengths):
/------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C4 (4)
+
| /-- C2 (2)
\---------+
\------- C3 (3)
|------------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3 trees sampled):
90 % credible set contains 2 trees
95 % credible set contains 3 trees
99 % credible set contains 3 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 4 ls = 363
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Sites with gaps or missing data are removed.
9 ambiguity characters in seq. 1
15 ambiguity characters in seq. 2
9 ambiguity characters in seq. 3
18 ambiguity characters in seq. 4
6 sites are removed. 84 88 89 119 120 121
Sequences read..
Counting site patterns.. 0:00
85 patterns at 115 / 115 sites (100.0%), 0:00
Counting codons..
48 bytes for distance
82960 bytes for conP
11560 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 4, (2, 3)); MP score: 56
0.158194 0.321168 0.042171 0.004263 0.058417 0.300000 1.300000
ntime & nrate & np: 5 2 7
Bounds (np=7):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 7
lnL0 = -747.527305
Iterating by ming2
Initial: fx= 747.527305
x= 0.15819 0.32117 0.04217 0.00426 0.05842 0.30000 1.30000
1 h-m-p 0.0000 0.0001 112.0967 ++ 746.728168 m 0.0001 12 | 1/7
2 h-m-p 0.0000 0.0022 174.0680 ++YCYCCC 738.226882 5 0.0015 32 | 1/7
3 h-m-p 0.0015 0.0074 27.9299 YCCCC 736.867280 4 0.0035 49 | 1/7
4 h-m-p 0.0007 0.0053 131.0407 YCCCC 734.131233 4 0.0017 66 | 1/7
5 h-m-p 0.0009 0.0047 199.1727 +YYYYYYCCCC 716.435292 10 0.0039 90 | 1/7
6 h-m-p 0.0290 0.1449 5.3341 CYC 716.225187 2 0.0076 103 | 0/7
7 h-m-p 0.0001 0.0018 464.3563 YYYCC 715.747244 4 0.0000 118 | 0/7
8 h-m-p 0.0151 0.4338 0.8170 ++YYYYYC 707.767553 5 0.2405 135 | 0/7
9 h-m-p 0.0598 0.2988 1.4924 CCC 705.856940 2 0.0629 156 | 0/7
10 h-m-p 0.1521 0.7607 0.5012 CCC 702.832727 2 0.2213 170 | 0/7
11 h-m-p 0.2277 8.0000 0.4872 YCCCC 697.688253 4 0.5255 194 | 0/7
12 h-m-p 1.3410 6.7051 0.1821 YCCCCC 692.345183 5 3.0031 220 | 0/7
13 h-m-p 1.6000 8.0000 0.1431 YYC 691.150175 2 2.1225 239 | 0/7
14 h-m-p 1.6000 8.0000 0.1537 YCC 690.142864 2 3.6682 259 | 0/7
15 h-m-p 1.6000 8.0000 0.1105 YCCC 689.510617 3 2.6376 281 | 0/7
16 h-m-p 1.6000 8.0000 0.0669 YCCC 689.173621 3 3.2876 303 | 0/7
17 h-m-p 1.6000 8.0000 0.0337 YCCC 689.106522 3 3.6711 325 | 0/7
18 h-m-p 1.6000 8.0000 0.0113 +YC 689.018923 1 4.0094 344 | 0/7
19 h-m-p 0.6024 8.0000 0.0750 +CCC 688.943665 2 3.2155 366 | 0/7
20 h-m-p 1.6000 8.0000 0.0136 CYC 688.932099 2 1.7023 386 | 0/7
21 h-m-p 1.6000 8.0000 0.0075 +YC 688.919977 1 4.0450 405 | 0/7
22 h-m-p 1.6000 8.0000 0.0107 YC 688.918007 1 1.0705 423 | 0/7
23 h-m-p 1.6000 8.0000 0.0055 YC 688.917903 1 1.2050 441 | 0/7
24 h-m-p 1.6000 8.0000 0.0017 C 688.917886 0 1.5371 458 | 0/7
25 h-m-p 1.6000 8.0000 0.0003 Y 688.917886 0 1.0766 475 | 0/7
26 h-m-p 1.6000 8.0000 0.0000 Y 688.917886 0 1.0696 492 | 0/7
27 h-m-p 1.6000 8.0000 0.0000 Y 688.917886 0 1.6000 509 | 0/7
28 h-m-p 1.6000 8.0000 0.0000 Y 688.917886 0 0.4000 526 | 0/7
29 h-m-p 0.0315 8.0000 0.0000 ---Y 688.917886 0 0.0001 546
Out..
lnL = -688.917886
547 lfun, 547 eigenQcodon, 2735 P(t)
Time used: 0:02
Model 1: NearlyNeutral
TREE # 1
(1, 4, (2, 3)); MP score: 56
0.158194 0.321168 0.042171 0.004263 0.058417 3.102345 0.755520 0.234606
ntime & nrate & np: 5 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 4.789722
np = 8
lnL0 = -693.409174
Iterating by ming2
Initial: fx= 693.409174
x= 0.15819 0.32117 0.04217 0.00426 0.05842 3.10234 0.75552 0.23461
1 h-m-p 0.0000 0.0095 60.7360 ++YYCCC 693.026104 4 0.0003 21 | 0/8
2 h-m-p 0.0003 0.0028 56.1087 ++ 690.275393 m 0.0028 32 | 0/8
3 h-m-p 0.0004 0.0018 88.2944 YCYCCC 689.044996 5 0.0008 51 | 0/8
4 h-m-p 0.0013 0.0066 13.0798 YYCC 688.973489 3 0.0009 66 | 0/8
5 h-m-p 0.0013 0.0133 9.1770 +YYYYCCC 688.789848 6 0.0054 86 | 0/8
6 h-m-p 0.0295 0.1474 1.1955 CCC 688.768601 2 0.0119 101 | 0/8
7 h-m-p 0.0149 0.3017 0.9501 YC 688.687672 1 0.0267 113 | 0/8
8 h-m-p 0.0216 0.1160 1.1744 YCCCC 687.782225 4 0.0467 139 | 0/8
9 h-m-p 1.1815 6.6537 0.0464 YCC 687.740536 2 0.7860 153 | 0/8
10 h-m-p 1.5603 7.8015 0.0132 YCC 687.733398 2 1.1199 175 | 0/8
11 h-m-p 1.6000 8.0000 0.0070 YC 687.732790 1 0.6568 195 | 0/8
12 h-m-p 1.6000 8.0000 0.0017 YC 687.732770 1 0.9828 215 | 0/8
13 h-m-p 1.6000 8.0000 0.0005 Y 687.732770 0 0.9658 234 | 0/8
14 h-m-p 1.6000 8.0000 0.0000 Y 687.732770 0 1.0442 253 | 0/8
15 h-m-p 0.5841 8.0000 0.0000 C 687.732770 0 0.7841 272 | 0/8
16 h-m-p 1.6000 8.0000 0.0000 -----Y 687.732770 0 0.0004 296
Out..
lnL = -687.732770
297 lfun, 891 eigenQcodon, 2970 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 4, (2, 3)); MP score: 56
initial w for M2:NSpselection reset.
0.158194 0.321168 0.042171 0.004263 0.058417 3.078916 1.079469 0.409056 0.257593 2.430889
ntime & nrate & np: 5 3 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 3.356969
np = 10
lnL0 = -702.744784
Iterating by ming2
Initial: fx= 702.744784
x= 0.15819 0.32117 0.04217 0.00426 0.05842 3.07892 1.07947 0.40906 0.25759 2.43089
1 h-m-p 0.0000 0.0149 49.4650 +++YCCCC 702.313984 4 0.0004 25 | 0/10
2 h-m-p 0.0002 0.0010 47.6774 ++ 701.573450 m 0.0010 38 | 0/10
3 h-m-p 0.0012 0.0062 41.2460 ++ 696.347516 m 0.0062 51 | 1/10
4 h-m-p 0.0017 0.0132 75.0712 YCCC 694.897699 3 0.0042 69 | 1/10
5 h-m-p 0.0003 0.0016 137.1774 +CCC 694.135322 2 0.0014 87 | 1/10
6 h-m-p 0.0017 0.0083 16.8771 ++ 693.380754 m 0.0083 100 | 1/10
7 h-m-p 0.0719 0.8645 1.9468 +CYCCC 689.952868 4 0.5036 122 | 0/10
8 h-m-p 0.0751 0.3754 2.6902 -YCC 689.939298 2 0.0029 139 | 0/10
9 h-m-p 0.0056 0.5614 1.3923 +++CCC 689.244808 2 0.3798 159 | 0/10
10 h-m-p 0.0784 0.3920 0.8013 ++ 688.649989 m 0.3920 172 | 1/10
11 h-m-p 0.3253 6.0266 0.7244 YC 688.197060 1 0.6923 196 | 1/10
12 h-m-p 1.6000 8.0000 0.2765 YYC 687.944999 2 1.3243 220 | 1/10
13 h-m-p 1.6000 8.0000 0.1227 YYC 687.793918 2 1.2604 244 | 0/10
14 h-m-p 0.4693 8.0000 0.3296 +YCCC 687.384432 3 3.9986 272 | 0/10
15 h-m-p 0.4564 8.0000 2.8872 CC 687.103124 1 0.4949 297 | 0/10
16 h-m-p 1.4379 7.1895 0.9782 CYCCC 685.922084 4 2.3625 317 | 0/10
17 h-m-p 0.3216 1.6079 1.9799 ++ 685.202142 m 1.6079 340 | 1/10
18 h-m-p 1.6000 8.0000 0.5397 CCCC 684.940195 3 1.8003 359 | 1/10
19 h-m-p 0.6533 8.0000 1.4871 +CCC 684.592451 2 2.5201 386 | 1/10
20 h-m-p 1.4741 8.0000 2.5424 YCCC 684.074390 3 2.8976 404 | 1/10
21 h-m-p 1.6000 8.0000 2.9034 CCCC 683.925954 3 0.7047 423 | 1/10
22 h-m-p 0.7634 8.0000 2.6804 +CCC 683.768093 2 2.8204 441 | 1/10
23 h-m-p 1.6000 8.0000 2.7124 YYCC 683.702929 3 2.3677 458 | 1/10
24 h-m-p 1.6000 8.0000 2.0259 CYC 683.689799 2 2.0432 474 | 1/10
25 h-m-p 1.6000 8.0000 1.2651 YC 683.687926 1 0.9294 488 | 1/10
26 h-m-p 1.2855 8.0000 0.9147 CC 683.687406 1 0.4588 503 | 1/10
27 h-m-p 1.3930 8.0000 0.3013 CC 683.687282 1 1.8421 527 | 1/10
28 h-m-p 1.6000 8.0000 0.0047 +Y 683.687098 0 7.0634 550 | 1/10
29 h-m-p 0.7695 8.0000 0.0430 Y 683.687084 0 1.3163 572 | 1/10
30 h-m-p 1.6000 8.0000 0.0033 C 683.687084 0 1.4111 594 | 1/10
31 h-m-p 1.6000 8.0000 0.0012 Y 683.687084 0 1.2778 616 | 1/10
32 h-m-p 1.6000 8.0000 0.0002 C 683.687084 0 1.6890 638 | 1/10
33 h-m-p 1.6000 8.0000 0.0001 Y 683.687084 0 1.1774 660 | 1/10
34 h-m-p 1.6000 8.0000 0.0000 ---C 683.687084 0 0.0063 685
Out..
lnL = -683.687084
686 lfun, 2744 eigenQcodon, 10290 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -693.295339 S = -656.244454 -30.398971
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 85 patterns 0:05
did 20 / 85 patterns 0:05
did 30 / 85 patterns 0:06
did 40 / 85 patterns 0:06
did 50 / 85 patterns 0:06
did 60 / 85 patterns 0:06
did 70 / 85 patterns 0:06
did 80 / 85 patterns 0:06
did 85 / 85 patterns 0:06
Time used: 0:06
Model 3: discrete
TREE # 1
(1, 4, (2, 3)); MP score: 56
0.158194 0.321168 0.042171 0.004263 0.058417 3.285070 0.408838 0.998206 0.076003 0.165170 0.249880
ntime & nrate & np: 5 4 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 6.249225
np = 11
lnL0 = -689.292531
Iterating by ming2
Initial: fx= 689.292531
x= 0.15819 0.32117 0.04217 0.00426 0.05842 3.28507 0.40884 0.99821 0.07600 0.16517 0.24988
1 h-m-p 0.0000 0.0426 110.6697 +CCCC 688.941827 3 0.0001 23 | 0/11
2 h-m-p 0.0004 0.0124 20.1748 YCCC 688.810086 3 0.0007 42 | 0/11
3 h-m-p 0.0046 0.0392 3.1543 YCC 688.771972 2 0.0080 59 | 0/11
4 h-m-p 0.0015 0.0075 12.2196 YCC 688.753486 2 0.0011 76 | 0/11
5 h-m-p 0.0025 0.0133 5.3868 ++ 688.668350 m 0.0133 90 | 0/11
6 h-m-p 0.0000 0.0000 16.9517
h-m-p: 1.91179305e-20 9.55896525e-20 1.69516946e+01 688.668350
.. | 0/11
7 h-m-p 0.0000 0.0156 6.0274 +++CCC 688.620057 2 0.0026 122 | 0/11
8 h-m-p 0.0005 0.0087 30.8453 YCC 688.600771 2 0.0002 139 | 0/11
9 h-m-p 0.0018 0.0886 3.9754 +YC 688.572726 1 0.0050 155 | 0/11
10 h-m-p 0.0018 0.0090 7.9972 YCC 688.558229 2 0.0015 172 | 0/11
11 h-m-p 0.0005 0.0026 5.9127 ++ 688.542049 m 0.0026 186 | 1/11
12 h-m-p 0.0012 0.0654 12.5399 ++CCCC 688.218442 3 0.0260 208 | 1/11
13 h-m-p 0.0571 0.2857 1.6685 CCC 688.199819 2 0.0137 226 | 1/11
14 h-m-p 0.0163 0.0854 1.4102 YCC 688.187434 2 0.0110 243 | 1/11
15 h-m-p 0.0517 8.0000 0.2991 ++YCCC 688.096090 3 1.6164 264 | 0/11
16 h-m-p 0.3770 8.0000 1.2824 -YCC 688.084716 2 0.0159 292 | 0/11
17 h-m-p 0.0354 8.0000 0.5741 +++CCCC 687.707579 3 3.0899 315 | 0/11
18 h-m-p 0.7117 3.5587 1.9052 YCYC 687.592746 3 0.4325 344 | 0/11
19 h-m-p 1.3441 8.0000 0.6131 CCC 687.242757 2 1.6655 362 | 0/11
20 h-m-p 1.6000 8.0000 0.4673 YCYC 686.831075 3 3.5496 391 | 0/11
21 h-m-p 0.7741 4.4301 2.1430 CYCC 686.305713 3 0.9230 421 | 0/11
22 h-m-p 0.3967 1.9834 0.6198 YYCC 686.248719 3 0.2656 439 | 0/11
23 h-m-p 0.2083 1.1990 0.7900 +YC 686.055644 1 0.6250 466 | 0/11
24 h-m-p 0.5024 2.5122 0.3410 ++ 685.730993 m 2.5122 491 | 0/11
25 h-m-p -0.0000 -0.0000 3.1489
h-m-p: -7.11727963e-18 -3.55863981e-17 3.14888720e+00 685.730993
.. | 0/11
26 h-m-p 0.0000 0.0135 7.8775 ++CCC 685.711170 2 0.0007 533 | 0/11
27 h-m-p 0.0004 0.0029 12.7915 CYC 685.697881 2 0.0004 550 | 0/11
28 h-m-p 0.0029 0.0145 1.4708 YC 685.696300 1 0.0015 565 | 0/11
29 h-m-p 0.0022 0.4452 1.0351 CC 685.695576 1 0.0019 581 | 0/11
30 h-m-p 0.0035 1.0153 0.5649 ++YC 685.682297 1 0.1145 598 | 0/11
31 h-m-p 0.0035 0.2000 18.5486 YC 685.651386 1 0.0086 624 | 0/11
32 h-m-p 0.0112 0.0560 5.6862 CYC 685.640353 2 0.0100 641 | 0/11
33 h-m-p 0.0187 0.2214 3.0508 ++ 685.447812 m 0.2214 655 | 0/11
34 h-m-p 0.0000 0.0000 1.6740
h-m-p: 5.51314399e-18 2.75657200e-17 1.67400095e+00 685.447812
.. | 0/11
35 h-m-p 0.0006 0.3031 2.2776 CC 685.447263 1 0.0002 682 | 0/11
36 h-m-p 0.0005 0.0138 0.8872 ++YC 685.444707 1 0.0074 699 | 0/11
37 h-m-p 0.0038 0.1218 1.7067 CC 685.442804 1 0.0036 726 | 0/11
38 h-m-p 0.0021 0.0666 2.9384 YC 685.438560 1 0.0052 741 | 0/11
39 h-m-p 0.0007 0.0033 4.4507 ++ 685.435063 m 0.0033 755 | 0/11
40 h-m-p 0.0027 0.0304 5.4514 YC 685.427953 1 0.0051 770 | 0/11
41 h-m-p 0.0117 0.0584 0.5377 CC 685.426852 1 0.0128 786 | 0/11
42 h-m-p 0.0030 0.0348 2.2766 ++ 685.403612 m 0.0348 811 | 0/11
43 h-m-p -0.0000 -0.0000 2.9538
h-m-p: -3.39496295e-19 -1.69748148e-18 2.95380827e+00 685.403612
.. | 0/11
44 h-m-p 0.0004 0.1913 0.8192 +YC 685.402645 1 0.0029 838 | 0/11
45 h-m-p 0.0004 0.0018 0.5810 ++ 685.402340 m 0.0018 863 | 0/11
46 h-m-p 0.0012 0.5860 1.2851 +YC 685.401571 1 0.0032 890 | 0/11
47 h-m-p 0.0003 0.0017 14.9372 ++ 685.397174 m 0.0017 904 | 0/11
48 h-m-p 0.0018 0.0615 14.6411 CC 685.390407 1 0.0026 920 | 0/11
49 h-m-p 0.0033 0.0166 1.8758 +YC 685.387042 1 0.0111 936 | 0/11
50 h-m-p 0.0007 0.0036 1.3476 ++ 685.385711 m 0.0036 950 | 0/11
51 h-m-p 0.0000 0.0000 21.4337
h-m-p: 8.51219519e-21 4.25609759e-20 2.14337140e+01 685.385711
.. | 0/11
52 h-m-p 0.0009 0.4292 0.7401 YC 685.385194 1 0.0019 976 | 0/11
53 h-m-p 0.0000 0.0001 3.7421 ++ 685.385023 m 0.0001 1001 | 1/11
54 h-m-p 0.0004 0.1813 1.0679 ++CC 685.382381 1 0.0086 1019 | 1/11
55 h-m-p 0.0018 0.0367 5.0443 CC 685.380810 1 0.0016 1035 | 1/11
56 h-m-p 0.0015 0.0350 5.2345 YC 685.376956 1 0.0031 1050 | 1/11
57 h-m-p 0.0019 0.0208 8.4260 YC 685.370882 1 0.0033 1065 | 1/11
58 h-m-p 0.0305 0.3659 0.9036 YC 685.370091 1 0.0051 1080 | 1/11
59 h-m-p 0.0160 8.0000 0.8527 +++CC 685.214323 1 1.2602 1109 | 1/11
60 h-m-p 0.7352 8.0000 1.4618 YCCC 684.921684 3 1.6277 1138 | 1/11
61 h-m-p 1.6000 8.0000 0.9663 +CC 684.293128 1 5.6157 1155 | 1/11
62 h-m-p 0.6704 3.3522 3.0367 YCCC 684.004912 3 1.4375 1184 | 1/11
63 h-m-p 1.3627 8.0000 3.2033 YCCC 683.900160 3 0.9612 1203 | 1/11
64 h-m-p 0.6698 5.1270 4.5970 CCCC 683.800117 3 0.8206 1223 | 1/11
65 h-m-p 0.9760 8.0000 3.8650 CCCC 683.725034 3 1.5225 1243 | 1/11
66 h-m-p 1.6000 8.0000 2.7462 YCC 683.709208 2 0.7108 1260 | 1/11
67 h-m-p 0.7700 8.0000 2.5352 YC 683.692879 1 1.3176 1275 | 1/11
68 h-m-p 1.5735 8.0000 2.1228 YCC 683.689185 2 0.9924 1292 | 1/11
69 h-m-p 1.6000 8.0000 0.5065 CC 683.688033 1 2.1281 1308 | 1/11
70 h-m-p 1.6000 8.0000 0.0638 CC 683.687425 1 2.2460 1334 | 1/11
71 h-m-p 1.6000 8.0000 0.0696 YC 683.687129 1 1.1825 1359 | 1/11
72 h-m-p 0.5117 8.0000 0.1608 +YC 683.687091 1 1.3121 1385 | 1/11
73 h-m-p 1.6000 8.0000 0.0166 Y 683.687086 0 1.1030 1409 | 1/11
74 h-m-p 1.6000 8.0000 0.0047 C 683.687085 0 2.2917 1433 | 1/11
75 h-m-p 1.6000 8.0000 0.0037 +Y 683.687084 0 5.0746 1458 | 1/11
76 h-m-p 1.6000 8.0000 0.0025 C 683.687084 0 1.9423 1482 | 1/11
77 h-m-p 1.6000 8.0000 0.0008 C 683.687084 0 1.4374 1506 | 1/11
78 h-m-p 1.6000 8.0000 0.0001 Y 683.687084 0 0.8267 1530 | 1/11
79 h-m-p 1.6000 8.0000 0.0000 -Y 683.687084 0 0.1000 1555 | 1/11
80 h-m-p 0.1476 8.0000 0.0000 --------------Y 683.687084 0 0.0000 1593
Out..
lnL = -683.687084
1594 lfun, 6376 eigenQcodon, 23910 P(t)
Time used: 0:13
Model 7: beta
TREE # 1
(1, 4, (2, 3)); MP score: 56
0.158194 0.321168 0.042171 0.004263 0.058417 3.285070 0.996708 1.805788
ntime & nrate & np: 5 1 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 4.943796
np = 8
lnL0 = -692.149462
Iterating by ming2
Initial: fx= 692.149462
x= 0.15819 0.32117 0.04217 0.00426 0.05842 3.28507 0.99671 1.80579
1 h-m-p 0.0001 0.1572 66.3886 YYCCC 691.937951 4 0.0001 19 | 0/8
2 h-m-p 0.0004 0.0044 21.7535 YCCC 691.778531 3 0.0008 35 | 0/8
3 h-m-p 0.0021 0.1277 8.2873 ++CYCCCC 690.140210 5 0.0525 57 | 0/8
4 h-m-p 0.0005 0.0027 251.9547 CYCCCC 689.149986 5 0.0009 77 | 0/8
5 h-m-p 0.0132 0.0661 9.6859 CYC 689.064164 2 0.0035 91 | 0/8
6 h-m-p 0.0215 0.9003 1.5813 +CYC 688.850706 2 0.0971 106 | 0/8
7 h-m-p 0.0040 0.0352 38.5724 YCCC 688.311921 3 0.0094 122 | 0/8
8 h-m-p 1.6000 8.0000 0.1239 YYC 688.286047 2 1.1846 135 | 0/8
9 h-m-p 1.6000 8.0000 0.0640 YC 688.279582 1 1.2220 155 | 0/8
10 h-m-p 0.9160 8.0000 0.0854 +YCC 688.268131 2 2.8012 178 | 0/8
11 h-m-p 0.9269 8.0000 0.2581 +YYYCC 688.209518 4 3.4642 203 | 0/8
12 h-m-p 0.2748 1.3742 1.0283 YCCCCC 688.193234 5 0.3590 231 | 0/8
13 h-m-p 1.6000 8.0000 0.1691 CYC 688.182291 2 0.3614 245 | 0/8
14 h-m-p 0.4590 8.0000 0.1331 CC 688.177335 1 0.6611 266 | 0/8
15 h-m-p 1.6000 8.0000 0.0446 YC 688.176840 1 0.9716 286 | 0/8
16 h-m-p 1.6000 8.0000 0.0065 Y 688.176804 0 1.1370 305 | 0/8
17 h-m-p 1.6000 8.0000 0.0012 C 688.176800 0 1.3032 324 | 0/8
18 h-m-p 1.6000 8.0000 0.0001 Y 688.176800 0 1.0018 343 | 0/8
19 h-m-p 1.6000 8.0000 0.0000 Y 688.176800 0 1.1540 362 | 0/8
20 h-m-p 1.6000 8.0000 0.0000 Y 688.176800 0 2.8289 381 | 0/8
21 h-m-p 1.6000 8.0000 0.0000 ---------C 688.176800 0 0.0000 409
Out..
lnL = -688.176800
410 lfun, 4510 eigenQcodon, 20500 P(t)
Time used: 0:18
Model 8: beta&w>1
TREE # 1
(1, 4, (2, 3)); MP score: 56
initial w for M8:NSbetaw>1 reset.
0.158194 0.321168 0.042171 0.004263 0.058417 3.099786 0.900000 0.709770 1.329016 2.821721
ntime & nrate & np: 5 2 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 4.095288
np = 10
lnL0 = -695.381965
Iterating by ming2
Initial: fx= 695.381965
x= 0.15819 0.32117 0.04217 0.00426 0.05842 3.09979 0.90000 0.70977 1.32902 2.82172
1 h-m-p 0.0000 0.0019 70.0184 +++YCCCC 693.214960 4 0.0011 25 | 0/10
2 h-m-p 0.0001 0.0005 98.0096 +YCCCC 691.792981 4 0.0004 46 | 0/10
3 h-m-p 0.0042 0.0743 10.3650 +CYYCCC 688.637899 5 0.0433 69 | 0/10
4 h-m-p 0.0008 0.0040 81.7752 YYC 688.378552 2 0.0007 84 | 0/10
5 h-m-p 0.0047 0.0372 11.5800 YCCC 688.283960 3 0.0026 102 | 0/10
6 h-m-p 0.0073 0.0364 3.3937 YC 688.262870 1 0.0035 116 | 0/10
7 h-m-p 0.0020 0.1629 5.9748 +CYC 688.174828 2 0.0097 133 | 0/10
8 h-m-p 0.0082 0.1445 7.0424 +CCCC 687.801344 3 0.0371 153 | 0/10
9 h-m-p 0.1996 0.9982 0.1144 +YYCCC 687.300027 4 0.6915 173 | 0/10
10 h-m-p 0.1532 8.0000 0.5164 +CCC 687.085910 2 0.8109 201 | 0/10
11 h-m-p 0.3181 1.5903 0.8558 +CCC 686.752760 2 1.3231 229 | 0/10
12 h-m-p 0.2186 1.0930 1.8388 +CYC 686.215139 2 0.9134 256 | 0/10
13 h-m-p 0.0123 0.0614 3.6970 ++ 686.119648 m 0.0614 269 | 0/10
14 h-m-p -0.0000 -0.0000 7.0995
h-m-p: -1.45167373e-19 -7.25836866e-19 7.09948533e+00 686.119648
.. | 0/10
15 h-m-p 0.0000 0.0070 50.7046 +YYCC 686.021510 3 0.0001 297 | 0/10
16 h-m-p 0.0003 0.0081 15.0394 CCC 685.977812 2 0.0004 314 | 0/10
17 h-m-p 0.0001 0.0003 15.1860 ++ 685.949304 m 0.0003 327 | 1/10
18 h-m-p 0.0019 0.0730 2.1714 C 685.944407 0 0.0019 340 | 1/10
19 h-m-p 0.0018 0.1732 2.3357 YC 685.942922 1 0.0010 354 | 1/10
20 h-m-p 0.0160 8.0000 0.3884 ++YCCC 685.911608 3 0.4555 374 | 1/10
21 h-m-p 0.0263 8.0000 6.7295 CCC 685.885065 2 0.0224 400 | 1/10
22 h-m-p 0.0125 1.0835 12.0059 +YCCC 685.712718 3 0.0872 419 | 1/10
23 h-m-p 0.9747 5.7458 1.0746 CCCC 685.449573 3 1.6010 438 | 1/10
24 h-m-p 1.0266 8.0000 1.6759 +YCCC 684.461962 3 5.2267 457 | 1/10
25 h-m-p 1.6000 8.0000 2.5523 CCC 684.196809 2 1.4313 474 | 1/10
26 h-m-p 0.8627 4.3133 3.8829 CCCCC 684.038432 4 1.0149 495 | 1/10
27 h-m-p 1.0588 8.0000 3.7220 YCCC 683.876716 3 2.4615 513 | 1/10
28 h-m-p 1.6000 8.0000 3.9147 YYC 683.816669 2 1.2688 528 | 1/10
29 h-m-p 1.3554 8.0000 3.6646 YC 683.788060 1 1.0924 542 | 1/10
30 h-m-p 1.3974 8.0000 2.8646 CC 683.776908 1 1.9709 557 | 1/10
31 h-m-p 1.6000 8.0000 0.5429 YC 683.775951 1 1.0728 571 | 1/10
32 h-m-p 1.6000 8.0000 0.1641 +CC 683.775246 1 5.5498 596 | 1/10
33 h-m-p 1.6000 8.0000 0.1486 +YC 683.773264 1 5.2732 620 | 1/10
34 h-m-p 1.6000 8.0000 0.0640 YC 683.772831 1 2.9996 643 | 1/10
35 h-m-p 1.6000 8.0000 0.0162 ++ 683.771571 m 8.0000 665 | 1/10
36 h-m-p 0.6695 8.0000 0.1930 +YC 683.770945 1 2.2698 689 | 1/10
37 h-m-p 1.6000 8.0000 0.0545 C 683.770891 0 1.7640 711 | 1/10
38 h-m-p 1.6000 8.0000 0.0431 ++ 683.770786 m 8.0000 733 | 1/10
39 h-m-p 1.6000 8.0000 0.0503 ++ 683.769704 m 8.0000 755 | 1/10
40 h-m-p 0.1966 8.0000 2.0472 +YC 683.764360 1 1.7730 779 | 1/10
41 h-m-p 1.6000 8.0000 1.4637 ++ 683.739092 m 8.0000 792 | 1/10
42 h-m-p 1.0006 5.1798 11.7030 +YCC 683.719000 2 3.0788 809 | 1/10
43 h-m-p 0.4453 2.2265 11.1953 +CC 683.709846 1 1.6750 825 | 1/10
44 h-m-p 0.1006 0.5030 12.0904 ++ 683.708250 m 0.5030 838 | 2/10
45 h-m-p 0.0765 7.5480 12.3537 ---C 683.708250 0 0.0003 854 | 2/10
46 h-m-p 0.0724 8.0000 0.0458 +C 683.708213 0 0.3715 868 | 2/10
47 h-m-p 0.1145 8.0000 0.1487 ---------------.. | 2/10
48 h-m-p 0.0009 0.4274 2.3354 --C 683.708178 0 0.0000 925 | 2/10
49 h-m-p 0.0016 0.7868 0.2683 Y 683.708136 0 0.0012 938 | 2/10
50 h-m-p 0.0053 2.6280 0.0668 Y 683.708112 0 0.0109 959 | 2/10
51 h-m-p 0.0043 1.6831 0.1690 C 683.708089 0 0.0053 980 | 2/10
52 h-m-p 0.0082 2.7066 0.1100 C 683.708068 0 0.0087 1001 | 2/10
53 h-m-p 0.4994 8.0000 0.0019 Y 683.708066 0 1.0651 1022 | 2/10
54 h-m-p 1.6000 8.0000 0.0007 ++ 683.708063 m 8.0000 1043 | 2/10
55 h-m-p 0.0484 8.0000 0.1149 ++C 683.708028 0 1.0406 1066 | 2/10
56 h-m-p 1.6000 8.0000 0.0027 ++ 683.708016 m 8.0000 1087 | 2/10
57 h-m-p 0.1931 8.0000 0.1113 ++Y 683.707950 0 2.3860 1110 | 2/10
58 h-m-p 1.6000 8.0000 0.1126 +C 683.707770 0 5.6047 1132 | 2/10
59 h-m-p 1.6000 8.0000 0.0036 Y 683.707770 0 0.8581 1153 | 2/10
60 h-m-p 1.6000 8.0000 0.0004 -------C 683.707770 0 0.0000 1181
Out..
lnL = -683.707770
1182 lfun, 14184 eigenQcodon, 65010 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -692.556891 S = -656.249737 -31.558473
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 85 patterns 0:37
did 20 / 85 patterns 0:37
did 30 / 85 patterns 0:37
did 40 / 85 patterns 0:38
did 50 / 85 patterns 0:38
did 60 / 85 patterns 0:38
did 70 / 85 patterns 0:38
did 80 / 85 patterns 0:38
did 85 / 85 patterns 0:38
Time used: 0:38
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=121
D_melanogaster_CG1840-PA MAYVDQNGRLWEKRPWDLRRVLDTFVGIWFAVKQLLASFLSPFTGNDSNG
D_sechellia_CG1840-PA MAYVDQYGRLWEKRPWDLKRVLDIFVGIWFAVKQLFASFLSPFTGNDSNG
D_simulans_CG1840-PA MAYVDQYGRLWEKRPWDLKRVLDIFVGIWFAVKQLFASFLSPFTGNDSNG
D_erecta_CG1840-PA MAYVDQNGRLWEKRPWDLRRVLAIFVGIWFAIKQLFASFLSPFTGNDNNG
****** ***********:*** *******:***:***********.**
D_melanogaster_CG1840-PA DNSRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGSGYRGGGLRPNRR
D_sechellia_CG1840-PA DNFRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGG--YRGGGLRPNPR
D_simulans_CG1840-PA DNFRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGGGYRGGGLRPNKR
D_erecta_CG1840-PA DNSRRGSGWGSSSWGGGGGGGGGGGGGGGGGGG-GGG--YGGGGLRPNRR
** ***.************************** *** * ******* *
D_melanogaster_CG1840-PA IGRIPPPSQSCNAGGCCG---
D_sechellia_CG1840-PA IGRIPPPSQSCSAGGCCGoo-
D_simulans_CG1840-PA IGRIPPPSQSCSAGGCCG---
D_erecta_CG1840-PA IGRIPPPSQSCSAGGCCGooo
***********.******
>D_melanogaster_CG1840-PA ATGGCGTACGTCGATCAAAATGGTCGTCTGTGGGAGAAACGTCCATGGGA CTTGAGACGAGTTTTGGACACATTCGTGGGTATATGGTTCGCCGTCAAAC AGTTGCTTGCATCGTTCCTGTCTCCATTCACTGGAAATGATAGCAACGGA GATAACTCCCGTCGAGGAAATGGATGGGGAAGTAGTAGCTGGGGCGGAGG GGGCGGTGGTGGTGGCGGCGGAGGCGGTGGCGGCGGAGGCGGTGGCGGAG GCGGAGGCGGTAGCGGTTATCGCGGAGGTGGATTAAGGCCTAATCGACGA ATTGGGCGCATTCCGCCCCCCTCCCAATCCTGCAATGCCGGAGGATGCTG CGGC--------- >D_sechellia_CG1840-PA ATGGCGTACGTCGATCAATATGGTCGTCTGTGGGAGAAACGTCCTTGGGA CTTGAAACGAGTTTTGGACATATTCGTGGGTATATGGTTCGCCGTCAAAC AGTTGTTTGCATCGTTCCTGTCTCCATTCACTGGAAATGATAGCAACGGA GATAACTTCCGTCGAGGAAATGGATGGGGAAGTAGCAGCTGGGGTGGAGG GGGCGGTGGTGGTGGCGGTGGTGGTGGTGGCGGAGGTGGTGGCGGTGGCG GCGGAGGTGGA------TATCGCGGAGGCGGATTAAGGCCTAACCCACGA ATTGGGCGCATTCCGCCCCCCTCCCAATCCTGCAGTGCCGGAGGATGCTG CGGC--------- >D_simulans_CG1840-PA ATGGCGTACGTCGATCAATATGGTCGTCTGTGGGAGAAACGTCCTTGGGA CTTGAAACGAGTTTTGGACATATTCGTGGGTATATGGTTCGCCGTCAAAC AGTTGTTTGCATCGTTCCTGTCTCCATTCACTGGAAATGATAGCAACGGA GATAACTTCCGTCGAGGAAATGGATGGGGAAGTAGCAGCTGGGGTGGAGG GGGCGGTGGTGGCGGCGGTGGCGGTGGTGGCGGAGGTGGTGGCGGTGGCG GTGGCGGCGGCGGTGGATATCGCGGAGGCGGATTAAGGCCTAACAAACGA ATTGGGCGCATTCCGCCCCCCTCCCAATCCTGCAGTGCCGGAGGATGCTG CGGC--------- >D_erecta_CG1840-PA ATGGCGTACGTCGATCAAAATGGTCGCCTATGGGAGAAACGTCCTTGGGA CTTGAGACGGGTTTTGGCCATCTTCGTGGGTATATGGTTTGCCATCAAGC AGTTGTTTGCATCGTTCCTGTCTCCATTCACTGGAAATGATAACAACGGA GACAACTCCCGTCGAGGAAGCGGATGGGGAAGTAGCAGCTGGGGCGGAGG CGGAGGAGGAGGTGGTGGTGGTGGTGGAGGTGGAGGCGGTGGAGGAGGA- --GGAGGTGGA------TATGGCGGAGGCGGATTAAGGCCCAACCGACGA ATTGGGCGCATACCGCCGCCCTCCCAATCCTGTAGTGCTGGAGGATGCTG CGGC---------
>D_melanogaster_CG1840-PA MAYVDQNGRLWEKRPWDLRRVLDTFVGIWFAVKQLLASFLSPFTGNDSNG DNSRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGSGYRGGGLRPNRR IGRIPPPSQSCNAGGCCG >D_sechellia_CG1840-PA MAYVDQYGRLWEKRPWDLKRVLDIFVGIWFAVKQLFASFLSPFTGNDSNG DNFRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGG--YRGGGLRPNPR IGRIPPPSQSCSAGGCCG >D_simulans_CG1840-PA MAYVDQYGRLWEKRPWDLKRVLDIFVGIWFAVKQLFASFLSPFTGNDSNG DNFRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGGGYRGGGLRPNKR IGRIPPPSQSCSAGGCCG >D_erecta_CG1840-PA MAYVDQNGRLWEKRPWDLRRVLAIFVGIWFAIKQLFASFLSPFTGNDNNG DNSRRGSGWGSSSWGGGGGGGGGGGGGGGGGGG-GGG--YGGGGLRPNRR IGRIPPPSQSCSAGGCCG
#NEXUS
[ID: 6353865116]
begin taxa;
dimensions ntax=4;
taxlabels
D_melanogaster_CG1840-PA
D_sechellia_CG1840-PA
D_simulans_CG1840-PA
D_erecta_CG1840-PA
;
end;
begin trees;
translate
1 D_melanogaster_CG1840-PA,
2 D_sechellia_CG1840-PA,
3 D_simulans_CG1840-PA,
4 D_erecta_CG1840-PA
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.1085313,4:0.2614363,(2:0.008886081,3:0.02568739)0.726:0.03454916);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.1085313,4:0.2614363,(2:0.008886081,3:0.02568739):0.03454916);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -742.50 -751.52
2 -742.57 -752.69
--------------------------------------
TOTAL -742.54 -752.27
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.465374 0.014658 0.267025 0.716394 0.444457 1027.48 1154.69 1.000
r(A<->C){all} 0.206571 0.005772 0.070171 0.359691 0.198798 463.96 656.87 1.000
r(A<->G){all} 0.070161 0.000967 0.020661 0.135151 0.065027 866.38 899.90 1.000
r(A<->T){all} 0.122038 0.004655 0.001412 0.248251 0.114263 503.14 651.14 1.000
r(C<->G){all} 0.016854 0.000217 0.000003 0.045159 0.012710 984.58 995.18 1.000
r(C<->T){all} 0.576538 0.007704 0.414927 0.751283 0.578010 535.87 563.71 1.000
r(G<->T){all} 0.007838 0.000062 0.000006 0.023058 0.005387 1083.84 1085.55 1.000
pi(A){all} 0.201540 0.000395 0.163875 0.240629 0.200672 810.85 1060.95 1.000
pi(C){all} 0.209482 0.000392 0.170932 0.248240 0.209206 1250.45 1323.77 1.000
pi(G){all} 0.377836 0.000626 0.326531 0.424200 0.377303 1241.45 1327.41 1.001
pi(T){all} 0.211143 0.000401 0.172406 0.251682 0.210190 1255.58 1314.12 1.000
alpha{1,2} 0.057268 0.002017 0.000103 0.143223 0.048292 1477.05 1489.02 1.000
alpha{3} 1.482187 0.472265 0.409050 2.820119 1.352726 1324.18 1383.16 1.000
pinvar{all} 0.343644 0.014084 0.094017 0.557037 0.354884 1412.63 1451.10 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/96/CG1840-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 4 ls = 115
Codon usage in sequences
------------------------------------------------------------------------------------------------------
Phe TTT 0 1 1 2 | Ser TCT 1 1 1 1 | Tyr TAT 1 2 2 1 | Cys TGT 0 0 0 1
TTC 4 5 5 3 | TCC 3 2 2 3 | TAC 1 1 1 1 | TGC 3 3 3 2
Leu TTA 1 1 1 1 | TCA 0 0 0 0 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0
TTG 3 3 3 3 | TCG 1 1 1 1 | TAG 0 0 0 0 | Trp TGG 5 5 5 5
------------------------------------------------------------------------------------------------------
Leu CTT 1 0 0 0 | Pro CCT 1 2 2 1 | His CAT 0 0 0 0 | Arg CGT 3 3 3 2
CTC 0 0 0 0 | CCC 2 2 2 2 | CAC 0 0 0 0 | CGC 2 2 2 2
CTA 0 0 0 1 | CCA 2 2 1 1 | Gln CAA 2 2 2 2 | CGA 4 3 3 3
CTG 2 2 2 1 | CCG 1 1 1 2 | CAG 1 1 1 1 | CGG 0 0 0 1
------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 1 | Thr ACT 1 1 1 1 | Asn AAT 5 2 2 2 | Ser AGT 2 2 2 2
ATC 0 0 0 2 | ACC 0 0 0 0 | AAC 2 3 3 4 | AGC 2 3 3 3
ATA 1 2 2 2 | ACA 1 0 0 0 | Lys AAA 2 3 4 1 | Arg AGA 1 0 0 1
Met ATG 1 1 1 1 | ACG 0 0 0 0 | AAG 0 0 0 1 | AGG 1 1 1 1
------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 | Ala GCT 0 0 0 1 | Asp GAT 3 3 3 2 | Gly GGT 9 14 11 10
GTC 2 2 2 1 | GCC 2 2 2 2 | GAC 2 2 2 2 | GGC 11 7 12 6
GTA 0 0 0 0 | GCA 1 1 1 1 | Glu GAA 0 0 0 0 | GGA 14 13 11 20
GTG 1 1 1 1 | GCG 1 1 1 1 | GAG 1 1 1 1 | GGG 2 2 2 1
------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_CG1840-PA
position 1: T:0.20000 C:0.18261 A:0.18261 G:0.43478
position 2: T:0.16522 C:0.14783 A:0.17391 G:0.51304
position 3: T:0.26087 C:0.31304 A:0.25217 G:0.17391
Average T:0.20870 C:0.21449 A:0.20290 G:0.37391
#2: D_sechellia_CG1840-PA
position 1: T:0.21739 C:0.17391 A:0.17391 G:0.43478
position 2: T:0.18261 C:0.13913 A:0.17391 G:0.50435
position 3: T:0.29565 C:0.29565 A:0.23478 G:0.17391
Average T:0.23188 C:0.20290 A:0.19420 G:0.37101
#3: D_simulans_CG1840-PA
position 1: T:0.21739 C:0.16522 A:0.18261 G:0.43478
position 2: T:0.18261 C:0.13043 A:0.18261 G:0.50435
position 3: T:0.26957 C:0.33913 A:0.21739 G:0.17391
Average T:0.22319 C:0.21159 A:0.19420 G:0.37101
#4: D_erecta_CG1840-PA
position 1: T:0.20870 C:0.16522 A:0.19130 G:0.43478
position 2: T:0.17391 C:0.14783 A:0.15652 G:0.52174
position 3: T:0.24348 C:0.28696 A:0.28696 G:0.18261
Average T:0.20870 C:0.20000 A:0.21159 G:0.37971
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 4 | Ser S TCT 4 | Tyr Y TAT 6 | Cys C TGT 1
TTC 17 | TCC 10 | TAC 4 | TGC 11
Leu L TTA 4 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 4 | TAG 0 | Trp W TGG 20
------------------------------------------------------------------------------
Leu L CTT 1 | Pro P CCT 6 | His H CAT 0 | Arg R CGT 11
CTC 0 | CCC 8 | CAC 0 | CGC 8
CTA 1 | CCA 6 | Gln Q CAA 8 | CGA 13
CTG 7 | CCG 5 | CAG 4 | CGG 1
------------------------------------------------------------------------------
Ile I ATT 7 | Thr T ACT 4 | Asn N AAT 11 | Ser S AGT 8
ATC 2 | ACC 0 | AAC 12 | AGC 11
ATA 7 | ACA 1 | Lys K AAA 10 | Arg R AGA 2
Met M ATG 4 | ACG 0 | AAG 1 | AGG 4
------------------------------------------------------------------------------
Val V GTT 4 | Ala A GCT 1 | Asp D GAT 11 | Gly G GGT 44
GTC 7 | GCC 8 | GAC 8 | GGC 36
GTA 0 | GCA 4 | Glu E GAA 0 | GGA 58
GTG 4 | GCG 4 | GAG 4 | GGG 7
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.21087 C:0.17174 A:0.18261 G:0.43478
position 2: T:0.17609 C:0.14130 A:0.17174 G:0.51087
position 3: T:0.26739 C:0.30870 A:0.24783 G:0.17609
Average T:0.21812 C:0.20725 A:0.20072 G:0.37391
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_CG1840-PA
D_sechellia_CG1840-PA 0.1387 (0.0280 0.2020)
D_simulans_CG1840-PA 0.1332 (0.0300 0.2252) 0.1339 (0.0078 0.0586)
D_erecta_CG1840-PA 0.0628 (0.0322 0.5134) 0.1046 (0.0362 0.3458) 0.0845 (0.0382 0.4520)
Model 0: one-ratio
TREE # 1: (1, 4, (2, 3)); MP score: 56
lnL(ntime: 5 np: 7): -688.917886 +0.000000
5..1 5..4 5..6 6..2 6..3
0.158960 0.330242 0.057483 0.012347 0.056926 3.102345 0.152005
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.61596
(1: 0.158960, 4: 0.330242, (2: 0.012347, 3: 0.056926): 0.057483);
(D_melanogaster_CG1840-PA: 0.158960, D_erecta_CG1840-PA: 0.330242, (D_sechellia_CG1840-PA: 0.012347, D_simulans_CG1840-PA: 0.056926): 0.057483);
Detailed output identifying parameters
kappa (ts/tv) = 3.10234
omega (dN/dS) = 0.15201
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.159 216.6 128.4 0.1520 0.0172 0.1133 3.7 14.5
5..4 0.330 216.6 128.4 0.1520 0.0358 0.2354 7.8 30.2
5..6 0.057 216.6 128.4 0.1520 0.0062 0.0410 1.3 5.3
6..2 0.012 216.6 128.4 0.1520 0.0013 0.0088 0.3 1.1
6..3 0.057 216.6 128.4 0.1520 0.0062 0.0406 1.3 5.2
tree length for dN: 0.0667
tree length for dS: 0.4391
Time used: 0:02
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 4, (2, 3)); MP score: 56
lnL(ntime: 5 np: 8): -687.732770 +0.000000
5..1 5..4 5..6 6..2 6..3
0.163439 0.338796 0.061253 0.008641 0.057102 3.078916 0.932710 0.097203
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.62923
(1: 0.163439, 4: 0.338796, (2: 0.008641, 3: 0.057102): 0.061253);
(D_melanogaster_CG1840-PA: 0.163439, D_erecta_CG1840-PA: 0.338796, (D_sechellia_CG1840-PA: 0.008641, D_simulans_CG1840-PA: 0.057102): 0.061253);
Detailed output identifying parameters
kappa (ts/tv) = 3.07892
dN/dS (w) for site classes (K=2)
p: 0.93271 0.06729
w: 0.09720 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.163 216.7 128.3 0.1580 0.0183 0.1156 4.0 14.8
5..4 0.339 216.7 128.3 0.1580 0.0379 0.2397 8.2 30.8
5..6 0.061 216.7 128.3 0.1580 0.0068 0.0433 1.5 5.6
6..2 0.009 216.7 128.3 0.1580 0.0010 0.0061 0.2 0.8
6..3 0.057 216.7 128.3 0.1580 0.0064 0.0404 1.4 5.2
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 4, (2, 3)); MP score: 56
lnL(ntime: 5 np: 10): -683.687084 +0.000000
5..1 5..4 5..6 6..2 6..3
0.238178 0.479515 0.076867 0.000004 0.083721 3.285070 0.991191 0.000000 0.128375 40.009567
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.87829
(1: 0.238178, 4: 0.479515, (2: 0.000004, 3: 0.083721): 0.076867);
(D_melanogaster_CG1840-PA: 0.238178, D_erecta_CG1840-PA: 0.479515, (D_sechellia_CG1840-PA: 0.000004, D_simulans_CG1840-PA: 0.083721): 0.076867);
Detailed output identifying parameters
kappa (ts/tv) = 3.28507
dN/dS (w) for site classes (K=3)
p: 0.99119 0.00000 0.00881
w: 0.12837 1.00000 40.00957
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.238 216.2 128.8 0.4797 0.0565 0.1178 12.2 15.2
5..4 0.480 216.2 128.8 0.4797 0.1138 0.2372 24.6 30.6
5..6 0.077 216.2 128.8 0.4797 0.0182 0.0380 3.9 4.9
6..2 0.000 216.2 128.8 0.4797 0.0000 0.0000 0.0 0.0
6..3 0.084 216.2 128.8 0.4797 0.0199 0.0414 4.3 5.3
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG1840-PA)
Pr(w>1) post mean +- SE for w
96 R 1.000** 39.997
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG1840-PA)
Pr(w>1) post mean +- SE for w
96 R 0.958* 6.725 +- 2.906
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.474 0.508 0.017 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.062 0.065 0.073 0.082 0.092 0.102 0.113 0.125 0.137 0.149
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.028
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.013 0.233
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.008 0.069 0.643
sum of density on p0-p1 = 1.000000
Time used: 0:06
Model 3: discrete (3 categories)
TREE # 1: (1, 4, (2, 3)); MP score: 56
lnL(ntime: 5 np: 11): -683.687084 +0.000000
5..1 5..4 5..6 6..2 6..3
0.238178 0.479515 0.076867 0.000004 0.083721 3.285070 0.598879 0.392313 0.128375 0.128375 40.009543
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.87829
(1: 0.238178, 4: 0.479515, (2: 0.000004, 3: 0.083721): 0.076867);
(D_melanogaster_CG1840-PA: 0.238178, D_erecta_CG1840-PA: 0.479515, (D_sechellia_CG1840-PA: 0.000004, D_simulans_CG1840-PA: 0.083721): 0.076867);
Detailed output identifying parameters
kappa (ts/tv) = 3.28507
dN/dS (w) for site classes (K=3)
p: 0.59888 0.39231 0.00881
w: 0.12837 0.12837 40.00954
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.238 216.2 128.8 0.4797 0.0565 0.1178 12.2 15.2
5..4 0.480 216.2 128.8 0.4797 0.1138 0.2372 24.6 30.6
5..6 0.077 216.2 128.8 0.4797 0.0182 0.0380 3.9 4.9
6..2 0.000 216.2 128.8 0.4797 0.0000 0.0000 0.0 0.0
6..3 0.084 216.2 128.8 0.4797 0.0199 0.0414 4.3 5.3
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG1840-PA)
Pr(w>1) post mean +- SE for w
96 R 1.000** 39.997
Time used: 0:13
Model 7: beta (10 categories)
TREE # 1: (1, 4, (2, 3)); MP score: 56
lnL(ntime: 5 np: 8): -688.176800 +0.000000
5..1 5..4 5..6 6..2 6..3
0.163344 0.338132 0.059113 0.009564 0.056893 3.099786 0.220073 1.067732
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.62705
(1: 0.163344, 4: 0.338132, (2: 0.009564, 3: 0.056893): 0.059113);
(D_melanogaster_CG1840-PA: 0.163344, D_erecta_CG1840-PA: 0.338132, (D_sechellia_CG1840-PA: 0.009564, D_simulans_CG1840-PA: 0.056893): 0.059113);
Detailed output identifying parameters
kappa (ts/tv) = 3.09979
Parameters in M7 (beta):
p = 0.22007 q = 1.06773
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00016 0.00168 0.00773 0.02425 0.06047 0.12972 0.25040 0.44830 0.76409
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.163 216.6 128.4 0.1687 0.0192 0.1139 4.2 14.6
5..4 0.338 216.6 128.4 0.1687 0.0398 0.2358 8.6 30.3
5..6 0.059 216.6 128.4 0.1687 0.0070 0.0412 1.5 5.3
6..2 0.010 216.6 128.4 0.1687 0.0011 0.0067 0.2 0.9
6..3 0.057 216.6 128.4 0.1687 0.0067 0.0397 1.4 5.1
Time used: 0:18
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 4, (2, 3)); MP score: 56
lnL(ntime: 5 np: 10): -683.707770 +0.000000
5..1 5..4 5..6 6..2 6..3
0.238303 0.479650 0.076756 0.000004 0.083728 3.285961 0.991191 14.690812 99.000000 40.048427
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.87844
(1: 0.238303, 4: 0.479650, (2: 0.000004, 3: 0.083728): 0.076756);
(D_melanogaster_CG1840-PA: 0.238303, D_erecta_CG1840-PA: 0.479650, (D_sechellia_CG1840-PA: 0.000004, D_simulans_CG1840-PA: 0.083728): 0.076756);
Detailed output identifying parameters
kappa (ts/tv) = 3.28596
Parameters in M8 (beta&w>1):
p0 = 0.99119 p = 14.69081 q = 99.00000
(p1 = 0.00881) w = 40.04843
dN/dS (w) for site classes (K=11)
p: 0.09912 0.09912 0.09912 0.09912 0.09912 0.09912 0.09912 0.09912 0.09912 0.09912 0.00881
w: 0.08164 0.09702 0.10696 0.11532 0.12315 0.13100 0.13941 0.14912 0.16176 0.18422 40.04843
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.238 216.2 128.8 0.4806 0.0566 0.1178 12.2 15.2
5..4 0.480 216.2 128.8 0.4806 0.1139 0.2370 24.6 30.5
5..6 0.077 216.2 128.8 0.4806 0.0182 0.0379 3.9 4.9
6..2 0.000 216.2 128.8 0.4806 0.0000 0.0000 0.0 0.0
6..3 0.084 216.2 128.8 0.4806 0.0199 0.0414 4.3 5.3
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG1840-PA)
Pr(w>1) post mean +- SE for w
96 R 1.000** 40.034
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG1840-PA)
Pr(w>1) post mean +- SE for w
96 R 0.975* 5.992 +- 2.950
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.013 0.987
p : 0.677 0.272 0.045 0.005 0.001 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.005 0.037 0.073 0.098 0.116 0.135 0.155 0.178 0.203
ws: 0.095 0.104 0.103 0.099 0.097 0.096 0.097 0.100 0.103 0.107
Time used: 0:38
Model 1: NearlyNeutral -687.73277
Model 2: PositiveSelection -683.687084
Model 0: one-ratio -688.917886
Model 3: discrete -683.687084
Model 7: beta -688.1768
Model 8: beta&w>1 -683.70777
Model 0 vs 1 2.3702319999999872
Model 2 vs 1 8.091371999999865
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG1840-PA)
Pr(w>1) post mean +- SE for w
96 R 1.000** 39.997
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG1840-PA)
Pr(w>1) post mean +- SE for w
96 R 0.958* 6.725 +- 2.906
Model 8 vs 7 8.93805999999995
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG1840-PA)
Pr(w>1) post mean +- SE for w
96 R 1.000** 40.034
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG1840-PA)
Pr(w>1) post mean +- SE for w
96 R 0.975* 5.992 +- 2.950
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
