--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Sat Dec 03 00:07:16 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/96/CG1840-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -742.50 -751.52
2 -742.57 -752.69
--------------------------------------
TOTAL -742.54 -752.27
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.465374 0.014658 0.267025 0.716394 0.444457 1027.48 1154.69 1.000
r(A<->C){all} 0.206571 0.005772 0.070171 0.359691 0.198798 463.96 656.87 1.000
r(A<->G){all} 0.070161 0.000967 0.020661 0.135151 0.065027 866.38 899.90 1.000
r(A<->T){all} 0.122038 0.004655 0.001412 0.248251 0.114263 503.14 651.14 1.000
r(C<->G){all} 0.016854 0.000217 0.000003 0.045159 0.012710 984.58 995.18 1.000
r(C<->T){all} 0.576538 0.007704 0.414927 0.751283 0.578010 535.87 563.71 1.000
r(G<->T){all} 0.007838 0.000062 0.000006 0.023058 0.005387 1083.84 1085.55 1.000
pi(A){all} 0.201540 0.000395 0.163875 0.240629 0.200672 810.85 1060.95 1.000
pi(C){all} 0.209482 0.000392 0.170932 0.248240 0.209206 1250.45 1323.77 1.000
pi(G){all} 0.377836 0.000626 0.326531 0.424200 0.377303 1241.45 1327.41 1.001
pi(T){all} 0.211143 0.000401 0.172406 0.251682 0.210190 1255.58 1314.12 1.000
alpha{1,2} 0.057268 0.002017 0.000103 0.143223 0.048292 1477.05 1489.02 1.000
alpha{3} 1.482187 0.472265 0.409050 2.820119 1.352726 1324.18 1383.16 1.000
pinvar{all} 0.343644 0.014084 0.094017 0.557037 0.354884 1412.63 1451.10 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -687.73277
Model 2: PositiveSelection -683.687084
Model 0: one-ratio -688.917886
Model 3: discrete -683.687084
Model 7: beta -688.1768
Model 8: beta&w>1 -683.70777
Model 0 vs 1 2.3702319999999872
Model 2 vs 1 8.091371999999865
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG1840-PA)
Pr(w>1) post mean +- SE for w
96 R 1.000** 39.997
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG1840-PA)
Pr(w>1) post mean +- SE for w
96 R 0.958* 6.725 +- 2.906
Model 8 vs 7 8.93805999999995
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG1840-PA)
Pr(w>1) post mean +- SE for w
96 R 1.000** 40.034
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG1840-PA)
Pr(w>1) post mean +- SE for w
96 R 0.975* 5.992 +- 2.950
>C1
MAYVDQNGRLWEKRPWDLRRVLDTFVGIWFAVKQLLASFLSPFTGNDSNG
DNSRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGSGYRGGGLRPNRR
IGRIPPPSQSCNAGGCCG
>C2
MAYVDQYGRLWEKRPWDLKRVLDIFVGIWFAVKQLFASFLSPFTGNDSNG
DNFRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGYRGGGLRPNPRIG
RIPPPSQSCSAGGCCGoo
>C3
MAYVDQYGRLWEKRPWDLKRVLDIFVGIWFAVKQLFASFLSPFTGNDSNG
DNFRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGGGYRGGGLRPNKR
IGRIPPPSQSCSAGGCCG
>C4
MAYVDQNGRLWEKRPWDLRRVLAIFVGIWFAIKQLFASFLSPFTGNDNNG
DNSRRGSGWGSSSWGGGGGGGGGGGGGGGGGGGGGGYGGGGLRPNRRIGR
IPPPSQSCSAGGCCGooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=121
C1 MAYVDQNGRLWEKRPWDLRRVLDTFVGIWFAVKQLLASFLSPFTGNDSNG
C2 MAYVDQYGRLWEKRPWDLKRVLDIFVGIWFAVKQLFASFLSPFTGNDSNG
C3 MAYVDQYGRLWEKRPWDLKRVLDIFVGIWFAVKQLFASFLSPFTGNDSNG
C4 MAYVDQNGRLWEKRPWDLRRVLAIFVGIWFAIKQLFASFLSPFTGNDNNG
****** ***********:*** *******:***:***********.**
C1 DNSRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGSGYRGGGLRPNRR
C2 DNFRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGG--YRGGGLRPNPR
C3 DNFRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGGGYRGGGLRPNKR
C4 DNSRRGSGWGSSSWGGGGGGGGGGGGGGGGGGG-GGG--YGGGGLRPNRR
** ***.************************** *** * ******* *
C1 IGRIPPPSQSCNAGGCCG---
C2 IGRIPPPSQSCSAGGCCGoo-
C3 IGRIPPPSQSCSAGGCCG---
C4 IGRIPPPSQSCSAGGCCGooo
***********.******
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 118 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 118 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1942]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [1942]--->[1910]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/96/CG1840-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.198 Mb, Max= 30.388 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MAYVDQNGRLWEKRPWDLRRVLDTFVGIWFAVKQLLASFLSPFTGNDSNG
DNSRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGSGYRGGGLRPNRR
IGRIPPPSQSCNAGGCCG---
>C2
MAYVDQYGRLWEKRPWDLKRVLDIFVGIWFAVKQLFASFLSPFTGNDSNG
DNFRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGG--YRGGGLRPNPR
IGRIPPPSQSCSAGGCCGoo-
>C3
MAYVDQYGRLWEKRPWDLKRVLDIFVGIWFAVKQLFASFLSPFTGNDSNG
DNFRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGGGYRGGGLRPNKR
IGRIPPPSQSCSAGGCCG---
>C4
MAYVDQNGRLWEKRPWDLRRVLAIFVGIWFAIKQLFASFLSPFTGNDNNG
DNSRRGSGWGSSSWGGGGGGGGGGGGGGGGGGG-GGG--YGGGGLRPNRR
IGRIPPPSQSCSAGGCCGooo
FORMAT of file /tmp/tmp4226681104109443730aln Not Supported[FATAL:T-COFFEE]
>C1
MAYVDQNGRLWEKRPWDLRRVLDTFVGIWFAVKQLLASFLSPFTGNDSNG
DNSRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGSGYRGGGLRPNRR
IGRIPPPSQSCNAGGCCG---
>C2
MAYVDQYGRLWEKRPWDLKRVLDIFVGIWFAVKQLFASFLSPFTGNDSNG
DNFRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGG--YRGGGLRPNPR
IGRIPPPSQSCSAGGCCGoo-
>C3
MAYVDQYGRLWEKRPWDLKRVLDIFVGIWFAVKQLFASFLSPFTGNDSNG
DNFRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGGGYRGGGLRPNKR
IGRIPPPSQSCSAGGCCG---
>C4
MAYVDQNGRLWEKRPWDLRRVLAIFVGIWFAIKQLFASFLSPFTGNDNNG
DNSRRGSGWGSSSWGGGGGGGGGGGGGGGGGGG-GGG--YGGGGLRPNRR
IGRIPPPSQSCSAGGCCGooo
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:121 S:90 BS:121
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# PW_SEQ_DISTANCES
BOT 0 1 93.97 C1 C2 93.97
TOP 1 0 93.97 C2 C1 93.97
BOT 0 2 93.22 C1 C3 93.22
TOP 2 0 93.22 C3 C1 93.22
BOT 0 3 93.04 C1 C4 93.04
TOP 3 0 93.04 C4 C1 93.04
BOT 1 2 99.14 C2 C3 99.14
TOP 2 1 99.14 C3 C2 99.14
BOT 1 3 92.31 C2 C4 92.31
TOP 3 1 92.31 C4 C2 92.31
BOT 2 3 92.17 C3 C4 92.17
TOP 3 2 92.17 C4 C3 92.17
AVG 0 C1 * 93.41
AVG 1 C2 * 95.14
AVG 2 C3 * 94.84
AVG 3 C4 * 92.51
TOT TOT * 93.97
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCGTACGTCGATCAAAATGGTCGTCTGTGGGAGAAACGTCCATGGGA
C2 ATGGCGTACGTCGATCAATATGGTCGTCTGTGGGAGAAACGTCCTTGGGA
C3 ATGGCGTACGTCGATCAATATGGTCGTCTGTGGGAGAAACGTCCTTGGGA
C4 ATGGCGTACGTCGATCAAAATGGTCGCCTATGGGAGAAACGTCCTTGGGA
******************:******* **.**************:*****
C1 CTTGAGACGAGTTTTGGACACATTCGTGGGTATATGGTTCGCCGTCAAAC
C2 CTTGAAACGAGTTTTGGACATATTCGTGGGTATATGGTTCGCCGTCAAAC
C3 CTTGAAACGAGTTTTGGACATATTCGTGGGTATATGGTTCGCCGTCAAAC
C4 CTTGAGACGGGTTTTGGCCATCTTCGTGGGTATATGGTTTGCCATCAAGC
*****.***.*******.** .***************** ***.****.*
C1 AGTTGCTTGCATCGTTCCTGTCTCCATTCACTGGAAATGATAGCAACGGA
C2 AGTTGTTTGCATCGTTCCTGTCTCCATTCACTGGAAATGATAGCAACGGA
C3 AGTTGTTTGCATCGTTCCTGTCTCCATTCACTGGAAATGATAGCAACGGA
C4 AGTTGTTTGCATCGTTCCTGTCTCCATTCACTGGAAATGATAACAACGGA
***** ************************************.*******
C1 GATAACTCCCGTCGAGGAAATGGATGGGGAAGTAGTAGCTGGGGCGGAGG
C2 GATAACTTCCGTCGAGGAAATGGATGGGGAAGTAGCAGCTGGGGTGGAGG
C3 GATAACTTCCGTCGAGGAAATGGATGGGGAAGTAGCAGCTGGGGTGGAGG
C4 GACAACTCCCGTCGAGGAAGCGGATGGGGAAGTAGCAGCTGGGGCGGAGG
** **** ***********. ************** ******** *****
C1 GGGCGGTGGTGGTGGCGGCGGAGGCGGTGGCGGCGGAGGCGGTGGCGGAG
C2 GGGCGGTGGTGGTGGCGGTGGTGGTGGTGGCGGAGGTGGTGGCGGTGGCG
C3 GGGCGGTGGTGGCGGCGGTGGCGGTGGTGGCGGAGGTGGTGGCGGTGGCG
C4 CGGAGGAGGAGGTGGTGGTGGTGGTGGAGGTGGAGGCGGTGGAGGAGGA-
**.**:**:** ** ** ** ** **:** **.** ** ** ** **.
C1 GCGGAGGCGGTAGCGGTTATCGCGGAGGTGGATTAAGGCCTAATCGACGA
C2 GCGGAGGTGGA------TATCGCGGAGGCGGATTAAGGCCTAACCCACGA
C3 GTGGCGGCGGCGGTGGATATCGCGGAGGCGGATTAAGGCCTAACAAACGA
C4 --GGAGGTGGA------TATGGCGGAGGCGGATTAAGGCCCAACCGACGA
**.** ** *** ******* *********** ** . ****
C1 ATTGGGCGCATTCCGCCCCCCTCCCAATCCTGCAATGCCGGAGGATGCTG
C2 ATTGGGCGCATTCCGCCCCCCTCCCAATCCTGCAGTGCCGGAGGATGCTG
C3 ATTGGGCGCATTCCGCCCCCCTCCCAATCCTGCAGTGCCGGAGGATGCTG
C4 ATTGGGCGCATACCGCCGCCCTCCCAATCCTGTAGTGCTGGAGGATGCTG
***********:***** ************** *.*** ***********
C1 CGGC---------
C2 CGGC---------
C3 CGGC---------
C4 CGGC---------
****
>C1
ATGGCGTACGTCGATCAAAATGGTCGTCTGTGGGAGAAACGTCCATGGGA
CTTGAGACGAGTTTTGGACACATTCGTGGGTATATGGTTCGCCGTCAAAC
AGTTGCTTGCATCGTTCCTGTCTCCATTCACTGGAAATGATAGCAACGGA
GATAACTCCCGTCGAGGAAATGGATGGGGAAGTAGTAGCTGGGGCGGAGG
GGGCGGTGGTGGTGGCGGCGGAGGCGGTGGCGGCGGAGGCGGTGGCGGAG
GCGGAGGCGGTAGCGGTTATCGCGGAGGTGGATTAAGGCCTAATCGACGA
ATTGGGCGCATTCCGCCCCCCTCCCAATCCTGCAATGCCGGAGGATGCTG
CGGC---------
>C2
ATGGCGTACGTCGATCAATATGGTCGTCTGTGGGAGAAACGTCCTTGGGA
CTTGAAACGAGTTTTGGACATATTCGTGGGTATATGGTTCGCCGTCAAAC
AGTTGTTTGCATCGTTCCTGTCTCCATTCACTGGAAATGATAGCAACGGA
GATAACTTCCGTCGAGGAAATGGATGGGGAAGTAGCAGCTGGGGTGGAGG
GGGCGGTGGTGGTGGCGGTGGTGGTGGTGGCGGAGGTGGTGGCGGTGGCG
GCGGAGGTGGA------TATCGCGGAGGCGGATTAAGGCCTAACCCACGA
ATTGGGCGCATTCCGCCCCCCTCCCAATCCTGCAGTGCCGGAGGATGCTG
CGGC---------
>C3
ATGGCGTACGTCGATCAATATGGTCGTCTGTGGGAGAAACGTCCTTGGGA
CTTGAAACGAGTTTTGGACATATTCGTGGGTATATGGTTCGCCGTCAAAC
AGTTGTTTGCATCGTTCCTGTCTCCATTCACTGGAAATGATAGCAACGGA
GATAACTTCCGTCGAGGAAATGGATGGGGAAGTAGCAGCTGGGGTGGAGG
GGGCGGTGGTGGCGGCGGTGGCGGTGGTGGCGGAGGTGGTGGCGGTGGCG
GTGGCGGCGGCGGTGGATATCGCGGAGGCGGATTAAGGCCTAACAAACGA
ATTGGGCGCATTCCGCCCCCCTCCCAATCCTGCAGTGCCGGAGGATGCTG
CGGC---------
>C4
ATGGCGTACGTCGATCAAAATGGTCGCCTATGGGAGAAACGTCCTTGGGA
CTTGAGACGGGTTTTGGCCATCTTCGTGGGTATATGGTTTGCCATCAAGC
AGTTGTTTGCATCGTTCCTGTCTCCATTCACTGGAAATGATAACAACGGA
GACAACTCCCGTCGAGGAAGCGGATGGGGAAGTAGCAGCTGGGGCGGAGG
CGGAGGAGGAGGTGGTGGTGGTGGTGGAGGTGGAGGCGGTGGAGGAGGA-
--GGAGGTGGA------TATGGCGGAGGCGGATTAAGGCCCAACCGACGA
ATTGGGCGCATACCGCCGCCCTCCCAATCCTGTAGTGCTGGAGGATGCTG
CGGC---------
>C1
MAYVDQNGRLWEKRPWDLRRVLDTFVGIWFAVKQLLASFLSPFTGNDSNG
DNSRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGSGYRGGGLRPNRR
IGRIPPPSQSCNAGGCCG
>C2
MAYVDQYGRLWEKRPWDLKRVLDIFVGIWFAVKQLFASFLSPFTGNDSNG
DNFRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGooYRGGGLRPNPR
IGRIPPPSQSCSAGGCCG
>C3
MAYVDQYGRLWEKRPWDLKRVLDIFVGIWFAVKQLFASFLSPFTGNDSNG
DNFRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGGGYRGGGLRPNKR
IGRIPPPSQSCSAGGCCG
>C4
MAYVDQNGRLWEKRPWDLRRVLAIFVGIWFAIKQLFASFLSPFTGNDNNG
DNSRRGSGWGSSSWGGGGGGGGGGGGGGGGGGGoGGGooYGGGGLRPNRR
IGRIPPPSQSCSAGGCCG
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 4 taxa and 363 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1480723495
Setting output file names to "/opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 415415018
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 6353865116
Seed = 440696255
Swapseed = 1480723495
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.35 % Dirichlet(Revmat{all})
1.35 % Slider(Revmat{all})
1.35 % Dirichlet(Pi{all})
1.35 % Slider(Pi{all})
2.70 % Multiplier(Alpha{1,2})
2.70 % Multiplier(Alpha{3})
2.70 % Slider(Pinvar{all})
13.51 % NNI(Tau{all},V{all})
13.51 % ParsSPR(Tau{all},V{all})
40.54 % Multiplier(V{all})
13.51 % Nodeslider(V{all})
5.41 % TLMultiplier(V{all})
Division 1 has 13 unique site patterns
Division 2 has 15 unique site patterns
Division 3 has 31 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -875.309402 -- -26.620141
Chain 2 -- -872.168366 -- -26.620141
Chain 3 -- -875.309402 -- -26.620141
Chain 4 -- -872.168366 -- -26.620141
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -875.309402 -- -26.620141
Chain 2 -- -858.895636 -- -26.620141
Chain 3 -- -858.895636 -- -26.620141
Chain 4 -- -872.168366 -- -26.620141
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-875.309] (-872.168) (-875.309) (-872.168) * [-875.309] (-858.896) (-858.896) (-872.168)
500 -- (-785.873) (-783.692) (-785.669) [-779.746] * [-784.714] (-790.211) (-788.290) (-790.241) -- 0:00:00
1000 -- [-776.234] (-770.899) (-776.029) (-771.319) * [-767.708] (-787.117) (-783.438) (-783.018) -- 0:00:00
1500 -- (-780.113) (-767.645) (-774.399) [-775.015] * (-760.825) (-780.961) [-761.450] (-777.207) -- 0:11:05
2000 -- (-778.673) (-761.054) (-771.846) [-764.036] * (-761.030) (-771.203) [-752.446] (-769.107) -- 0:08:19
2500 -- (-765.644) (-756.097) (-759.520) [-762.419] * [-752.079] (-766.051) (-748.637) (-761.387) -- 0:06:39
3000 -- (-756.301) (-757.661) [-752.519] (-760.085) * [-750.562] (-764.468) (-749.537) (-764.445) -- 0:05:32
3500 -- (-757.056) (-754.194) [-756.273] (-761.629) * [-748.718] (-760.046) (-750.261) (-754.875) -- 0:04:44
4000 -- (-755.179) [-752.215] (-751.230) (-758.964) * (-743.899) (-752.288) [-750.628] (-754.225) -- 0:04:09
4500 -- [-747.724] (-744.127) (-743.642) (-751.185) * (-748.416) (-753.443) [-749.170] (-754.507) -- 0:03:41
5000 -- (-754.742) (-745.060) (-744.893) [-750.593] * (-751.657) (-740.724) [-748.545] (-754.611) -- 0:03:19
Average standard deviation of split frequencies: 0.157135
5500 -- (-756.649) (-744.705) [-742.518] (-752.428) * (-741.375) [-744.325] (-743.931) (-754.266) -- 0:03:00
6000 -- [-751.888] (-743.252) (-745.630) (-748.027) * (-743.092) [-743.011] (-744.735) (-746.661) -- 0:02:45
6500 -- (-745.771) (-743.870) (-748.115) [-748.987] * (-739.365) (-747.675) (-751.306) [-745.414] -- 0:02:32
7000 -- (-753.651) [-745.989] (-743.672) (-750.763) * (-743.387) [-745.660] (-748.934) (-750.371) -- 0:02:21
7500 -- (-746.865) (-743.653) (-747.701) [-748.373] * [-742.636] (-749.081) (-751.494) (-749.721) -- 0:02:12
8000 -- (-756.663) (-750.111) [-746.839] (-742.369) * (-743.343) (-747.371) [-747.138] (-755.974) -- 0:02:04
8500 -- (-742.149) (-746.598) (-749.647) [-743.109] * [-742.616] (-747.869) (-743.145) (-748.981) -- 0:01:56
9000 -- (-747.265) [-749.519] (-748.270) (-745.007) * (-741.047) (-748.783) [-747.113] (-746.419) -- 0:01:50
9500 -- (-746.450) (-744.956) (-747.358) [-746.711] * (-741.547) (-748.865) (-743.633) [-744.282] -- 0:03:28
10000 -- (-744.567) (-747.123) (-744.517) [-745.353] * [-740.850] (-747.874) (-742.951) (-745.024) -- 0:03:18
Average standard deviation of split frequencies: 0.044194
10500 -- (-743.526) (-753.047) (-748.276) [-745.075] * (-747.556) (-749.411) (-744.554) [-744.461] -- 0:03:08
11000 -- (-753.278) (-746.642) [-748.484] (-746.853) * (-747.730) (-745.254) (-746.719) [-740.930] -- 0:02:59
11500 -- (-744.871) [-744.656] (-742.671) (-745.149) * (-753.292) (-750.032) (-742.961) [-741.148] -- 0:02:51
12000 -- (-744.528) [-744.047] (-747.979) (-746.509) * (-747.197) (-746.176) (-740.542) [-740.599] -- 0:02:44
12500 -- [-746.082] (-742.609) (-745.566) (-743.400) * (-746.403) (-747.121) [-741.469] (-747.548) -- 0:02:38
13000 -- (-749.676) (-744.047) (-743.605) [-749.047] * (-752.167) [-747.551] (-745.017) (-744.865) -- 0:02:31
13500 -- (-746.388) (-743.958) (-750.806) [-745.704] * (-747.480) (-749.549) (-745.202) [-744.570] -- 0:02:26
14000 -- [-743.746] (-745.404) (-744.976) (-740.339) * (-753.542) (-749.270) [-744.506] (-746.688) -- 0:02:20
14500 -- (-745.838) (-744.591) (-742.665) [-742.762] * (-744.217) (-748.078) (-750.501) [-741.071] -- 0:02:15
15000 -- (-746.051) [-743.635] (-747.007) (-752.280) * (-744.660) (-747.237) (-746.109) [-742.011] -- 0:02:11
Average standard deviation of split frequencies: 0.029463
15500 -- (-751.615) (-740.911) [-745.670] (-747.646) * [-745.472] (-746.153) (-748.940) (-751.725) -- 0:02:07
16000 -- (-749.865) (-743.366) [-743.114] (-746.238) * [-743.548] (-746.568) (-747.664) (-743.260) -- 0:02:03
16500 -- [-743.924] (-744.616) (-744.189) (-745.559) * (-742.900) (-748.746) [-748.880] (-744.531) -- 0:01:59
17000 -- (-746.020) (-747.443) (-745.498) [-743.488] * (-747.445) (-751.103) (-753.306) [-746.126] -- 0:01:55
17500 -- (-751.898) (-742.800) (-743.766) [-740.651] * [-743.189] (-749.083) (-746.125) (-744.786) -- 0:01:52
18000 -- [-745.606] (-748.331) (-747.828) (-746.910) * (-743.593) (-742.533) (-743.211) [-749.087] -- 0:01:49
18500 -- (-743.954) [-745.371] (-743.827) (-750.312) * [-743.280] (-746.066) (-746.781) (-745.809) -- 0:01:46
19000 -- (-746.939) (-747.795) [-749.106] (-743.921) * (-748.957) (-743.197) [-745.197] (-744.387) -- 0:01:43
19500 -- (-742.480) (-744.879) [-738.966] (-748.222) * (-744.653) (-744.565) [-746.669] (-751.132) -- 0:02:30
20000 -- (-743.389) (-743.532) [-740.598] (-753.527) * [-743.597] (-750.004) (-749.001) (-745.853) -- 0:02:27
Average standard deviation of split frequencies: 0.045620
20500 -- (-744.862) [-743.632] (-738.985) (-749.715) * [-741.864] (-747.696) (-751.177) (-745.329) -- 0:02:23
21000 -- [-742.051] (-745.527) (-748.242) (-749.941) * (-740.199) (-746.684) (-746.855) [-746.154] -- 0:02:19
21500 -- (-745.368) [-745.696] (-745.785) (-745.426) * (-743.524) (-747.805) (-745.126) [-748.472] -- 0:02:16
22000 -- (-741.489) (-748.687) [-741.621] (-746.380) * (-743.560) (-742.086) (-744.924) [-743.183] -- 0:02:13
22500 -- (-741.250) (-748.628) (-744.176) [-742.352] * (-744.273) (-750.333) (-744.672) [-746.603] -- 0:02:10
23000 -- (-739.874) [-741.723] (-745.458) (-746.316) * [-743.418] (-749.525) (-746.338) (-749.823) -- 0:02:07
23500 -- [-739.842] (-748.114) (-743.290) (-744.919) * [-743.326] (-744.008) (-748.484) (-747.651) -- 0:02:04
24000 -- [-745.669] (-749.848) (-742.976) (-747.649) * [-744.972] (-742.785) (-745.837) (-751.012) -- 0:02:02
24500 -- [-743.534] (-749.352) (-746.133) (-745.679) * (-744.933) (-747.560) [-744.996] (-747.799) -- 0:01:59
25000 -- (-742.933) (-748.478) [-745.656] (-744.306) * (-748.275) (-747.942) (-748.642) [-747.900] -- 0:01:57
Average standard deviation of split frequencies: 0.063458
25500 -- (-746.365) (-742.627) (-754.560) [-742.792] * [-743.052] (-744.921) (-749.225) (-751.312) -- 0:01:54
26000 -- (-744.782) (-739.576) (-751.307) [-746.936] * (-745.347) (-746.034) [-746.751] (-747.022) -- 0:01:52
26500 -- [-751.540] (-749.945) (-745.946) (-751.272) * [-745.749] (-746.230) (-747.837) (-745.013) -- 0:01:50
27000 -- (-754.338) (-749.100) [-745.290] (-747.872) * [-749.175] (-745.045) (-744.860) (-749.069) -- 0:01:48
27500 -- (-751.658) (-752.513) (-744.545) [-746.968] * [-742.239] (-748.707) (-748.928) (-744.166) -- 0:01:46
28000 -- (-746.547) [-750.098] (-744.049) (-750.767) * (-742.407) (-746.235) (-752.811) [-749.696] -- 0:01:44
28500 -- (-748.143) (-752.754) [-743.911] (-752.001) * (-743.234) (-746.211) [-746.570] (-744.779) -- 0:01:42
29000 -- (-742.898) (-748.251) (-743.433) [-755.078] * [-743.898] (-746.532) (-746.929) (-745.176) -- 0:02:13
29500 -- (-746.334) (-751.920) [-740.208] (-752.200) * [-747.106] (-748.531) (-749.235) (-749.287) -- 0:02:11
30000 -- [-741.593] (-745.989) (-743.570) (-754.559) * [-742.277] (-749.212) (-748.397) (-741.237) -- 0:02:09
Average standard deviation of split frequencies: 0.053802
30500 -- (-740.836) [-745.059] (-742.964) (-754.289) * [-746.564] (-744.712) (-751.681) (-747.452) -- 0:02:07
31000 -- [-740.736] (-742.082) (-747.763) (-752.043) * (-750.498) [-738.805] (-749.512) (-752.064) -- 0:02:05
31500 -- (-744.760) (-749.058) [-746.339] (-746.075) * [-744.717] (-741.709) (-751.174) (-745.854) -- 0:02:02
32000 -- (-746.827) (-748.670) (-741.402) [-740.906] * [-743.729] (-747.258) (-749.616) (-750.793) -- 0:02:01
32500 -- [-743.873] (-749.030) (-742.775) (-744.621) * [-743.657] (-747.027) (-755.598) (-744.614) -- 0:01:59
33000 -- (-745.457) [-748.671] (-745.404) (-740.186) * (-745.961) [-746.088] (-748.339) (-747.562) -- 0:01:57
33500 -- [-740.822] (-750.657) (-743.215) (-744.493) * (-742.269) (-742.582) [-741.106] (-749.233) -- 0:01:55
34000 -- (-746.637) [-743.117] (-742.429) (-751.349) * [-745.095] (-746.157) (-739.923) (-743.127) -- 0:01:53
34500 -- (-748.320) [-741.476] (-742.780) (-745.946) * (-746.320) (-747.647) (-745.211) [-747.627] -- 0:01:51
35000 -- (-745.480) (-742.622) [-748.689] (-748.365) * (-753.769) (-747.197) [-747.754] (-746.756) -- 0:01:50
Average standard deviation of split frequencies: 0.006547
35500 -- (-746.527) (-744.100) (-749.983) [-741.529] * (-755.516) (-744.037) [-742.347] (-745.168) -- 0:01:48
36000 -- (-749.763) (-750.631) [-746.467] (-745.386) * (-747.544) [-743.745] (-747.391) (-743.802) -- 0:01:47
36500 -- (-748.014) (-749.097) [-743.747] (-749.212) * [-744.796] (-745.173) (-746.494) (-749.190) -- 0:01:45
37000 -- [-742.162] (-746.661) (-751.031) (-744.988) * (-741.620) [-743.034] (-748.036) (-746.939) -- 0:01:44
37500 -- (-757.382) [-745.363] (-745.307) (-745.220) * [-745.695] (-746.353) (-745.404) (-746.035) -- 0:01:42
38000 -- (-747.383) [-742.439] (-742.953) (-747.071) * (-746.811) [-747.164] (-746.838) (-751.939) -- 0:01:41
38500 -- (-747.426) [-742.343] (-749.875) (-745.029) * (-750.020) (-744.523) [-749.825] (-742.514) -- 0:01:39
39000 -- (-745.868) (-743.213) [-746.063] (-741.167) * (-749.648) [-747.018] (-753.485) (-746.592) -- 0:02:03
39500 -- (-748.161) [-742.617] (-749.409) (-744.846) * (-753.274) [-748.598] (-742.175) (-745.763) -- 0:02:01
40000 -- (-741.563) (-742.211) (-743.094) [-745.684] * [-749.596] (-748.369) (-741.511) (-746.129) -- 0:02:00
Average standard deviation of split frequencies: 0.011592
40500 -- (-752.959) (-744.906) (-746.160) [-746.864] * (-748.466) (-746.920) (-744.315) [-742.929] -- 0:01:58
41000 -- [-748.261] (-741.755) (-747.480) (-745.182) * (-746.412) (-746.692) (-744.841) [-748.738] -- 0:01:56
41500 -- [-746.807] (-748.664) (-745.296) (-750.166) * [-746.938] (-748.532) (-746.847) (-746.576) -- 0:01:55
42000 -- (-744.575) (-747.465) [-742.329] (-747.500) * (-742.758) [-746.717] (-745.065) (-748.879) -- 0:01:54
42500 -- (-746.769) [-742.883] (-744.484) (-752.828) * [-748.036] (-750.185) (-744.059) (-744.609) -- 0:01:52
43000 -- (-742.328) (-743.965) [-742.132] (-747.034) * (-748.124) [-745.701] (-748.775) (-743.368) -- 0:01:51
43500 -- (-748.122) (-746.046) (-746.521) [-743.532] * (-746.024) [-743.169] (-747.213) (-745.114) -- 0:01:49
44000 -- (-746.837) (-744.490) (-745.947) [-747.441] * [-748.027] (-741.651) (-741.043) (-745.235) -- 0:01:48
44500 -- (-741.505) [-741.832] (-747.710) (-747.885) * (-747.404) (-745.136) [-744.694] (-744.430) -- 0:01:47
45000 -- (-746.907) (-743.092) (-746.708) [-743.670] * (-745.743) (-744.587) (-742.275) [-741.991] -- 0:01:46
Average standard deviation of split frequencies: 0.046116
45500 -- (-743.593) (-745.027) (-748.784) [-744.355] * (-747.426) (-752.327) [-741.920] (-745.463) -- 0:01:44
46000 -- [-743.058] (-741.446) (-746.417) (-742.370) * [-750.328] (-749.427) (-738.685) (-741.360) -- 0:01:43
46500 -- (-745.961) (-744.909) [-744.772] (-751.040) * (-741.193) [-746.016] (-742.830) (-743.094) -- 0:01:42
47000 -- (-743.484) [-748.557] (-749.219) (-745.100) * (-747.438) (-747.592) [-745.101] (-757.042) -- 0:01:41
47500 -- [-742.902] (-745.560) (-749.005) (-745.690) * [-742.623] (-749.663) (-745.665) (-748.312) -- 0:01:40
48000 -- [-743.146] (-746.401) (-743.194) (-741.568) * (-741.724) (-751.766) (-743.775) [-750.524] -- 0:01:39
48500 -- (-744.375) (-743.557) [-747.435] (-740.623) * [-747.779] (-746.320) (-742.519) (-756.565) -- 0:01:57
49000 -- [-741.023] (-744.163) (-745.540) (-741.685) * (-744.794) (-744.064) [-741.097] (-746.483) -- 0:01:56
49500 -- (-744.040) (-746.433) [-742.831] (-743.849) * (-752.994) [-743.300] (-745.579) (-747.597) -- 0:01:55
50000 -- [-743.789] (-749.336) (-746.100) (-742.148) * (-755.314) (-742.490) (-747.061) [-744.746] -- 0:01:54
Average standard deviation of split frequencies: 0.051172
50500 -- [-741.612] (-744.171) (-744.052) (-748.470) * [-746.526] (-747.112) (-748.780) (-744.808) -- 0:01:52
51000 -- (-742.827) (-743.122) (-742.304) [-746.260] * (-745.389) (-747.107) (-744.009) [-749.126] -- 0:01:51
51500 -- (-748.974) [-743.412] (-744.542) (-744.582) * (-753.251) [-742.379] (-747.315) (-747.804) -- 0:01:50
52000 -- (-744.307) (-747.159) (-748.624) [-748.966] * (-754.335) (-744.011) [-742.721] (-747.803) -- 0:01:49
52500 -- (-749.695) [-744.222] (-745.983) (-745.469) * (-746.214) (-742.763) (-746.659) [-753.977] -- 0:01:48
53000 -- (-746.704) [-742.053] (-754.795) (-749.199) * [-741.839] (-742.590) (-744.564) (-748.137) -- 0:01:47
53500 -- (-747.108) (-750.629) (-747.070) [-744.799] * (-744.167) (-743.808) (-741.890) [-749.447] -- 0:01:46
54000 -- (-746.369) [-746.724] (-753.246) (-746.837) * [-741.725] (-742.348) (-744.716) (-748.214) -- 0:01:45
54500 -- (-746.453) (-744.384) (-750.309) [-745.575] * [-746.282] (-750.689) (-741.500) (-745.928) -- 0:01:44
55000 -- (-748.285) (-749.243) (-743.558) [-747.121] * [-743.427] (-742.219) (-749.541) (-759.402) -- 0:01:43
Average standard deviation of split frequencies: 0.046299
55500 -- (-747.680) (-747.456) [-745.601] (-745.416) * (-743.614) (-753.402) (-754.033) [-743.115] -- 0:01:42
56000 -- (-743.109) (-746.622) [-742.658] (-747.766) * [-743.252] (-753.137) (-745.896) (-744.365) -- 0:01:41
56500 -- (-741.248) (-749.702) [-748.676] (-745.238) * (-749.664) (-750.177) (-747.449) [-740.984] -- 0:01:40
57000 -- (-745.747) (-750.403) [-744.785] (-741.118) * (-743.208) (-754.374) [-743.870] (-743.938) -- 0:01:39
57500 -- (-743.322) (-748.945) [-746.662] (-747.416) * (-744.859) (-750.150) (-746.248) [-744.259] -- 0:01:38
58000 -- (-748.663) [-747.216] (-745.225) (-739.987) * [-748.042] (-751.099) (-745.680) (-741.967) -- 0:01:37
58500 -- (-746.351) (-747.127) [-743.380] (-748.130) * (-751.746) [-745.514] (-745.413) (-747.269) -- 0:01:52
59000 -- [-745.459] (-747.296) (-747.042) (-741.458) * [-743.572] (-752.767) (-744.777) (-741.122) -- 0:01:51
59500 -- (-747.970) (-748.583) (-745.952) [-744.422] * (-752.795) (-750.555) (-748.856) [-743.937] -- 0:01:50
60000 -- (-748.099) [-748.929] (-742.417) (-744.057) * (-745.577) [-744.291] (-742.793) (-744.096) -- 0:01:49
Average standard deviation of split frequencies: 0.054393
60500 -- (-743.273) (-742.249) (-743.472) [-754.712] * (-752.130) [-744.300] (-747.237) (-741.889) -- 0:01:48
61000 -- (-744.820) [-744.188] (-748.319) (-744.539) * [-743.866] (-743.855) (-748.906) (-747.685) -- 0:01:47
61500 -- (-746.417) (-749.953) [-746.105] (-746.690) * (-739.151) (-742.501) (-743.982) [-743.648] -- 0:01:46
62000 -- (-754.278) (-749.242) (-740.449) [-748.069] * (-751.447) (-747.179) (-746.461) [-746.279] -- 0:01:45
62500 -- [-745.654] (-747.170) (-746.884) (-749.725) * (-747.242) [-743.805] (-747.871) (-752.255) -- 0:01:45
63000 -- (-744.479) [-743.571] (-741.428) (-749.431) * (-750.321) [-748.051] (-749.297) (-748.922) -- 0:01:44
63500 -- [-741.331] (-745.366) (-745.701) (-749.151) * (-746.263) [-742.969] (-746.273) (-745.125) -- 0:01:43
64000 -- (-747.602) [-751.220] (-747.375) (-744.284) * [-744.549] (-745.548) (-744.752) (-743.591) -- 0:01:42
64500 -- [-746.188] (-743.789) (-744.412) (-747.307) * [-746.724] (-743.797) (-744.056) (-742.375) -- 0:01:41
65000 -- (-747.471) [-744.371] (-745.066) (-753.205) * (-745.401) (-747.265) [-741.624] (-740.909) -- 0:01:40
Average standard deviation of split frequencies: 0.067854
65500 -- (-749.718) (-742.915) (-743.149) [-747.581] * (-744.303) (-750.406) [-748.298] (-744.755) -- 0:01:39
66000 -- (-744.320) (-746.808) (-748.091) [-743.908] * [-743.300] (-742.374) (-747.558) (-740.220) -- 0:01:39
66500 -- (-754.238) [-744.075] (-743.107) (-752.181) * [-748.451] (-744.878) (-745.518) (-744.969) -- 0:01:38
67000 -- (-744.082) (-743.286) [-740.618] (-753.703) * (-743.912) [-745.492] (-746.842) (-750.549) -- 0:01:37
67500 -- (-747.940) (-740.956) [-745.369] (-752.144) * [-755.129] (-743.593) (-744.388) (-745.721) -- 0:01:36
68000 -- (-741.369) (-743.482) [-741.346] (-749.922) * (-746.280) (-745.237) (-747.408) [-741.801] -- 0:01:35
68500 -- (-751.003) (-742.946) [-742.718] (-758.901) * (-744.128) [-748.542] (-745.056) (-743.045) -- 0:01:48
69000 -- (-744.190) (-744.093) [-746.791] (-756.783) * (-746.725) (-742.076) (-751.934) [-744.272] -- 0:01:47
69500 -- [-743.578] (-746.149) (-742.888) (-749.683) * (-750.500) (-744.354) [-747.255] (-750.690) -- 0:01:47
70000 -- (-742.225) (-747.399) [-748.078] (-750.873) * (-752.144) (-740.421) [-745.046] (-749.259) -- 0:01:46
Average standard deviation of split frequencies: 0.043360
70500 -- (-749.559) (-755.593) (-742.823) [-745.761] * [-745.896] (-744.008) (-746.212) (-742.572) -- 0:01:45
71000 -- (-740.981) (-750.327) [-744.397] (-744.028) * (-754.316) (-744.505) (-744.016) [-741.329] -- 0:01:44
71500 -- [-746.361] (-746.797) (-748.429) (-748.921) * (-750.979) [-741.604] (-743.035) (-747.786) -- 0:01:43
72000 -- [-746.571] (-748.658) (-743.094) (-741.163) * [-750.502] (-747.894) (-741.253) (-743.922) -- 0:01:43
72500 -- [-746.148] (-742.393) (-744.591) (-746.723) * (-751.453) (-751.258) [-742.179] (-744.748) -- 0:01:42
73000 -- (-745.622) (-744.258) (-743.076) [-747.518] * (-749.596) (-751.323) (-744.501) [-743.634] -- 0:01:41
73500 -- [-746.193] (-749.104) (-749.135) (-743.057) * [-746.616] (-747.276) (-747.302) (-744.735) -- 0:01:40
74000 -- (-750.854) (-750.754) (-749.302) [-744.686] * (-755.683) [-749.098] (-745.171) (-750.849) -- 0:01:40
74500 -- (-753.303) [-743.821] (-745.944) (-746.298) * (-746.674) (-750.107) [-742.539] (-745.865) -- 0:01:39
75000 -- (-748.008) (-748.384) (-746.430) [-745.432] * (-745.086) (-744.046) [-749.540] (-749.046) -- 0:01:38
Average standard deviation of split frequencies: 0.046520
75500 -- (-748.179) (-743.113) (-750.770) [-746.062] * (-746.148) (-745.027) (-753.967) [-749.553] -- 0:01:37
76000 -- [-750.175] (-752.440) (-744.293) (-744.447) * (-743.891) (-747.899) (-746.384) [-747.163] -- 0:01:37
76500 -- (-743.207) (-744.847) (-753.167) [-744.561] * (-741.054) (-744.510) [-748.963] (-743.777) -- 0:01:36
77000 -- (-747.153) (-746.048) [-745.931] (-746.553) * [-743.556] (-745.552) (-750.496) (-743.424) -- 0:01:35
77500 -- (-745.715) (-744.499) [-747.234] (-743.541) * (-742.744) (-744.449) [-743.114] (-749.887) -- 0:01:35
78000 -- (-751.715) (-755.760) (-750.219) [-744.678] * [-744.694] (-749.368) (-747.434) (-740.639) -- 0:01:46
78500 -- (-754.831) (-752.008) (-750.771) [-744.012] * (-748.075) (-743.981) (-749.304) [-746.308] -- 0:01:45
79000 -- (-751.220) (-747.901) [-754.084] (-744.573) * (-745.996) (-745.472) (-744.658) [-745.775] -- 0:01:44
79500 -- [-741.724] (-747.428) (-745.865) (-747.650) * (-750.046) (-748.840) [-743.422] (-746.108) -- 0:01:44
80000 -- [-754.691] (-747.498) (-747.080) (-741.415) * (-747.010) (-751.114) (-747.110) [-746.478] -- 0:01:43
Average standard deviation of split frequencies: 0.037985
80500 -- (-742.767) [-746.831] (-753.405) (-741.884) * [-749.916] (-752.335) (-744.675) (-746.100) -- 0:01:42
81000 -- (-745.242) (-744.901) (-748.499) [-744.942] * (-748.308) (-745.298) (-747.665) [-743.058] -- 0:01:42
81500 -- (-742.058) (-745.095) (-752.215) [-743.621] * (-748.001) (-749.320) [-743.002] (-745.448) -- 0:01:41
82000 -- [-739.443] (-744.862) (-746.073) (-741.624) * (-749.388) [-747.748] (-748.723) (-745.278) -- 0:01:40
82500 -- (-739.044) (-743.575) (-746.880) [-742.828] * [-746.244] (-744.475) (-748.606) (-744.356) -- 0:01:40
83000 -- (-742.998) (-742.393) [-745.572] (-744.902) * (-743.282) (-743.338) (-754.208) [-745.335] -- 0:01:39
83500 -- [-746.854] (-742.169) (-742.787) (-743.559) * (-743.499) (-746.221) [-750.901] (-748.388) -- 0:01:38
84000 -- (-754.060) [-745.137] (-742.783) (-744.677) * [-746.838] (-741.164) (-756.398) (-747.166) -- 0:01:38
84500 -- [-743.228] (-744.866) (-744.191) (-744.420) * (-742.530) [-744.539] (-746.762) (-750.130) -- 0:01:37
85000 -- [-740.308] (-744.397) (-748.345) (-746.724) * (-744.118) (-741.099) [-744.667] (-751.266) -- 0:01:36
Average standard deviation of split frequencies: 0.036543
85500 -- (-747.620) (-745.393) [-742.976] (-748.477) * [-743.253] (-745.529) (-747.788) (-743.902) -- 0:01:36
86000 -- [-747.246] (-747.293) (-745.147) (-748.310) * (-748.122) [-749.800] (-751.134) (-744.428) -- 0:01:35
86500 -- (-744.743) (-743.958) [-740.627] (-757.308) * (-746.468) [-745.477] (-749.477) (-751.363) -- 0:01:35
87000 -- [-745.792] (-749.825) (-744.225) (-750.721) * (-743.972) (-744.251) [-745.284] (-748.483) -- 0:01:34
87500 -- [-742.397] (-743.958) (-747.766) (-747.285) * (-740.911) [-744.831] (-748.098) (-744.473) -- 0:01:33
88000 -- (-746.561) (-749.837) (-744.263) [-753.490] * (-743.299) [-740.473] (-744.777) (-740.932) -- 0:01:43
88500 -- [-742.955] (-744.120) (-748.004) (-756.069) * [-743.878] (-743.571) (-744.707) (-743.644) -- 0:01:42
89000 -- (-744.125) (-743.366) (-742.194) [-751.768] * (-743.625) (-743.538) [-742.014] (-744.495) -- 0:01:42
89500 -- (-745.323) (-739.661) [-744.137] (-745.764) * (-741.925) (-748.768) [-743.977] (-744.792) -- 0:01:41
90000 -- (-744.817) (-746.763) (-746.583) [-748.270] * (-744.588) [-745.667] (-743.812) (-743.763) -- 0:01:41
Average standard deviation of split frequencies: 0.054593
90500 -- [-745.400] (-749.724) (-757.183) (-748.362) * [-744.661] (-749.511) (-742.433) (-749.716) -- 0:01:40
91000 -- (-754.350) (-746.459) [-745.327] (-743.934) * (-747.840) [-745.065] (-742.064) (-748.242) -- 0:01:39
91500 -- [-745.659] (-742.127) (-742.275) (-747.654) * (-758.901) (-745.065) [-743.034] (-751.125) -- 0:01:39
92000 -- (-747.639) [-742.719] (-746.402) (-748.563) * (-749.861) [-742.158] (-744.217) (-748.159) -- 0:01:38
92500 -- (-746.236) (-741.900) [-743.331] (-742.260) * [-745.738] (-750.676) (-744.335) (-753.119) -- 0:01:38
93000 -- (-750.748) (-753.006) [-746.602] (-749.831) * [-745.488] (-752.411) (-744.092) (-753.447) -- 0:01:37
93500 -- (-743.578) [-745.191] (-747.482) (-746.302) * (-746.737) (-745.117) [-744.941] (-748.531) -- 0:01:36
94000 -- (-746.504) (-744.564) [-745.129] (-740.964) * (-742.651) (-747.804) [-744.084] (-744.864) -- 0:01:36
94500 -- (-747.081) (-747.795) [-742.080] (-742.228) * (-742.294) (-744.927) [-743.719] (-743.508) -- 0:01:35
95000 -- [-746.119] (-744.766) (-745.424) (-743.774) * (-745.627) [-743.985] (-743.237) (-746.571) -- 0:01:35
Average standard deviation of split frequencies: 0.066291
95500 -- (-743.935) (-743.430) [-743.398] (-745.192) * [-742.393] (-745.005) (-743.733) (-742.585) -- 0:01:34
96000 -- [-742.662] (-742.080) (-744.918) (-745.607) * (-748.918) (-748.967) [-741.431] (-742.808) -- 0:01:34
96500 -- (-743.718) [-745.480] (-763.202) (-746.647) * (-744.549) [-748.895] (-751.948) (-743.657) -- 0:01:33
97000 -- (-744.031) (-747.680) [-749.620] (-745.196) * [-743.775] (-748.688) (-751.105) (-747.910) -- 0:01:33
97500 -- (-746.443) (-745.645) (-744.196) [-747.887] * [-746.096] (-749.476) (-747.837) (-757.637) -- 0:01:32
98000 -- (-746.779) (-744.860) [-744.420] (-746.263) * (-751.551) (-742.389) (-750.566) [-749.311] -- 0:01:41
98500 -- (-751.800) (-747.017) (-746.036) [-743.711] * (-744.737) (-743.943) (-748.870) [-752.586] -- 0:01:40
99000 -- (-743.228) [-741.227] (-742.792) (-744.466) * (-739.766) (-750.757) [-747.011] (-745.821) -- 0:01:40
99500 -- (-744.322) (-739.284) [-741.349] (-744.842) * (-743.623) (-744.624) [-746.132] (-748.961) -- 0:01:39
100000 -- (-747.393) [-742.181] (-742.675) (-743.118) * [-740.835] (-747.311) (-751.360) (-746.025) -- 0:01:39
Average standard deviation of split frequencies: 0.046828
100500 -- (-741.815) (-744.677) [-743.533] (-744.198) * (-744.781) [-741.388] (-750.041) (-743.810) -- 0:01:38
101000 -- [-743.749] (-745.823) (-744.443) (-747.516) * (-741.753) (-748.231) (-746.936) [-742.637] -- 0:01:37
101500 -- (-749.234) (-761.379) (-742.833) [-748.522] * (-741.831) (-743.573) (-746.786) [-749.969] -- 0:01:37
102000 -- [-743.236] (-754.694) (-741.234) (-749.654) * (-742.687) [-740.795] (-740.503) (-744.912) -- 0:01:36
102500 -- (-742.768) (-747.163) [-744.640] (-746.790) * (-745.188) (-741.818) [-746.692] (-744.761) -- 0:01:36
103000 -- (-741.737) (-747.954) [-757.299] (-745.959) * (-744.048) [-748.567] (-748.016) (-747.863) -- 0:01:35
103500 -- (-744.852) (-746.600) (-741.302) [-744.127] * (-740.690) (-751.424) (-748.154) [-741.603] -- 0:01:35
104000 -- (-747.497) (-751.959) (-747.114) [-743.852] * (-743.657) (-751.147) (-748.948) [-750.251] -- 0:01:34
104500 -- (-744.003) (-746.132) (-744.869) [-744.511] * (-747.290) (-749.112) [-744.463] (-742.745) -- 0:01:34
105000 -- (-749.518) [-744.469] (-744.913) (-740.095) * (-741.240) (-749.752) (-749.839) [-746.233] -- 0:01:33
Average standard deviation of split frequencies: 0.046696
105500 -- (-751.338) (-743.270) (-743.582) [-748.900] * (-746.813) (-745.253) (-753.180) [-740.959] -- 0:01:33
106000 -- (-756.768) [-741.465] (-742.600) (-750.204) * (-743.333) (-754.937) [-744.096] (-742.513) -- 0:01:32
106500 -- (-745.907) [-743.324] (-748.327) (-741.497) * [-748.973] (-748.059) (-750.535) (-749.499) -- 0:01:32
107000 -- (-756.348) (-742.192) [-746.026] (-744.189) * [-746.029] (-746.125) (-743.290) (-745.693) -- 0:01:31
107500 -- (-751.171) [-743.987] (-749.967) (-746.423) * (-741.367) (-746.108) [-743.758] (-749.498) -- 0:01:39
108000 -- (-745.819) [-743.760] (-746.674) (-741.338) * [-740.794] (-742.592) (-745.782) (-751.048) -- 0:01:39
108500 -- (-744.077) [-744.694] (-744.871) (-748.573) * (-741.910) [-744.633] (-745.527) (-749.965) -- 0:01:38
109000 -- (-744.001) [-749.845] (-753.596) (-742.807) * [-742.330] (-742.262) (-745.229) (-748.814) -- 0:01:38
109500 -- [-741.894] (-747.589) (-742.249) (-747.894) * (-742.177) [-745.685] (-749.521) (-744.208) -- 0:01:37
110000 -- (-747.113) (-743.422) [-743.725] (-748.969) * (-744.056) (-742.009) [-752.400] (-748.503) -- 0:01:37
Average standard deviation of split frequencies: 0.044727
110500 -- (-742.343) [-744.060] (-744.794) (-740.052) * (-743.680) [-742.500] (-744.045) (-752.238) -- 0:01:36
111000 -- (-744.556) (-745.769) (-744.673) [-744.851] * [-746.907] (-752.976) (-744.930) (-749.859) -- 0:01:36
111500 -- (-757.426) (-744.854) [-742.252] (-743.125) * [-744.119] (-746.707) (-749.912) (-743.761) -- 0:01:35
112000 -- (-752.813) (-744.012) [-748.378] (-745.574) * (-747.474) (-751.650) [-748.642] (-749.344) -- 0:01:35
112500 -- (-748.659) (-743.990) (-748.210) [-745.526] * (-747.225) (-748.658) (-745.351) [-747.317] -- 0:01:34
113000 -- (-752.100) (-747.964) [-742.156] (-744.915) * (-746.360) (-742.490) [-746.333] (-747.227) -- 0:01:34
113500 -- (-752.221) [-744.480] (-744.697) (-748.847) * (-747.033) (-742.558) [-744.118] (-750.217) -- 0:01:33
114000 -- (-745.676) (-745.847) [-742.694] (-752.218) * (-748.894) (-743.112) (-741.246) [-747.187] -- 0:01:33
114500 -- (-748.014) (-744.416) [-750.017] (-749.432) * (-745.269) [-744.859] (-740.148) (-751.082) -- 0:01:32
115000 -- (-751.131) (-743.729) (-743.947) [-743.394] * (-750.341) [-744.408] (-742.175) (-745.129) -- 0:01:32
Average standard deviation of split frequencies: 0.028447
115500 -- (-745.395) (-751.670) [-743.618] (-742.833) * (-745.162) (-750.368) [-747.834] (-742.946) -- 0:01:31
116000 -- (-747.663) (-745.705) (-746.998) [-743.161] * (-749.431) (-746.148) [-749.473] (-744.812) -- 0:01:31
116500 -- (-746.413) (-740.755) [-744.175] (-751.452) * (-752.184) [-745.095] (-740.901) (-745.159) -- 0:01:31
117000 -- (-748.206) (-739.784) (-751.526) [-748.787] * [-747.968] (-743.669) (-743.966) (-745.439) -- 0:01:30
117500 -- (-756.592) [-743.348] (-749.436) (-743.790) * (-751.420) [-749.317] (-745.781) (-744.776) -- 0:01:37
118000 -- (-757.644) [-743.057] (-749.695) (-753.128) * [-746.606] (-751.236) (-750.695) (-746.244) -- 0:01:37
118500 -- (-742.102) (-743.516) [-748.817] (-748.332) * (-743.873) (-750.909) (-757.946) [-744.033] -- 0:01:36
119000 -- (-747.678) (-745.658) [-742.134] (-742.024) * (-744.201) (-746.805) (-753.179) [-741.820] -- 0:01:36
119500 -- (-746.920) [-743.825] (-740.449) (-742.202) * (-744.072) (-747.499) (-748.823) [-746.882] -- 0:01:35
120000 -- (-744.272) (-744.013) [-739.960] (-742.937) * [-744.521] (-743.260) (-747.536) (-747.919) -- 0:01:35
Average standard deviation of split frequencies: 0.007813
120500 -- [-743.230] (-745.663) (-744.603) (-743.541) * (-749.038) (-750.390) [-745.175] (-746.493) -- 0:01:34
121000 -- (-748.977) [-746.218] (-742.495) (-749.952) * [-742.638] (-747.922) (-746.835) (-746.542) -- 0:01:34
121500 -- (-747.276) [-742.161] (-746.590) (-754.003) * (-741.501) (-752.712) [-745.273] (-749.408) -- 0:01:33
122000 -- (-746.394) (-745.492) [-749.540] (-743.961) * (-746.965) (-751.461) [-745.875] (-751.753) -- 0:01:33
122500 -- (-747.507) (-749.729) [-742.959] (-744.099) * (-748.638) [-747.853] (-747.264) (-745.606) -- 0:01:33
123000 -- (-746.541) (-756.813) [-743.010] (-749.065) * (-748.342) (-748.698) (-748.279) [-745.216] -- 0:01:32
123500 -- (-751.162) (-750.248) [-742.536] (-745.822) * (-754.591) (-753.159) [-746.665] (-745.816) -- 0:01:32
124000 -- (-754.909) (-752.999) (-745.214) [-747.792] * [-753.946] (-748.500) (-747.763) (-752.572) -- 0:01:31
124500 -- [-756.735] (-752.243) (-744.074) (-747.935) * (-745.868) (-745.339) [-741.728] (-755.749) -- 0:01:31
125000 -- (-747.935) (-747.073) [-750.229] (-745.655) * (-748.271) [-746.732] (-750.416) (-748.024) -- 0:01:31
Average standard deviation of split frequencies: 0.003741
125500 -- (-743.517) (-749.237) (-744.620) [-743.624] * (-747.920) (-743.302) [-745.802] (-743.878) -- 0:01:30
126000 -- [-746.763] (-748.276) (-744.578) (-749.821) * (-744.951) [-745.876] (-743.438) (-747.044) -- 0:01:30
126500 -- (-746.576) (-748.321) (-741.046) [-747.483] * (-741.932) (-753.961) (-746.334) [-747.595] -- 0:01:29
127000 -- (-744.390) (-745.895) [-744.872] (-751.846) * (-748.853) [-746.100] (-744.694) (-748.131) -- 0:01:29
127500 -- (-745.648) (-753.913) [-746.012] (-745.938) * (-745.119) (-746.856) (-753.810) [-748.554] -- 0:01:35
128000 -- (-745.087) (-751.334) (-748.386) [-748.659] * [-746.704] (-741.782) (-751.842) (-744.506) -- 0:01:35
128500 -- (-740.115) [-754.447] (-740.978) (-747.079) * [-738.866] (-743.304) (-751.144) (-748.898) -- 0:01:34
129000 -- (-740.945) [-748.571] (-743.545) (-750.771) * (-742.304) [-745.393] (-751.280) (-754.957) -- 0:01:34
129500 -- (-743.494) (-745.694) [-743.627] (-748.237) * (-744.551) [-742.417] (-748.314) (-750.044) -- 0:01:34
130000 -- (-740.401) (-748.440) [-746.466] (-747.676) * [-743.998] (-741.357) (-743.537) (-746.891) -- 0:01:33
Average standard deviation of split frequencies: 0.007215
130500 -- [-742.677] (-749.246) (-743.302) (-754.145) * (-746.650) (-744.780) [-744.375] (-744.838) -- 0:01:33
131000 -- (-743.258) (-748.490) [-742.124] (-746.663) * [-747.616] (-745.241) (-748.103) (-745.637) -- 0:01:32
131500 -- [-745.366] (-744.729) (-745.374) (-758.553) * (-741.855) [-745.993] (-741.122) (-740.614) -- 0:01:32
132000 -- [-747.067] (-744.097) (-746.861) (-751.675) * (-743.571) [-742.326] (-745.621) (-743.202) -- 0:01:32
132500 -- (-748.642) (-744.828) (-744.104) [-741.441] * (-743.759) [-749.715] (-742.859) (-747.998) -- 0:01:31
133000 -- (-745.800) [-743.382] (-748.782) (-746.925) * [-744.583] (-749.478) (-749.212) (-746.926) -- 0:01:31
133500 -- (-742.655) [-742.347] (-753.524) (-741.714) * (-743.889) [-749.747] (-746.867) (-742.648) -- 0:01:30
134000 -- (-745.074) (-743.855) (-747.406) [-744.017] * (-745.313) (-748.615) [-743.446] (-748.430) -- 0:01:30
134500 -- (-744.642) [-746.805] (-753.045) (-743.765) * (-742.968) [-742.933] (-745.313) (-750.991) -- 0:01:30
135000 -- (-745.716) (-750.073) (-756.817) [-741.020] * [-742.640] (-745.940) (-747.259) (-748.234) -- 0:01:29
Average standard deviation of split frequencies: 0.016176
135500 -- (-743.788) [-745.522] (-741.173) (-740.759) * (-742.490) [-745.426] (-746.513) (-747.822) -- 0:01:29
136000 -- [-749.019] (-744.570) (-741.433) (-744.457) * (-741.970) (-748.576) [-745.930] (-748.119) -- 0:01:28
136500 -- (-744.447) (-744.838) (-745.403) [-748.106] * [-740.930] (-748.349) (-743.552) (-744.191) -- 0:01:28
137000 -- (-745.660) (-743.586) (-747.295) [-750.532] * (-742.700) (-746.627) [-742.617] (-746.028) -- 0:01:28
137500 -- (-745.878) (-746.901) [-744.613] (-743.563) * (-748.325) [-747.627] (-741.700) (-747.241) -- 0:01:34
138000 -- (-754.149) [-746.057] (-748.789) (-749.884) * (-747.962) [-745.314] (-745.593) (-748.657) -- 0:01:33
138500 -- (-746.326) (-746.811) (-746.247) [-750.442] * (-745.906) [-742.855] (-747.018) (-745.709) -- 0:01:33
139000 -- (-749.143) (-751.789) [-746.323] (-748.361) * (-745.281) [-747.623] (-744.377) (-745.835) -- 0:01:32
139500 -- (-746.145) [-752.028] (-753.336) (-750.992) * (-745.686) (-743.241) (-747.064) [-747.940] -- 0:01:32
140000 -- [-739.854] (-744.412) (-750.018) (-753.915) * (-753.953) (-742.485) [-743.527] (-747.965) -- 0:01:32
Average standard deviation of split frequencies: 0.015639
140500 -- (-744.303) (-744.974) [-749.580] (-749.188) * (-743.364) (-742.771) (-746.126) [-743.893] -- 0:01:31
141000 -- [-740.545] (-743.282) (-748.270) (-742.152) * (-745.959) [-741.440] (-749.912) (-750.537) -- 0:01:31
141500 -- [-744.324] (-743.923) (-751.169) (-743.985) * [-745.554] (-743.922) (-745.938) (-746.333) -- 0:01:31
142000 -- (-746.259) (-746.905) [-746.395] (-746.014) * (-754.971) (-741.561) [-744.038] (-751.279) -- 0:01:30
142500 -- (-742.599) (-745.137) [-745.421] (-743.932) * (-748.551) [-739.776] (-742.366) (-747.204) -- 0:01:30
143000 -- [-744.131] (-744.902) (-740.666) (-747.938) * (-746.791) [-748.269] (-745.987) (-748.130) -- 0:01:29
143500 -- (-743.483) (-749.740) (-749.072) [-748.508] * (-751.560) (-752.543) [-745.880] (-757.769) -- 0:01:29
144000 -- (-744.023) (-749.032) [-742.273] (-746.451) * (-748.676) (-749.159) (-746.784) [-742.898] -- 0:01:29
144500 -- (-748.633) (-745.362) [-745.604] (-745.597) * (-749.359) (-747.328) (-742.998) [-746.900] -- 0:01:28
145000 -- (-749.472) (-749.515) (-747.237) [-741.478] * (-744.014) [-746.631] (-742.346) (-747.263) -- 0:01:28
Average standard deviation of split frequencies: 0.015068
145500 -- [-747.814] (-745.649) (-748.389) (-747.582) * (-748.729) [-742.770] (-749.168) (-750.352) -- 0:01:28
146000 -- (-745.302) [-743.098] (-747.657) (-749.306) * (-749.959) (-744.782) [-743.786] (-742.366) -- 0:01:27
146500 -- (-742.777) [-745.716] (-742.682) (-744.046) * [-754.740] (-744.214) (-752.028) (-744.707) -- 0:01:27
147000 -- (-746.687) (-743.579) [-742.993] (-750.778) * (-748.531) (-745.644) [-750.050] (-746.379) -- 0:01:27
147500 -- [-746.292] (-745.639) (-741.909) (-742.112) * [-749.249] (-748.970) (-743.809) (-748.073) -- 0:01:32
148000 -- (-744.427) [-746.078] (-752.654) (-743.612) * (-744.178) (-745.409) (-746.166) [-747.721] -- 0:01:32
148500 -- (-743.443) (-744.812) [-745.984] (-752.161) * (-744.103) [-744.306] (-749.590) (-746.560) -- 0:01:31
149000 -- [-740.562] (-742.931) (-747.722) (-745.976) * (-750.688) (-745.810) [-746.443] (-743.714) -- 0:01:31
149500 -- (-747.035) (-749.547) (-748.450) [-744.711] * [-742.064] (-748.591) (-747.256) (-745.246) -- 0:01:31
150000 -- (-746.361) [-743.043] (-748.430) (-742.850) * (-747.190) [-744.371] (-742.575) (-746.429) -- 0:01:30
Average standard deviation of split frequencies: 0.018773
150500 -- (-748.344) (-746.012) (-742.936) [-741.778] * (-746.593) (-743.628) (-747.357) [-760.036] -- 0:01:30
151000 -- (-745.741) [-747.924] (-744.169) (-748.705) * (-747.968) (-742.091) [-745.993] (-747.891) -- 0:01:29
151500 -- (-749.943) (-749.424) (-740.148) [-745.780] * (-746.462) [-742.789] (-749.505) (-743.578) -- 0:01:29
152000 -- (-745.328) (-752.611) (-746.732) [-742.544] * (-748.492) (-750.911) (-753.775) [-741.401] -- 0:01:29
152500 -- (-744.933) (-745.166) [-746.136] (-744.461) * (-747.439) (-743.779) (-753.901) [-739.608] -- 0:01:28
153000 -- (-745.398) (-744.626) [-745.321] (-748.116) * [-747.985] (-741.672) (-752.199) (-745.602) -- 0:01:28
153500 -- (-745.940) (-745.908) [-748.938] (-747.669) * (-745.797) (-741.388) [-746.494] (-741.017) -- 0:01:28
154000 -- (-743.520) [-740.186] (-744.650) (-743.785) * (-747.299) [-744.932] (-747.670) (-742.983) -- 0:01:27
154500 -- [-746.593] (-744.246) (-744.487) (-748.967) * (-754.395) (-743.139) (-754.191) [-742.641] -- 0:01:27
155000 -- (-745.827) [-751.653] (-747.802) (-745.131) * (-743.338) [-740.356] (-745.077) (-747.841) -- 0:01:27
Average standard deviation of split frequencies: 0.018131
155500 -- (-746.349) (-743.242) (-747.880) [-744.870] * (-742.485) [-743.763] (-742.842) (-744.108) -- 0:01:26
156000 -- (-746.520) (-741.913) (-743.195) [-745.964] * (-746.945) [-745.571] (-749.636) (-745.780) -- 0:01:26
156500 -- (-740.975) (-741.354) [-745.688] (-746.332) * [-748.451] (-747.082) (-745.656) (-751.132) -- 0:01:26
157000 -- [-745.223] (-744.487) (-746.435) (-744.733) * (-747.273) (-748.236) (-745.870) [-748.110] -- 0:01:25
157500 -- [-742.365] (-743.499) (-742.005) (-747.247) * (-742.615) (-750.246) (-748.299) [-743.128] -- 0:01:30
158000 -- (-752.063) (-746.220) (-745.531) [-741.896] * (-744.586) (-748.988) (-750.933) [-754.246] -- 0:01:30
158500 -- [-747.334] (-747.370) (-742.227) (-748.448) * [-743.918] (-748.943) (-740.761) (-744.946) -- 0:01:30
159000 -- (-753.887) (-744.473) [-745.572] (-750.842) * (-750.534) (-746.905) (-742.176) [-743.960] -- 0:01:29
159500 -- (-743.794) [-744.687] (-748.370) (-747.903) * (-744.490) (-745.989) (-745.850) [-744.221] -- 0:01:29
160000 -- [-743.326] (-745.912) (-742.152) (-745.471) * (-743.503) [-744.707] (-748.198) (-744.930) -- 0:01:29
Average standard deviation of split frequencies: 0.013692
160500 -- (-744.827) [-748.165] (-744.010) (-740.483) * [-746.468] (-752.605) (-746.835) (-747.859) -- 0:01:28
161000 -- (-743.238) [-741.877] (-749.801) (-745.220) * (-747.342) (-745.890) (-748.215) [-747.274] -- 0:01:28
161500 -- (-738.940) [-749.267] (-745.918) (-745.896) * (-746.860) (-745.644) [-748.638] (-747.402) -- 0:01:28
162000 -- (-744.834) [-747.358] (-741.826) (-744.962) * [-741.713] (-746.019) (-750.191) (-745.226) -- 0:01:27
162500 -- (-750.707) (-743.192) [-742.486] (-741.773) * (-745.865) (-751.710) [-745.094] (-749.693) -- 0:01:27
163000 -- [-749.082] (-742.686) (-745.636) (-740.045) * (-745.432) [-753.501] (-745.047) (-746.261) -- 0:01:27
163500 -- (-747.630) (-748.496) (-742.277) [-743.291] * (-747.392) (-748.698) [-745.368] (-745.948) -- 0:01:26
164000 -- (-754.648) (-742.507) (-742.938) [-744.287] * (-744.029) (-747.674) [-747.643] (-752.243) -- 0:01:26
164500 -- (-748.612) [-744.318] (-741.587) (-746.582) * (-742.931) [-749.607] (-747.327) (-758.110) -- 0:01:26
165000 -- (-745.212) (-751.830) [-744.718] (-746.580) * [-741.752] (-756.604) (-750.491) (-747.391) -- 0:01:26
Average standard deviation of split frequencies: 0.013252
165500 -- [-747.423] (-747.707) (-744.001) (-747.700) * (-745.429) (-753.930) (-749.349) [-747.493] -- 0:01:25
166000 -- [-745.532] (-743.542) (-744.452) (-743.633) * (-743.806) (-742.729) (-748.445) [-743.406] -- 0:01:25
166500 -- (-748.765) (-746.736) (-745.597) [-747.000] * (-742.911) [-747.220] (-746.704) (-749.582) -- 0:01:25
167000 -- (-745.869) (-751.760) (-743.582) [-744.607] * (-750.605) (-744.805) (-744.486) [-743.153] -- 0:01:24
167500 -- [-740.838] (-752.302) (-746.140) (-747.150) * [-742.049] (-743.017) (-747.625) (-742.053) -- 0:01:29
168000 -- [-742.893] (-757.643) (-743.093) (-745.198) * (-744.229) (-740.163) (-751.404) [-742.233] -- 0:01:29
168500 -- (-741.736) [-750.962] (-745.171) (-741.906) * (-742.585) [-744.973] (-746.537) (-741.197) -- 0:01:28
169000 -- (-745.047) (-742.866) (-747.472) [-741.236] * [-746.549] (-747.395) (-744.904) (-745.321) -- 0:01:28
169500 -- [-744.401] (-742.693) (-748.336) (-743.569) * (-745.610) (-749.085) (-747.870) [-747.251] -- 0:01:28
170000 -- (-745.850) [-746.072] (-752.757) (-744.618) * [-746.325] (-747.137) (-749.503) (-746.870) -- 0:01:27
Average standard deviation of split frequencies: 0.014731
170500 -- (-748.149) (-739.910) (-747.192) [-744.802] * (-747.715) (-748.588) [-742.755] (-753.610) -- 0:01:27
171000 -- (-743.481) [-740.939] (-743.267) (-747.769) * (-742.876) (-741.631) (-741.325) [-745.363] -- 0:01:27
171500 -- (-746.547) (-743.728) (-743.021) [-744.061] * (-747.430) [-739.874] (-743.267) (-746.238) -- 0:01:26
172000 -- (-747.499) [-739.615] (-742.492) (-746.391) * (-750.702) (-741.026) (-744.317) [-748.557] -- 0:01:26
172500 -- (-748.499) (-745.033) (-744.064) [-748.687] * (-745.838) (-743.783) (-747.059) [-748.665] -- 0:01:26
173000 -- (-749.051) (-743.906) [-744.707] (-743.421) * [-742.050] (-747.841) (-751.431) (-747.291) -- 0:01:26
173500 -- (-748.050) (-748.454) [-741.985] (-746.335) * (-746.626) (-741.009) (-746.827) [-744.026] -- 0:01:25
174000 -- [-744.750] (-745.785) (-746.168) (-742.564) * (-749.950) (-744.881) (-750.140) [-745.322] -- 0:01:25
174500 -- [-744.025] (-745.320) (-743.522) (-749.115) * [-741.216] (-746.013) (-751.792) (-744.915) -- 0:01:25
175000 -- (-747.359) (-742.390) (-750.023) [-745.200] * (-744.501) (-743.524) [-747.031] (-744.154) -- 0:01:24
Average standard deviation of split frequencies: 0.019642
175500 -- (-749.687) (-745.079) [-739.478] (-743.667) * [-741.757] (-740.860) (-745.420) (-746.150) -- 0:01:24
176000 -- (-749.396) (-750.628) [-742.992] (-744.973) * (-747.479) [-745.543] (-747.884) (-743.253) -- 0:01:24
176500 -- (-746.984) (-753.307) (-748.304) [-750.017] * (-747.487) (-746.745) [-746.489] (-743.934) -- 0:01:23
177000 -- (-754.087) (-754.855) (-747.808) [-746.642] * [-742.012] (-742.000) (-749.084) (-743.366) -- 0:01:23
177500 -- [-746.338] (-755.984) (-745.146) (-741.732) * [-743.970] (-744.789) (-750.113) (-740.912) -- 0:01:28
178000 -- (-747.066) (-748.127) [-746.628] (-747.021) * (-748.258) (-746.515) (-750.805) [-745.477] -- 0:01:27
178500 -- (-749.445) [-743.442] (-749.977) (-746.642) * (-746.827) [-745.957] (-754.207) (-748.204) -- 0:01:27
179000 -- (-748.643) (-742.043) (-746.178) [-749.554] * (-745.882) (-747.615) [-749.366] (-752.814) -- 0:01:27
179500 -- [-742.258] (-745.345) (-743.798) (-746.193) * (-742.637) [-743.885] (-758.726) (-743.113) -- 0:01:26
180000 -- (-747.494) (-742.573) (-748.550) [-746.551] * (-744.870) [-746.823] (-753.013) (-748.756) -- 0:01:26
Average standard deviation of split frequencies: 0.024353
180500 -- [-744.302] (-746.710) (-745.678) (-743.402) * (-743.359) [-740.355] (-757.513) (-745.700) -- 0:01:26
181000 -- (-749.978) (-752.586) (-749.770) [-746.288] * (-746.831) [-745.937] (-752.378) (-743.972) -- 0:01:25
181500 -- [-744.314] (-748.707) (-745.940) (-747.201) * (-743.583) [-748.417] (-751.704) (-742.192) -- 0:01:25
182000 -- (-741.806) (-755.405) [-745.500] (-743.938) * [-745.416] (-748.824) (-750.862) (-740.586) -- 0:01:25
182500 -- (-745.569) (-750.649) [-744.887] (-743.673) * (-742.229) (-754.217) (-747.478) [-742.971] -- 0:01:25
183000 -- (-743.518) (-741.317) (-745.349) [-741.233] * (-748.808) (-748.688) (-754.514) [-743.486] -- 0:01:24
183500 -- (-744.717) (-745.712) (-743.391) [-740.730] * [-740.273] (-751.691) (-751.167) (-746.271) -- 0:01:24
184000 -- [-746.078] (-745.070) (-748.147) (-748.270) * [-740.374] (-741.881) (-745.846) (-749.633) -- 0:01:24
184500 -- (-750.628) (-743.146) (-747.738) [-751.384] * (-742.714) [-740.713] (-746.796) (-741.005) -- 0:01:23
185000 -- (-745.647) [-747.929] (-749.795) (-747.085) * [-744.680] (-744.656) (-748.075) (-741.537) -- 0:01:23
Average standard deviation of split frequencies: 0.016896
185500 -- (-747.442) [-742.329] (-749.601) (-744.778) * (-742.515) (-742.233) (-751.702) [-746.276] -- 0:01:23
186000 -- (-746.770) (-743.587) [-747.166] (-741.919) * (-745.934) (-741.760) (-751.545) [-746.032] -- 0:01:23
186500 -- (-748.907) [-743.462] (-743.748) (-743.501) * [-745.859] (-743.991) (-746.329) (-742.409) -- 0:01:22
187000 -- (-748.780) (-745.480) [-742.883] (-741.537) * (-750.760) (-740.063) [-744.702] (-742.881) -- 0:01:26
187500 -- (-744.103) [-747.728] (-744.991) (-744.792) * (-755.906) [-742.514] (-747.753) (-742.932) -- 0:01:26
188000 -- [-743.894] (-746.604) (-744.545) (-746.504) * (-752.420) (-745.121) (-748.320) [-743.149] -- 0:01:26
188500 -- (-750.291) [-751.072] (-747.683) (-742.906) * (-746.550) [-748.176] (-746.633) (-744.958) -- 0:01:26
189000 -- (-744.863) (-745.579) (-745.215) [-743.156] * (-740.896) (-751.029) [-749.416] (-742.625) -- 0:01:25
189500 -- (-742.976) (-749.583) [-742.912] (-743.287) * (-740.469) (-747.162) (-745.285) [-745.008] -- 0:01:25
190000 -- (-751.099) (-749.544) (-748.647) [-745.883] * (-743.671) (-748.161) [-747.534] (-746.209) -- 0:01:25
Average standard deviation of split frequencies: 0.018131
190500 -- (-747.668) (-753.299) [-745.258] (-743.818) * (-743.057) (-742.579) [-744.231] (-749.585) -- 0:01:24
191000 -- (-750.745) (-747.516) [-749.026] (-744.288) * (-741.537) [-739.666] (-739.665) (-745.715) -- 0:01:24
191500 -- [-746.465] (-747.365) (-744.172) (-743.391) * (-749.021) (-745.005) [-742.222] (-748.739) -- 0:01:24
192000 -- (-749.017) (-742.447) (-748.039) [-745.438] * (-741.466) (-743.682) (-745.338) [-743.865] -- 0:01:24
192500 -- (-743.156) [-747.200] (-747.355) (-748.822) * (-749.012) (-747.960) (-751.231) [-745.818] -- 0:01:23
193000 -- (-743.107) (-744.548) [-748.270] (-748.520) * (-750.869) (-748.575) (-750.567) [-745.497] -- 0:01:23
193500 -- (-744.184) (-743.374) (-749.597) [-741.459] * [-747.199] (-749.774) (-748.899) (-750.135) -- 0:01:23
194000 -- [-744.030] (-742.666) (-748.590) (-755.147) * (-745.791) (-749.645) (-749.892) [-748.392] -- 0:01:23
194500 -- [-743.946] (-746.051) (-747.005) (-740.498) * (-747.976) (-752.731) [-745.956] (-745.277) -- 0:01:22
195000 -- (-741.657) (-746.237) [-746.463] (-744.281) * [-744.685] (-748.252) (-745.869) (-744.252) -- 0:01:22
Average standard deviation of split frequencies: 0.017638
195500 -- (-747.962) (-748.127) [-747.425] (-747.720) * (-744.483) [-746.765] (-755.520) (-743.818) -- 0:01:22
196000 -- (-746.195) [-741.801] (-750.323) (-751.917) * (-744.055) (-747.217) [-744.356] (-744.798) -- 0:01:22
196500 -- (-745.303) [-748.656] (-754.390) (-748.600) * (-748.011) [-742.366] (-747.459) (-739.353) -- 0:01:21
197000 -- (-743.514) (-752.770) (-756.552) [-742.738] * (-748.494) [-741.629] (-744.143) (-744.622) -- 0:01:25
197500 -- [-745.755] (-747.843) (-754.517) (-741.097) * (-746.714) (-747.614) [-746.312] (-747.374) -- 0:01:25
198000 -- (-750.142) (-748.868) (-757.158) [-740.061] * [-749.046] (-744.998) (-740.637) (-745.017) -- 0:01:25
198500 -- [-743.393] (-746.211) (-757.740) (-742.106) * (-745.547) [-746.394] (-753.023) (-747.694) -- 0:01:24
199000 -- [-739.762] (-743.606) (-753.225) (-746.585) * (-744.508) [-748.872] (-748.776) (-745.143) -- 0:01:24
199500 -- (-747.125) (-746.507) (-751.525) [-745.893] * (-748.215) (-757.605) [-743.195] (-747.999) -- 0:01:24
200000 -- (-745.950) (-747.359) [-748.715] (-746.953) * [-742.698] (-746.166) (-743.957) (-742.533) -- 0:01:24
Average standard deviation of split frequencies: 0.027016
200500 -- [-743.795] (-748.926) (-747.895) (-743.388) * (-747.761) (-747.974) (-747.228) [-741.708] -- 0:01:23
201000 -- (-739.814) (-745.573) [-742.843] (-742.760) * (-748.605) (-747.037) [-747.036] (-745.115) -- 0:01:23
201500 -- [-741.406] (-747.928) (-748.125) (-743.849) * (-747.629) [-745.510] (-750.216) (-744.974) -- 0:01:23
202000 -- (-744.288) [-745.398] (-751.935) (-745.511) * [-744.826] (-744.072) (-748.434) (-750.386) -- 0:01:22
202500 -- [-742.953] (-743.214) (-746.574) (-748.040) * [-746.546] (-741.336) (-742.920) (-746.855) -- 0:01:22
203000 -- (-750.130) [-743.783] (-746.304) (-744.311) * [-743.922] (-742.622) (-743.113) (-750.010) -- 0:01:22
203500 -- (-743.962) [-743.850] (-755.602) (-746.929) * (-745.186) [-744.625] (-745.661) (-746.009) -- 0:01:22
204000 -- (-750.366) [-742.565] (-749.356) (-744.538) * (-745.681) (-747.501) [-743.248] (-747.661) -- 0:01:21
204500 -- (-742.811) [-743.263] (-752.602) (-747.326) * (-744.949) (-748.743) [-745.429] (-744.597) -- 0:01:21
205000 -- (-753.042) [-747.383] (-745.392) (-740.947) * (-743.557) (-747.124) [-745.455] (-743.389) -- 0:01:21
Average standard deviation of split frequencies: 0.027460
205500 -- (-749.832) (-744.661) (-745.078) [-740.231] * (-748.920) [-742.761] (-743.566) (-746.361) -- 0:01:21
206000 -- [-742.351] (-740.447) (-745.556) (-743.763) * (-749.900) [-744.149] (-742.665) (-751.251) -- 0:01:20
206500 -- (-746.669) [-741.700] (-742.027) (-740.999) * (-741.957) [-741.265] (-742.572) (-750.097) -- 0:01:20
207000 -- (-745.401) [-742.832] (-745.711) (-745.049) * (-740.545) (-745.143) [-741.808] (-742.845) -- 0:01:24
207500 -- (-747.202) (-745.400) (-748.635) [-742.720] * [-745.200] (-746.524) (-742.882) (-742.326) -- 0:01:24
208000 -- [-747.192] (-743.138) (-743.363) (-741.577) * (-744.918) [-749.098] (-750.372) (-746.604) -- 0:01:23
208500 -- (-752.631) (-750.384) (-743.035) [-747.108] * (-749.626) (-754.941) (-741.842) [-749.399] -- 0:01:23
209000 -- (-740.038) (-748.778) [-740.479] (-747.019) * (-746.664) (-747.963) [-743.859] (-743.995) -- 0:01:23
209500 -- (-751.073) [-745.240] (-743.783) (-750.283) * (-754.704) [-743.496] (-742.083) (-743.224) -- 0:01:23
210000 -- [-741.587] (-744.966) (-744.206) (-748.515) * (-755.397) (-744.448) (-743.669) [-742.505] -- 0:01:22
Average standard deviation of split frequencies: 0.022377
210500 -- (-746.564) (-746.573) [-744.153] (-747.902) * [-754.128] (-749.662) (-743.716) (-742.374) -- 0:01:22
211000 -- (-743.658) (-744.320) [-744.813] (-749.190) * [-742.851] (-742.617) (-744.211) (-745.384) -- 0:01:22
211500 -- [-743.312] (-743.504) (-750.472) (-748.577) * (-748.827) (-743.589) (-742.278) [-742.215] -- 0:01:22
212000 -- (-746.088) [-742.347] (-743.222) (-749.295) * (-752.299) [-742.482] (-746.572) (-747.292) -- 0:01:21
212500 -- (-745.498) (-745.538) [-741.186] (-751.022) * (-744.214) (-749.284) (-747.621) [-745.479] -- 0:01:21
213000 -- [-748.912] (-744.787) (-743.638) (-744.753) * (-741.793) [-746.657] (-742.105) (-747.008) -- 0:01:21
213500 -- (-745.383) [-746.985] (-744.871) (-755.841) * [-742.385] (-745.928) (-752.834) (-748.989) -- 0:01:21
214000 -- (-745.362) (-749.273) (-745.228) [-749.629] * [-740.044] (-757.641) (-744.222) (-743.970) -- 0:01:20
214500 -- (-752.418) [-744.034] (-750.952) (-749.779) * [-741.085] (-746.946) (-747.764) (-741.580) -- 0:01:20
215000 -- (-756.875) (-748.113) (-746.487) [-746.898] * [-740.330] (-745.552) (-748.932) (-745.692) -- 0:01:20
Average standard deviation of split frequencies: 0.020733
215500 -- (-755.530) (-745.644) [-747.531] (-748.726) * (-745.917) (-749.879) [-744.172] (-743.085) -- 0:01:20
216000 -- (-763.905) (-748.901) [-744.074] (-751.548) * (-746.719) (-750.339) (-744.368) [-746.858] -- 0:01:19
216500 -- (-768.342) (-742.614) (-747.224) [-747.157] * [-742.348] (-754.029) (-742.898) (-740.018) -- 0:01:23
217000 -- (-762.824) (-744.016) [-748.539] (-745.644) * [-742.889] (-748.654) (-745.978) (-759.718) -- 0:01:22
217500 -- (-755.495) (-748.283) (-748.217) [-747.728] * (-747.649) (-748.127) (-748.916) [-741.781] -- 0:01:22
218000 -- (-751.313) [-747.124] (-745.651) (-744.230) * (-747.670) (-752.383) [-742.203] (-749.332) -- 0:01:22
218500 -- [-752.822] (-742.118) (-744.215) (-751.468) * (-744.115) [-748.865] (-745.012) (-744.558) -- 0:01:22
219000 -- (-756.711) [-743.376] (-743.147) (-746.919) * [-747.496] (-745.435) (-744.055) (-749.014) -- 0:01:22
219500 -- (-748.738) [-740.025] (-743.819) (-746.390) * (-744.288) (-747.114) (-743.093) [-743.024] -- 0:01:21
220000 -- (-748.074) (-745.184) [-743.881] (-745.562) * (-748.847) (-749.447) [-745.077] (-741.759) -- 0:01:21
Average standard deviation of split frequencies: 0.021363
220500 -- (-747.626) (-740.445) (-751.435) [-740.814] * (-746.213) (-748.949) [-742.588] (-747.857) -- 0:01:21
221000 -- (-751.456) [-745.867] (-746.316) (-745.924) * [-746.006] (-749.502) (-748.263) (-745.778) -- 0:01:21
221500 -- (-752.631) (-741.689) [-741.905] (-750.203) * (-744.399) [-745.172] (-750.121) (-745.874) -- 0:01:20
222000 -- (-742.970) (-742.909) [-741.579] (-750.777) * (-745.771) [-745.559] (-750.256) (-761.753) -- 0:01:20
222500 -- (-748.434) (-743.114) [-742.983] (-751.245) * (-745.913) [-746.459] (-747.285) (-751.795) -- 0:01:20
223000 -- (-751.912) (-749.954) (-747.258) [-744.969] * (-744.650) (-745.921) (-746.301) [-748.004] -- 0:01:20
223500 -- (-749.093) (-747.522) (-747.913) [-741.718] * (-746.768) (-743.571) [-748.972] (-745.464) -- 0:01:19
224000 -- (-750.241) [-747.336] (-740.508) (-749.298) * (-745.369) (-741.887) [-747.880] (-748.814) -- 0:01:19
224500 -- (-752.444) (-743.757) [-744.246] (-745.517) * [-746.365] (-741.422) (-742.731) (-748.062) -- 0:01:19
225000 -- (-751.572) [-748.934] (-748.821) (-742.812) * (-743.946) (-744.902) [-748.713] (-751.903) -- 0:01:19
Average standard deviation of split frequencies: 0.019468
225500 -- (-746.459) (-747.566) (-742.209) [-742.256] * (-746.567) [-741.420] (-754.089) (-751.287) -- 0:01:18
226000 -- (-743.065) (-744.084) [-744.364] (-745.143) * (-743.804) (-750.925) (-746.247) [-740.123] -- 0:01:18
226500 -- [-741.799] (-743.423) (-745.424) (-748.962) * (-743.932) (-745.543) (-746.843) [-743.136] -- 0:01:21
227000 -- [-743.829] (-742.485) (-754.884) (-744.605) * (-741.473) [-745.671] (-746.521) (-741.974) -- 0:01:21
227500 -- [-746.676] (-745.954) (-744.561) (-754.755) * (-744.193) [-745.849] (-743.939) (-744.438) -- 0:01:21
228000 -- (-744.197) [-748.457] (-744.290) (-743.056) * [-748.793] (-743.249) (-743.643) (-743.570) -- 0:01:21
228500 -- (-745.005) (-749.513) (-741.086) [-749.576] * (-750.159) (-750.529) [-744.365] (-742.991) -- 0:01:21
229000 -- (-745.629) (-746.234) (-745.246) [-744.119] * (-743.669) (-740.196) (-749.478) [-739.523] -- 0:01:20
229500 -- (-750.258) (-745.200) (-745.883) [-740.918] * (-747.898) (-742.988) [-749.299] (-741.356) -- 0:01:20
230000 -- (-742.340) [-744.232] (-741.518) (-742.068) * (-751.324) [-745.223] (-745.728) (-744.237) -- 0:01:20
Average standard deviation of split frequencies: 0.019074
230500 -- (-743.355) (-750.740) [-741.906] (-748.448) * (-747.500) (-743.093) [-744.166] (-743.881) -- 0:01:20
231000 -- (-747.554) (-749.792) [-742.502] (-748.956) * (-748.241) (-748.202) [-746.692] (-743.278) -- 0:01:19
231500 -- (-748.733) (-749.271) [-742.595] (-749.957) * [-747.533] (-747.367) (-744.465) (-745.142) -- 0:01:19
232000 -- (-747.128) (-746.937) (-746.464) [-744.118] * [-749.204] (-751.650) (-743.646) (-749.717) -- 0:01:19
232500 -- (-744.027) [-744.544] (-748.045) (-745.224) * [-745.090] (-745.362) (-741.151) (-743.318) -- 0:01:19
233000 -- (-743.266) (-745.691) (-743.751) [-746.797] * [-750.675] (-742.451) (-747.469) (-746.424) -- 0:01:19
233500 -- (-747.538) [-749.271] (-742.820) (-741.424) * (-749.371) (-751.590) [-743.617] (-745.123) -- 0:01:18
234000 -- (-740.464) [-745.277] (-748.367) (-748.141) * (-746.793) [-748.556] (-748.941) (-744.468) -- 0:01:18
234500 -- (-743.905) (-748.876) (-748.423) [-741.291] * (-742.786) [-749.080] (-748.894) (-743.897) -- 0:01:18
235000 -- [-744.940] (-744.366) (-749.286) (-747.398) * [-745.465] (-754.606) (-747.833) (-746.080) -- 0:01:18
Average standard deviation of split frequencies: 0.019975
235500 -- (-744.619) (-748.569) (-753.005) [-746.225] * (-744.230) (-752.733) (-746.223) [-746.619] -- 0:01:17
236000 -- (-746.463) (-753.807) (-747.628) [-742.002] * (-749.151) (-747.673) [-741.561] (-745.978) -- 0:01:20
236500 -- (-742.374) (-754.786) (-746.829) [-747.156] * (-747.773) (-742.902) [-743.175] (-749.094) -- 0:01:20
237000 -- [-743.418] (-756.715) (-754.413) (-746.576) * (-743.559) [-748.308] (-746.870) (-746.888) -- 0:01:20
237500 -- (-749.516) (-745.917) (-750.097) [-743.697] * [-747.966] (-746.627) (-747.919) (-747.803) -- 0:01:20
238000 -- (-747.838) [-746.063] (-750.240) (-743.201) * [-741.000] (-744.595) (-743.244) (-748.302) -- 0:01:20
238500 -- (-744.941) [-746.029] (-749.122) (-748.840) * [-745.330] (-748.608) (-741.042) (-749.246) -- 0:01:19
239000 -- [-744.378] (-745.745) (-747.919) (-749.035) * (-745.064) [-745.630] (-744.127) (-744.816) -- 0:01:19
239500 -- (-744.987) (-748.972) [-746.955] (-753.015) * [-748.089] (-743.235) (-748.528) (-742.709) -- 0:01:19
240000 -- [-746.246] (-743.047) (-746.178) (-747.931) * (-748.199) [-744.446] (-748.097) (-744.170) -- 0:01:19
Average standard deviation of split frequencies: 0.019587
240500 -- [-745.903] (-754.364) (-745.728) (-751.265) * (-747.911) (-747.770) (-743.909) [-745.062] -- 0:01:18
241000 -- [-750.056] (-750.656) (-747.191) (-747.081) * (-743.026) [-746.361] (-746.379) (-744.870) -- 0:01:18
241500 -- [-745.521] (-745.387) (-745.357) (-755.122) * [-746.567] (-748.521) (-747.117) (-749.582) -- 0:01:18
242000 -- (-745.678) (-745.712) [-746.551] (-754.800) * [-743.196] (-755.335) (-744.677) (-742.644) -- 0:01:18
242500 -- (-742.671) (-747.837) [-744.175] (-746.601) * (-744.445) (-747.610) [-741.704] (-748.491) -- 0:01:18
243000 -- (-746.364) [-742.186] (-746.263) (-742.238) * [-746.393] (-744.928) (-746.273) (-744.106) -- 0:01:17
243500 -- (-739.571) (-750.192) [-741.805] (-744.264) * (-746.241) (-742.254) (-743.974) [-747.921] -- 0:01:17
244000 -- [-740.829] (-750.152) (-741.700) (-744.237) * (-747.646) (-747.497) [-751.309] (-750.805) -- 0:01:17
244500 -- (-746.464) [-755.060] (-744.182) (-744.048) * (-745.870) [-746.657] (-749.976) (-744.759) -- 0:01:17
245000 -- [-742.145] (-748.063) (-745.346) (-741.855) * (-747.033) (-740.473) (-746.231) [-743.988] -- 0:01:17
Average standard deviation of split frequencies: 0.021079
245500 -- (-743.715) (-748.387) [-747.908] (-742.527) * (-746.717) [-746.148] (-745.733) (-747.110) -- 0:01:19
246000 -- (-745.677) (-754.898) (-744.390) [-743.372] * (-745.023) (-746.828) (-743.001) [-742.853] -- 0:01:19
246500 -- (-745.646) [-753.065] (-746.400) (-740.623) * [-744.028] (-743.084) (-746.965) (-742.549) -- 0:01:19
247000 -- (-743.711) (-752.032) (-744.610) [-741.327] * (-744.517) (-742.823) [-741.433] (-745.601) -- 0:01:19
247500 -- (-746.604) [-747.452] (-744.161) (-743.036) * [-740.731] (-751.534) (-751.752) (-747.690) -- 0:01:19
248000 -- (-745.497) (-746.097) (-753.707) [-742.572] * (-745.275) (-745.157) [-743.149] (-745.805) -- 0:01:18
248500 -- (-740.723) (-749.134) (-745.705) [-743.652] * (-741.994) [-742.700] (-743.273) (-742.012) -- 0:01:18
249000 -- (-743.433) (-749.665) [-750.472] (-747.950) * [-746.119] (-746.319) (-746.786) (-743.994) -- 0:01:18
249500 -- (-750.940) (-745.133) [-741.790] (-750.299) * (-752.450) [-744.543] (-745.327) (-743.397) -- 0:01:18
250000 -- (-741.259) [-742.348] (-742.996) (-743.288) * (-749.439) (-746.496) [-747.349] (-744.313) -- 0:01:18
Average standard deviation of split frequencies: 0.025388
250500 -- (-744.634) [-744.343] (-742.032) (-748.238) * (-745.286) [-746.246] (-744.484) (-743.566) -- 0:01:17
251000 -- (-744.727) (-751.924) (-748.700) [-743.397] * (-742.692) (-740.487) (-747.617) [-743.516] -- 0:01:17
251500 -- (-743.902) (-750.702) [-746.822] (-744.169) * (-749.156) [-744.768] (-756.774) (-744.561) -- 0:01:17
252000 -- [-746.932] (-744.904) (-748.473) (-747.680) * (-747.825) (-752.106) [-746.888] (-747.261) -- 0:01:17
252500 -- [-745.436] (-742.164) (-744.182) (-744.254) * (-747.533) (-745.418) [-746.079] (-744.619) -- 0:01:16
253000 -- (-744.949) (-743.149) [-746.381] (-742.772) * (-746.348) (-750.251) [-747.495] (-743.133) -- 0:01:16
253500 -- (-741.679) [-743.606] (-750.132) (-744.720) * (-747.472) [-741.816] (-741.339) (-745.060) -- 0:01:16
254000 -- (-745.183) (-747.429) (-745.875) [-743.034] * [-740.791] (-742.048) (-750.674) (-749.363) -- 0:01:16
254500 -- [-745.478] (-746.610) (-743.459) (-740.516) * (-751.083) [-742.966] (-745.571) (-754.170) -- 0:01:16
255000 -- [-740.341] (-742.521) (-746.162) (-742.077) * (-748.426) [-744.647] (-748.981) (-742.712) -- 0:01:15
Average standard deviation of split frequencies: 0.030383
255500 -- (-742.120) (-747.985) [-741.632] (-744.062) * (-745.947) (-741.801) (-747.795) [-744.036] -- 0:01:18
256000 -- (-743.509) (-745.086) [-744.975] (-747.481) * (-745.089) (-745.803) (-749.195) [-742.775] -- 0:01:18
256500 -- [-741.247] (-755.137) (-742.346) (-749.139) * (-749.145) [-746.951] (-748.282) (-745.678) -- 0:01:18
257000 -- [-740.566] (-758.017) (-747.778) (-756.358) * [-742.876] (-750.416) (-750.074) (-746.496) -- 0:01:18
257500 -- [-741.757] (-746.899) (-744.353) (-747.643) * (-745.602) (-743.923) (-745.755) [-745.940] -- 0:01:17
258000 -- (-749.638) (-748.754) [-748.569] (-741.118) * (-749.134) (-741.863) [-742.437] (-745.714) -- 0:01:17
258500 -- [-738.888] (-748.909) (-745.997) (-742.623) * [-748.691] (-750.825) (-746.163) (-749.192) -- 0:01:17
259000 -- [-747.100] (-749.113) (-744.171) (-750.462) * (-742.827) (-743.583) [-740.880] (-748.048) -- 0:01:17
259500 -- (-742.493) (-746.329) (-743.514) [-745.246] * (-745.129) (-741.908) (-744.430) [-744.779] -- 0:01:17
260000 -- (-744.411) (-749.011) (-743.209) [-744.090] * (-743.217) (-747.182) [-746.616] (-746.486) -- 0:01:16
Average standard deviation of split frequencies: 0.037978
260500 -- (-740.890) (-750.698) [-752.101] (-756.073) * [-749.176] (-755.206) (-749.745) (-741.042) -- 0:01:16
261000 -- [-744.277] (-752.988) (-748.250) (-744.294) * (-740.200) (-746.499) (-757.361) [-744.413] -- 0:01:16
261500 -- (-739.602) [-756.691] (-747.313) (-744.315) * (-751.701) (-746.870) [-746.479] (-744.767) -- 0:01:16
262000 -- (-743.677) (-751.014) (-748.034) [-746.993] * (-756.791) [-745.585] (-749.674) (-745.592) -- 0:01:16
262500 -- (-748.158) [-749.939] (-748.160) (-748.447) * (-754.603) [-742.686] (-743.080) (-748.882) -- 0:01:15
263000 -- (-741.938) (-743.917) (-743.618) [-744.378] * (-751.053) [-746.483] (-748.271) (-744.938) -- 0:01:15
263500 -- (-744.202) (-748.841) [-745.931] (-746.870) * [-746.314] (-744.445) (-749.690) (-750.991) -- 0:01:15
264000 -- [-744.064] (-750.586) (-747.949) (-750.004) * (-750.720) [-745.447] (-747.460) (-748.859) -- 0:01:15
264500 -- (-745.853) [-751.356] (-754.707) (-744.877) * (-746.541) (-749.691) [-745.933] (-751.430) -- 0:01:15
265000 -- [-740.120] (-743.468) (-744.778) (-746.245) * [-748.342] (-749.563) (-750.571) (-744.627) -- 0:01:14
Average standard deviation of split frequencies: 0.037216
265500 -- [-743.187] (-747.670) (-742.999) (-751.506) * (-740.813) (-746.123) [-749.909] (-744.097) -- 0:01:17
266000 -- [-744.118] (-750.304) (-752.314) (-746.899) * (-746.037) (-756.320) [-744.103] (-757.568) -- 0:01:17
266500 -- (-747.363) (-748.767) [-746.602] (-745.999) * [-747.085] (-756.997) (-749.620) (-752.246) -- 0:01:17
267000 -- (-746.203) (-744.024) [-742.712] (-745.538) * [-747.741] (-750.226) (-749.340) (-748.502) -- 0:01:16
267500 -- (-747.085) (-748.602) (-741.286) [-742.931] * (-740.377) (-751.423) (-741.253) [-750.786] -- 0:01:16
268000 -- (-747.365) (-750.414) (-741.939) [-742.970] * [-742.578] (-750.302) (-747.837) (-746.115) -- 0:01:16
268500 -- [-744.679] (-744.143) (-741.376) (-753.509) * (-744.059) (-750.167) [-743.081] (-745.581) -- 0:01:16
269000 -- (-746.974) [-744.800] (-743.742) (-756.566) * (-746.836) (-752.622) [-743.540] (-744.616) -- 0:01:16
269500 -- (-745.734) [-743.572] (-745.521) (-747.951) * (-747.900) [-748.809] (-746.427) (-747.644) -- 0:01:15
270000 -- (-745.684) (-746.083) [-746.521] (-740.434) * (-748.309) (-744.366) [-743.359] (-742.090) -- 0:01:15
Average standard deviation of split frequencies: 0.038316
270500 -- (-748.795) (-741.468) (-744.900) [-743.194] * (-748.969) (-742.016) [-745.320] (-742.460) -- 0:01:15
271000 -- [-745.101] (-748.800) (-742.362) (-745.907) * (-743.353) [-745.065] (-755.461) (-745.346) -- 0:01:15
271500 -- (-747.144) (-746.361) (-747.619) [-741.155] * (-749.185) [-745.855] (-745.480) (-750.104) -- 0:01:15
272000 -- [-744.709] (-749.138) (-745.136) (-740.541) * [-745.266] (-744.488) (-743.803) (-745.969) -- 0:01:14
272500 -- (-742.244) (-742.543) [-742.214] (-750.290) * [-744.126] (-745.214) (-748.390) (-743.961) -- 0:01:14
273000 -- (-743.030) [-744.215] (-744.732) (-746.421) * [-743.256] (-741.788) (-746.868) (-742.385) -- 0:01:14
273500 -- (-743.443) (-744.453) (-752.218) [-747.940] * (-750.339) (-745.811) (-750.258) [-748.972] -- 0:01:14
274000 -- [-745.419] (-748.696) (-747.209) (-743.775) * (-745.504) (-745.759) [-745.181] (-746.396) -- 0:01:14
274500 -- [-750.190] (-747.809) (-749.710) (-742.885) * (-750.590) (-742.948) (-749.656) [-745.213] -- 0:01:14
275000 -- (-744.500) (-744.594) (-748.763) [-744.878] * [-747.720] (-742.426) (-746.212) (-746.184) -- 0:01:16
Average standard deviation of split frequencies: 0.032452
275500 -- (-742.187) [-743.413] (-743.400) (-743.561) * (-750.774) [-743.366] (-740.930) (-750.941) -- 0:01:16
276000 -- (-746.702) [-745.042] (-746.510) (-741.791) * (-746.112) (-744.212) (-742.477) [-747.939] -- 0:01:16
276500 -- (-751.641) [-745.596] (-743.384) (-746.851) * (-746.966) (-748.399) (-742.010) [-746.830] -- 0:01:15
277000 -- (-744.799) [-746.679] (-742.380) (-749.195) * (-748.010) (-750.355) (-742.210) [-743.056] -- 0:01:15
277500 -- (-744.633) [-746.763] (-741.677) (-748.876) * (-744.206) (-743.074) [-743.198] (-746.594) -- 0:01:15
278000 -- (-752.631) (-744.203) [-749.551] (-743.647) * [-752.386] (-742.115) (-749.244) (-747.496) -- 0:01:15
278500 -- (-741.236) (-751.856) [-746.122] (-745.372) * [-747.711] (-742.382) (-747.946) (-745.532) -- 0:01:15
279000 -- (-740.796) (-750.077) [-742.049] (-742.819) * (-745.538) (-746.026) [-746.100] (-751.009) -- 0:01:14
279500 -- [-744.405] (-751.423) (-746.574) (-740.748) * (-751.284) [-742.011] (-744.334) (-744.953) -- 0:01:14
280000 -- (-738.990) (-742.816) (-742.616) [-745.545] * [-743.137] (-751.939) (-748.123) (-741.753) -- 0:01:14
Average standard deviation of split frequencies: 0.033592
280500 -- (-739.603) [-747.304] (-740.623) (-745.548) * (-743.976) [-745.911] (-743.158) (-747.122) -- 0:01:14
281000 -- (-742.422) (-745.647) [-742.830] (-744.930) * (-746.013) (-751.181) [-741.978] (-747.331) -- 0:01:14
281500 -- (-744.929) (-742.330) (-747.056) [-750.174] * (-746.108) (-744.204) [-743.460] (-745.817) -- 0:01:14
282000 -- (-743.246) (-748.775) (-746.163) [-746.287] * (-740.068) (-744.908) (-745.323) [-747.566] -- 0:01:13
282500 -- (-743.090) (-747.462) (-742.302) [-748.300] * [-743.534] (-744.851) (-742.844) (-739.931) -- 0:01:13
283000 -- (-746.583) (-751.517) [-741.025] (-748.707) * [-745.187] (-753.826) (-745.958) (-744.858) -- 0:01:13
283500 -- (-752.768) [-747.659] (-743.360) (-745.869) * (-744.418) (-756.915) [-744.282] (-746.923) -- 0:01:13
284000 -- (-744.639) [-745.157] (-743.541) (-745.470) * (-743.622) (-753.976) (-741.023) [-744.684] -- 0:01:13
284500 -- (-745.266) (-745.212) [-747.775] (-744.443) * (-747.305) (-750.539) [-743.228] (-747.833) -- 0:01:15
285000 -- (-746.960) (-744.014) [-747.947] (-745.240) * [-743.425] (-749.086) (-743.757) (-750.944) -- 0:01:15
Average standard deviation of split frequencies: 0.034614
285500 -- (-741.753) (-742.673) (-747.156) [-741.729] * [-741.484] (-746.972) (-743.548) (-745.850) -- 0:01:15
286000 -- (-743.777) (-741.157) (-744.387) [-743.577] * (-747.343) (-745.803) (-752.458) [-741.833] -- 0:01:14
286500 -- (-744.174) (-746.821) (-745.475) [-741.531] * (-740.693) (-753.107) [-744.121] (-744.532) -- 0:01:14
287000 -- [-748.933] (-746.137) (-748.046) (-742.429) * (-745.335) (-747.069) [-745.097] (-744.186) -- 0:01:14
287500 -- (-748.001) (-753.494) [-744.872] (-744.836) * (-748.347) (-745.954) (-740.623) [-740.986] -- 0:01:14
288000 -- [-741.108] (-745.704) (-746.835) (-741.412) * [-747.299] (-743.713) (-744.834) (-743.703) -- 0:01:14
288500 -- [-745.653] (-744.442) (-747.778) (-749.387) * (-751.526) (-749.545) (-741.199) [-742.984] -- 0:01:13
289000 -- (-743.762) [-745.729] (-741.625) (-743.945) * (-740.535) [-759.498] (-747.550) (-743.392) -- 0:01:13
289500 -- (-744.389) [-742.172] (-741.281) (-745.754) * (-750.253) (-749.202) [-745.311] (-743.340) -- 0:01:13
290000 -- (-753.928) (-740.456) [-744.225] (-745.675) * [-750.298] (-751.891) (-748.129) (-743.740) -- 0:01:13
Average standard deviation of split frequencies: 0.036491
290500 -- (-754.950) [-743.766] (-748.087) (-744.132) * (-749.717) (-754.850) (-746.549) [-739.791] -- 0:01:13
291000 -- (-750.296) (-746.107) [-740.446] (-745.024) * (-751.161) [-752.146] (-760.597) (-746.819) -- 0:01:13
291500 -- (-750.964) (-743.951) [-749.560] (-746.555) * [-750.398] (-750.979) (-755.850) (-741.791) -- 0:01:12
292000 -- (-748.262) (-744.479) (-747.175) [-745.143] * (-750.985) (-756.294) [-746.628] (-741.910) -- 0:01:12
292500 -- (-746.639) (-744.721) (-743.761) [-742.359] * [-743.971] (-750.268) (-744.028) (-746.758) -- 0:01:12
293000 -- (-742.101) [-743.788] (-742.316) (-748.983) * (-743.797) [-745.212] (-748.182) (-746.018) -- 0:01:12
293500 -- (-751.468) (-741.819) [-743.758] (-747.336) * (-747.765) (-749.081) [-747.342] (-740.833) -- 0:01:12
294000 -- (-745.277) (-748.187) [-740.816] (-749.542) * [-745.054] (-750.616) (-751.476) (-746.129) -- 0:01:12
294500 -- (-745.767) (-744.259) (-748.171) [-745.030] * (-747.082) [-742.285] (-741.485) (-747.112) -- 0:01:14
295000 -- (-746.135) (-745.206) (-741.849) [-748.695] * [-746.731] (-755.295) (-745.225) (-744.945) -- 0:01:14
Average standard deviation of split frequencies: 0.035037
295500 -- (-745.146) [-741.782] (-741.632) (-744.533) * (-748.779) (-750.566) (-749.653) [-745.915] -- 0:01:13
296000 -- (-744.851) (-741.947) [-745.418] (-745.273) * (-752.805) (-742.959) [-744.518] (-752.215) -- 0:01:13
296500 -- [-747.323] (-749.062) (-739.647) (-748.399) * (-747.212) (-754.529) (-749.064) [-746.944] -- 0:01:13
297000 -- (-748.442) [-744.915] (-748.840) (-748.369) * (-749.014) (-746.789) [-746.865] (-750.850) -- 0:01:13
297500 -- (-745.840) (-741.650) [-742.088] (-746.996) * (-749.239) (-744.604) (-742.984) [-746.205] -- 0:01:13
298000 -- (-744.157) (-752.489) [-744.413] (-744.034) * [-746.445] (-748.583) (-741.883) (-742.214) -- 0:01:13
298500 -- (-745.602) (-757.874) (-750.799) [-746.352] * (-752.284) [-744.728] (-752.268) (-745.266) -- 0:01:12
299000 -- [-744.578] (-754.712) (-746.534) (-745.432) * (-747.855) [-741.826] (-745.231) (-751.781) -- 0:01:12
299500 -- (-745.056) (-751.001) (-751.904) [-745.922] * [-748.513] (-741.144) (-746.299) (-745.326) -- 0:01:12
300000 -- [-744.126] (-751.066) (-743.604) (-747.632) * (-746.022) (-744.591) (-745.116) [-743.727] -- 0:01:12
Average standard deviation of split frequencies: 0.025870
300500 -- [-742.797] (-748.466) (-741.579) (-742.968) * [-747.134] (-745.969) (-745.466) (-745.580) -- 0:01:12
301000 -- (-741.244) (-744.745) (-748.454) [-747.475] * (-745.228) [-740.190] (-744.009) (-742.939) -- 0:01:11
301500 -- (-742.267) [-742.514] (-749.921) (-748.846) * (-749.939) (-747.799) [-747.674] (-742.864) -- 0:01:11
302000 -- (-744.936) [-742.683] (-744.101) (-743.605) * (-745.922) (-749.869) [-743.016] (-745.113) -- 0:01:11
302500 -- (-742.000) [-742.747] (-756.522) (-742.717) * [-746.512] (-749.691) (-750.222) (-744.173) -- 0:01:11
303000 -- [-743.778] (-741.977) (-745.347) (-740.201) * (-747.154) (-744.754) (-744.037) [-743.508] -- 0:01:11
303500 -- (-746.007) [-740.866] (-748.349) (-747.779) * [-746.276] (-746.033) (-749.614) (-744.897) -- 0:01:11
304000 -- (-747.586) [-744.308] (-748.126) (-743.603) * (-748.033) (-745.119) (-759.717) [-747.426] -- 0:01:13
304500 -- (-750.372) [-744.034] (-748.920) (-743.964) * (-742.593) (-746.158) (-743.625) [-743.964] -- 0:01:13
305000 -- (-745.320) [-747.219] (-743.656) (-742.526) * (-746.207) (-744.109) (-746.395) [-745.466] -- 0:01:12
Average standard deviation of split frequencies: 0.027730
305500 -- [-751.302] (-756.651) (-749.417) (-743.363) * [-749.958] (-745.316) (-740.353) (-746.742) -- 0:01:12
306000 -- (-741.930) [-743.944] (-745.686) (-747.510) * [-741.125] (-741.009) (-741.898) (-749.890) -- 0:01:12
306500 -- (-748.031) (-746.917) [-741.453] (-749.168) * [-743.388] (-743.352) (-741.657) (-741.906) -- 0:01:12
307000 -- (-745.407) [-745.274] (-741.517) (-746.150) * (-744.352) [-744.265] (-745.265) (-743.773) -- 0:01:12
307500 -- [-740.618] (-746.149) (-747.174) (-741.761) * (-749.163) [-746.356] (-741.302) (-745.246) -- 0:01:12
308000 -- [-742.629] (-749.215) (-747.833) (-742.184) * (-752.537) (-748.964) (-746.513) [-749.533] -- 0:01:11
308500 -- (-744.261) (-749.026) (-744.967) [-750.873] * (-748.544) (-748.591) (-745.972) [-745.182] -- 0:01:11
309000 -- [-745.584] (-741.642) (-755.088) (-743.403) * (-752.757) [-744.855] (-747.007) (-744.126) -- 0:01:11
309500 -- (-746.930) (-745.583) [-744.502] (-742.341) * (-749.577) (-743.151) (-744.933) [-744.630] -- 0:01:11
310000 -- (-749.625) (-749.995) (-743.623) [-745.024] * (-752.110) (-745.210) (-746.110) [-743.224] -- 0:01:11
Average standard deviation of split frequencies: 0.028072
310500 -- (-757.483) (-742.848) (-745.718) [-742.251] * (-753.844) [-745.929] (-743.481) (-743.418) -- 0:01:11
311000 -- (-746.533) [-750.048] (-747.809) (-742.150) * (-750.430) [-750.021] (-747.433) (-746.225) -- 0:01:10
311500 -- (-749.403) (-742.242) [-749.730] (-744.431) * [-748.604] (-749.118) (-751.114) (-741.627) -- 0:01:10
312000 -- (-741.463) (-749.902) (-741.431) [-743.851] * (-746.800) (-743.605) [-750.564] (-750.035) -- 0:01:10
312500 -- (-747.486) [-740.980] (-747.097) (-742.596) * [-745.137] (-746.022) (-747.731) (-747.314) -- 0:01:10
313000 -- (-752.496) (-744.605) (-744.925) [-750.581] * (-745.170) (-744.568) (-748.645) [-745.239] -- 0:01:10
313500 -- (-748.800) (-742.184) (-743.345) [-744.877] * [-745.064] (-743.051) (-743.387) (-748.609) -- 0:01:10
314000 -- (-746.077) (-751.235) (-745.166) [-743.835] * [-742.522] (-744.600) (-745.598) (-744.857) -- 0:01:12
314500 -- (-744.859) (-750.336) (-745.749) [-745.960] * (-749.142) (-744.907) (-747.569) [-747.822] -- 0:01:11
315000 -- [-750.247] (-742.824) (-745.977) (-748.630) * [-756.154] (-748.832) (-739.974) (-742.956) -- 0:01:11
Average standard deviation of split frequencies: 0.026106
315500 -- (-747.372) (-750.033) [-746.639] (-745.218) * (-748.789) [-744.967] (-742.461) (-746.153) -- 0:01:11
316000 -- (-745.258) (-746.849) [-749.943] (-741.762) * [-749.354] (-749.082) (-744.227) (-745.193) -- 0:01:11
316500 -- (-744.581) [-747.772] (-750.572) (-744.464) * [-748.956] (-747.808) (-748.335) (-745.181) -- 0:01:11
317000 -- [-744.656] (-743.654) (-742.129) (-749.217) * (-745.366) (-747.316) (-748.071) [-744.167] -- 0:01:11
317500 -- (-748.189) [-741.652] (-744.969) (-751.666) * [-748.479] (-749.512) (-754.578) (-747.235) -- 0:01:10
318000 -- (-747.558) (-749.206) [-742.615] (-748.144) * (-746.472) (-753.883) (-742.350) [-740.669] -- 0:01:10
318500 -- (-743.350) [-746.348] (-745.847) (-746.845) * (-754.207) [-748.544] (-744.003) (-743.499) -- 0:01:10
319000 -- [-740.351] (-748.972) (-745.416) (-746.695) * (-750.536) [-743.768] (-746.286) (-751.253) -- 0:01:10
319500 -- (-750.888) [-740.831] (-743.191) (-749.353) * [-746.511] (-744.090) (-744.868) (-742.030) -- 0:01:10
320000 -- (-751.744) (-745.710) [-746.990] (-746.434) * [-746.033] (-740.986) (-745.413) (-744.160) -- 0:01:10
Average standard deviation of split frequencies: 0.022051
320500 -- (-749.074) [-741.582] (-745.210) (-742.037) * [-747.510] (-747.990) (-744.554) (-747.682) -- 0:01:09
321000 -- (-751.638) (-747.126) (-748.530) [-745.195] * (-747.101) [-742.716] (-741.720) (-750.614) -- 0:01:09
321500 -- (-746.656) (-742.859) [-743.735] (-745.801) * (-746.966) [-742.995] (-742.876) (-743.411) -- 0:01:09
322000 -- (-742.812) (-751.355) [-741.676] (-743.089) * [-745.227] (-746.453) (-742.121) (-746.623) -- 0:01:09
322500 -- (-739.670) [-741.906] (-749.919) (-748.301) * (-741.181) (-749.198) (-738.971) [-741.666] -- 0:01:09
323000 -- [-742.563] (-747.418) (-744.701) (-748.396) * (-747.135) (-741.582) (-740.919) [-747.508] -- 0:01:09
323500 -- (-745.113) [-747.477] (-751.070) (-755.745) * (-745.595) (-741.537) [-745.967] (-746.166) -- 0:01:11
324000 -- (-743.803) (-744.599) [-747.201] (-746.466) * (-745.711) [-748.357] (-747.345) (-745.081) -- 0:01:10
324500 -- (-743.329) (-743.610) [-744.858] (-749.640) * (-745.798) (-752.280) (-745.356) [-747.222] -- 0:01:10
325000 -- [-741.923] (-745.255) (-747.573) (-747.867) * (-747.219) (-747.830) [-740.570] (-748.602) -- 0:01:10
Average standard deviation of split frequencies: 0.023136
325500 -- (-744.773) [-745.410] (-748.480) (-745.639) * [-744.406] (-754.227) (-746.091) (-745.664) -- 0:01:10
326000 -- (-751.967) [-744.757] (-746.009) (-746.479) * (-746.420) (-749.243) [-742.845] (-751.494) -- 0:01:10
326500 -- (-746.777) (-741.026) [-746.544] (-748.173) * (-743.277) (-748.170) (-744.883) [-743.391] -- 0:01:10
327000 -- (-747.757) [-745.022] (-747.868) (-751.500) * (-749.694) (-744.719) (-741.814) [-741.860] -- 0:01:09
327500 -- (-748.927) [-742.933] (-744.684) (-765.732) * (-744.388) (-742.274) (-756.136) [-744.447] -- 0:01:09
328000 -- (-745.964) [-744.992] (-750.486) (-747.218) * (-741.049) [-742.565] (-751.456) (-742.332) -- 0:01:09
328500 -- (-747.595) (-745.481) (-747.628) [-747.242] * (-742.098) (-746.935) (-750.078) [-743.479] -- 0:01:09
329000 -- (-743.318) (-746.347) [-746.934] (-750.538) * [-745.458] (-747.136) (-749.687) (-742.229) -- 0:01:09
329500 -- (-746.884) [-742.061] (-754.400) (-743.055) * (-746.656) (-747.578) [-742.758] (-741.765) -- 0:01:09
330000 -- (-750.033) [-745.758] (-744.100) (-748.540) * (-750.585) [-740.011] (-745.260) (-744.336) -- 0:01:09
Average standard deviation of split frequencies: 0.022097
330500 -- (-754.390) (-741.211) [-746.416] (-747.665) * (-744.053) [-746.721] (-745.759) (-743.911) -- 0:01:08
331000 -- (-751.725) (-742.088) [-743.418] (-747.274) * [-743.516] (-746.213) (-749.904) (-744.743) -- 0:01:08
331500 -- (-750.122) [-743.523] (-747.378) (-746.301) * (-746.745) [-746.275] (-745.398) (-741.624) -- 0:01:08
332000 -- (-753.393) (-744.277) (-743.230) [-747.228] * (-745.597) (-740.830) (-744.683) [-750.384] -- 0:01:08
332500 -- (-749.269) [-751.453] (-749.783) (-747.971) * (-746.953) [-740.307] (-746.996) (-746.276) -- 0:01:08
333000 -- (-746.198) (-745.682) (-744.874) [-743.600] * (-743.692) (-749.216) [-744.846] (-742.277) -- 0:01:10
333500 -- [-748.692] (-741.799) (-746.324) (-743.342) * (-741.390) [-742.733] (-744.498) (-749.223) -- 0:01:09
334000 -- (-747.245) (-748.912) (-740.986) [-741.212] * (-742.519) [-741.242] (-747.028) (-742.420) -- 0:01:09
334500 -- (-746.168) (-746.068) [-744.698] (-748.917) * (-743.188) (-745.579) [-745.243] (-746.250) -- 0:01:09
335000 -- (-757.140) [-745.542] (-741.279) (-744.457) * (-744.070) (-744.970) (-744.745) [-748.350] -- 0:01:09
Average standard deviation of split frequencies: 0.021746
335500 -- (-740.134) [-745.076] (-744.229) (-746.083) * [-745.034] (-741.668) (-749.710) (-748.373) -- 0:01:09
336000 -- (-749.446) (-747.527) [-744.979] (-748.044) * (-754.820) [-743.803] (-748.312) (-746.557) -- 0:01:09
336500 -- (-746.928) [-746.210] (-743.611) (-745.187) * (-754.966) (-747.080) (-750.662) [-749.507] -- 0:01:09
337000 -- (-743.141) (-745.224) (-756.274) [-744.420] * (-749.147) [-743.631] (-751.656) (-750.977) -- 0:01:08
337500 -- (-744.928) [-746.441] (-751.847) (-745.899) * (-745.995) (-739.835) [-744.068] (-748.313) -- 0:01:08
338000 -- (-740.466) [-742.700] (-741.992) (-745.133) * (-743.867) (-746.859) (-748.410) [-746.410] -- 0:01:08
338500 -- (-748.669) [-744.966] (-743.003) (-743.214) * (-744.664) (-743.598) [-750.063] (-746.569) -- 0:01:08
339000 -- (-747.713) (-752.063) (-744.514) [-746.868] * [-745.966] (-745.305) (-749.188) (-743.750) -- 0:01:08
339500 -- (-744.795) (-747.416) [-744.600] (-744.127) * (-747.906) [-743.622] (-745.083) (-750.500) -- 0:01:08
340000 -- (-747.499) (-744.936) (-746.492) [-741.104] * (-744.622) [-744.558] (-748.540) (-744.018) -- 0:01:07
Average standard deviation of split frequencies: 0.022140
340500 -- (-743.840) [-745.616] (-744.726) (-747.285) * (-744.540) (-743.783) (-754.317) [-740.773] -- 0:01:07
341000 -- (-746.179) (-743.809) (-742.334) [-747.719] * (-745.886) (-752.544) [-746.679] (-743.498) -- 0:01:07
341500 -- (-746.299) [-746.058] (-746.593) (-743.549) * (-745.773) (-742.556) (-746.771) [-741.347] -- 0:01:07
342000 -- [-750.714] (-747.548) (-748.632) (-743.379) * (-746.982) (-746.518) (-745.598) [-745.513] -- 0:01:07
342500 -- (-743.782) [-746.206] (-745.583) (-748.493) * (-751.566) (-747.554) [-741.332] (-743.256) -- 0:01:09
343000 -- (-749.655) (-754.243) [-744.926] (-739.359) * [-743.204] (-745.772) (-746.098) (-747.994) -- 0:01:08
343500 -- (-745.302) (-745.925) (-750.407) [-742.949] * [-747.954] (-743.797) (-741.476) (-749.354) -- 0:01:08
344000 -- (-748.835) (-747.282) (-746.688) [-742.995] * (-747.377) [-744.118] (-744.899) (-754.358) -- 0:01:08
344500 -- [-747.134] (-743.129) (-749.914) (-742.123) * [-749.723] (-742.329) (-745.733) (-749.196) -- 0:01:08
345000 -- (-743.864) (-743.177) (-748.450) [-743.030] * (-747.913) (-743.073) (-743.670) [-744.986] -- 0:01:08
Average standard deviation of split frequencies: 0.025886
345500 -- (-749.392) (-747.512) [-743.535] (-741.300) * (-751.583) (-749.756) (-742.136) [-747.422] -- 0:01:08
346000 -- (-743.850) [-748.340] (-743.315) (-744.133) * (-752.915) (-749.334) (-744.186) [-743.563] -- 0:01:08
346500 -- (-746.622) [-744.158] (-741.141) (-748.319) * [-753.660] (-751.749) (-745.376) (-746.736) -- 0:01:07
347000 -- (-746.013) (-743.738) [-745.273] (-749.039) * (-749.745) (-750.416) (-743.562) [-745.523] -- 0:01:07
347500 -- [-748.207] (-746.342) (-746.908) (-746.391) * (-745.683) [-748.041] (-745.802) (-745.141) -- 0:01:07
348000 -- (-750.403) [-740.779] (-745.803) (-745.539) * [-742.774] (-745.472) (-742.410) (-742.346) -- 0:01:07
348500 -- (-744.407) (-747.337) (-744.212) [-745.543] * (-742.685) [-742.376] (-743.991) (-748.479) -- 0:01:07
349000 -- (-746.558) [-745.730] (-743.556) (-742.856) * (-748.514) [-743.256] (-749.947) (-745.296) -- 0:01:07
349500 -- (-744.467) (-744.561) [-744.568] (-744.855) * (-745.759) (-749.263) (-744.862) [-745.584] -- 0:01:07
350000 -- (-746.348) [-744.127] (-749.531) (-754.373) * [-746.115] (-748.790) (-750.193) (-745.908) -- 0:01:06
Average standard deviation of split frequencies: 0.026886
350500 -- (-748.657) [-744.920] (-742.694) (-743.640) * (-751.760) [-749.749] (-743.655) (-746.894) -- 0:01:06
351000 -- (-747.017) (-750.230) [-741.429] (-750.839) * (-743.670) (-747.727) [-750.065] (-743.328) -- 0:01:06
351500 -- (-746.545) (-747.489) [-742.051] (-749.540) * (-746.364) (-747.001) [-744.421] (-746.333) -- 0:01:06
352000 -- (-753.108) [-742.508] (-748.475) (-752.246) * (-744.338) [-744.915] (-744.755) (-745.990) -- 0:01:06
352500 -- (-747.430) (-742.291) [-740.746] (-754.120) * (-743.798) [-741.719] (-747.857) (-750.320) -- 0:01:07
353000 -- (-747.034) (-745.915) (-741.856) [-744.711] * (-744.056) (-752.454) (-748.538) [-747.312] -- 0:01:07
353500 -- [-748.755] (-753.633) (-741.365) (-745.179) * [-747.758] (-749.309) (-747.080) (-746.055) -- 0:01:07
354000 -- (-755.810) [-746.610] (-744.609) (-748.813) * (-751.951) (-747.694) (-749.027) [-746.666] -- 0:01:07
354500 -- (-747.088) (-743.253) [-740.636] (-747.874) * (-745.033) (-744.197) (-745.713) [-745.424] -- 0:01:07
355000 -- (-744.106) [-746.251] (-744.226) (-748.207) * [-747.412] (-752.365) (-750.790) (-741.143) -- 0:01:07
Average standard deviation of split frequencies: 0.023835
355500 -- (-749.518) [-746.802] (-750.537) (-745.118) * [-740.955] (-752.561) (-747.103) (-746.360) -- 0:01:07
356000 -- [-750.374] (-743.284) (-746.031) (-748.657) * [-741.572] (-758.001) (-751.949) (-747.886) -- 0:01:06
356500 -- (-746.819) [-742.723] (-751.833) (-747.002) * (-741.906) (-746.386) (-742.881) [-750.069] -- 0:01:06
357000 -- (-748.513) [-741.702] (-746.025) (-748.631) * (-745.342) [-744.516] (-748.204) (-748.759) -- 0:01:06
357500 -- (-750.928) (-741.586) (-746.836) [-743.030] * (-745.458) [-748.619] (-741.227) (-747.528) -- 0:01:06
358000 -- [-742.952] (-742.466) (-748.128) (-743.148) * (-743.246) [-751.156] (-743.266) (-746.989) -- 0:01:06
358500 -- (-746.111) (-748.242) (-745.299) [-740.045] * [-748.839] (-748.249) (-745.056) (-742.099) -- 0:01:06
359000 -- (-741.063) [-748.448] (-742.900) (-749.093) * (-743.750) [-749.277] (-746.403) (-747.830) -- 0:01:06
359500 -- [-742.986] (-742.268) (-745.130) (-748.588) * (-745.594) (-749.853) (-743.956) [-742.809] -- 0:01:05
360000 -- (-743.839) [-740.792] (-744.823) (-744.238) * (-758.005) (-743.425) (-743.267) [-747.981] -- 0:01:05
Average standard deviation of split frequencies: 0.022220
360500 -- (-749.089) (-746.317) [-747.719] (-744.621) * (-747.057) (-744.305) [-745.898] (-744.610) -- 0:01:05
361000 -- (-740.200) (-746.162) (-748.818) [-745.170] * (-748.688) [-744.073] (-750.495) (-744.519) -- 0:01:05
361500 -- [-744.307] (-745.681) (-755.514) (-746.389) * (-746.732) (-742.446) (-743.590) [-746.821] -- 0:01:05
362000 -- (-743.692) (-745.853) [-748.429] (-747.486) * (-751.904) (-750.643) (-743.453) [-747.461] -- 0:01:06
362500 -- (-744.574) (-751.258) [-747.927] (-744.851) * (-747.760) (-749.280) (-747.330) [-746.388] -- 0:01:06
363000 -- (-744.988) (-744.013) [-749.982] (-746.810) * [-747.214] (-748.226) (-746.178) (-748.737) -- 0:01:06
363500 -- [-742.975] (-742.938) (-748.338) (-747.357) * (-744.235) (-743.929) (-743.875) [-745.317] -- 0:01:06
364000 -- (-740.763) [-749.000] (-748.082) (-747.317) * (-750.097) (-749.095) (-744.558) [-744.982] -- 0:01:06
364500 -- (-739.640) (-747.043) [-740.523] (-745.001) * (-747.406) (-747.407) (-745.205) [-740.713] -- 0:01:06
365000 -- [-741.432] (-741.166) (-740.436) (-743.407) * (-747.598) [-744.756] (-746.795) (-749.310) -- 0:01:06
Average standard deviation of split frequencies: 0.023184
365500 -- (-748.606) [-743.866] (-743.680) (-743.951) * (-743.779) (-743.704) (-753.876) [-741.554] -- 0:01:05
366000 -- (-743.716) (-747.365) (-741.411) [-746.121] * [-741.499] (-745.953) (-745.878) (-748.925) -- 0:01:05
366500 -- (-741.286) (-743.412) (-746.754) [-744.432] * [-743.583] (-745.042) (-745.221) (-743.358) -- 0:01:05
367000 -- [-741.562] (-750.034) (-745.773) (-744.065) * (-745.748) (-749.326) [-743.142] (-746.470) -- 0:01:05
367500 -- (-740.724) (-743.708) [-744.500] (-743.556) * (-760.363) (-746.416) [-746.731] (-754.503) -- 0:01:05
368000 -- (-742.894) (-749.449) [-744.089] (-744.214) * (-757.150) [-742.397] (-743.476) (-754.158) -- 0:01:05
368500 -- [-743.021] (-749.497) (-744.854) (-739.338) * (-747.638) (-744.736) [-745.876] (-755.716) -- 0:01:05
369000 -- (-749.482) (-745.503) (-744.936) [-744.659] * (-752.516) (-744.855) [-751.441] (-741.478) -- 0:01:04
369500 -- (-745.558) [-743.548] (-747.539) (-742.911) * (-744.334) [-741.494] (-750.561) (-747.956) -- 0:01:04
370000 -- [-742.153] (-745.670) (-746.993) (-741.856) * (-744.535) (-751.863) (-746.701) [-742.171] -- 0:01:04
Average standard deviation of split frequencies: 0.028615
370500 -- (-746.488) (-745.750) [-742.581] (-745.998) * (-753.195) (-742.898) (-746.004) [-743.993] -- 0:01:04
371000 -- (-746.730) (-747.601) [-749.966] (-750.006) * (-750.476) [-744.534] (-744.234) (-742.285) -- 0:01:06
371500 -- (-741.830) (-746.692) [-744.608] (-743.785) * (-751.505) (-744.858) [-747.217] (-743.095) -- 0:01:05
372000 -- (-744.351) [-744.357] (-746.252) (-748.349) * (-747.916) (-743.385) [-749.819] (-751.435) -- 0:01:05
372500 -- (-741.692) (-742.171) [-744.902] (-748.302) * (-744.878) (-746.544) (-755.412) [-745.946] -- 0:01:05
373000 -- (-741.964) (-743.375) [-756.877] (-751.508) * [-755.856] (-748.094) (-757.294) (-755.125) -- 0:01:05
373500 -- (-744.384) [-744.527] (-744.820) (-747.489) * [-749.352] (-743.811) (-743.978) (-746.310) -- 0:01:05
374000 -- (-745.201) (-748.040) [-745.367] (-742.855) * [-746.698] (-744.458) (-741.923) (-747.347) -- 0:01:05
374500 -- (-743.107) (-747.007) [-746.049] (-745.524) * (-750.211) (-745.722) (-747.708) [-742.557] -- 0:01:05
375000 -- (-743.630) (-747.668) (-745.824) [-744.002] * (-746.234) [-743.810] (-752.098) (-748.037) -- 0:01:05
Average standard deviation of split frequencies: 0.029463
375500 -- (-744.557) (-744.814) (-745.761) [-743.167] * (-748.868) (-742.210) [-742.962] (-744.393) -- 0:01:04
376000 -- [-746.571] (-742.674) (-743.691) (-743.903) * (-761.393) (-758.481) (-744.459) [-746.284] -- 0:01:04
376500 -- (-742.290) (-741.989) [-745.887] (-741.108) * (-746.710) [-746.770] (-749.855) (-754.782) -- 0:01:04
377000 -- (-750.359) (-742.902) (-744.999) [-744.805] * (-747.057) (-742.368) [-745.059] (-750.128) -- 0:01:04
377500 -- [-746.873] (-744.745) (-747.539) (-744.061) * (-742.771) [-743.504] (-746.627) (-750.075) -- 0:01:04
378000 -- (-756.644) (-745.381) (-744.263) [-743.797] * (-745.104) (-746.031) [-744.940] (-751.538) -- 0:01:04
378500 -- [-745.970] (-746.535) (-754.567) (-746.981) * [-743.975] (-743.043) (-747.636) (-746.833) -- 0:01:04
379000 -- (-743.378) [-743.192] (-747.322) (-745.288) * [-747.702] (-752.639) (-740.721) (-748.268) -- 0:01:03
379500 -- (-743.600) [-742.539] (-747.101) (-744.715) * (-756.697) (-749.995) [-744.120] (-743.533) -- 0:01:03
380000 -- [-745.711] (-743.022) (-757.231) (-748.225) * (-757.688) (-746.850) [-742.358] (-742.729) -- 0:01:03
Average standard deviation of split frequencies: 0.031578
380500 -- (-744.600) [-743.780] (-749.418) (-747.759) * (-746.314) (-742.781) [-749.194] (-745.912) -- 0:01:03
381000 -- (-747.716) (-740.643) (-745.289) [-745.868] * (-747.509) (-750.051) [-745.500] (-748.881) -- 0:01:04
381500 -- (-750.233) (-745.542) (-750.367) [-752.374] * [-745.755] (-742.999) (-745.921) (-755.680) -- 0:01:04
382000 -- [-751.106] (-743.021) (-745.735) (-755.866) * [-740.453] (-748.054) (-747.133) (-758.819) -- 0:01:04
382500 -- (-751.146) (-744.107) [-744.261] (-743.007) * (-745.797) (-754.650) [-746.231] (-752.857) -- 0:01:04
383000 -- [-749.152] (-750.731) (-750.277) (-748.168) * [-744.608] (-749.798) (-744.936) (-756.984) -- 0:01:04
383500 -- [-745.540] (-748.962) (-751.863) (-753.991) * (-749.183) [-748.469] (-747.329) (-750.837) -- 0:01:04
384000 -- (-744.824) (-746.354) [-747.205] (-752.229) * [-745.301] (-748.017) (-743.046) (-750.135) -- 0:01:04
384500 -- (-745.119) [-745.809] (-746.167) (-745.277) * (-742.465) [-747.828] (-743.522) (-748.392) -- 0:01:04
385000 -- (-744.828) [-745.784] (-749.346) (-744.188) * (-747.821) (-751.750) [-751.146] (-747.677) -- 0:01:03
Average standard deviation of split frequencies: 0.029921
385500 -- [-741.554] (-749.276) (-751.640) (-748.180) * [-748.407] (-747.832) (-744.836) (-753.864) -- 0:01:03
386000 -- (-752.791) (-750.163) [-746.928] (-751.932) * (-743.869) (-745.968) (-744.779) [-750.329] -- 0:01:03
386500 -- [-744.971] (-745.657) (-747.483) (-748.827) * [-746.871] (-744.448) (-744.476) (-755.485) -- 0:01:03
387000 -- (-755.399) [-744.890] (-750.815) (-747.275) * [-745.538] (-747.988) (-741.677) (-750.973) -- 0:01:03
387500 -- (-748.439) (-747.785) (-742.037) [-743.886] * [-745.253] (-747.695) (-741.294) (-745.711) -- 0:01:03
388000 -- [-744.432] (-749.664) (-745.168) (-745.094) * (-750.115) (-745.504) [-740.568] (-743.451) -- 0:01:03
388500 -- [-745.147] (-744.847) (-747.715) (-748.604) * (-751.061) (-747.793) [-743.721] (-745.718) -- 0:01:02
389000 -- (-744.508) (-755.464) [-741.530] (-742.552) * (-743.460) (-744.633) [-749.714] (-758.182) -- 0:01:02
389500 -- (-750.564) [-745.291] (-750.152) (-745.519) * (-742.372) (-745.497) [-748.153] (-744.136) -- 0:01:02
390000 -- [-744.654] (-749.721) (-752.923) (-746.133) * (-756.423) (-741.949) (-746.550) [-741.464] -- 0:01:02
Average standard deviation of split frequencies: 0.027753
390500 -- (-747.877) (-743.379) [-748.814] (-742.393) * (-749.011) (-743.823) (-753.173) [-745.471] -- 0:01:03
391000 -- (-747.585) (-744.780) (-745.695) [-744.859] * (-749.240) (-744.166) (-747.700) [-745.699] -- 0:01:03
391500 -- (-748.569) (-747.574) (-746.800) [-744.373] * (-746.552) (-743.018) [-753.101] (-745.958) -- 0:01:03
392000 -- (-747.955) [-741.396] (-748.263) (-743.125) * (-744.561) (-747.468) (-743.641) [-742.676] -- 0:01:03
392500 -- [-743.969] (-743.791) (-751.456) (-743.744) * (-746.423) [-752.016] (-747.005) (-742.978) -- 0:01:03
393000 -- (-754.635) (-752.044) [-743.424] (-745.032) * (-741.826) (-744.897) [-743.897] (-745.871) -- 0:01:03
393500 -- (-752.165) (-743.607) [-742.344] (-744.259) * (-743.908) (-746.075) [-743.787] (-746.873) -- 0:01:03
394000 -- (-752.027) (-753.051) [-742.378] (-751.569) * (-741.023) (-751.352) (-745.604) [-741.590] -- 0:01:03
394500 -- (-755.748) (-761.382) (-744.946) [-743.768] * [-745.233] (-746.474) (-749.428) (-743.721) -- 0:01:02
395000 -- (-758.474) (-746.383) (-747.391) [-745.386] * (-750.054) (-742.939) [-745.755] (-744.773) -- 0:01:02
Average standard deviation of split frequencies: 0.027380
395500 -- (-753.719) [-749.322] (-748.088) (-756.866) * (-747.818) (-746.498) (-747.334) [-740.857] -- 0:01:02
396000 -- [-749.065] (-746.220) (-744.224) (-741.593) * (-745.491) (-747.795) [-745.119] (-747.213) -- 0:01:02
396500 -- (-750.018) (-746.355) [-743.303] (-743.558) * (-743.740) (-752.138) (-742.547) [-745.902] -- 0:01:02
397000 -- (-754.794) (-742.485) [-741.921] (-741.560) * (-751.058) [-753.259] (-744.784) (-747.256) -- 0:01:02
397500 -- (-749.623) [-747.992] (-742.508) (-750.349) * [-742.434] (-752.330) (-749.235) (-747.467) -- 0:01:02
398000 -- (-747.641) (-743.095) [-741.643] (-752.358) * [-744.100] (-751.178) (-743.741) (-745.249) -- 0:01:02
398500 -- (-750.815) (-747.513) [-747.009] (-742.571) * (-746.471) (-747.211) (-741.976) [-752.670] -- 0:01:01
399000 -- (-748.768) (-750.310) (-746.196) [-745.073] * (-744.592) (-744.920) (-745.994) [-746.667] -- 0:01:01
399500 -- [-753.594] (-750.988) (-744.844) (-745.740) * (-740.523) (-749.436) (-747.732) [-750.922] -- 0:01:01
400000 -- (-747.827) (-747.627) (-745.030) [-751.910] * [-743.949] (-753.446) (-751.778) (-745.649) -- 0:01:01
Average standard deviation of split frequencies: 0.024708
400500 -- (-750.775) [-744.511] (-742.624) (-747.977) * (-744.429) [-746.310] (-747.428) (-745.864) -- 0:01:02
401000 -- (-756.179) (-740.989) [-745.108] (-755.349) * (-748.242) [-741.256] (-746.353) (-745.270) -- 0:01:02
401500 -- (-755.773) (-745.229) [-740.740] (-749.480) * (-744.118) (-748.489) [-745.407] (-742.625) -- 0:01:02
402000 -- (-754.789) [-748.187] (-741.802) (-749.688) * (-747.890) (-746.564) (-746.263) [-747.703] -- 0:01:02
402500 -- (-753.428) (-750.812) [-742.809] (-746.973) * (-746.941) (-745.435) (-748.866) [-745.226] -- 0:01:02
403000 -- (-748.139) [-753.099] (-740.645) (-747.168) * (-744.899) (-751.638) (-747.976) [-743.473] -- 0:01:02
403500 -- [-752.099] (-752.518) (-740.448) (-744.400) * (-748.557) [-747.568] (-744.502) (-741.673) -- 0:01:02
404000 -- (-746.159) (-747.258) [-744.288] (-744.923) * (-747.197) (-741.927) (-746.376) [-742.133] -- 0:01:01
404500 -- (-751.737) [-742.235] (-750.603) (-748.526) * (-745.624) (-745.124) (-743.295) [-747.600] -- 0:01:01
405000 -- (-746.557) [-747.204] (-746.193) (-746.982) * (-745.842) (-742.175) [-745.568] (-743.262) -- 0:01:01
Average standard deviation of split frequencies: 0.023222
405500 -- (-741.318) (-744.082) (-742.514) [-742.878] * [-745.762] (-744.344) (-750.073) (-746.973) -- 0:01:01
406000 -- (-750.271) (-751.028) [-743.642] (-745.253) * [-744.754] (-749.649) (-748.609) (-746.467) -- 0:01:01
406500 -- (-745.632) [-745.253] (-750.300) (-747.407) * (-742.648) [-747.292] (-747.483) (-744.271) -- 0:01:01
407000 -- (-745.452) (-744.715) (-743.772) [-748.063] * [-750.507] (-744.353) (-745.732) (-745.649) -- 0:01:01
407500 -- (-748.925) (-742.462) [-747.857] (-748.787) * (-747.761) (-744.268) (-747.413) [-745.387] -- 0:01:01
408000 -- (-745.291) (-744.709) (-749.230) [-744.609] * (-748.211) (-743.986) [-746.009] (-741.224) -- 0:01:00
408500 -- [-746.566] (-745.680) (-745.774) (-745.870) * (-745.794) (-749.689) [-747.406] (-745.834) -- 0:01:00
409000 -- [-749.295] (-742.205) (-751.667) (-743.595) * (-754.069) (-742.857) [-744.976] (-745.136) -- 0:01:00
409500 -- [-744.927] (-747.404) (-755.239) (-746.539) * (-750.296) (-745.523) [-746.991] (-745.596) -- 0:01:00
410000 -- [-749.824] (-746.546) (-753.616) (-744.505) * (-750.271) (-742.454) [-749.114] (-747.563) -- 0:01:01
Average standard deviation of split frequencies: 0.020088
410500 -- (-748.623) (-749.883) (-747.168) [-745.082] * (-743.229) (-746.045) [-745.452] (-746.496) -- 0:01:01
411000 -- (-752.685) (-752.312) (-749.170) [-745.027] * (-745.334) [-745.530] (-746.396) (-749.692) -- 0:01:01
411500 -- (-745.275) [-743.784] (-749.231) (-748.891) * (-743.758) [-742.147] (-752.500) (-755.192) -- 0:01:01
412000 -- (-744.242) (-754.840) (-758.616) [-746.762] * [-745.702] (-748.638) (-748.041) (-745.177) -- 0:01:01
412500 -- (-748.272) (-751.518) (-748.498) [-745.915] * [-747.028] (-747.382) (-742.292) (-748.632) -- 0:01:01
413000 -- (-748.421) (-756.821) [-745.994] (-743.077) * (-744.562) (-747.868) (-741.756) [-744.998] -- 0:01:01
413500 -- [-746.131] (-748.357) (-746.374) (-748.132) * (-744.682) (-746.780) [-751.122] (-750.013) -- 0:01:00
414000 -- (-756.460) (-755.385) [-743.972] (-740.377) * (-742.807) [-747.542] (-743.690) (-743.123) -- 0:01:00
414500 -- (-746.263) (-750.605) [-743.295] (-752.320) * (-742.927) [-747.991] (-747.613) (-747.419) -- 0:01:00
415000 -- [-745.637] (-743.430) (-747.095) (-743.197) * (-743.335) [-739.402] (-748.863) (-749.964) -- 0:01:00
Average standard deviation of split frequencies: 0.018698
415500 -- (-752.550) (-753.070) [-741.243] (-742.591) * (-750.842) (-743.846) [-745.937] (-746.821) -- 0:01:00
416000 -- (-745.910) (-751.231) (-743.079) [-742.998] * (-750.051) (-746.362) (-744.914) [-741.495] -- 0:01:00
416500 -- [-751.647] (-747.848) (-748.633) (-743.824) * (-753.089) (-743.225) [-741.832] (-740.798) -- 0:01:00
417000 -- (-749.652) (-744.779) (-746.348) [-745.976] * [-744.558] (-740.560) (-753.472) (-743.765) -- 0:01:00
417500 -- (-743.226) (-746.240) (-750.057) [-743.394] * [-743.856] (-744.061) (-749.368) (-744.064) -- 0:00:59
418000 -- (-745.023) [-745.911] (-748.208) (-742.713) * [-744.323] (-748.916) (-760.284) (-741.202) -- 0:00:59
418500 -- (-742.869) (-751.900) [-741.492] (-742.385) * (-748.834) (-752.032) (-753.868) [-742.917] -- 0:00:59
419000 -- (-742.178) (-749.752) [-744.566] (-741.587) * (-750.900) (-743.419) (-750.508) [-745.247] -- 0:00:59
419500 -- (-751.481) (-749.516) (-748.279) [-743.087] * (-744.946) (-742.594) (-747.516) [-743.474] -- 0:00:59
420000 -- (-747.359) (-742.268) (-752.684) [-746.752] * (-742.747) (-744.103) (-749.280) [-742.218] -- 0:01:00
Average standard deviation of split frequencies: 0.021292
420500 -- (-747.757) (-748.130) (-744.869) [-749.501] * [-746.432] (-744.490) (-751.264) (-747.721) -- 0:01:00
421000 -- (-747.576) [-748.741] (-749.305) (-742.753) * (-747.701) [-747.743] (-751.176) (-746.493) -- 0:01:00
421500 -- (-744.025) [-745.248] (-747.913) (-745.071) * (-741.692) (-743.883) (-749.124) [-740.987] -- 0:01:00
422000 -- (-744.915) [-748.181] (-747.257) (-745.681) * [-749.033] (-746.293) (-746.412) (-745.814) -- 0:01:00
422500 -- (-745.595) (-742.816) [-747.754] (-745.965) * (-745.509) (-740.193) (-746.576) [-744.711] -- 0:01:00
423000 -- (-748.993) (-747.014) (-750.104) [-743.229] * (-743.590) (-746.977) (-743.471) [-745.629] -- 0:01:00
423500 -- (-755.734) (-747.220) [-743.475] (-744.255) * (-747.396) (-740.971) [-746.074] (-747.955) -- 0:00:59
424000 -- (-750.910) (-748.373) (-748.518) [-741.029] * [-741.952] (-741.710) (-749.488) (-753.716) -- 0:00:59
424500 -- (-746.122) (-748.448) (-751.977) [-744.243] * (-748.900) (-743.925) (-746.277) [-741.268] -- 0:00:59
425000 -- (-742.517) [-746.211] (-749.106) (-747.961) * [-743.413] (-754.215) (-749.033) (-747.028) -- 0:00:59
Average standard deviation of split frequencies: 0.020472
425500 -- [-743.327] (-749.173) (-747.610) (-748.873) * [-743.793] (-742.330) (-752.563) (-745.300) -- 0:00:59
426000 -- (-741.855) [-748.875] (-744.071) (-743.987) * [-742.103] (-743.193) (-753.732) (-749.741) -- 0:00:59
426500 -- (-750.099) [-744.441] (-747.088) (-752.447) * (-743.674) (-747.822) [-745.650] (-744.063) -- 0:00:59
427000 -- (-745.657) [-745.390] (-752.002) (-743.396) * [-741.591] (-744.803) (-742.966) (-745.144) -- 0:00:59
427500 -- (-744.061) [-742.908] (-743.782) (-744.075) * (-744.587) [-744.473] (-743.129) (-748.201) -- 0:00:58
428000 -- (-745.173) (-746.406) [-743.248] (-744.977) * (-739.616) (-746.655) [-741.354] (-743.196) -- 0:00:58
428500 -- (-742.280) (-745.009) (-744.626) [-746.819] * [-747.614] (-745.224) (-742.314) (-740.206) -- 0:00:58
429000 -- (-746.698) (-745.061) (-743.643) [-746.144] * (-748.780) (-749.995) (-740.625) [-742.060] -- 0:00:58
429500 -- (-752.062) (-750.028) [-745.668] (-746.506) * [-746.768] (-753.138) (-751.484) (-740.453) -- 0:00:59
430000 -- (-748.473) (-746.491) [-743.561] (-747.424) * (-745.379) (-748.591) [-740.027] (-745.196) -- 0:00:59
Average standard deviation of split frequencies: 0.025723
430500 -- (-751.535) (-745.133) (-742.313) [-745.608] * (-757.473) (-748.603) (-748.263) [-742.177] -- 0:00:59
431000 -- (-750.617) (-750.442) (-746.758) [-747.778] * [-749.856] (-744.133) (-747.294) (-745.472) -- 0:00:59
431500 -- (-758.994) (-743.027) (-754.906) [-746.919] * (-742.523) (-742.946) (-749.546) [-743.394] -- 0:00:59
432000 -- (-749.515) [-741.231] (-744.181) (-745.931) * [-746.584] (-742.809) (-747.905) (-742.241) -- 0:00:59
432500 -- (-747.306) (-744.230) [-748.535] (-741.350) * (-739.904) [-742.955] (-747.060) (-742.794) -- 0:00:59
433000 -- (-742.774) [-747.916] (-748.510) (-748.730) * (-745.046) (-747.890) [-750.939] (-744.610) -- 0:00:58
433500 -- (-745.521) (-744.076) [-746.919] (-745.148) * (-748.325) (-743.367) (-751.549) [-742.771] -- 0:00:58
434000 -- (-740.643) (-742.014) [-745.980] (-743.780) * [-745.303] (-746.583) (-749.190) (-742.569) -- 0:00:58
434500 -- (-745.985) [-740.863] (-753.433) (-746.261) * (-746.982) (-744.058) [-745.236] (-742.741) -- 0:00:58
435000 -- (-743.155) [-740.582] (-747.371) (-747.179) * [-743.616] (-742.362) (-747.879) (-744.726) -- 0:00:58
Average standard deviation of split frequencies: 0.028111
435500 -- (-751.770) [-740.011] (-746.802) (-747.640) * (-749.360) (-744.350) [-743.150] (-741.691) -- 0:00:58
436000 -- (-748.357) (-745.603) (-751.516) [-744.787] * (-747.099) (-744.930) [-744.561] (-745.569) -- 0:00:58
436500 -- [-744.903] (-745.803) (-742.972) (-748.198) * [-743.651] (-744.974) (-745.857) (-744.199) -- 0:00:58
437000 -- (-742.402) (-749.241) (-752.515) [-745.503] * (-749.723) [-743.435] (-742.803) (-743.063) -- 0:00:57
437500 -- (-745.798) [-747.418] (-745.471) (-747.388) * (-745.777) [-746.515] (-753.860) (-744.252) -- 0:00:57
438000 -- [-742.152] (-745.582) (-748.692) (-751.683) * (-748.019) (-748.895) (-747.515) [-743.586] -- 0:00:57
438500 -- (-746.338) (-744.260) [-743.239] (-742.833) * (-749.197) (-743.421) [-744.127] (-746.226) -- 0:00:57
439000 -- (-750.041) (-745.122) [-741.130] (-747.609) * (-753.263) (-754.926) (-752.490) [-747.506] -- 0:00:58
439500 -- (-745.685) (-745.410) [-746.550] (-747.891) * (-748.651) (-743.865) (-742.983) [-746.469] -- 0:00:58
440000 -- (-747.288) [-745.511] (-743.730) (-742.069) * (-751.056) [-746.084] (-746.882) (-746.054) -- 0:00:58
Average standard deviation of split frequencies: 0.025139
440500 -- (-744.088) (-746.901) (-745.924) [-740.509] * (-743.254) [-746.521] (-746.678) (-744.396) -- 0:00:58
441000 -- (-748.685) (-744.640) [-741.112] (-743.831) * [-742.916] (-745.429) (-744.211) (-745.313) -- 0:00:58
441500 -- (-744.984) (-744.654) (-748.109) [-741.910] * [-744.743] (-742.418) (-746.040) (-752.167) -- 0:00:58
442000 -- [-744.290] (-746.416) (-749.229) (-744.530) * (-746.879) [-743.816] (-743.719) (-753.449) -- 0:00:58
442500 -- (-745.072) (-743.827) (-748.478) [-745.692] * (-744.954) [-741.865] (-745.111) (-743.132) -- 0:00:57
443000 -- (-743.966) (-747.535) [-745.895] (-751.122) * [-745.251] (-744.230) (-743.439) (-742.745) -- 0:00:57
443500 -- (-749.333) (-754.437) [-746.628] (-745.665) * [-746.042] (-747.289) (-744.886) (-743.849) -- 0:00:57
444000 -- (-745.579) (-745.287) [-743.437] (-744.642) * (-745.981) [-748.956] (-746.308) (-748.858) -- 0:00:57
444500 -- (-748.568) (-744.228) (-746.570) [-743.778] * (-742.859) (-745.835) (-746.514) [-743.455] -- 0:00:57
445000 -- (-742.116) (-743.975) [-747.356] (-747.163) * (-746.028) (-748.890) (-746.348) [-742.278] -- 0:00:57
Average standard deviation of split frequencies: 0.022196
445500 -- (-748.370) (-745.167) [-743.747] (-743.038) * [-744.271] (-748.839) (-743.586) (-746.691) -- 0:00:57
446000 -- (-747.123) (-744.701) [-744.616] (-745.369) * (-742.716) (-746.262) (-745.112) [-747.060] -- 0:00:57
446500 -- [-753.712] (-744.144) (-749.078) (-746.831) * (-743.350) [-740.189] (-751.175) (-745.913) -- 0:00:57
447000 -- (-744.962) (-744.437) [-748.499] (-749.823) * (-746.106) (-745.197) (-745.877) [-745.082] -- 0:00:56
447500 -- (-745.283) [-746.556] (-745.944) (-743.926) * [-742.140] (-745.875) (-739.949) (-752.574) -- 0:00:56
448000 -- (-744.054) [-740.621] (-745.835) (-744.402) * (-749.856) [-744.431] (-747.446) (-743.296) -- 0:00:56
448500 -- (-755.178) (-743.801) [-743.802] (-745.229) * [-746.693] (-742.970) (-748.276) (-743.340) -- 0:00:56
449000 -- (-753.442) (-742.355) (-742.785) [-746.588] * (-744.460) [-744.234] (-753.253) (-745.759) -- 0:00:57
449500 -- (-753.532) (-746.295) [-740.304] (-744.842) * [-745.758] (-743.993) (-744.579) (-746.239) -- 0:00:57
450000 -- (-754.882) (-738.628) [-745.993] (-748.214) * (-747.086) (-756.240) [-743.471] (-743.334) -- 0:00:57
Average standard deviation of split frequencies: 0.019351
450500 -- (-752.491) (-742.088) [-745.041] (-743.907) * [-747.890] (-745.714) (-743.354) (-744.981) -- 0:00:57
451000 -- (-753.481) (-742.514) [-747.042] (-745.254) * (-745.082) [-743.020] (-743.607) (-742.972) -- 0:00:57
451500 -- (-756.265) (-742.351) (-749.781) [-744.322] * [-742.021] (-746.756) (-741.817) (-747.639) -- 0:00:57
452000 -- [-748.458] (-742.724) (-751.523) (-755.479) * (-742.398) [-751.766] (-743.699) (-751.855) -- 0:00:56
452500 -- (-747.184) [-744.210] (-748.408) (-750.917) * (-741.554) [-746.618] (-751.773) (-759.012) -- 0:00:56
453000 -- (-746.606) (-749.566) (-747.211) [-746.873] * [-743.409] (-748.176) (-741.689) (-751.296) -- 0:00:56
453500 -- (-745.899) [-745.982] (-745.845) (-741.872) * (-745.356) (-748.248) (-740.762) [-749.365] -- 0:00:56
454000 -- (-743.292) [-746.581] (-742.140) (-744.219) * (-744.100) (-750.818) (-743.352) [-743.518] -- 0:00:56
454500 -- (-739.693) (-748.823) [-743.456] (-743.219) * [-744.722] (-745.300) (-743.876) (-745.042) -- 0:00:56
455000 -- (-744.819) (-744.845) (-742.481) [-743.590] * (-752.525) (-755.190) (-743.144) [-745.536] -- 0:00:56
Average standard deviation of split frequencies: 0.018091
455500 -- [-743.586] (-740.243) (-744.119) (-748.052) * (-745.903) (-746.463) [-744.611] (-745.371) -- 0:00:56
456000 -- (-743.662) (-743.939) [-741.205] (-741.064) * (-745.840) [-745.549] (-740.747) (-746.338) -- 0:00:56
456500 -- [-743.873] (-744.852) (-744.379) (-744.804) * (-750.218) [-751.759] (-740.462) (-751.473) -- 0:00:55
457000 -- (-745.908) [-746.842] (-740.197) (-746.836) * (-743.353) [-744.348] (-740.331) (-743.092) -- 0:00:55
457500 -- (-742.760) (-742.933) [-740.845] (-745.146) * [-747.022] (-743.474) (-751.076) (-741.882) -- 0:00:55
458000 -- (-745.418) [-744.219] (-742.715) (-741.027) * (-749.938) (-743.695) [-750.156] (-749.209) -- 0:00:55
458500 -- (-744.933) (-743.478) [-742.068] (-752.789) * (-745.053) [-745.399] (-747.786) (-749.666) -- 0:00:56
459000 -- [-746.040] (-743.740) (-741.877) (-746.137) * [-747.222] (-744.981) (-744.555) (-743.376) -- 0:00:56
459500 -- (-751.392) [-743.500] (-746.750) (-748.215) * (-743.968) [-745.937] (-742.980) (-740.410) -- 0:00:56
460000 -- [-745.845] (-751.326) (-753.362) (-751.157) * (-743.129) [-747.553] (-746.258) (-745.553) -- 0:00:56
Average standard deviation of split frequencies: 0.018420
460500 -- (-752.079) (-748.555) [-743.151] (-742.360) * (-740.444) (-742.606) (-747.846) [-747.217] -- 0:00:56
461000 -- (-746.682) (-740.937) (-745.928) [-744.508] * (-741.880) (-750.689) [-749.784] (-743.873) -- 0:00:56
461500 -- (-744.465) [-739.698] (-747.889) (-747.533) * (-741.141) (-744.298) (-751.317) [-744.008] -- 0:00:56
462000 -- (-748.433) (-744.423) (-742.525) [-741.060] * (-752.384) [-744.949] (-750.108) (-749.775) -- 0:00:55
462500 -- (-749.600) (-742.676) [-753.893] (-743.818) * (-749.063) [-742.564] (-745.156) (-743.964) -- 0:00:55
463000 -- [-745.356] (-742.963) (-744.497) (-754.555) * (-748.335) [-747.809] (-746.165) (-752.148) -- 0:00:55
463500 -- [-746.080] (-748.009) (-744.361) (-746.225) * (-749.338) [-747.872] (-744.359) (-745.921) -- 0:00:55
464000 -- (-743.552) [-744.088] (-750.908) (-754.354) * (-745.837) (-747.954) (-746.644) [-747.819] -- 0:00:55
464500 -- (-743.658) (-745.964) [-746.001] (-747.989) * [-744.208] (-743.354) (-746.974) (-744.707) -- 0:00:55
465000 -- (-748.196) (-748.310) (-741.888) [-750.282] * (-742.426) (-744.669) (-742.900) [-745.954] -- 0:00:55
Average standard deviation of split frequencies: 0.018715
465500 -- [-743.738] (-746.725) (-745.183) (-749.132) * (-746.427) (-750.057) [-745.626] (-745.323) -- 0:00:55
466000 -- [-746.384] (-751.876) (-745.440) (-754.428) * (-743.055) (-742.541) (-745.986) [-743.841] -- 0:00:55
466500 -- [-747.746] (-747.378) (-743.130) (-746.427) * (-743.688) [-743.084] (-743.186) (-752.310) -- 0:00:54
467000 -- [-752.391] (-747.938) (-745.413) (-746.516) * (-743.754) [-740.006] (-743.386) (-745.803) -- 0:00:54
467500 -- (-750.008) [-743.654] (-746.662) (-752.507) * (-746.231) [-744.721] (-745.446) (-746.698) -- 0:00:54
468000 -- (-745.575) (-741.876) (-742.302) [-755.004] * (-750.859) (-745.572) [-740.540] (-750.218) -- 0:00:54
468500 -- (-752.563) (-749.031) [-750.289] (-753.593) * (-744.241) (-742.345) (-744.117) [-756.758] -- 0:00:55
469000 -- [-742.068] (-747.132) (-749.304) (-749.180) * (-744.481) [-743.868] (-747.292) (-749.152) -- 0:00:55
469500 -- (-743.634) (-750.500) (-750.222) [-751.726] * (-746.010) [-743.090] (-743.408) (-743.903) -- 0:00:55
470000 -- (-742.659) [-740.506] (-750.723) (-745.317) * [-745.567] (-752.537) (-739.885) (-745.099) -- 0:00:55
Average standard deviation of split frequencies: 0.017527
470500 -- (-745.099) [-741.799] (-748.406) (-745.331) * (-740.715) [-748.178] (-742.667) (-746.539) -- 0:00:55
471000 -- (-741.776) (-750.670) [-752.329] (-745.261) * [-746.042] (-750.258) (-747.702) (-747.718) -- 0:00:55
471500 -- [-745.443] (-745.057) (-749.521) (-747.818) * (-743.966) (-747.795) (-747.120) [-741.644] -- 0:00:54
472000 -- (-745.645) [-744.688] (-742.761) (-747.498) * (-749.771) [-744.296] (-745.573) (-743.520) -- 0:00:54
472500 -- (-748.566) [-744.758] (-741.864) (-744.944) * (-745.309) [-743.115] (-745.720) (-742.874) -- 0:00:54
473000 -- (-744.117) [-746.463] (-745.163) (-748.128) * (-749.936) (-742.202) (-744.200) [-744.211] -- 0:00:54
473500 -- (-745.768) (-741.981) [-752.131] (-749.557) * (-746.055) [-741.610] (-746.385) (-751.735) -- 0:00:54
474000 -- [-748.332] (-742.323) (-749.187) (-744.958) * (-748.628) (-744.425) [-743.764] (-750.910) -- 0:00:54
474500 -- (-745.130) (-742.202) (-745.941) [-744.363] * (-744.351) (-741.701) (-748.804) [-744.215] -- 0:00:54
475000 -- (-742.814) (-745.617) (-747.830) [-742.043] * (-742.352) (-745.599) (-748.283) [-742.586] -- 0:00:54
Average standard deviation of split frequencies: 0.016341
475500 -- [-743.754] (-744.679) (-743.809) (-744.727) * (-746.019) [-741.072] (-747.908) (-742.004) -- 0:00:54
476000 -- (-741.828) (-744.325) [-747.747] (-752.763) * (-748.583) [-743.088] (-747.334) (-743.112) -- 0:00:53
476500 -- (-748.565) (-742.013) (-748.216) [-742.979] * (-745.089) (-745.970) [-745.603] (-741.829) -- 0:00:53
477000 -- [-744.256] (-746.060) (-748.976) (-749.664) * (-743.932) [-742.345] (-744.238) (-745.426) -- 0:00:53
477500 -- (-742.734) [-743.407] (-747.152) (-746.924) * (-743.864) [-748.350] (-741.387) (-748.801) -- 0:00:53
478000 -- [-744.882] (-740.934) (-743.415) (-744.681) * [-745.826] (-743.485) (-744.899) (-747.575) -- 0:00:54
478500 -- (-741.154) (-748.646) (-738.558) [-753.850] * (-744.079) [-745.011] (-750.567) (-747.075) -- 0:00:54
479000 -- (-741.496) (-746.171) [-747.723] (-743.646) * (-751.655) (-748.701) (-744.508) [-743.696] -- 0:00:54
479500 -- (-743.834) [-746.063] (-746.306) (-749.300) * [-742.800] (-751.884) (-748.034) (-747.432) -- 0:00:54
480000 -- (-746.150) [-748.109] (-744.877) (-746.935) * (-743.934) (-750.347) [-743.956] (-742.381) -- 0:00:54
Average standard deviation of split frequencies: 0.017653
480500 -- (-745.336) (-745.874) [-746.186] (-744.459) * (-745.204) [-746.239] (-741.485) (-749.992) -- 0:00:54
481000 -- (-741.891) [-743.687] (-743.582) (-741.805) * (-747.863) (-745.769) (-747.942) [-742.592] -- 0:00:53
481500 -- [-746.952] (-746.354) (-751.440) (-748.002) * (-750.379) [-742.248] (-746.393) (-745.478) -- 0:00:53
482000 -- (-746.275) (-745.369) [-748.571] (-745.025) * (-747.924) [-742.736] (-748.125) (-747.012) -- 0:00:53
482500 -- (-749.825) [-744.395] (-744.508) (-746.037) * [-745.959] (-740.729) (-745.482) (-743.330) -- 0:00:53
483000 -- (-745.162) [-743.832] (-738.826) (-751.078) * (-745.760) (-742.995) (-751.541) [-744.675] -- 0:00:53
483500 -- (-748.593) (-742.042) [-747.827] (-743.633) * [-748.631] (-749.373) (-743.828) (-744.114) -- 0:00:53
484000 -- (-744.112) (-747.030) (-739.638) [-742.468] * (-748.309) [-741.511] (-741.485) (-741.774) -- 0:00:53
484500 -- [-749.874] (-745.367) (-751.312) (-740.662) * (-743.927) [-743.626] (-747.512) (-743.502) -- 0:00:53
485000 -- (-745.891) (-745.218) [-742.512] (-748.463) * (-743.060) (-745.835) (-750.609) [-744.298] -- 0:00:53
Average standard deviation of split frequencies: 0.015519
485500 -- (-745.946) (-749.301) [-745.200] (-748.698) * (-740.715) (-744.293) [-741.103] (-744.448) -- 0:00:52
486000 -- (-749.704) (-746.002) [-749.025] (-746.619) * [-741.626] (-746.619) (-745.771) (-744.788) -- 0:00:52
486500 -- (-751.488) (-749.732) [-745.511] (-748.609) * (-747.081) [-744.576] (-747.066) (-746.640) -- 0:00:52
487000 -- (-749.574) (-745.241) (-748.980) [-744.482] * (-746.050) [-745.807] (-745.187) (-747.104) -- 0:00:52
487500 -- (-748.221) [-745.319] (-743.967) (-746.345) * (-744.872) (-745.558) [-750.431] (-741.442) -- 0:00:52
488000 -- (-749.338) [-743.021] (-745.202) (-746.537) * (-744.709) [-748.919] (-746.913) (-746.279) -- 0:00:53
488500 -- (-751.284) (-742.728) (-744.782) [-745.891] * (-750.979) (-747.055) [-741.278] (-745.073) -- 0:00:53
489000 -- (-744.678) [-742.428] (-745.792) (-745.576) * [-747.060] (-748.957) (-747.838) (-749.648) -- 0:00:53
489500 -- [-745.792] (-742.850) (-743.882) (-745.050) * (-746.590) [-750.998] (-747.837) (-747.784) -- 0:00:53
490000 -- (-746.698) (-751.487) [-749.017] (-746.806) * (-745.302) (-744.573) [-750.339] (-746.091) -- 0:00:53
Average standard deviation of split frequencies: 0.014892
490500 -- (-745.335) (-745.551) (-746.603) [-750.543] * (-751.763) (-748.759) [-741.092] (-745.808) -- 0:00:52
491000 -- (-743.452) (-742.067) (-752.734) [-749.161] * (-755.437) [-747.519] (-743.450) (-746.493) -- 0:00:52
491500 -- (-741.539) [-740.406] (-750.679) (-746.038) * (-746.900) [-748.609] (-744.594) (-743.629) -- 0:00:52
492000 -- [-742.738] (-749.056) (-742.746) (-748.315) * (-743.770) [-752.026] (-747.994) (-745.299) -- 0:00:52
492500 -- [-746.061] (-743.756) (-744.971) (-744.654) * (-742.512) (-746.410) [-743.234] (-745.454) -- 0:00:52
493000 -- [-748.569] (-743.500) (-749.182) (-749.032) * [-744.225] (-746.092) (-745.557) (-741.649) -- 0:00:52
493500 -- (-742.737) [-744.698] (-747.574) (-750.658) * (-744.577) (-745.081) (-746.604) [-741.488] -- 0:00:52
494000 -- [-746.408] (-748.042) (-745.602) (-749.062) * [-747.752] (-742.272) (-746.974) (-744.013) -- 0:00:52
494500 -- [-748.959] (-744.307) (-746.115) (-753.013) * (-745.299) (-744.149) (-747.314) [-742.506] -- 0:00:52
495000 -- [-743.721] (-741.179) (-746.734) (-759.608) * (-744.585) (-748.528) (-748.192) [-743.104] -- 0:00:52
Average standard deviation of split frequencies: 0.013781
495500 -- (-750.123) (-748.557) [-743.673] (-756.826) * (-745.593) [-743.383] (-756.866) (-747.702) -- 0:00:51
496000 -- (-749.001) (-743.866) [-741.899] (-752.796) * (-746.462) (-743.626) (-750.053) [-745.334] -- 0:00:51
496500 -- (-749.489) (-743.785) (-752.052) [-744.524] * (-742.593) (-744.847) [-742.523] (-747.657) -- 0:00:51
497000 -- (-746.208) [-741.369] (-742.443) (-752.006) * (-742.027) (-750.099) (-748.204) [-743.730] -- 0:00:51
497500 -- (-749.495) (-744.207) (-745.532) [-748.089] * (-748.295) (-750.479) [-744.948] (-747.085) -- 0:00:52
498000 -- (-745.963) (-748.126) (-745.180) [-744.817] * (-745.995) (-745.327) [-746.830] (-752.571) -- 0:00:52
498500 -- (-748.248) [-744.254] (-742.051) (-745.541) * (-742.975) (-752.938) [-742.498] (-749.453) -- 0:00:52
499000 -- (-746.219) [-747.131] (-741.902) (-745.464) * (-752.376) (-748.172) [-745.576] (-745.579) -- 0:00:52
499500 -- (-746.307) (-746.979) [-742.405] (-741.470) * (-749.514) (-748.139) [-744.839] (-744.562) -- 0:00:52
500000 -- (-741.080) (-748.543) [-744.676] (-746.078) * [-749.903] (-747.817) (-742.839) (-751.841) -- 0:00:52
Average standard deviation of split frequencies: 0.013653
500500 -- [-745.786] (-747.681) (-747.982) (-742.871) * [-745.248] (-743.317) (-743.888) (-749.933) -- 0:00:51
501000 -- [-747.234] (-745.640) (-745.158) (-743.692) * [-745.728] (-744.149) (-745.956) (-750.283) -- 0:00:51
501500 -- (-748.456) (-746.210) [-743.655] (-739.841) * [-740.844] (-748.721) (-752.882) (-747.711) -- 0:00:51
502000 -- [-749.471] (-747.892) (-746.938) (-743.095) * (-748.864) [-746.010] (-751.945) (-741.922) -- 0:00:51
502500 -- [-749.298] (-746.800) (-743.718) (-751.604) * (-743.593) (-742.582) [-746.386] (-745.920) -- 0:00:51
503000 -- (-747.352) (-744.445) (-746.400) [-749.942] * (-746.926) [-757.421] (-740.826) (-746.541) -- 0:00:51
503500 -- [-742.919] (-743.527) (-757.433) (-753.333) * [-744.766] (-752.265) (-741.256) (-745.828) -- 0:00:51
504000 -- (-743.625) (-748.273) [-750.338] (-755.722) * (-745.706) (-744.031) [-743.028] (-745.058) -- 0:00:51
504500 -- (-743.319) (-751.488) [-746.857] (-748.799) * (-745.672) (-746.422) [-743.051] (-747.141) -- 0:00:51
505000 -- (-741.238) (-758.068) (-742.025) [-741.178] * (-746.516) (-747.630) (-743.135) [-748.706] -- 0:00:50
Average standard deviation of split frequencies: 0.016304
505500 -- (-744.210) (-749.902) [-743.169] (-742.020) * [-745.580] (-744.095) (-752.383) (-745.895) -- 0:00:50
506000 -- [-744.237] (-746.108) (-747.962) (-745.403) * (-745.396) (-748.422) [-743.649] (-745.269) -- 0:00:50
506500 -- [-745.149] (-745.848) (-742.987) (-742.251) * [-745.467] (-742.940) (-743.146) (-749.035) -- 0:00:50
507000 -- (-741.814) (-748.130) [-744.383] (-746.185) * (-744.202) (-745.699) (-744.173) [-742.087] -- 0:00:50
507500 -- (-744.126) (-751.752) [-742.029] (-746.894) * (-754.108) (-744.378) [-743.052] (-742.933) -- 0:00:51
508000 -- (-745.250) (-761.032) (-743.871) [-745.496] * (-752.859) (-747.949) [-746.450] (-745.807) -- 0:00:51
508500 -- (-750.755) (-748.665) (-751.636) [-742.171] * (-746.682) (-742.492) [-744.679] (-743.777) -- 0:00:51
509000 -- (-744.402) [-752.236] (-748.938) (-748.010) * [-745.103] (-743.197) (-742.724) (-750.400) -- 0:00:51
509500 -- (-743.551) (-747.666) [-748.159] (-742.984) * (-744.982) (-742.867) [-742.258] (-746.162) -- 0:00:51
510000 -- [-741.068] (-748.091) (-744.958) (-742.305) * (-747.343) [-744.288] (-743.482) (-742.888) -- 0:00:50
Average standard deviation of split frequencies: 0.016616
510500 -- [-744.131] (-747.139) (-749.249) (-745.703) * (-742.021) (-745.326) [-746.201] (-745.938) -- 0:00:50
511000 -- (-749.113) (-744.970) [-747.182] (-749.002) * (-742.776) [-741.640] (-752.729) (-743.835) -- 0:00:50
511500 -- (-749.296) (-744.157) (-742.608) [-746.415] * (-743.383) [-744.707] (-749.954) (-744.724) -- 0:00:50
512000 -- (-746.736) [-751.295] (-750.835) (-743.076) * (-742.453) (-743.504) [-748.735] (-746.489) -- 0:00:50
512500 -- (-744.830) (-748.419) (-746.865) [-747.814] * [-743.943] (-751.909) (-753.727) (-748.342) -- 0:00:50
513000 -- (-741.229) (-747.372) [-744.615] (-754.827) * (-749.097) (-743.656) [-747.898] (-752.416) -- 0:00:50
513500 -- (-745.191) (-749.704) (-747.225) [-744.583] * (-747.267) (-746.272) (-747.598) [-744.880] -- 0:00:50
514000 -- (-749.325) (-745.456) [-745.751] (-742.776) * (-745.360) (-742.411) (-746.417) [-745.677] -- 0:00:50
514500 -- (-743.993) [-745.735] (-743.747) (-753.763) * (-744.782) [-742.874] (-746.628) (-751.675) -- 0:00:50
515000 -- [-750.665] (-745.143) (-742.564) (-743.780) * (-748.190) (-740.512) [-743.264] (-743.889) -- 0:00:49
Average standard deviation of split frequencies: 0.015074
515500 -- (-747.140) (-744.941) [-740.696] (-745.544) * (-747.049) [-741.635] (-749.673) (-753.022) -- 0:00:49
516000 -- (-741.196) (-746.876) [-747.199] (-742.971) * (-749.778) [-742.792] (-749.732) (-743.473) -- 0:00:49
516500 -- (-751.190) (-748.648) (-745.831) [-738.573] * (-746.182) (-743.954) [-749.734] (-745.128) -- 0:00:49
517000 -- [-748.141] (-744.269) (-747.545) (-747.163) * (-748.517) (-744.483) [-743.937] (-743.011) -- 0:00:50
517500 -- (-741.680) [-744.648] (-745.714) (-747.191) * (-745.727) (-752.714) [-748.258] (-741.051) -- 0:00:50
518000 -- (-749.404) [-748.721] (-752.718) (-752.252) * (-743.136) (-750.119) (-745.033) [-747.895] -- 0:00:50
518500 -- [-747.565] (-751.235) (-743.788) (-746.609) * (-739.927) (-752.004) [-743.153] (-745.727) -- 0:00:50
519000 -- (-748.196) (-747.773) [-747.385] (-747.004) * (-748.174) (-750.885) [-747.053] (-747.382) -- 0:00:50
519500 -- [-745.009] (-745.012) (-743.725) (-747.964) * (-744.291) (-746.011) (-745.662) [-750.885] -- 0:00:49
520000 -- (-752.312) [-744.933] (-741.449) (-746.587) * [-743.959] (-756.411) (-742.972) (-749.706) -- 0:00:49
Average standard deviation of split frequencies: 0.010865
520500 -- [-747.602] (-747.775) (-743.303) (-748.601) * (-741.889) (-747.765) (-747.156) [-747.227] -- 0:00:49
521000 -- (-752.209) (-748.402) (-744.240) [-742.767] * (-748.895) (-744.824) [-746.654] (-746.443) -- 0:00:49
521500 -- (-750.331) (-746.348) [-745.146] (-747.908) * (-747.076) [-746.232] (-747.322) (-753.291) -- 0:00:49
522000 -- (-750.361) [-745.998] (-746.657) (-756.668) * (-741.728) [-747.732] (-743.134) (-744.185) -- 0:00:49
522500 -- (-750.204) (-748.035) [-748.895] (-748.260) * (-744.360) (-742.845) (-742.604) [-746.020] -- 0:00:49
523000 -- [-742.759] (-747.630) (-747.495) (-750.500) * (-753.833) (-751.745) (-746.389) [-743.486] -- 0:00:49
523500 -- (-747.199) [-746.222] (-744.869) (-751.933) * (-751.071) (-745.482) (-744.047) [-742.402] -- 0:00:49
524000 -- [-748.032] (-744.981) (-749.796) (-743.714) * [-747.362] (-742.829) (-744.862) (-745.746) -- 0:00:49
524500 -- (-748.939) (-742.562) [-744.420] (-749.179) * [-746.953] (-752.118) (-747.405) (-746.095) -- 0:00:48
525000 -- (-744.567) (-749.218) [-740.877] (-747.033) * (-752.794) (-744.742) [-746.689] (-748.192) -- 0:00:48
Average standard deviation of split frequencies: 0.011203
525500 -- (-741.646) (-749.058) (-743.437) [-741.508] * [-749.547] (-744.560) (-742.448) (-749.968) -- 0:00:48
526000 -- (-744.525) (-747.084) (-743.013) [-747.833] * (-753.992) [-741.130] (-744.947) (-749.580) -- 0:00:48
526500 -- (-741.080) (-747.967) [-745.482] (-742.757) * [-742.805] (-744.549) (-745.878) (-750.714) -- 0:00:48
527000 -- (-742.013) (-739.625) [-750.554] (-748.018) * (-740.906) (-747.951) (-750.752) [-746.284] -- 0:00:49
527500 -- (-745.533) (-754.129) (-749.382) [-744.972] * (-741.584) (-746.420) (-745.258) [-744.057] -- 0:00:49
528000 -- (-743.114) (-743.253) [-748.744] (-748.350) * (-742.369) [-744.078] (-746.548) (-744.311) -- 0:00:49
528500 -- (-747.184) (-747.936) (-745.180) [-748.958] * (-746.084) (-752.963) [-747.807] (-749.324) -- 0:00:49
529000 -- (-745.597) (-747.304) (-741.429) [-743.097] * (-745.081) [-742.843] (-747.902) (-751.643) -- 0:00:48
529500 -- (-744.329) [-744.357] (-739.770) (-739.716) * [-748.957] (-746.754) (-748.254) (-753.570) -- 0:00:48
530000 -- [-744.074] (-743.072) (-746.205) (-741.553) * (-747.396) (-740.734) [-749.426] (-753.924) -- 0:00:48
Average standard deviation of split frequencies: 0.010216
530500 -- (-746.043) (-743.541) (-743.657) [-747.986] * [-740.574] (-744.398) (-749.036) (-746.546) -- 0:00:48
531000 -- (-746.877) (-747.823) (-745.285) [-743.667] * (-741.828) [-746.188] (-752.928) (-748.322) -- 0:00:48
531500 -- (-744.013) (-751.528) (-747.175) [-742.988] * [-742.998] (-745.457) (-752.656) (-749.087) -- 0:00:48
532000 -- [-749.249] (-744.611) (-747.432) (-741.733) * (-739.655) [-750.193] (-747.906) (-744.409) -- 0:00:48
532500 -- (-743.508) (-746.072) [-747.931] (-743.986) * (-743.252) (-748.081) [-749.115] (-741.793) -- 0:00:48
533000 -- (-743.590) (-744.379) (-746.866) [-740.785] * [-741.996] (-750.435) (-749.117) (-746.024) -- 0:00:48
533500 -- (-749.837) [-742.063] (-745.206) (-745.597) * (-746.586) [-744.972] (-746.220) (-747.000) -- 0:00:48
534000 -- (-753.329) (-744.176) [-750.502] (-752.200) * (-743.640) [-740.632] (-753.071) (-750.087) -- 0:00:47
534500 -- [-743.955] (-745.152) (-753.456) (-756.793) * (-751.237) (-749.257) (-751.326) [-747.358] -- 0:00:47
535000 -- (-746.480) [-742.184] (-745.401) (-756.289) * (-742.508) (-752.121) [-746.662] (-744.241) -- 0:00:47
Average standard deviation of split frequencies: 0.010554
535500 -- (-750.832) (-744.551) (-742.990) [-746.075] * (-746.316) (-749.050) (-747.693) [-747.167] -- 0:00:47
536000 -- (-747.367) [-742.789] (-757.283) (-753.914) * (-741.914) (-746.302) [-750.484] (-749.356) -- 0:00:47
536500 -- [-745.903] (-741.793) (-752.422) (-748.244) * (-748.062) (-746.912) (-745.944) [-744.509] -- 0:00:47
537000 -- [-744.528] (-741.284) (-752.270) (-745.141) * (-743.004) (-741.618) (-740.395) [-747.067] -- 0:00:48
537500 -- (-743.978) [-747.320] (-749.735) (-749.534) * (-742.310) (-746.960) (-746.416) [-744.731] -- 0:00:48
538000 -- (-742.294) (-745.351) (-745.971) [-744.610] * (-740.956) [-748.761] (-743.339) (-744.962) -- 0:00:48
538500 -- (-744.975) [-742.683] (-740.530) (-751.144) * [-743.217] (-756.437) (-748.288) (-746.524) -- 0:00:47
539000 -- (-749.028) [-746.284] (-739.302) (-751.608) * (-740.592) (-743.576) [-744.306] (-744.611) -- 0:00:47
539500 -- (-742.285) (-750.378) [-741.296] (-749.173) * (-745.632) (-740.162) (-741.805) [-742.626] -- 0:00:47
540000 -- (-744.515) (-743.792) (-741.040) [-746.546] * (-746.545) [-744.124] (-744.876) (-753.119) -- 0:00:47
Average standard deviation of split frequencies: 0.009155
540500 -- (-744.965) (-748.614) [-745.418] (-744.576) * (-749.769) (-743.713) (-745.935) [-743.167] -- 0:00:47
541000 -- (-746.497) (-747.037) (-745.660) [-745.635] * (-743.463) (-748.960) [-743.989] (-748.405) -- 0:00:47
541500 -- (-749.761) (-752.094) [-745.580] (-749.405) * (-745.887) (-748.638) (-743.551) [-749.020] -- 0:00:47
542000 -- (-745.289) (-747.000) [-744.145] (-747.132) * (-748.828) (-746.517) [-740.934] (-745.011) -- 0:00:47
542500 -- (-743.443) [-745.767] (-747.213) (-743.962) * [-743.237] (-745.134) (-742.435) (-744.303) -- 0:00:47
543000 -- (-743.946) [-744.097] (-751.882) (-750.005) * (-743.319) [-749.449] (-750.844) (-744.036) -- 0:00:47
543500 -- (-749.069) (-746.127) (-750.388) [-742.750] * (-743.618) (-748.510) (-749.767) [-743.012] -- 0:00:47
544000 -- (-743.699) (-744.924) [-747.210] (-745.835) * (-747.499) [-746.777] (-753.614) (-748.395) -- 0:00:46
544500 -- [-740.970] (-743.534) (-748.567) (-746.518) * (-748.937) (-748.180) [-749.147] (-748.079) -- 0:00:46
545000 -- (-744.613) (-751.054) [-744.732] (-748.517) * (-749.506) (-747.832) [-751.047] (-745.007) -- 0:00:46
Average standard deviation of split frequencies: 0.005180
545500 -- (-750.006) (-753.931) [-751.457] (-746.816) * (-741.927) (-751.577) (-744.624) [-743.477] -- 0:00:46
546000 -- (-748.638) (-748.553) (-747.865) [-746.741] * (-745.658) [-750.021] (-749.218) (-745.342) -- 0:00:46
546500 -- [-748.833] (-749.461) (-745.261) (-743.535) * [-749.472] (-749.581) (-745.143) (-742.263) -- 0:00:46
547000 -- (-747.488) [-746.533] (-746.595) (-743.515) * (-747.888) (-747.653) [-742.234] (-740.398) -- 0:00:47
547500 -- (-749.134) (-749.982) [-745.722] (-749.445) * (-747.218) (-745.138) [-746.806] (-745.194) -- 0:00:47
548000 -- (-751.330) [-742.954] (-744.450) (-744.347) * [-744.918] (-742.586) (-743.560) (-740.941) -- 0:00:47
548500 -- (-747.486) [-745.576] (-747.842) (-745.913) * (-746.873) (-745.893) [-744.879] (-746.266) -- 0:00:46
549000 -- (-746.640) (-742.340) [-745.587] (-744.034) * (-742.209) (-745.546) [-747.379] (-748.097) -- 0:00:46
549500 -- (-742.929) (-742.535) (-746.040) [-745.211] * (-750.184) (-745.261) [-741.043] (-745.933) -- 0:00:46
550000 -- (-754.729) (-746.740) (-743.564) [-745.699] * [-745.885] (-748.502) (-745.178) (-746.307) -- 0:00:46
Average standard deviation of split frequencies: 0.005136
550500 -- [-746.122] (-748.088) (-742.998) (-743.788) * (-744.668) [-745.324] (-747.799) (-750.008) -- 0:00:46
551000 -- (-753.923) [-746.198] (-746.573) (-740.976) * (-746.551) (-742.943) (-746.910) [-744.585] -- 0:00:46
551500 -- (-744.906) (-743.781) [-743.844] (-742.701) * (-740.522) (-747.043) (-745.832) [-747.982] -- 0:00:46
552000 -- (-747.726) (-751.096) [-753.943] (-742.201) * (-741.185) [-740.766] (-749.858) (-748.887) -- 0:00:46
552500 -- (-744.408) (-746.996) [-744.047] (-745.757) * (-749.307) [-742.468] (-745.148) (-749.384) -- 0:00:46
553000 -- [-757.182] (-742.057) (-745.735) (-746.824) * (-750.000) (-744.085) [-746.553] (-742.903) -- 0:00:46
553500 -- [-749.580] (-744.040) (-744.133) (-744.990) * (-744.891) (-745.129) (-746.650) [-742.994] -- 0:00:45
554000 -- (-744.386) (-748.622) [-745.866] (-744.829) * [-747.273] (-742.977) (-752.880) (-747.636) -- 0:00:45
554500 -- (-744.572) (-750.313) [-742.590] (-756.340) * (-741.923) [-745.935] (-752.274) (-741.823) -- 0:00:45
555000 -- (-747.738) [-748.450] (-744.619) (-746.709) * [-745.149] (-741.844) (-750.976) (-747.200) -- 0:00:45
Average standard deviation of split frequencies: 0.005511
555500 -- (-749.342) (-745.752) (-744.299) [-743.570] * [-747.652] (-745.561) (-755.680) (-746.806) -- 0:00:45
556000 -- [-741.963] (-746.621) (-742.784) (-741.765) * (-743.865) (-744.369) [-747.503] (-746.700) -- 0:00:45
556500 -- (-747.755) (-743.929) (-742.177) [-746.821] * (-743.521) (-747.492) [-746.997] (-746.555) -- 0:00:46
557000 -- (-746.757) [-745.457] (-740.475) (-743.754) * (-745.287) (-745.515) [-742.211] (-746.430) -- 0:00:46
557500 -- [-744.439] (-746.774) (-748.432) (-742.606) * (-746.479) (-756.805) (-743.620) [-744.496] -- 0:00:46
558000 -- (-750.781) (-743.003) (-747.759) [-743.220] * (-740.278) [-743.144] (-748.459) (-742.396) -- 0:00:45
558500 -- (-750.965) (-742.583) (-757.643) [-740.854] * [-749.481] (-751.345) (-746.049) (-747.268) -- 0:00:45
559000 -- (-746.383) (-749.682) (-747.305) [-748.875] * (-741.473) [-747.199] (-753.068) (-744.393) -- 0:00:45
559500 -- (-748.497) (-746.743) (-747.780) [-743.629] * (-744.064) [-747.944] (-746.793) (-746.442) -- 0:00:45
560000 -- (-747.802) [-751.111] (-744.330) (-747.321) * (-746.136) (-743.709) (-742.867) [-746.129] -- 0:00:45
Average standard deviation of split frequencies: 0.009249
560500 -- [-743.985] (-750.027) (-749.492) (-743.778) * [-749.513] (-742.607) (-745.230) (-750.901) -- 0:00:45
561000 -- (-746.639) [-749.330] (-746.503) (-741.479) * [-740.923] (-751.883) (-750.681) (-746.363) -- 0:00:45
561500 -- (-753.149) [-744.999] (-749.846) (-740.802) * (-743.126) (-748.062) [-744.509] (-745.813) -- 0:00:45
562000 -- [-742.519] (-749.976) (-747.094) (-749.898) * (-745.571) (-751.108) (-743.511) [-748.667] -- 0:00:45
562500 -- (-744.589) [-741.058] (-745.902) (-749.369) * [-742.416] (-743.917) (-751.445) (-743.874) -- 0:00:45
563000 -- (-750.178) [-745.792] (-747.794) (-743.642) * [-740.742] (-748.658) (-747.506) (-746.629) -- 0:00:45
563500 -- (-752.232) (-740.040) (-745.845) [-742.464] * (-745.723) (-746.247) (-746.355) [-748.855] -- 0:00:44
564000 -- (-750.315) (-743.821) (-744.345) [-743.602] * [-742.548] (-747.213) (-740.658) (-749.243) -- 0:00:44
564500 -- (-746.455) [-741.360] (-747.736) (-750.532) * (-746.745) [-745.441] (-744.520) (-746.573) -- 0:00:44
565000 -- [-749.084] (-744.211) (-743.855) (-746.196) * [-740.091] (-749.035) (-745.023) (-747.366) -- 0:00:44
Average standard deviation of split frequencies: 0.008745
565500 -- [-749.043] (-749.942) (-752.928) (-745.055) * (-749.263) (-743.760) [-746.959] (-756.965) -- 0:00:44
566000 -- (-752.521) [-757.769] (-741.773) (-745.417) * (-743.718) (-742.679) [-745.771] (-753.954) -- 0:00:44
566500 -- (-746.044) (-752.953) (-747.911) [-744.153] * (-746.946) [-742.065] (-747.191) (-750.687) -- 0:00:45
567000 -- (-750.525) [-750.569] (-744.227) (-743.700) * (-742.034) (-748.430) (-748.185) [-744.073] -- 0:00:45
567500 -- (-750.730) [-745.927] (-749.607) (-747.691) * (-742.395) [-745.161] (-750.456) (-740.784) -- 0:00:44
568000 -- (-746.455) (-750.642) [-741.996] (-747.773) * (-743.300) [-748.137] (-745.936) (-742.536) -- 0:00:44
568500 -- [-740.099] (-747.536) (-742.869) (-749.932) * (-751.058) [-741.985] (-755.846) (-742.304) -- 0:00:44
569000 -- (-744.436) [-751.179] (-750.691) (-742.469) * (-750.587) [-745.856] (-755.293) (-749.170) -- 0:00:44
569500 -- [-745.324] (-751.038) (-747.926) (-747.196) * (-743.312) (-751.255) (-745.460) [-743.352] -- 0:00:44
570000 -- (-744.498) (-744.313) [-742.897] (-750.268) * [-744.107] (-753.712) (-745.335) (-742.259) -- 0:00:44
Average standard deviation of split frequencies: 0.007435
570500 -- (-741.157) (-745.029) (-747.313) [-741.947] * [-746.873] (-749.741) (-748.146) (-746.285) -- 0:00:44
571000 -- (-742.774) (-751.436) (-750.027) [-745.830] * (-744.262) (-750.595) [-745.247] (-745.502) -- 0:00:44
571500 -- [-742.210] (-768.153) (-747.349) (-746.339) * (-747.628) [-740.626] (-747.295) (-749.440) -- 0:00:44
572000 -- (-741.600) (-746.307) (-745.955) [-747.850] * (-744.900) (-747.733) [-743.466] (-747.737) -- 0:00:44
572500 -- (-746.198) (-743.754) [-742.884] (-747.428) * (-746.108) (-744.080) [-746.324] (-751.105) -- 0:00:44
573000 -- [-742.532] (-747.166) (-749.947) (-745.061) * [-750.253] (-751.235) (-745.496) (-749.497) -- 0:00:43
573500 -- (-745.489) (-747.460) (-746.788) [-742.805] * (-749.447) (-746.092) (-747.862) [-749.626] -- 0:00:43
574000 -- [-744.730] (-744.181) (-742.975) (-743.780) * (-754.543) (-745.038) [-743.854] (-746.806) -- 0:00:43
574500 -- [-742.273] (-744.734) (-740.879) (-744.710) * [-751.614] (-747.204) (-748.253) (-747.709) -- 0:00:43
575000 -- (-743.775) (-750.793) [-743.949] (-752.474) * (-750.896) [-745.852] (-744.835) (-748.110) -- 0:00:43
Average standard deviation of split frequencies: 0.004092
575500 -- (-742.119) [-743.593] (-754.023) (-747.299) * (-747.572) (-745.977) (-744.383) [-746.753] -- 0:00:43
576000 -- (-743.979) [-749.105] (-741.886) (-747.926) * [-749.474] (-748.417) (-742.559) (-744.413) -- 0:00:44
576500 -- (-748.341) (-743.136) (-743.294) [-747.757] * (-747.049) (-754.044) [-745.316] (-745.536) -- 0:00:44
577000 -- [-746.020] (-748.472) (-743.464) (-746.040) * (-748.637) [-751.021] (-757.531) (-742.792) -- 0:00:43
577500 -- (-745.693) (-751.100) [-748.617] (-746.838) * (-742.788) [-750.471] (-746.096) (-743.763) -- 0:00:43
578000 -- (-746.040) (-746.680) (-744.783) [-745.752] * [-748.091] (-745.310) (-748.165) (-748.595) -- 0:00:43
578500 -- (-752.338) [-746.684] (-742.826) (-745.771) * (-743.424) (-749.470) (-740.424) [-750.364] -- 0:00:43
579000 -- (-748.591) (-746.428) (-744.255) [-748.719] * (-744.291) (-750.644) (-747.849) [-745.006] -- 0:00:43
579500 -- [-742.013] (-750.034) (-743.896) (-742.455) * [-740.223] (-743.528) (-742.983) (-753.202) -- 0:00:43
580000 -- (-743.607) (-748.177) [-740.282] (-743.614) * (-742.539) (-745.129) [-746.651] (-747.027) -- 0:00:43
Average standard deviation of split frequencies: 0.007306
580500 -- (-742.305) (-752.457) (-741.997) [-747.730] * (-745.591) (-742.844) [-749.112] (-749.610) -- 0:00:43
581000 -- (-746.616) (-746.595) [-740.740] (-746.306) * (-748.000) [-745.577] (-755.076) (-740.531) -- 0:00:43
581500 -- [-741.089] (-743.565) (-746.115) (-745.725) * [-742.710] (-746.903) (-747.776) (-744.484) -- 0:00:43
582000 -- (-744.799) (-746.418) (-743.948) [-753.660] * (-747.252) [-743.215] (-741.849) (-744.209) -- 0:00:43
582500 -- (-751.378) (-747.443) [-741.966] (-748.613) * (-741.396) [-747.831] (-742.656) (-747.500) -- 0:00:43
583000 -- (-745.469) (-749.517) [-746.460] (-747.235) * (-751.829) [-746.074] (-744.972) (-749.575) -- 0:00:42
583500 -- (-745.433) (-748.649) [-740.931] (-747.874) * [-748.670] (-749.450) (-748.435) (-755.921) -- 0:00:42
584000 -- (-748.085) (-745.115) [-744.147] (-742.524) * (-745.077) [-742.550] (-746.844) (-749.492) -- 0:00:42
584500 -- (-747.961) (-750.181) (-745.109) [-748.881] * (-743.464) [-743.332] (-741.238) (-744.249) -- 0:00:42
585000 -- (-751.738) [-747.782] (-746.228) (-746.152) * (-751.136) [-741.060] (-744.315) (-744.320) -- 0:00:42
Average standard deviation of split frequencies: 0.006033
585500 -- (-750.471) (-747.652) [-748.536] (-749.216) * (-743.544) (-744.889) (-746.815) [-741.594] -- 0:00:42
586000 -- [-743.720] (-747.575) (-754.234) (-748.217) * (-741.649) [-740.824] (-746.623) (-743.266) -- 0:00:43
586500 -- [-742.608] (-746.531) (-745.913) (-744.938) * (-739.271) [-744.316] (-746.954) (-754.720) -- 0:00:43
587000 -- (-745.242) [-742.248] (-745.706) (-749.722) * [-752.180] (-748.068) (-748.920) (-742.724) -- 0:00:42
587500 -- [-746.223] (-743.791) (-744.012) (-746.866) * (-745.069) [-749.029] (-749.146) (-743.827) -- 0:00:42
588000 -- [-743.277] (-754.860) (-748.659) (-754.208) * (-743.474) (-746.934) [-751.737] (-749.111) -- 0:00:42
588500 -- (-750.371) [-740.411] (-752.523) (-752.944) * (-747.321) (-752.410) (-748.111) [-745.881] -- 0:00:42
589000 -- (-748.334) (-741.862) (-746.872) [-746.705] * (-742.401) [-747.162] (-745.394) (-742.947) -- 0:00:42
589500 -- (-751.694) [-744.747] (-746.149) (-748.738) * (-743.844) (-746.702) (-747.486) [-749.755] -- 0:00:42
590000 -- (-740.433) [-746.971] (-746.675) (-749.693) * [-741.686] (-746.470) (-752.331) (-749.329) -- 0:00:42
Average standard deviation of split frequencies: 0.004389
590500 -- [-741.465] (-745.892) (-747.300) (-749.633) * (-746.659) (-751.014) [-746.545] (-746.361) -- 0:00:42
591000 -- [-743.873] (-747.798) (-740.316) (-751.321) * (-743.650) (-748.799) (-749.821) [-747.453] -- 0:00:42
591500 -- (-746.468) [-741.752] (-741.059) (-747.650) * (-746.111) [-745.225] (-748.460) (-745.776) -- 0:00:42
592000 -- [-749.287] (-742.397) (-747.362) (-752.301) * (-745.336) [-751.494] (-747.862) (-742.127) -- 0:00:42
592500 -- [-744.052] (-746.438) (-741.394) (-751.536) * (-745.599) (-749.661) (-746.622) [-745.097] -- 0:00:41
593000 -- [-747.365] (-744.396) (-746.713) (-747.381) * (-744.573) (-750.798) [-742.779] (-742.364) -- 0:00:41
593500 -- (-746.776) (-745.539) [-742.221] (-748.518) * [-744.539] (-743.565) (-746.070) (-743.611) -- 0:00:41
594000 -- (-746.416) [-746.460] (-738.776) (-745.923) * (-744.541) (-743.548) (-750.076) [-748.326] -- 0:00:41
594500 -- (-749.406) (-746.792) (-747.751) [-746.189] * (-743.632) (-744.889) [-744.534] (-742.157) -- 0:00:41
595000 -- [-749.124] (-751.705) (-752.301) (-746.738) * (-743.078) (-747.164) (-751.784) [-743.611] -- 0:00:41
Average standard deviation of split frequencies: 0.004746
595500 -- (-744.920) (-747.278) [-750.141] (-745.712) * (-745.740) (-748.499) [-745.864] (-745.546) -- 0:00:42
596000 -- (-753.048) (-751.526) (-741.730) [-751.837] * (-748.452) (-745.374) [-741.579] (-741.365) -- 0:00:42
596500 -- (-750.817) (-745.931) (-752.898) [-751.596] * (-743.524) [-744.568] (-744.289) (-751.434) -- 0:00:41
597000 -- (-746.803) (-747.659) (-744.387) [-749.823] * (-741.070) [-744.947] (-747.170) (-744.442) -- 0:00:41
597500 -- (-744.905) (-744.403) [-742.704] (-750.278) * [-746.322] (-744.193) (-746.613) (-740.590) -- 0:00:41
598000 -- (-741.582) (-746.214) [-744.372] (-743.305) * (-751.381) [-742.361] (-751.935) (-750.968) -- 0:00:41
598500 -- [-745.428] (-745.978) (-747.145) (-740.854) * (-747.065) (-749.594) (-747.116) [-744.936] -- 0:00:41
599000 -- (-742.154) (-748.572) [-744.798] (-743.286) * (-745.247) [-744.257] (-749.134) (-742.669) -- 0:00:41
599500 -- (-741.585) [-744.299] (-746.067) (-742.973) * (-744.509) [-742.366] (-746.135) (-738.392) -- 0:00:41
600000 -- [-740.336] (-748.056) (-741.617) (-740.697) * (-748.446) [-745.369] (-742.469) (-748.114) -- 0:00:41
Average standard deviation of split frequencies: 0.005494
600500 -- (-744.762) (-747.214) [-748.086] (-745.906) * (-751.146) (-748.160) [-747.803] (-751.238) -- 0:00:41
601000 -- (-743.635) (-747.990) (-741.035) [-742.002] * (-751.937) (-745.515) (-745.450) [-741.811] -- 0:00:41
601500 -- (-740.190) [-749.520] (-745.804) (-741.628) * (-747.232) (-744.843) (-741.756) [-740.370] -- 0:00:41
602000 -- [-744.011] (-748.203) (-741.803) (-742.334) * [-750.973] (-743.301) (-748.446) (-740.810) -- 0:00:40
602500 -- (-750.874) (-744.294) [-745.424] (-743.266) * [-747.509] (-745.871) (-750.211) (-743.932) -- 0:00:40
603000 -- (-743.126) [-743.914] (-742.838) (-742.291) * (-744.574) (-748.588) (-746.846) [-743.132] -- 0:00:40
603500 -- (-750.033) [-748.526] (-741.506) (-743.221) * [-742.048] (-747.991) (-744.218) (-745.447) -- 0:00:40
604000 -- [-742.989] (-749.594) (-747.131) (-748.533) * (-749.535) [-744.287] (-740.419) (-744.918) -- 0:00:40
604500 -- [-746.636] (-745.272) (-749.657) (-744.428) * (-748.414) (-746.576) (-745.479) [-742.592] -- 0:00:40
605000 -- (-745.751) [-742.939] (-748.517) (-746.460) * (-745.401) (-746.607) [-744.249] (-740.682) -- 0:00:41
Average standard deviation of split frequencies: 0.005056
605500 -- (-746.458) (-746.135) [-745.260] (-741.778) * (-745.537) (-742.801) (-746.453) [-742.892] -- 0:00:41
606000 -- [-748.186] (-742.686) (-746.833) (-744.210) * (-751.595) (-745.466) [-754.352] (-742.535) -- 0:00:40
606500 -- (-752.532) (-743.061) (-745.006) [-743.828] * [-744.289] (-744.286) (-747.747) (-742.200) -- 0:00:40
607000 -- [-751.058] (-742.884) (-740.892) (-746.236) * (-748.648) [-743.916] (-745.818) (-740.944) -- 0:00:40
607500 -- (-742.470) (-748.766) [-740.873] (-742.563) * (-746.276) [-748.523] (-749.401) (-743.879) -- 0:00:40
608000 -- (-747.769) (-747.140) (-747.951) [-745.054] * (-742.531) (-747.346) [-743.782] (-751.006) -- 0:00:40
608500 -- (-744.026) (-748.335) (-740.680) [-745.425] * [-744.873] (-751.035) (-745.574) (-749.356) -- 0:00:40
609000 -- [-744.179] (-743.406) (-748.830) (-743.780) * (-746.425) (-746.306) (-749.168) [-746.763] -- 0:00:40
609500 -- (-743.233) (-744.985) [-749.619] (-741.404) * (-753.752) (-746.594) (-749.328) [-746.393] -- 0:00:40
610000 -- (-745.896) (-742.711) [-745.432] (-744.640) * (-747.233) (-749.748) [-745.505] (-740.620) -- 0:00:40
Average standard deviation of split frequencies: 0.006176
610500 -- (-748.913) (-746.337) (-741.475) [-742.143] * [-744.987] (-744.955) (-741.125) (-742.615) -- 0:00:40
611000 -- (-748.934) (-748.097) [-741.722] (-747.531) * (-740.839) [-744.717] (-747.760) (-743.761) -- 0:00:40
611500 -- (-749.302) (-744.217) [-741.139] (-751.573) * [-745.297] (-743.619) (-739.889) (-744.924) -- 0:00:40
612000 -- [-742.222] (-743.836) (-742.657) (-743.355) * (-753.322) [-742.734] (-747.375) (-745.601) -- 0:00:39
612500 -- (-741.489) [-748.892] (-746.104) (-745.790) * (-749.107) [-742.300] (-743.657) (-742.740) -- 0:00:39
613000 -- (-744.707) [-744.998] (-743.603) (-740.204) * (-748.114) (-743.312) (-743.084) [-745.825] -- 0:00:39
613500 -- (-749.104) [-741.257] (-749.718) (-743.666) * (-744.506) (-744.303) (-755.493) [-745.362] -- 0:00:39
614000 -- (-746.302) (-742.625) (-751.326) [-745.189] * (-742.792) (-748.179) (-745.314) [-740.822] -- 0:00:39
614500 -- (-746.393) [-743.273] (-743.038) (-743.300) * (-755.488) (-751.471) (-743.548) [-740.042] -- 0:00:39
615000 -- (-739.780) (-747.732) [-746.254] (-746.270) * (-745.509) (-742.873) (-741.363) [-744.489] -- 0:00:40
Average standard deviation of split frequencies: 0.006122
615500 -- (-742.452) [-746.167] (-747.346) (-746.340) * (-747.884) [-740.035] (-742.334) (-744.747) -- 0:00:39
616000 -- (-748.376) (-746.314) (-743.843) [-741.856] * (-742.532) (-743.041) (-749.093) [-743.447] -- 0:00:39
616500 -- (-749.413) (-742.095) [-745.939] (-742.723) * (-745.525) (-745.095) [-749.410] (-745.683) -- 0:00:39
617000 -- (-752.963) (-748.907) [-740.909] (-743.592) * (-756.568) (-744.942) [-747.391] (-745.723) -- 0:00:39
617500 -- (-743.906) (-740.864) [-743.103] (-739.188) * (-747.577) (-747.523) (-750.883) [-742.979] -- 0:00:39
618000 -- (-746.350) (-747.739) [-743.336] (-741.930) * [-743.736] (-748.062) (-748.372) (-750.747) -- 0:00:39
618500 -- [-744.615] (-742.601) (-746.998) (-745.924) * (-746.624) [-748.150] (-745.923) (-747.128) -- 0:00:39
619000 -- (-745.085) (-746.793) [-744.059] (-746.270) * [-749.071] (-748.765) (-748.205) (-748.927) -- 0:00:39
619500 -- [-748.815] (-747.478) (-745.576) (-745.088) * (-742.826) (-750.456) (-742.358) [-744.504] -- 0:00:39
620000 -- [-744.112] (-742.777) (-748.462) (-747.089) * (-748.871) [-750.448] (-746.467) (-742.952) -- 0:00:39
Average standard deviation of split frequencies: 0.005696
620500 -- [-747.746] (-741.982) (-747.298) (-743.107) * (-744.733) (-747.166) (-741.141) [-740.034] -- 0:00:39
621000 -- [-742.705] (-752.160) (-744.652) (-744.964) * (-742.018) (-747.663) (-742.357) [-744.655] -- 0:00:39
621500 -- (-741.407) (-746.736) [-742.842] (-741.536) * (-750.352) [-746.307] (-750.865) (-741.357) -- 0:00:38
622000 -- (-747.627) (-742.489) (-746.901) [-745.102] * [-745.995] (-745.861) (-746.992) (-743.613) -- 0:00:38
622500 -- (-748.825) (-746.563) (-745.464) [-748.230] * (-747.477) (-752.122) (-747.162) [-742.379] -- 0:00:38
623000 -- (-746.257) (-751.946) [-741.140] (-756.746) * (-744.273) (-750.114) (-745.705) [-742.466] -- 0:00:38
623500 -- [-741.935] (-748.706) (-745.172) (-745.526) * [-743.063] (-747.374) (-752.486) (-746.322) -- 0:00:38
624000 -- (-741.444) [-749.617] (-740.531) (-746.054) * (-747.582) [-747.990] (-750.130) (-746.262) -- 0:00:38
624500 -- (-751.651) (-749.460) [-743.770] (-749.372) * [-747.861] (-742.785) (-754.826) (-746.806) -- 0:00:39
625000 -- [-740.817] (-745.920) (-749.261) (-747.009) * (-742.532) (-745.615) (-743.193) [-746.971] -- 0:00:39
Average standard deviation of split frequencies: 0.004895
625500 -- [-748.553] (-748.260) (-752.031) (-747.153) * (-741.978) (-745.310) [-750.138] (-745.386) -- 0:00:38
626000 -- (-749.558) (-746.876) (-750.026) [-747.723] * (-751.920) (-750.343) [-741.474] (-746.746) -- 0:00:38
626500 -- (-746.100) (-741.787) [-746.447] (-744.371) * (-745.904) (-750.970) [-743.712] (-744.568) -- 0:00:38
627000 -- (-749.558) (-746.487) [-748.743] (-747.924) * [-748.311] (-743.797) (-747.784) (-750.383) -- 0:00:38
627500 -- (-745.831) (-744.312) [-748.285] (-749.171) * (-745.391) (-744.668) (-741.704) [-744.363] -- 0:00:38
628000 -- (-743.969) (-749.596) [-747.118] (-751.459) * (-746.597) (-748.867) [-742.725] (-746.224) -- 0:00:38
628500 -- [-753.010] (-743.214) (-743.308) (-743.586) * [-743.475] (-747.943) (-741.421) (-753.051) -- 0:00:38
629000 -- (-748.946) (-745.034) [-743.072] (-751.916) * (-746.389) (-740.714) [-741.348] (-746.834) -- 0:00:38
629500 -- (-746.797) (-750.800) (-752.803) [-741.985] * (-742.151) (-748.578) [-741.092] (-747.977) -- 0:00:38
630000 -- (-739.592) (-746.005) [-749.198] (-746.372) * [-743.020] (-745.203) (-745.766) (-742.597) -- 0:00:38
Average standard deviation of split frequencies: 0.005606
630500 -- [-742.350] (-747.311) (-744.174) (-748.072) * (-749.279) (-741.852) (-748.096) [-743.925] -- 0:00:38
631000 -- (-748.459) [-749.937] (-745.109) (-744.912) * (-746.994) (-750.161) [-741.489] (-743.664) -- 0:00:38
631500 -- (-745.734) [-744.643] (-747.863) (-745.135) * (-747.580) [-743.999] (-743.819) (-744.195) -- 0:00:37
632000 -- (-742.774) [-739.398] (-754.520) (-745.422) * (-743.125) (-750.326) (-746.888) [-745.167] -- 0:00:37
632500 -- (-752.042) (-742.152) (-747.525) [-748.866] * (-740.435) (-744.222) [-742.606] (-745.673) -- 0:00:37
633000 -- (-742.170) (-743.761) (-746.526) [-742.173] * (-742.622) (-744.917) [-747.396] (-743.607) -- 0:00:37
633500 -- [-743.727] (-743.366) (-746.640) (-746.215) * [-739.660] (-745.054) (-743.150) (-745.330) -- 0:00:37
634000 -- (-746.903) (-751.578) [-744.673] (-751.393) * [-744.155] (-742.756) (-743.609) (-750.383) -- 0:00:37
634500 -- (-753.192) (-743.794) (-747.447) [-744.648] * (-750.265) (-742.333) (-744.890) [-742.787] -- 0:00:38
635000 -- [-743.249] (-744.671) (-745.089) (-743.355) * (-742.710) (-752.619) [-744.596] (-742.856) -- 0:00:37
Average standard deviation of split frequencies: 0.005930
635500 -- (-744.172) (-747.423) [-746.467] (-739.761) * (-743.043) (-743.421) [-744.948] (-743.180) -- 0:00:37
636000 -- (-743.874) (-748.662) (-742.819) [-752.531] * (-743.521) [-744.228] (-744.841) (-748.110) -- 0:00:37
636500 -- (-743.179) [-744.658] (-749.671) (-742.889) * (-746.261) (-744.658) (-748.113) [-744.206] -- 0:00:37
637000 -- (-744.535) (-748.741) [-743.132] (-747.851) * [-749.288] (-755.084) (-748.257) (-743.827) -- 0:00:37
637500 -- (-743.984) (-746.144) [-746.591] (-751.604) * (-741.059) (-745.287) (-747.915) [-745.399] -- 0:00:37
638000 -- (-745.229) [-749.880] (-743.531) (-753.892) * (-743.900) (-744.795) (-758.035) [-744.626] -- 0:00:37
638500 -- [-741.398] (-748.065) (-742.708) (-745.625) * [-743.246] (-746.935) (-757.567) (-748.275) -- 0:00:37
639000 -- (-742.794) (-750.819) [-743.465] (-742.334) * (-754.453) (-741.853) [-751.747] (-749.669) -- 0:00:37
639500 -- [-740.853] (-750.435) (-746.219) (-743.959) * [-743.337] (-741.350) (-747.333) (-760.960) -- 0:00:37
640000 -- (-750.294) [-749.563] (-748.747) (-742.996) * (-745.661) (-746.132) (-750.048) [-742.494] -- 0:00:37
Average standard deviation of split frequencies: 0.005519
640500 -- (-749.799) (-743.234) (-742.996) [-742.197] * [-742.509] (-742.317) (-753.611) (-746.512) -- 0:00:37
641000 -- [-742.404] (-747.743) (-747.778) (-751.025) * (-745.755) (-743.459) (-748.102) [-745.438] -- 0:00:36
641500 -- (-754.572) [-747.289] (-744.841) (-752.936) * (-744.569) [-740.483] (-749.425) (-750.388) -- 0:00:36
642000 -- (-755.506) (-742.590) [-744.418] (-742.467) * (-743.836) [-746.609] (-749.589) (-747.636) -- 0:00:36
642500 -- (-754.230) (-744.162) (-744.552) [-750.194] * (-746.129) (-745.610) (-741.602) [-743.753] -- 0:00:36
643000 -- (-746.184) (-745.109) (-744.889) [-749.385] * (-744.939) (-742.174) (-740.862) [-743.301] -- 0:00:36
643500 -- (-744.215) (-746.163) [-743.082] (-740.425) * [-748.065] (-745.367) (-748.424) (-742.058) -- 0:00:36
644000 -- (-748.583) (-747.986) [-743.428] (-745.799) * (-746.245) (-744.640) [-742.455] (-745.761) -- 0:00:37
644500 -- (-749.987) (-747.597) (-744.232) [-741.880] * (-745.516) (-745.847) [-740.756] (-744.431) -- 0:00:36
645000 -- (-747.464) [-745.814] (-743.543) (-746.664) * (-751.113) [-746.283] (-749.074) (-746.324) -- 0:00:36
Average standard deviation of split frequencies: 0.005838
645500 -- (-751.415) (-746.710) (-741.325) [-739.225] * (-745.028) (-744.247) [-742.926] (-749.460) -- 0:00:36
646000 -- [-745.319] (-750.366) (-749.189) (-746.903) * (-747.944) [-743.019] (-745.324) (-746.831) -- 0:00:36
646500 -- (-745.010) (-748.024) (-744.561) [-746.870] * (-748.545) [-747.913] (-744.654) (-745.070) -- 0:00:36
647000 -- (-742.395) (-755.914) [-749.340] (-750.111) * (-743.919) (-743.401) [-747.931] (-754.891) -- 0:00:36
647500 -- (-744.290) (-752.936) (-744.808) [-745.354] * (-745.665) (-748.577) [-746.750] (-749.385) -- 0:00:36
648000 -- [-746.168] (-758.376) (-744.720) (-747.178) * (-745.901) [-744.160] (-745.960) (-748.898) -- 0:00:36
648500 -- (-743.644) (-751.795) [-742.235] (-746.988) * (-743.391) (-744.889) (-748.400) [-744.527] -- 0:00:36
649000 -- (-749.955) (-755.045) [-739.893] (-743.185) * (-745.805) [-747.682] (-745.002) (-740.795) -- 0:00:36
649500 -- [-745.643] (-749.334) (-740.076) (-746.980) * [-742.511] (-744.977) (-742.924) (-745.387) -- 0:00:36
650000 -- (-746.046) (-753.349) [-742.822] (-746.171) * (-744.809) (-746.154) [-745.704] (-747.057) -- 0:00:36
Average standard deviation of split frequencies: 0.005434
650500 -- (-749.093) [-744.194] (-749.229) (-753.578) * (-745.710) (-744.185) [-746.869] (-746.354) -- 0:00:35
651000 -- (-754.904) [-743.343] (-747.839) (-743.244) * [-742.859] (-748.620) (-749.327) (-745.557) -- 0:00:35
651500 -- (-756.755) (-742.442) (-746.536) [-748.985] * (-750.079) (-746.429) (-749.975) [-746.609] -- 0:00:35
652000 -- (-743.738) (-740.279) [-741.488] (-753.461) * (-752.320) (-742.256) (-746.928) [-740.690] -- 0:00:35
652500 -- (-750.974) (-746.196) (-741.702) [-745.570] * (-751.894) (-745.396) (-746.656) [-742.165] -- 0:00:35
653000 -- (-747.155) (-742.138) [-743.390] (-745.286) * (-747.638) (-746.173) (-746.189) [-741.154] -- 0:00:35
653500 -- [-745.203] (-746.035) (-750.953) (-748.621) * (-748.211) (-748.026) (-743.772) [-749.219] -- 0:00:35
654000 -- (-748.756) (-746.428) (-748.670) [-747.300] * (-743.047) (-744.000) [-742.971] (-744.201) -- 0:00:35
654500 -- (-754.747) (-749.609) (-756.008) [-740.661] * [-751.349] (-749.137) (-747.299) (-742.389) -- 0:00:35
655000 -- (-741.960) (-749.700) (-751.090) [-748.101] * (-742.574) (-747.771) [-740.188] (-754.465) -- 0:00:35
Average standard deviation of split frequencies: 0.005030
655500 -- [-746.680] (-747.813) (-754.165) (-743.125) * [-747.686] (-752.180) (-744.269) (-753.989) -- 0:00:35
656000 -- (-743.679) (-747.372) [-747.916] (-744.373) * [-747.321] (-749.598) (-750.294) (-743.831) -- 0:00:35
656500 -- (-745.868) (-744.228) (-747.830) [-743.082] * (-750.820) (-748.603) (-750.569) [-746.415] -- 0:00:35
657000 -- (-752.696) [-744.244] (-747.324) (-744.881) * [-744.611] (-753.694) (-747.426) (-745.658) -- 0:00:35
657500 -- (-749.678) (-744.388) (-749.201) [-745.080] * [-739.386] (-761.675) (-746.781) (-747.882) -- 0:00:35
658000 -- (-745.315) (-749.093) [-746.247] (-742.963) * [-740.079] (-752.545) (-745.437) (-747.200) -- 0:00:35
658500 -- [-746.813] (-744.919) (-747.467) (-745.792) * (-741.672) (-747.850) (-746.187) [-751.002] -- 0:00:35
659000 -- (-742.465) (-750.870) (-743.023) [-745.748] * [-746.530] (-747.843) (-742.868) (-744.159) -- 0:00:35
659500 -- (-749.742) [-743.916] (-747.337) (-746.625) * [-745.404] (-749.194) (-750.428) (-743.897) -- 0:00:35
660000 -- (-739.921) (-741.330) [-744.906] (-748.562) * (-749.189) (-744.311) [-747.543] (-746.513) -- 0:00:35
Average standard deviation of split frequencies: 0.005351
660500 -- (-744.460) [-743.368] (-744.102) (-743.872) * (-742.982) [-743.518] (-745.316) (-744.810) -- 0:00:34
661000 -- (-743.231) (-748.879) [-744.289] (-741.100) * (-752.483) (-748.156) [-744.176] (-750.543) -- 0:00:34
661500 -- [-742.248] (-746.250) (-748.725) (-742.332) * (-750.262) [-742.085] (-752.549) (-745.349) -- 0:00:34
662000 -- [-746.782] (-747.521) (-746.993) (-744.179) * [-740.788] (-740.760) (-751.137) (-749.883) -- 0:00:34
662500 -- (-743.926) (-746.494) (-747.679) [-740.976] * (-744.636) [-744.985] (-749.823) (-746.156) -- 0:00:34
663000 -- (-748.475) (-743.632) [-742.361] (-746.577) * [-742.704] (-745.322) (-743.752) (-747.084) -- 0:00:34
663500 -- [-743.431] (-749.368) (-743.326) (-744.671) * [-747.127] (-750.838) (-743.684) (-749.417) -- 0:00:34
664000 -- (-746.577) (-747.894) [-746.123] (-753.215) * (-748.815) (-749.827) (-748.217) [-740.562] -- 0:00:34
664500 -- (-745.669) (-753.162) (-743.103) [-743.892] * (-742.653) [-751.815] (-749.607) (-745.299) -- 0:00:34
665000 -- [-746.089] (-742.175) (-742.008) (-747.158) * [-745.826] (-748.422) (-748.346) (-747.398) -- 0:00:34
Average standard deviation of split frequencies: 0.005309
665500 -- (-742.046) (-748.066) [-745.029] (-743.425) * [-743.888] (-743.820) (-743.341) (-750.377) -- 0:00:34
666000 -- (-746.614) [-745.514] (-746.626) (-748.101) * (-744.675) (-745.878) (-750.116) [-747.875] -- 0:00:34
666500 -- [-743.266] (-749.074) (-748.272) (-753.833) * [-743.617] (-746.600) (-750.007) (-743.824) -- 0:00:34
667000 -- (-745.322) (-744.650) (-745.218) [-744.055] * [-743.868] (-753.544) (-748.182) (-754.049) -- 0:00:34
667500 -- (-743.432) [-747.526] (-744.952) (-748.985) * (-747.297) [-746.714] (-746.206) (-756.631) -- 0:00:34
668000 -- (-742.071) (-747.072) [-744.276] (-749.719) * [-743.927] (-744.483) (-752.335) (-744.914) -- 0:00:34
668500 -- (-749.973) (-745.537) [-745.088] (-749.747) * (-743.988) (-747.265) [-743.469] (-745.121) -- 0:00:34
669000 -- (-743.083) (-743.551) (-743.886) [-745.434] * [-746.796] (-749.161) (-740.380) (-747.805) -- 0:00:34
669500 -- (-751.847) [-743.160] (-747.581) (-750.212) * (-744.531) [-741.185] (-745.407) (-749.031) -- 0:00:34
670000 -- (-750.429) [-742.230] (-745.161) (-758.219) * (-741.473) (-745.166) (-752.454) [-748.007] -- 0:00:33
Average standard deviation of split frequencies: 0.005623
670500 -- (-752.094) (-748.777) [-745.837] (-747.453) * (-742.875) [-747.884] (-760.301) (-752.600) -- 0:00:33
671000 -- (-744.852) (-751.932) (-746.994) [-746.399] * (-743.621) (-744.798) [-746.870] (-749.981) -- 0:00:33
671500 -- (-748.610) (-750.526) (-752.292) [-747.424] * [-746.680] (-744.827) (-746.836) (-758.094) -- 0:00:33
672000 -- [-749.006] (-748.303) (-746.674) (-740.401) * (-744.836) [-741.907] (-750.386) (-744.196) -- 0:00:33
672500 -- (-748.150) (-745.324) [-745.348] (-745.107) * [-746.229] (-746.978) (-750.548) (-746.478) -- 0:00:33
673000 -- (-745.387) (-744.423) (-743.422) [-746.942] * [-745.660] (-743.550) (-747.512) (-749.973) -- 0:00:33
673500 -- [-747.573] (-743.939) (-742.711) (-747.389) * (-751.101) [-747.471] (-751.855) (-748.355) -- 0:00:33
674000 -- (-747.062) (-743.184) [-744.698] (-744.646) * (-745.914) (-743.874) [-745.173] (-749.177) -- 0:00:33
674500 -- (-745.190) (-744.505) (-744.993) [-742.556] * (-746.890) (-742.807) [-746.165] (-753.235) -- 0:00:33
675000 -- (-746.564) [-741.110] (-743.330) (-739.955) * [-741.965] (-746.871) (-755.455) (-747.294) -- 0:00:33
Average standard deviation of split frequencies: 0.007903
675500 -- (-751.700) (-742.273) (-745.872) [-740.681] * [-744.290] (-747.174) (-751.746) (-751.922) -- 0:00:33
676000 -- (-745.190) (-741.592) (-742.078) [-743.112] * (-747.485) (-744.923) (-746.942) [-744.909] -- 0:00:33
676500 -- (-747.845) (-742.738) (-747.223) [-745.888] * [-744.493] (-750.416) (-750.034) (-749.957) -- 0:00:33
677000 -- (-744.400) (-740.406) [-743.013] (-745.764) * (-749.027) [-742.607] (-750.800) (-746.910) -- 0:00:33
677500 -- (-749.277) (-743.940) [-748.088] (-743.830) * (-749.259) (-744.666) (-744.594) [-751.439] -- 0:00:33
678000 -- [-746.776] (-741.979) (-747.404) (-748.466) * (-744.363) (-749.739) (-748.565) [-746.931] -- 0:00:33
678500 -- (-748.656) (-744.514) [-746.568] (-756.861) * (-740.411) (-744.397) (-745.031) [-745.093] -- 0:00:33
679000 -- (-750.143) [-741.087] (-746.673) (-743.182) * [-745.796] (-749.667) (-748.811) (-747.239) -- 0:00:33
679500 -- (-750.186) [-741.538] (-742.116) (-744.399) * (-747.663) [-745.363] (-748.549) (-747.492) -- 0:00:33
680000 -- [-746.552] (-745.832) (-750.316) (-744.050) * [-746.950] (-748.890) (-744.155) (-742.550) -- 0:00:32
Average standard deviation of split frequencies: 0.005194
680500 -- (-751.537) (-743.057) (-751.879) [-744.598] * (-745.241) (-747.636) (-746.633) [-747.776] -- 0:00:32
681000 -- (-745.122) (-752.838) [-748.126] (-743.923) * [-742.966] (-749.712) (-743.970) (-744.748) -- 0:00:32
681500 -- (-743.690) (-749.106) [-744.135] (-743.786) * (-742.472) [-745.127] (-747.586) (-745.202) -- 0:00:32
682000 -- (-745.833) (-746.917) [-742.902] (-745.867) * (-745.844) (-750.800) [-746.693] (-743.628) -- 0:00:32
682500 -- (-745.260) (-742.568) (-747.674) [-746.459] * (-746.981) (-745.420) (-742.571) [-745.448] -- 0:00:32
683000 -- [-747.433] (-751.582) (-745.018) (-749.970) * [-743.346] (-743.579) (-739.374) (-749.092) -- 0:00:32
683500 -- (-743.914) (-745.104) (-750.639) [-744.437] * [-745.158] (-747.669) (-741.039) (-746.721) -- 0:00:32
684000 -- [-744.667] (-744.119) (-755.502) (-751.219) * (-746.584) (-745.123) (-748.993) [-748.038] -- 0:00:32
684500 -- [-742.179] (-744.835) (-749.748) (-745.778) * [-741.880] (-743.243) (-747.879) (-743.025) -- 0:00:32
685000 -- (-745.031) (-749.717) [-744.872] (-748.386) * (-745.431) (-743.753) [-745.799] (-747.676) -- 0:00:32
Average standard deviation of split frequencies: 0.005154
685500 -- (-752.613) [-745.909] (-742.575) (-744.536) * [-747.672] (-741.222) (-747.128) (-744.683) -- 0:00:32
686000 -- [-744.142] (-741.362) (-745.306) (-745.174) * (-743.882) (-742.701) (-740.383) [-747.366] -- 0:00:32
686500 -- (-742.963) [-747.408] (-745.127) (-749.728) * (-745.140) (-746.519) (-744.351) [-753.289] -- 0:00:32
687000 -- (-749.570) [-742.654] (-747.270) (-744.923) * (-752.764) [-743.349] (-741.790) (-750.072) -- 0:00:32
687500 -- (-750.749) (-741.818) (-745.150) [-753.497] * (-748.653) [-744.674] (-748.438) (-749.084) -- 0:00:32
688000 -- (-740.808) (-744.815) (-747.194) [-748.830] * (-752.219) [-746.669] (-750.034) (-742.989) -- 0:00:32
688500 -- (-743.164) (-744.217) [-742.686] (-746.972) * (-755.304) (-751.185) [-748.806] (-745.738) -- 0:00:32
689000 -- [-744.969] (-746.354) (-745.044) (-750.873) * (-747.747) (-744.878) [-741.554] (-748.342) -- 0:00:32
689500 -- [-743.040] (-749.653) (-751.826) (-747.903) * (-756.082) [-738.967] (-746.013) (-744.104) -- 0:00:31
690000 -- (-747.768) (-751.486) (-744.064) [-744.307] * (-748.928) (-744.065) (-747.280) [-746.661] -- 0:00:31
Average standard deviation of split frequencies: 0.004778
690500 -- [-742.304] (-744.250) (-740.353) (-746.758) * [-748.255] (-745.176) (-745.762) (-745.438) -- 0:00:31
691000 -- (-744.112) [-746.848] (-748.104) (-740.957) * (-748.448) [-742.778] (-748.035) (-745.805) -- 0:00:31
691500 -- [-745.003] (-742.427) (-744.174) (-749.067) * (-743.239) [-742.225] (-746.472) (-748.724) -- 0:00:31
692000 -- (-740.558) [-748.538] (-746.905) (-746.461) * (-751.009) (-740.681) [-749.558] (-745.300) -- 0:00:31
692500 -- [-747.240] (-748.324) (-742.112) (-745.704) * (-746.336) [-742.786] (-747.662) (-741.251) -- 0:00:31
693000 -- (-751.369) [-742.216] (-748.378) (-747.192) * (-747.446) (-740.996) (-751.139) [-743.630] -- 0:00:31
693500 -- (-741.902) (-751.004) [-749.519] (-747.655) * (-743.257) [-749.879] (-746.454) (-744.165) -- 0:00:31
694000 -- (-745.735) (-754.253) (-749.347) [-745.034] * [-749.935] (-746.052) (-747.063) (-749.081) -- 0:00:31
694500 -- (-743.137) (-746.356) (-750.291) [-742.918] * (-746.189) [-742.663] (-742.653) (-745.093) -- 0:00:31
695000 -- (-745.921) [-746.651] (-750.157) (-745.721) * (-750.498) (-748.636) (-744.117) [-745.633] -- 0:00:31
Average standard deviation of split frequencies: 0.004741
695500 -- [-747.004] (-752.222) (-748.097) (-742.061) * (-745.812) (-747.039) [-744.218] (-746.933) -- 0:00:31
696000 -- [-744.504] (-744.825) (-746.254) (-745.492) * (-744.552) (-749.111) (-752.077) [-740.716] -- 0:00:31
696500 -- (-745.091) (-747.918) [-746.090] (-748.406) * (-750.684) (-749.487) [-739.774] (-743.559) -- 0:00:31
697000 -- (-741.899) (-753.206) [-747.585] (-745.959) * [-741.804] (-742.294) (-745.188) (-750.746) -- 0:00:31
697500 -- (-743.881) (-741.449) [-745.435] (-747.777) * [-742.474] (-742.238) (-749.378) (-742.604) -- 0:00:31
698000 -- (-738.822) (-746.028) [-749.784] (-741.442) * (-739.530) (-743.017) (-747.687) [-742.795] -- 0:00:31
698500 -- (-745.517) [-744.806] (-747.282) (-747.387) * [-744.869] (-752.859) (-746.248) (-743.391) -- 0:00:31
699000 -- (-747.022) [-744.529] (-751.249) (-746.668) * (-749.462) [-751.722] (-749.766) (-746.607) -- 0:00:31
699500 -- (-752.572) (-743.952) (-745.892) [-747.810] * (-745.261) (-745.091) (-747.009) [-747.993] -- 0:00:30
700000 -- [-750.443] (-741.910) (-746.790) (-744.944) * [-751.562] (-745.793) (-750.347) (-750.211) -- 0:00:30
Average standard deviation of split frequencies: 0.006728
700500 -- (-748.027) (-750.023) (-743.652) [-744.053] * [-746.192] (-745.101) (-749.961) (-747.360) -- 0:00:30
701000 -- [-747.352] (-748.972) (-749.921) (-746.760) * (-749.684) (-744.214) (-741.758) [-750.699] -- 0:00:30
701500 -- (-744.919) [-752.283] (-741.337) (-750.906) * (-744.781) (-744.773) [-747.826] (-755.190) -- 0:00:30
702000 -- [-746.012] (-749.066) (-747.546) (-745.993) * [-742.481] (-743.963) (-743.003) (-742.178) -- 0:00:30
702500 -- (-745.923) [-744.755] (-749.440) (-744.506) * [-741.615] (-744.731) (-748.947) (-748.333) -- 0:00:30
703000 -- (-743.639) [-741.947] (-747.360) (-748.901) * (-742.366) [-743.906] (-746.347) (-747.125) -- 0:00:30
703500 -- (-741.447) (-747.009) [-746.382] (-753.308) * [-746.024] (-742.639) (-742.751) (-755.365) -- 0:00:30
704000 -- [-742.667] (-743.374) (-749.084) (-743.818) * [-747.179] (-748.549) (-749.408) (-746.436) -- 0:00:30
704500 -- (-746.190) (-742.679) (-754.347) [-743.168] * (-745.725) [-748.759] (-746.655) (-745.029) -- 0:00:30
705000 -- (-747.556) [-740.103] (-747.919) (-741.704) * (-746.641) (-749.006) (-741.206) [-750.267] -- 0:00:30
Average standard deviation of split frequencies: 0.006232
705500 -- (-745.715) [-744.529] (-754.524) (-744.744) * [-742.095] (-748.359) (-747.395) (-743.404) -- 0:00:30
706000 -- (-749.156) (-745.882) (-751.839) [-744.324] * (-743.478) (-748.555) [-744.629] (-743.377) -- 0:00:30
706500 -- (-745.785) (-741.308) (-745.753) [-739.253] * (-741.572) (-746.702) (-743.110) [-742.331] -- 0:00:30
707000 -- (-750.578) (-743.474) (-746.054) [-741.344] * (-746.411) [-747.308] (-744.627) (-748.167) -- 0:00:30
707500 -- (-743.193) (-748.464) (-749.643) [-741.907] * (-744.136) (-741.532) (-748.099) [-746.570] -- 0:00:30
708000 -- [-748.198] (-745.392) (-750.670) (-743.656) * [-745.673] (-746.365) (-745.458) (-746.391) -- 0:00:30
708500 -- [-747.602] (-742.552) (-748.758) (-745.922) * (-745.668) [-742.198] (-742.602) (-744.334) -- 0:00:30
709000 -- (-745.060) (-744.972) (-745.927) [-747.882] * (-741.831) (-745.152) [-746.978] (-748.475) -- 0:00:29
709500 -- (-742.775) (-743.637) (-746.925) [-745.726] * (-743.974) (-740.670) (-749.020) [-748.791] -- 0:00:29
710000 -- (-745.505) (-747.902) [-750.095] (-744.293) * [-747.615] (-745.330) (-746.732) (-749.048) -- 0:00:29
Average standard deviation of split frequencies: 0.006191
710500 -- (-740.936) (-757.082) [-744.574] (-747.216) * (-742.699) (-743.369) [-741.760] (-749.583) -- 0:00:29
711000 -- [-744.528] (-751.589) (-742.787) (-742.773) * (-746.418) [-744.873] (-747.208) (-748.792) -- 0:00:29
711500 -- (-747.320) (-748.011) [-749.861] (-742.360) * (-752.793) (-743.490) [-744.059] (-749.668) -- 0:00:29
712000 -- (-747.656) (-752.616) (-748.185) [-740.978] * [-747.417] (-744.003) (-744.406) (-745.115) -- 0:00:29
712500 -- (-744.611) (-748.078) [-741.072] (-748.306) * [-743.196] (-750.232) (-747.504) (-746.545) -- 0:00:29
713000 -- (-744.348) [-745.110] (-743.866) (-748.509) * (-740.360) (-746.143) [-745.763] (-744.107) -- 0:00:29
713500 -- (-742.938) (-743.664) [-739.603] (-749.783) * (-750.323) [-743.076] (-748.334) (-746.086) -- 0:00:29
714000 -- (-749.506) (-744.996) [-745.259] (-755.530) * [-742.218] (-754.727) (-748.915) (-745.922) -- 0:00:29
714500 -- (-752.176) (-748.247) [-747.525] (-750.201) * [-741.783] (-748.687) (-749.635) (-741.421) -- 0:00:29
715000 -- [-749.840] (-746.606) (-748.865) (-750.652) * (-740.451) [-745.976] (-744.368) (-741.594) -- 0:00:29
Average standard deviation of split frequencies: 0.004609
715500 -- [-744.323] (-746.005) (-741.392) (-753.957) * (-743.718) (-754.936) (-742.896) [-745.922] -- 0:00:29
716000 -- (-744.496) [-745.745] (-748.264) (-749.302) * (-745.831) (-749.097) (-744.851) [-743.582] -- 0:00:29
716500 -- (-749.813) (-741.156) [-744.074] (-756.109) * (-743.444) (-750.608) [-744.605] (-743.493) -- 0:00:29
717000 -- [-747.013] (-743.914) (-745.026) (-755.183) * (-745.407) (-745.727) (-743.081) [-750.417] -- 0:00:29
717500 -- (-748.268) [-742.653] (-742.158) (-746.546) * (-746.277) [-745.917] (-754.391) (-742.820) -- 0:00:29
718000 -- [-746.198] (-745.841) (-744.553) (-747.624) * [-758.319] (-746.302) (-751.802) (-750.599) -- 0:00:29
718500 -- (-743.254) (-743.744) [-740.758] (-751.405) * (-742.749) (-746.138) [-744.792] (-747.127) -- 0:00:28
719000 -- (-745.808) (-745.221) [-744.300] (-743.166) * (-745.046) (-752.373) [-744.615] (-749.749) -- 0:00:28
719500 -- (-747.829) (-745.926) [-747.044] (-743.737) * (-742.867) (-747.261) [-748.254] (-747.968) -- 0:00:28
720000 -- [-751.953] (-744.333) (-747.964) (-748.760) * [-741.296] (-743.788) (-747.617) (-746.842) -- 0:00:28
Average standard deviation of split frequencies: 0.004252
720500 -- (-742.700) (-747.769) (-748.002) [-744.983] * (-753.285) (-741.079) [-746.603] (-741.413) -- 0:00:28
721000 -- [-744.113] (-748.761) (-744.046) (-746.884) * (-744.918) (-746.577) (-744.711) [-747.588] -- 0:00:28
721500 -- (-748.370) (-746.140) [-743.538] (-755.861) * (-747.916) (-747.821) (-753.756) [-743.338] -- 0:00:28
722000 -- [-746.775] (-749.346) (-746.717) (-744.925) * (-745.023) (-747.111) (-747.833) [-744.103] -- 0:00:28
722500 -- (-746.997) [-742.134] (-747.388) (-748.501) * (-744.678) (-744.503) [-749.205] (-744.519) -- 0:00:28
723000 -- (-746.622) (-744.845) (-750.361) [-750.523] * (-751.353) (-743.183) (-747.925) [-743.135] -- 0:00:28
723500 -- (-742.301) (-746.233) [-744.017] (-746.856) * (-754.734) [-743.327] (-744.082) (-741.012) -- 0:00:28
724000 -- (-747.469) (-743.953) [-747.136] (-743.555) * (-750.090) (-746.348) (-744.174) [-741.271] -- 0:00:28
724500 -- (-745.783) [-742.185] (-752.118) (-751.230) * (-760.394) [-743.730] (-750.255) (-746.662) -- 0:00:28
725000 -- (-745.711) [-739.670] (-743.982) (-744.564) * (-754.916) (-748.188) [-745.447] (-742.061) -- 0:00:28
Average standard deviation of split frequencies: 0.003896
725500 -- (-747.058) (-749.508) (-748.920) [-748.283] * (-756.656) (-744.388) (-747.563) [-743.415] -- 0:00:28
726000 -- (-745.921) (-741.803) (-741.459) [-743.602] * (-750.416) (-743.558) (-750.786) [-741.089] -- 0:00:28
726500 -- (-743.452) (-745.772) [-743.702] (-745.771) * [-743.430] (-741.986) (-744.118) (-745.266) -- 0:00:28
727000 -- [-746.638] (-745.460) (-745.724) (-741.096) * (-748.789) [-743.234] (-752.440) (-745.151) -- 0:00:28
727500 -- [-744.943] (-741.449) (-751.334) (-742.361) * (-748.496) [-750.386] (-751.095) (-742.895) -- 0:00:28
728000 -- [-743.037] (-742.449) (-749.171) (-742.817) * [-741.678] (-744.374) (-748.114) (-745.121) -- 0:00:28
728500 -- [-742.124] (-744.464) (-747.843) (-746.740) * [-740.855] (-742.333) (-744.121) (-743.638) -- 0:00:27
729000 -- (-744.688) (-743.778) (-748.107) [-746.583] * [-741.173] (-748.338) (-744.635) (-741.844) -- 0:00:27
729500 -- (-758.026) (-741.948) [-749.268] (-748.091) * (-746.937) [-745.911] (-751.985) (-755.898) -- 0:00:27
730000 -- (-749.741) (-742.953) (-742.741) [-750.484] * [-747.221] (-751.119) (-742.874) (-750.614) -- 0:00:27
Average standard deviation of split frequencies: 0.003871
730500 -- (-750.439) (-746.478) [-744.422] (-740.607) * [-743.957] (-748.246) (-741.931) (-745.761) -- 0:00:27
731000 -- (-748.754) [-742.746] (-747.097) (-743.434) * (-743.380) (-744.482) (-742.910) [-746.140] -- 0:00:27
731500 -- (-743.171) (-745.925) (-743.119) [-743.664] * (-747.761) [-739.927] (-748.591) (-745.998) -- 0:00:27
732000 -- (-747.666) (-746.724) (-747.910) [-750.182] * (-747.910) [-745.970] (-744.878) (-754.597) -- 0:00:27
732500 -- (-745.529) [-749.245] (-748.564) (-744.232) * [-747.136] (-744.858) (-747.378) (-741.757) -- 0:00:27
733000 -- [-745.028] (-748.971) (-751.164) (-744.792) * (-747.657) (-746.338) [-745.930] (-746.295) -- 0:00:27
733500 -- (-747.492) (-751.761) (-753.287) [-744.903] * (-749.222) (-744.578) [-746.123] (-748.807) -- 0:00:27
734000 -- (-744.136) (-761.894) (-749.179) [-745.071] * [-748.652] (-742.724) (-745.057) (-742.685) -- 0:00:27
734500 -- [-739.499] (-753.954) (-744.430) (-746.245) * (-748.953) [-744.996] (-749.132) (-750.985) -- 0:00:27
735000 -- (-743.965) (-745.594) [-748.651] (-760.057) * (-739.952) (-748.334) (-747.856) [-746.224] -- 0:00:27
Average standard deviation of split frequencies: 0.004163
735500 -- (-743.245) [-746.399] (-748.602) (-746.126) * (-756.238) [-747.004] (-750.378) (-742.376) -- 0:00:27
736000 -- [-741.578] (-747.056) (-748.687) (-746.702) * (-742.654) (-744.137) [-750.795] (-747.246) -- 0:00:27
736500 -- [-743.383] (-748.028) (-746.384) (-744.778) * (-746.332) [-749.794] (-743.255) (-751.800) -- 0:00:27
737000 -- (-748.426) (-745.837) (-755.942) [-742.030] * [-743.072] (-752.537) (-751.637) (-746.684) -- 0:00:27
737500 -- (-742.868) (-743.663) (-748.428) [-740.901] * (-739.954) (-750.635) (-752.822) [-744.112] -- 0:00:27
738000 -- (-742.452) [-747.008] (-743.467) (-747.975) * [-740.946] (-747.791) (-745.466) (-746.730) -- 0:00:26
738500 -- (-740.922) [-741.059] (-749.753) (-746.125) * (-747.533) (-750.157) (-747.487) [-742.097] -- 0:00:26
739000 -- (-743.269) (-750.937) [-744.476] (-750.554) * (-744.120) (-756.292) (-746.421) [-750.102] -- 0:00:26
739500 -- (-743.989) [-747.262] (-743.261) (-754.882) * (-742.555) (-745.850) (-745.836) [-750.284] -- 0:00:26
740000 -- (-744.225) [-742.938] (-744.361) (-744.976) * (-744.767) (-742.363) (-743.449) [-744.867] -- 0:00:26
Average standard deviation of split frequencies: 0.003819
740500 -- (-742.388) [-743.095] (-750.339) (-742.778) * [-744.677] (-743.673) (-745.188) (-752.053) -- 0:00:26
741000 -- [-743.396] (-747.359) (-749.962) (-741.738) * [-743.252] (-750.802) (-749.955) (-743.427) -- 0:00:26
741500 -- [-751.387] (-742.584) (-748.171) (-745.977) * [-745.423] (-752.830) (-742.138) (-745.113) -- 0:00:26
742000 -- [-747.301] (-751.630) (-746.156) (-744.368) * (-751.664) (-753.862) [-742.546] (-744.951) -- 0:00:26
742500 -- [-747.931] (-748.541) (-744.539) (-749.640) * (-745.740) (-747.449) [-741.834] (-749.514) -- 0:00:26
743000 -- (-746.544) (-747.181) [-742.454] (-749.081) * [-742.622] (-747.097) (-744.649) (-744.194) -- 0:00:26
743500 -- (-746.332) (-745.143) (-745.139) [-749.737] * (-744.419) (-749.311) (-746.260) [-742.164] -- 0:00:26
744000 -- (-745.217) (-744.358) [-740.988] (-752.512) * (-740.106) (-750.396) [-747.651] (-744.403) -- 0:00:26
744500 -- [-743.824] (-746.597) (-739.337) (-751.426) * (-742.594) (-744.577) [-742.621] (-742.488) -- 0:00:26
745000 -- (-746.279) [-745.052] (-750.691) (-752.179) * (-749.162) (-746.882) (-743.465) [-743.642] -- 0:00:26
Average standard deviation of split frequencies: 0.003160
745500 -- (-748.378) (-741.980) (-740.638) [-744.057] * (-745.993) [-744.082] (-744.275) (-750.023) -- 0:00:26
746000 -- (-749.379) (-745.080) [-742.260] (-749.140) * (-746.754) [-745.542] (-745.703) (-746.187) -- 0:00:26
746500 -- (-748.023) [-746.998] (-752.125) (-745.765) * [-743.667] (-740.722) (-746.256) (-747.986) -- 0:00:26
747000 -- [-747.642] (-748.241) (-743.972) (-743.686) * (-744.104) (-746.218) [-746.543] (-751.455) -- 0:00:26
747500 -- (-749.551) [-745.136] (-745.206) (-747.420) * [-746.495] (-744.129) (-758.615) (-746.367) -- 0:00:26
748000 -- (-743.600) [-745.179] (-751.052) (-745.078) * (-745.935) (-751.183) (-743.817) [-742.948] -- 0:00:25
748500 -- (-744.269) [-746.047] (-749.070) (-747.029) * (-747.333) (-746.014) [-742.883] (-744.296) -- 0:00:25
749000 -- (-753.016) (-747.648) [-748.512] (-745.953) * (-751.513) (-751.328) (-746.283) [-753.680] -- 0:00:25
749500 -- (-745.091) [-746.545] (-746.139) (-746.385) * (-745.926) (-748.102) [-749.063] (-751.718) -- 0:00:25
750000 -- (-743.919) (-749.865) (-746.372) [-751.259] * (-744.565) [-746.109] (-748.169) (-752.944) -- 0:00:25
Average standard deviation of split frequencies: 0.002198
750500 -- (-744.206) (-750.205) (-751.227) [-745.068] * (-746.827) [-748.530] (-746.700) (-744.083) -- 0:00:25
751000 -- (-743.067) (-750.528) (-745.208) [-742.895] * [-746.886] (-745.693) (-747.653) (-743.911) -- 0:00:25
751500 -- (-747.546) [-745.252] (-740.524) (-741.181) * (-747.884) (-746.070) [-739.468] (-746.317) -- 0:00:25
752000 -- [-747.458] (-748.118) (-749.901) (-742.589) * [-741.991] (-747.000) (-743.581) (-746.181) -- 0:00:25
752500 -- [-741.250] (-742.241) (-745.193) (-753.045) * [-747.744] (-745.384) (-745.357) (-744.193) -- 0:00:25
753000 -- (-743.245) (-747.766) (-747.786) [-744.080] * (-747.642) [-743.699] (-749.289) (-745.449) -- 0:00:25
753500 -- (-750.056) [-743.194] (-742.790) (-749.795) * (-742.647) (-749.639) (-747.194) [-745.355] -- 0:00:25
754000 -- (-749.414) [-740.285] (-746.252) (-743.501) * (-744.071) (-742.229) (-750.300) [-743.834] -- 0:00:25
754500 -- (-739.700) [-745.629] (-743.308) (-749.803) * [-744.938] (-746.757) (-754.647) (-742.449) -- 0:00:25
755000 -- (-741.880) (-752.673) (-744.011) [-747.217] * (-744.621) (-757.897) [-749.228] (-746.160) -- 0:00:25
Average standard deviation of split frequencies: 0.002182
755500 -- [-746.912] (-747.535) (-749.407) (-749.434) * (-745.626) (-744.847) (-751.948) [-746.795] -- 0:00:25
756000 -- (-743.648) (-747.160) [-748.019] (-750.093) * (-749.310) (-745.378) [-743.565] (-748.455) -- 0:00:25
756500 -- (-749.246) (-748.521) [-748.733] (-748.139) * (-749.298) [-750.114] (-749.038) (-743.813) -- 0:00:25
757000 -- (-743.733) (-751.784) [-744.689] (-755.677) * (-743.765) (-754.128) (-742.659) [-740.399] -- 0:00:25
757500 -- [-741.822] (-750.232) (-744.260) (-764.319) * (-749.363) (-751.372) [-740.718] (-744.683) -- 0:00:24
758000 -- (-743.563) (-751.235) [-750.169] (-753.126) * (-751.847) (-748.929) [-743.807] (-744.243) -- 0:00:24
758500 -- (-747.413) (-753.569) (-747.693) [-745.080] * (-748.963) (-746.370) (-747.555) [-743.742] -- 0:00:24
759000 -- (-742.229) (-747.158) (-745.031) [-748.797] * (-745.046) [-745.263] (-744.607) (-748.107) -- 0:00:24
759500 -- (-747.002) (-746.260) [-743.428] (-742.175) * (-747.022) (-744.384) (-748.778) [-743.987] -- 0:00:24
760000 -- [-743.556] (-748.999) (-745.865) (-742.641) * [-745.403] (-744.153) (-753.858) (-742.109) -- 0:00:24
Average standard deviation of split frequencies: 0.001549
760500 -- (-745.774) [-743.699] (-749.331) (-755.581) * [-741.852] (-742.555) (-754.908) (-745.288) -- 0:00:24
761000 -- (-744.932) (-746.715) (-745.755) [-746.459] * (-747.499) (-744.786) [-741.612] (-743.757) -- 0:00:24
761500 -- (-750.171) (-749.174) [-745.861] (-742.801) * (-747.371) (-745.978) [-746.378] (-743.260) -- 0:00:24
762000 -- (-744.882) [-743.057] (-753.465) (-742.432) * [-753.212] (-746.005) (-743.430) (-742.540) -- 0:00:24
762500 -- (-744.839) [-740.839] (-751.932) (-743.471) * (-750.841) (-745.601) [-743.899] (-748.397) -- 0:00:24
763000 -- [-742.978] (-750.664) (-748.648) (-743.046) * (-749.608) (-757.319) (-741.012) [-740.025] -- 0:00:24
763500 -- (-748.498) (-745.601) [-742.649] (-743.204) * (-743.694) (-743.966) [-744.259] (-742.819) -- 0:00:24
764000 -- (-743.262) (-747.809) (-746.641) [-743.591] * (-743.961) (-747.080) (-741.436) [-742.990] -- 0:00:24
764500 -- (-744.968) (-743.816) [-744.997] (-746.486) * [-745.593] (-748.007) (-742.093) (-744.091) -- 0:00:24
765000 -- [-746.200] (-746.679) (-746.855) (-742.159) * (-744.139) [-746.345] (-741.037) (-747.284) -- 0:00:24
Average standard deviation of split frequencies: 0.001846
765500 -- (-745.754) (-743.544) (-756.003) [-747.800] * (-748.158) [-744.873] (-751.206) (-746.405) -- 0:00:24
766000 -- (-748.898) (-751.064) (-750.917) [-745.566] * [-740.772] (-743.838) (-745.985) (-740.891) -- 0:00:24
766500 -- (-752.631) [-748.028] (-750.040) (-741.588) * (-749.709) (-747.754) [-745.877] (-746.400) -- 0:00:24
767000 -- (-749.152) [-745.166] (-750.699) (-744.909) * (-743.923) [-745.275] (-745.885) (-743.359) -- 0:00:23
767500 -- (-743.790) [-745.043] (-750.020) (-745.291) * (-751.913) (-745.919) [-744.132] (-754.309) -- 0:00:23
768000 -- (-747.598) [-742.414] (-742.212) (-744.783) * (-751.944) [-745.458] (-745.051) (-746.714) -- 0:00:23
768500 -- (-748.539) (-745.069) (-746.613) [-741.093] * (-749.870) (-742.652) [-746.289] (-744.258) -- 0:00:23
769000 -- [-745.499] (-751.973) (-750.648) (-747.046) * [-754.986] (-747.166) (-745.152) (-743.741) -- 0:00:23
769500 -- [-747.874] (-745.995) (-748.126) (-747.987) * (-746.523) (-750.013) (-746.532) [-742.917] -- 0:00:23
770000 -- (-747.139) (-746.171) (-748.250) [-747.021] * (-745.168) (-746.908) [-743.039] (-749.081) -- 0:00:23
Average standard deviation of split frequencies: 0.001529
770500 -- (-747.255) [-745.119] (-745.862) (-748.285) * [-741.247] (-752.389) (-745.557) (-745.472) -- 0:00:23
771000 -- (-750.434) [-750.784] (-745.283) (-748.829) * (-745.162) (-748.099) (-751.038) [-742.308] -- 0:00:23
771500 -- (-744.722) [-752.336] (-740.429) (-751.038) * (-748.001) (-750.475) [-743.018] (-743.608) -- 0:00:23
772000 -- [-750.927] (-750.740) (-749.529) (-748.607) * (-747.621) (-753.491) (-743.687) [-744.983] -- 0:00:23
772500 -- (-748.455) (-745.746) (-756.970) [-742.960] * (-751.269) [-743.515] (-745.516) (-743.353) -- 0:00:23
773000 -- (-750.418) (-742.203) [-754.408] (-743.590) * (-746.879) [-744.622] (-740.576) (-751.426) -- 0:00:23
773500 -- [-742.502] (-744.534) (-751.158) (-745.264) * [-742.027] (-752.552) (-745.334) (-743.287) -- 0:00:23
774000 -- (-743.908) [-746.242] (-741.563) (-745.448) * [-747.194] (-747.371) (-750.196) (-746.101) -- 0:00:23
774500 -- [-746.475] (-744.114) (-741.400) (-747.566) * [-750.767] (-744.672) (-749.174) (-745.546) -- 0:00:23
775000 -- (-749.499) [-747.909] (-747.440) (-743.398) * (-741.649) (-750.570) (-744.589) [-750.618] -- 0:00:23
Average standard deviation of split frequencies: 0.002430
775500 -- [-745.641] (-742.151) (-744.235) (-746.002) * (-753.197) [-749.892] (-749.216) (-752.084) -- 0:00:23
776000 -- (-762.006) (-748.554) (-743.412) [-744.094] * (-742.553) [-751.483] (-745.192) (-751.597) -- 0:00:23
776500 -- [-747.286] (-743.859) (-747.084) (-745.778) * (-748.954) [-749.123] (-743.913) (-751.876) -- 0:00:23
777000 -- (-752.029) [-742.065] (-746.211) (-747.011) * (-746.888) (-744.868) [-743.167] (-752.983) -- 0:00:22
777500 -- (-747.616) (-746.555) [-746.108] (-754.245) * (-747.562) (-746.001) (-745.903) [-745.477] -- 0:00:22
778000 -- (-745.188) (-743.321) (-744.451) [-743.510] * (-744.883) (-748.242) (-754.302) [-742.416] -- 0:00:22
778500 -- (-754.138) (-743.096) (-747.421) [-741.811] * (-746.750) (-747.417) (-744.988) [-744.133] -- 0:00:22
779000 -- [-744.105] (-741.676) (-744.591) (-749.868) * (-745.007) (-743.632) (-754.090) [-745.219] -- 0:00:22
779500 -- [-745.278] (-742.117) (-743.087) (-748.047) * [-746.784] (-745.463) (-744.351) (-742.862) -- 0:00:22
780000 -- (-745.387) [-752.604] (-742.996) (-743.557) * [-746.140] (-748.212) (-744.122) (-744.152) -- 0:00:22
Average standard deviation of split frequencies: 0.002415
780500 -- (-748.236) [-746.176] (-742.503) (-745.539) * (-749.398) (-750.614) [-742.565] (-751.935) -- 0:00:22
781000 -- (-746.323) (-747.461) [-747.072] (-750.974) * (-749.534) (-746.415) [-742.016] (-748.283) -- 0:00:22
781500 -- (-743.724) (-745.376) (-742.983) [-749.119] * (-745.565) (-744.346) [-743.118] (-748.992) -- 0:00:22
782000 -- [-741.780] (-742.988) (-738.968) (-754.058) * (-744.155) [-739.557] (-742.606) (-751.033) -- 0:00:22
782500 -- (-745.625) (-742.518) [-745.880] (-747.955) * (-744.607) [-743.421] (-745.126) (-747.814) -- 0:00:22
783000 -- [-745.664] (-744.696) (-746.246) (-747.056) * (-750.667) (-750.468) [-746.410] (-745.212) -- 0:00:22
783500 -- (-745.447) [-744.021] (-744.944) (-744.914) * (-747.745) (-744.507) [-743.884] (-742.311) -- 0:00:22
784000 -- (-744.894) (-745.400) (-745.257) [-741.180] * (-743.682) (-747.015) [-740.272] (-750.704) -- 0:00:22
784500 -- [-743.081] (-745.040) (-745.361) (-745.336) * (-749.852) (-745.058) (-744.825) [-748.156] -- 0:00:22
785000 -- [-744.634] (-752.976) (-743.973) (-744.579) * (-749.134) (-752.741) (-747.051) [-740.556] -- 0:00:22
Average standard deviation of split frequencies: 0.002399
785500 -- [-748.309] (-747.318) (-741.912) (-740.688) * (-753.335) (-749.866) (-748.149) [-746.342] -- 0:00:22
786000 -- (-752.788) (-748.421) [-747.805] (-749.435) * (-749.546) (-751.221) (-751.824) [-746.219] -- 0:00:22
786500 -- (-752.605) [-749.885] (-742.208) (-744.884) * (-746.232) [-745.789] (-752.388) (-743.148) -- 0:00:21
787000 -- [-748.913] (-752.416) (-746.511) (-743.390) * (-750.739) (-752.534) (-749.321) [-745.276] -- 0:00:21
787500 -- [-752.093] (-750.354) (-748.993) (-748.063) * (-738.902) (-748.720) [-743.781] (-747.867) -- 0:00:21
788000 -- (-746.678) (-746.705) (-746.461) [-743.998] * [-742.622] (-742.193) (-747.149) (-744.472) -- 0:00:21
788500 -- (-751.371) (-750.042) (-751.654) [-743.065] * (-742.059) (-747.362) (-747.460) [-741.776] -- 0:00:21
789000 -- (-747.738) (-753.879) (-745.565) [-748.908] * (-747.565) (-741.472) (-744.256) [-744.431] -- 0:00:21
789500 -- (-751.166) (-748.434) (-748.783) [-747.293] * (-747.879) [-744.471] (-743.000) (-747.141) -- 0:00:21
790000 -- [-753.066] (-760.426) (-744.247) (-754.692) * (-741.462) [-743.342] (-745.520) (-746.757) -- 0:00:21
Average standard deviation of split frequencies: 0.002087
790500 -- [-743.564] (-757.178) (-745.447) (-742.172) * (-748.313) (-742.055) [-746.895] (-745.822) -- 0:00:21
791000 -- [-742.629] (-749.223) (-745.837) (-750.806) * [-748.946] (-742.530) (-743.463) (-744.026) -- 0:00:21
791500 -- (-747.619) (-751.362) (-744.689) [-745.098] * (-749.853) (-744.323) (-742.807) [-745.166] -- 0:00:21
792000 -- [-747.638] (-750.276) (-740.506) (-751.780) * (-739.998) (-744.384) (-751.713) [-742.289] -- 0:00:21
792500 -- (-754.318) (-746.351) [-742.750] (-749.589) * (-743.121) (-744.290) [-744.812] (-742.796) -- 0:00:21
793000 -- (-743.898) (-747.251) [-747.426] (-743.654) * [-742.340] (-743.286) (-740.079) (-741.131) -- 0:00:21
793500 -- [-743.027] (-750.183) (-741.912) (-741.922) * (-741.310) (-746.642) [-744.857] (-746.113) -- 0:00:21
794000 -- (-745.193) [-748.303] (-746.894) (-742.048) * (-750.329) (-752.642) (-747.550) [-745.342] -- 0:00:21
794500 -- [-741.856] (-745.542) (-743.767) (-753.780) * (-744.278) (-739.602) (-748.318) [-750.503] -- 0:00:21
795000 -- [-742.153] (-742.704) (-750.195) (-743.755) * (-750.240) (-745.144) [-743.231] (-749.214) -- 0:00:21
Average standard deviation of split frequencies: 0.002369
795500 -- [-752.052] (-748.112) (-749.966) (-746.097) * (-742.351) [-742.484] (-748.396) (-751.240) -- 0:00:21
796000 -- (-742.361) (-742.348) (-743.532) [-747.820] * (-748.364) (-742.284) (-748.180) [-753.470] -- 0:00:21
796500 -- [-742.933] (-745.063) (-744.677) (-751.966) * (-743.897) [-744.407] (-751.129) (-749.908) -- 0:00:20
797000 -- (-738.548) [-745.589] (-746.005) (-751.252) * (-746.533) (-748.502) (-743.360) [-744.826] -- 0:00:20
797500 -- [-744.554] (-742.273) (-747.682) (-755.715) * (-744.497) [-746.090] (-754.414) (-745.764) -- 0:00:20
798000 -- (-746.091) (-744.388) (-748.696) [-744.401] * (-747.334) [-745.238] (-747.681) (-741.716) -- 0:00:20
798500 -- (-750.132) [-746.181] (-744.560) (-743.939) * [-748.359] (-748.390) (-746.193) (-756.213) -- 0:00:20
799000 -- [-749.190] (-749.718) (-744.828) (-747.674) * (-747.619) [-740.230] (-751.062) (-745.728) -- 0:00:20
799500 -- [-746.639] (-745.654) (-744.379) (-753.712) * (-750.042) (-751.522) [-744.268] (-746.728) -- 0:00:20
800000 -- (-748.173) [-742.342] (-747.716) (-748.536) * (-747.618) (-744.796) (-747.348) [-740.638] -- 0:00:20
Average standard deviation of split frequencies: 0.002649
800500 -- [-749.414] (-747.186) (-747.142) (-744.942) * (-742.784) (-744.312) (-743.538) [-745.085] -- 0:00:20
801000 -- (-745.987) (-748.370) (-751.851) [-743.718] * (-748.716) (-742.535) [-743.405] (-741.694) -- 0:00:20
801500 -- [-746.774] (-746.888) (-744.527) (-745.243) * (-747.644) (-750.324) (-744.517) [-744.126] -- 0:00:20
802000 -- (-749.823) (-745.799) (-750.373) [-745.348] * [-748.937] (-749.365) (-743.434) (-745.143) -- 0:00:20
802500 -- (-747.204) (-747.891) (-750.255) [-743.484] * (-755.270) (-741.643) [-746.495] (-747.115) -- 0:00:20
803000 -- [-742.113] (-743.082) (-743.402) (-746.386) * [-753.235] (-741.980) (-759.110) (-746.220) -- 0:00:20
803500 -- (-750.133) [-740.997] (-746.104) (-743.906) * (-750.833) [-740.437] (-747.411) (-745.053) -- 0:00:20
804000 -- (-755.445) (-743.582) [-745.681] (-752.271) * [-748.275] (-752.116) (-750.304) (-742.348) -- 0:00:20
804500 -- [-744.311] (-747.782) (-741.293) (-747.749) * (-744.826) (-741.218) (-752.062) [-749.105] -- 0:00:20
805000 -- (-745.602) [-745.653] (-748.922) (-748.944) * (-748.348) [-744.525] (-747.363) (-749.331) -- 0:00:20
Average standard deviation of split frequencies: 0.004971
805500 -- (-743.991) [-743.424] (-742.054) (-755.869) * (-742.151) [-747.717] (-751.561) (-743.605) -- 0:00:20
806000 -- [-743.392] (-752.285) (-744.479) (-757.960) * (-743.183) (-744.170) (-759.436) [-744.004] -- 0:00:19
806500 -- [-742.217] (-744.188) (-746.821) (-753.061) * [-740.889] (-742.821) (-751.777) (-741.818) -- 0:00:19
807000 -- [-746.419] (-740.937) (-743.188) (-747.054) * (-743.472) (-746.519) (-751.408) [-746.342] -- 0:00:19
807500 -- (-748.011) (-745.777) [-748.713] (-747.408) * (-744.595) [-742.481] (-758.428) (-758.327) -- 0:00:19
808000 -- [-745.509] (-748.696) (-743.285) (-747.824) * [-744.024] (-746.692) (-753.549) (-744.870) -- 0:00:19
808500 -- (-744.690) [-745.895] (-742.330) (-756.225) * (-740.239) [-738.697] (-753.751) (-742.894) -- 0:00:19
809000 -- (-741.963) [-744.711] (-749.366) (-751.398) * [-740.670] (-743.812) (-750.720) (-744.574) -- 0:00:19
809500 -- (-746.734) (-749.804) (-746.831) [-751.310] * (-749.912) (-742.149) [-745.825] (-749.929) -- 0:00:19
810000 -- (-745.499) [-745.099] (-743.616) (-747.077) * [-747.164] (-748.014) (-747.242) (-743.735) -- 0:00:19
Average standard deviation of split frequencies: 0.004071
810500 -- (-746.537) (-744.799) [-743.676] (-746.312) * (-741.511) (-752.118) [-741.882] (-751.076) -- 0:00:19
811000 -- [-743.939] (-744.164) (-747.767) (-745.244) * (-746.219) (-745.436) [-742.963] (-751.704) -- 0:00:19
811500 -- [-745.372] (-750.908) (-751.866) (-741.542) * (-740.883) [-746.882] (-747.240) (-744.219) -- 0:00:19
812000 -- (-742.368) (-746.880) [-745.133] (-751.573) * [-744.604] (-744.908) (-748.072) (-747.975) -- 0:00:19
812500 -- (-744.693) (-744.938) (-750.561) [-743.997] * (-750.347) [-742.981] (-742.684) (-745.396) -- 0:00:19
813000 -- (-748.098) (-745.254) (-744.903) [-740.850] * (-740.292) (-745.217) [-741.906] (-749.117) -- 0:00:19
813500 -- [-747.340] (-745.709) (-748.037) (-742.321) * (-747.465) (-743.866) [-744.553] (-750.004) -- 0:00:19
814000 -- (-753.233) [-745.124] (-744.787) (-741.546) * (-743.783) (-748.975) (-749.137) [-746.649] -- 0:00:19
814500 -- (-746.905) (-746.937) (-747.627) [-744.565] * [-742.932] (-748.341) (-745.130) (-746.754) -- 0:00:19
815000 -- [-745.604] (-749.401) (-748.166) (-746.002) * (-743.517) (-742.448) [-742.080] (-747.886) -- 0:00:19
Average standard deviation of split frequencies: 0.002889
815500 -- (-746.114) [-740.606] (-746.706) (-746.775) * [-748.363] (-742.428) (-746.399) (-751.951) -- 0:00:19
816000 -- [-749.098] (-745.818) (-750.591) (-745.470) * [-744.671] (-744.628) (-749.393) (-743.468) -- 0:00:18
816500 -- (-747.755) (-748.046) (-745.946) [-745.637] * (-741.429) [-747.095] (-745.428) (-742.681) -- 0:00:18
817000 -- [-745.843] (-747.945) (-746.477) (-746.124) * (-746.279) (-741.322) (-744.265) [-746.151] -- 0:00:18
817500 -- [-743.411] (-746.051) (-741.014) (-752.712) * (-744.769) (-746.588) (-758.592) [-742.457] -- 0:00:18
818000 -- (-743.541) [-744.150] (-740.968) (-742.536) * [-743.560] (-743.462) (-753.153) (-746.464) -- 0:00:18
818500 -- [-745.046] (-744.114) (-744.210) (-745.948) * [-743.737] (-745.503) (-743.322) (-751.277) -- 0:00:18
819000 -- (-743.422) [-742.437] (-747.136) (-746.866) * (-750.943) [-744.189] (-741.999) (-751.720) -- 0:00:18
819500 -- [-739.737] (-743.889) (-756.965) (-748.370) * [-743.274] (-748.519) (-748.389) (-747.292) -- 0:00:18
820000 -- (-744.981) (-744.817) [-743.398] (-742.507) * [-743.805] (-746.168) (-739.047) (-745.131) -- 0:00:18
Average standard deviation of split frequencies: 0.003159
820500 -- [-742.933] (-746.236) (-749.372) (-743.916) * (-744.890) (-752.338) [-742.818] (-750.429) -- 0:00:18
821000 -- [-743.481] (-745.802) (-746.263) (-747.617) * (-746.243) (-749.028) [-740.131] (-744.855) -- 0:00:18
821500 -- (-749.205) (-743.084) (-745.998) [-744.899] * (-752.551) (-749.678) (-741.474) [-745.691] -- 0:00:18
822000 -- [-746.431] (-742.621) (-743.652) (-744.665) * (-752.330) (-745.517) (-741.457) [-746.813] -- 0:00:18
822500 -- (-741.269) [-740.694] (-751.331) (-747.628) * (-750.731) (-743.875) (-745.162) [-745.480] -- 0:00:18
823000 -- [-747.195] (-748.977) (-751.528) (-745.669) * (-750.649) (-746.497) [-740.362] (-744.517) -- 0:00:18
823500 -- (-744.423) (-746.895) [-743.846] (-752.404) * [-751.149] (-746.354) (-744.395) (-746.590) -- 0:00:18
824000 -- (-744.087) (-744.718) [-742.835] (-748.368) * (-746.351) [-744.929] (-743.448) (-748.317) -- 0:00:18
824500 -- (-750.472) (-749.343) [-749.044] (-749.697) * (-747.857) (-745.790) [-745.840] (-746.318) -- 0:00:18
825000 -- (-745.334) (-750.040) (-747.010) [-748.038] * (-755.770) [-742.933] (-750.982) (-745.274) -- 0:00:18
Average standard deviation of split frequencies: 0.001427
825500 -- [-748.783] (-748.809) (-745.825) (-749.432) * (-749.281) [-746.684] (-745.046) (-744.355) -- 0:00:17
826000 -- [-742.664] (-743.280) (-744.579) (-745.886) * [-744.556] (-743.039) (-745.489) (-747.455) -- 0:00:17
826500 -- (-744.387) (-744.098) (-750.373) [-745.805] * (-745.925) (-753.343) [-743.815] (-748.476) -- 0:00:17
827000 -- [-743.469] (-741.293) (-745.504) (-744.312) * (-744.469) (-742.600) [-742.966] (-749.444) -- 0:00:17
827500 -- (-743.647) [-743.185] (-746.116) (-744.096) * (-744.160) (-744.707) [-742.956] (-746.248) -- 0:00:17
828000 -- [-751.043] (-745.170) (-744.333) (-747.153) * [-744.628] (-744.014) (-744.078) (-747.570) -- 0:00:17
828500 -- (-748.390) (-745.242) [-744.912] (-743.647) * (-744.306) (-743.877) [-744.577] (-753.942) -- 0:00:17
829000 -- (-747.091) [-742.197] (-744.956) (-743.312) * [-747.033] (-747.072) (-742.148) (-745.355) -- 0:00:17
829500 -- [-742.446] (-742.619) (-746.435) (-750.633) * [-742.749] (-744.617) (-747.071) (-749.986) -- 0:00:17
830000 -- (-748.625) [-745.443] (-745.306) (-746.380) * (-743.037) (-741.066) [-745.245] (-744.733) -- 0:00:17
Average standard deviation of split frequencies: 0.001703
830500 -- [-747.441] (-742.429) (-742.986) (-746.485) * (-749.694) [-743.451] (-752.282) (-741.325) -- 0:00:17
831000 -- (-752.545) (-741.814) [-751.349] (-750.004) * (-743.022) (-751.725) [-743.973] (-743.336) -- 0:00:17
831500 -- [-744.252] (-744.438) (-746.538) (-758.173) * [-745.239] (-740.359) (-746.502) (-744.638) -- 0:00:17
832000 -- (-752.888) [-740.888] (-750.937) (-758.582) * [-750.484] (-745.994) (-746.827) (-744.358) -- 0:00:17
832500 -- (-748.386) [-745.027] (-750.810) (-753.163) * [-747.974] (-747.790) (-741.633) (-739.603) -- 0:00:17
833000 -- (-744.074) [-745.566] (-743.564) (-754.340) * [-742.309] (-742.804) (-742.730) (-747.659) -- 0:00:17
833500 -- [-743.831] (-740.921) (-754.549) (-746.556) * (-744.988) (-741.332) (-748.165) [-744.300] -- 0:00:17
834000 -- (-758.291) [-745.704] (-749.922) (-750.254) * [-743.561] (-745.641) (-743.783) (-743.167) -- 0:00:17
834500 -- (-750.633) [-742.627] (-752.251) (-749.407) * (-746.172) (-744.172) (-750.086) [-742.111] -- 0:00:17
835000 -- (-747.586) [-746.209] (-745.663) (-745.366) * (-748.934) [-746.605] (-745.906) (-746.828) -- 0:00:16
Average standard deviation of split frequencies: 0.001974
835500 -- (-751.544) (-744.309) (-746.450) [-746.430] * (-742.311) (-745.231) [-748.907] (-747.135) -- 0:00:16
836000 -- (-748.599) (-744.813) [-742.004] (-754.378) * (-742.610) [-753.186] (-753.554) (-745.419) -- 0:00:16
836500 -- (-744.276) [-750.443] (-744.269) (-748.551) * [-745.568] (-746.748) (-742.562) (-750.617) -- 0:00:16
837000 -- (-749.217) [-743.810] (-748.962) (-747.223) * (-746.065) [-748.991] (-745.686) (-758.225) -- 0:00:16
837500 -- (-744.159) [-741.946] (-744.862) (-753.281) * (-744.547) (-745.735) [-748.006] (-747.270) -- 0:00:16
838000 -- (-748.753) [-746.343] (-743.074) (-744.033) * (-742.238) (-754.728) (-742.391) [-749.071] -- 0:00:16
838500 -- (-752.270) (-747.142) [-748.236] (-746.794) * (-745.375) [-743.183] (-745.292) (-745.655) -- 0:00:16
839000 -- (-745.092) [-745.527] (-745.894) (-742.513) * (-750.725) [-747.968] (-741.955) (-741.518) -- 0:00:16
839500 -- (-750.471) [-742.562] (-741.260) (-742.893) * (-744.542) (-749.739) (-744.588) [-742.663] -- 0:00:16
840000 -- (-744.102) (-745.024) (-744.845) [-749.613] * (-743.481) (-747.346) (-743.794) [-743.331] -- 0:00:16
Average standard deviation of split frequencies: 0.002523
840500 -- (-748.490) (-742.754) [-740.544] (-751.261) * (-755.489) [-741.310] (-744.459) (-744.072) -- 0:00:16
841000 -- [-748.296] (-747.924) (-747.128) (-751.424) * (-746.767) (-742.380) (-746.837) [-744.023] -- 0:00:16
841500 -- [-745.230] (-747.886) (-744.133) (-753.543) * (-751.361) (-744.187) (-742.607) [-745.600] -- 0:00:16
842000 -- (-749.378) (-745.127) (-743.587) [-744.690] * (-755.148) (-744.668) [-739.772] (-744.391) -- 0:00:16
842500 -- [-743.888] (-741.653) (-746.551) (-743.168) * (-753.389) (-750.140) (-742.595) [-742.172] -- 0:00:16
843000 -- (-744.396) (-747.309) [-746.093] (-745.462) * (-750.429) [-740.830] (-744.769) (-748.052) -- 0:00:16
843500 -- [-740.027] (-743.335) (-750.062) (-745.421) * (-747.154) (-742.843) (-752.255) [-741.010] -- 0:00:16
844000 -- (-749.300) [-744.440] (-742.818) (-743.783) * (-754.458) (-749.179) (-747.526) [-746.012] -- 0:00:16
844500 -- (-744.712) (-750.714) [-744.580] (-744.484) * (-745.863) (-747.988) [-744.186] (-751.981) -- 0:00:16
845000 -- [-743.819] (-746.201) (-744.744) (-748.987) * (-748.733) (-743.966) [-747.885] (-750.311) -- 0:00:15
Average standard deviation of split frequencies: 0.002229
845500 -- (-749.419) [-743.995] (-749.761) (-746.544) * (-742.174) (-743.240) (-745.822) [-741.977] -- 0:00:15
846000 -- (-743.439) [-743.679] (-750.037) (-750.381) * (-741.937) (-744.612) (-743.040) [-743.862] -- 0:00:15
846500 -- (-756.790) (-746.675) (-749.018) [-745.311] * [-740.947] (-742.805) (-751.453) (-742.500) -- 0:00:15
847000 -- (-753.951) (-743.301) [-745.635] (-742.944) * [-750.201] (-749.809) (-752.200) (-744.794) -- 0:00:15
847500 -- (-756.825) (-746.700) [-745.840] (-745.738) * [-749.741] (-746.023) (-744.988) (-747.732) -- 0:00:15
848000 -- (-754.270) (-745.252) (-739.278) [-740.267] * (-742.695) (-744.247) [-748.573] (-744.221) -- 0:00:15
848500 -- [-743.060] (-744.067) (-744.146) (-741.918) * (-745.124) (-742.926) [-755.012] (-741.067) -- 0:00:15
849000 -- (-742.750) (-742.703) (-742.834) [-744.495] * (-746.833) (-742.757) [-749.461] (-747.128) -- 0:00:15
849500 -- (-746.249) [-744.039] (-743.664) (-741.769) * (-743.881) [-742.062] (-750.168) (-744.432) -- 0:00:15
850000 -- (-748.360) (-753.549) (-746.205) [-741.607] * [-743.472] (-744.637) (-747.041) (-749.167) -- 0:00:15
Average standard deviation of split frequencies: 0.002494
850500 -- (-749.035) (-743.471) (-743.041) [-742.953] * (-747.086) [-748.823] (-744.249) (-745.454) -- 0:00:15
851000 -- [-746.956] (-743.281) (-749.415) (-756.751) * (-742.017) (-743.106) (-742.061) [-740.434] -- 0:00:15
851500 -- (-747.537) (-753.478) (-744.796) [-740.880] * (-747.334) (-742.641) [-748.152] (-744.273) -- 0:00:15
852000 -- (-744.029) [-741.979] (-749.511) (-740.936) * [-746.877] (-742.897) (-745.269) (-746.237) -- 0:00:15
852500 -- (-749.394) (-746.028) [-746.425] (-746.453) * [-742.821] (-744.314) (-749.196) (-751.304) -- 0:00:15
853000 -- [-742.832] (-741.990) (-743.657) (-742.570) * (-741.115) [-741.479] (-747.605) (-751.019) -- 0:00:15
853500 -- [-749.021] (-745.461) (-747.415) (-743.639) * (-745.627) (-739.450) [-748.505] (-747.376) -- 0:00:15
854000 -- (-747.666) [-742.403] (-745.535) (-747.884) * (-742.305) (-745.594) (-747.143) [-748.742] -- 0:00:15
854500 -- (-747.749) (-743.233) (-745.194) [-747.075] * (-746.163) (-748.967) [-742.275] (-748.193) -- 0:00:14
855000 -- (-743.678) [-746.797] (-746.681) (-748.033) * [-746.691] (-743.796) (-744.801) (-744.857) -- 0:00:14
Average standard deviation of split frequencies: 0.002478
855500 -- [-743.147] (-742.537) (-752.033) (-745.522) * (-751.665) (-753.627) (-745.138) [-740.098] -- 0:00:14
856000 -- [-742.924] (-744.461) (-761.439) (-744.121) * [-744.328] (-751.231) (-743.154) (-745.535) -- 0:00:14
856500 -- (-742.586) (-749.329) (-765.931) [-744.408] * (-741.801) [-744.123] (-746.322) (-745.049) -- 0:00:14
857000 -- (-746.592) (-744.135) [-742.079] (-746.160) * (-746.090) (-742.509) [-746.838] (-747.517) -- 0:00:14
857500 -- (-746.526) [-746.110] (-743.454) (-744.735) * (-750.007) (-745.147) (-744.406) [-747.441] -- 0:00:14
858000 -- (-741.997) (-744.081) [-743.178] (-750.283) * (-744.526) [-748.261] (-747.523) (-744.336) -- 0:00:14
858500 -- (-744.196) (-742.567) [-745.331] (-749.548) * (-744.483) (-750.318) [-741.022] (-744.965) -- 0:00:14
859000 -- (-746.476) (-747.597) (-750.843) [-745.642] * (-746.589) [-745.026] (-744.854) (-741.972) -- 0:00:14
859500 -- (-744.140) (-752.997) [-743.643] (-742.428) * [-747.897] (-743.577) (-747.597) (-742.826) -- 0:00:14
860000 -- [-742.777] (-745.044) (-741.647) (-747.300) * [-747.756] (-744.388) (-750.722) (-749.456) -- 0:00:14
Average standard deviation of split frequencies: 0.002739
860500 -- [-741.866] (-744.031) (-745.144) (-744.368) * (-746.334) [-747.965] (-743.981) (-744.329) -- 0:00:14
861000 -- (-747.829) (-743.064) (-746.651) [-743.413] * (-747.276) (-751.658) [-742.620] (-744.418) -- 0:00:14
861500 -- (-748.399) (-748.263) (-753.056) [-742.263] * [-744.081] (-752.858) (-742.550) (-740.187) -- 0:00:14
862000 -- (-745.630) (-749.691) [-744.874] (-744.269) * (-748.097) [-743.245] (-748.984) (-741.614) -- 0:00:14
862500 -- (-750.571) (-758.697) [-743.083] (-746.443) * (-748.489) [-746.140] (-746.039) (-749.372) -- 0:00:14
863000 -- (-744.299) (-750.870) [-752.168] (-747.869) * (-748.273) (-751.398) (-748.828) [-743.386] -- 0:00:14
863500 -- (-744.910) [-747.300] (-750.521) (-742.768) * (-744.432) [-749.880] (-742.401) (-745.146) -- 0:00:14
864000 -- (-747.064) (-747.028) (-745.315) [-741.786] * (-743.239) (-743.207) [-745.393] (-744.821) -- 0:00:14
864500 -- (-746.351) (-747.765) (-746.533) [-743.194] * [-742.230] (-747.439) (-745.503) (-740.368) -- 0:00:13
865000 -- [-740.828] (-748.406) (-744.476) (-746.070) * (-752.664) (-743.602) (-750.322) [-743.616] -- 0:00:13
Average standard deviation of split frequencies: 0.002722
865500 -- (-747.234) (-743.726) (-749.227) [-742.266] * (-749.429) [-742.003] (-744.208) (-742.205) -- 0:00:13
866000 -- [-746.428] (-740.798) (-746.374) (-741.431) * (-745.679) (-748.812) [-740.749] (-742.113) -- 0:00:13
866500 -- (-748.873) [-742.411] (-746.083) (-744.607) * (-741.529) (-756.677) [-752.011] (-748.438) -- 0:00:13
867000 -- (-749.752) (-747.487) [-743.963] (-744.793) * [-749.470] (-751.150) (-742.414) (-747.536) -- 0:00:13
867500 -- [-740.894] (-749.574) (-743.623) (-744.747) * (-751.733) (-744.004) (-745.141) [-743.731] -- 0:00:13
868000 -- (-744.677) (-748.618) (-747.521) [-753.444] * (-749.996) (-744.594) [-743.938] (-742.651) -- 0:00:13
868500 -- (-745.519) (-753.595) (-742.912) [-745.832] * [-750.310] (-747.117) (-742.070) (-742.477) -- 0:00:13
869000 -- [-745.813] (-753.288) (-742.093) (-743.502) * [-746.748] (-745.252) (-745.094) (-742.790) -- 0:00:13
869500 -- [-744.432] (-754.493) (-744.142) (-746.642) * (-747.769) (-746.962) (-744.022) [-746.383] -- 0:00:13
870000 -- (-743.438) [-742.419] (-748.742) (-744.968) * (-753.928) (-749.137) (-745.111) [-739.465] -- 0:00:13
Average standard deviation of split frequencies: 0.002978
870500 -- (-747.744) [-744.635] (-745.701) (-747.499) * [-748.864] (-750.985) (-741.553) (-742.379) -- 0:00:13
871000 -- (-744.363) [-744.323] (-743.142) (-748.376) * (-752.599) (-747.881) (-746.848) [-745.718] -- 0:00:13
871500 -- [-741.954] (-747.973) (-744.410) (-743.203) * (-760.706) [-753.208] (-748.671) (-747.241) -- 0:00:13
872000 -- [-750.076] (-746.331) (-747.192) (-745.457) * (-752.433) [-747.989] (-743.755) (-744.860) -- 0:00:13
872500 -- (-744.059) (-749.642) [-752.656] (-746.729) * [-745.949] (-747.219) (-751.504) (-741.585) -- 0:00:13
873000 -- [-747.314] (-744.788) (-751.367) (-746.358) * (-761.444) (-751.363) (-742.762) [-746.799] -- 0:00:13
873500 -- (-745.793) (-742.637) [-749.880] (-750.516) * (-750.081) (-750.079) (-742.941) [-747.688] -- 0:00:13
874000 -- [-744.729] (-751.837) (-743.711) (-752.503) * (-754.986) [-744.123] (-742.360) (-744.998) -- 0:00:12
874500 -- (-746.422) (-742.187) [-748.019] (-744.445) * (-751.505) [-743.529] (-745.691) (-743.401) -- 0:00:12
875000 -- (-751.424) [-740.816] (-752.525) (-749.223) * (-746.857) (-746.439) [-743.633] (-746.329) -- 0:00:12
Average standard deviation of split frequencies: 0.004664
875500 -- (-745.299) [-742.285] (-743.955) (-747.498) * (-756.493) (-749.996) [-743.541] (-747.293) -- 0:00:12
876000 -- (-748.076) [-744.006] (-741.461) (-747.757) * (-745.997) (-751.049) (-743.337) [-746.044] -- 0:00:12
876500 -- (-747.606) [-741.889] (-750.042) (-751.080) * (-743.583) (-748.160) [-744.287] (-743.636) -- 0:00:12
877000 -- [-742.302] (-746.937) (-744.068) (-745.805) * (-749.482) [-748.122] (-752.164) (-745.281) -- 0:00:12
877500 -- [-744.812] (-750.232) (-748.286) (-745.426) * (-745.788) (-749.691) (-750.882) [-748.155] -- 0:00:12
878000 -- [-745.924] (-746.817) (-742.913) (-745.436) * (-745.243) (-755.325) (-741.429) [-748.077] -- 0:00:12
878500 -- (-748.802) (-744.643) [-745.952] (-751.237) * (-742.446) (-748.488) (-742.820) [-747.747] -- 0:00:12
879000 -- (-742.742) [-742.014] (-748.027) (-747.461) * (-744.684) (-747.725) [-741.966] (-742.180) -- 0:00:12
879500 -- (-746.030) [-740.245] (-748.831) (-750.427) * (-742.912) (-746.834) [-749.246] (-745.416) -- 0:00:12
880000 -- [-743.061] (-745.312) (-751.295) (-745.798) * [-747.468] (-746.396) (-743.797) (-742.486) -- 0:00:12
Average standard deviation of split frequencies: 0.005710
880500 -- (-747.386) (-752.189) (-741.203) [-746.401] * [-749.201] (-744.902) (-747.707) (-751.456) -- 0:00:12
881000 -- (-746.520) [-748.533] (-746.222) (-749.669) * (-746.960) [-744.781] (-748.436) (-742.905) -- 0:00:12
881500 -- (-756.451) (-751.054) [-743.139] (-750.393) * (-743.173) [-747.825] (-745.722) (-745.122) -- 0:00:12
882000 -- (-752.571) [-747.310] (-749.664) (-746.447) * (-747.640) (-747.085) (-749.328) [-743.714] -- 0:00:12
882500 -- (-748.001) (-742.633) [-741.604] (-748.612) * [-746.601] (-748.626) (-744.551) (-742.628) -- 0:00:12
883000 -- (-746.363) [-743.244] (-751.874) (-744.188) * (-740.301) (-742.813) (-747.692) [-742.130] -- 0:00:12
883500 -- (-743.214) [-744.993] (-742.798) (-745.192) * (-743.000) (-747.714) [-743.008] (-753.174) -- 0:00:11
884000 -- (-742.355) (-751.949) [-744.997] (-745.739) * (-746.064) (-746.563) (-747.695) [-752.032] -- 0:00:11
884500 -- [-744.992] (-752.445) (-749.153) (-744.113) * (-744.824) [-748.382] (-743.522) (-753.877) -- 0:00:11
885000 -- [-746.105] (-746.340) (-746.883) (-747.376) * [-743.814] (-745.751) (-751.937) (-746.787) -- 0:00:11
Average standard deviation of split frequencies: 0.006739
885500 -- (-745.218) (-747.889) [-748.563] (-751.455) * (-743.440) [-743.098] (-743.880) (-751.436) -- 0:00:11
886000 -- [-744.404] (-742.531) (-748.244) (-749.195) * (-750.681) [-745.604] (-747.134) (-751.045) -- 0:00:11
886500 -- [-745.152] (-745.591) (-746.262) (-742.706) * (-749.566) [-743.432] (-741.246) (-756.585) -- 0:00:11
887000 -- [-747.546] (-745.087) (-746.554) (-742.749) * (-748.479) (-747.631) [-743.107] (-751.915) -- 0:00:11
887500 -- (-743.719) [-745.611] (-742.328) (-752.452) * (-755.248) (-748.869) (-744.813) [-748.001] -- 0:00:11
888000 -- (-754.088) (-748.301) [-743.519] (-746.766) * (-750.756) [-746.617] (-746.953) (-746.896) -- 0:00:11
888500 -- (-744.439) (-741.013) (-741.210) [-740.310] * (-747.870) (-747.125) [-747.207] (-742.980) -- 0:00:11
889000 -- (-746.254) (-749.443) (-748.700) [-749.797] * (-751.059) (-750.401) (-745.523) [-744.041] -- 0:00:11
889500 -- (-746.694) (-744.299) (-749.732) [-741.422] * (-756.095) (-747.374) (-753.872) [-742.987] -- 0:00:11
890000 -- (-747.190) (-747.190) (-744.376) [-745.215] * (-749.019) (-747.328) [-747.435] (-748.393) -- 0:00:11
Average standard deviation of split frequencies: 0.006351
890500 -- (-748.230) (-745.535) [-743.636] (-745.761) * (-748.450) (-743.072) [-748.481] (-746.836) -- 0:00:11
891000 -- [-742.130] (-746.642) (-743.571) (-750.065) * [-747.591] (-746.320) (-743.792) (-746.991) -- 0:00:11
891500 -- (-744.458) (-749.810) (-752.001) [-746.726] * (-744.650) (-745.905) (-748.391) [-743.068] -- 0:00:11
892000 -- [-740.273] (-743.980) (-745.240) (-742.496) * [-742.260] (-746.329) (-754.671) (-743.654) -- 0:00:11
892500 -- (-743.754) (-742.361) [-742.581] (-748.639) * (-750.259) (-742.029) (-748.154) [-743.985] -- 0:00:11
893000 -- (-752.537) (-746.176) (-752.261) [-744.855] * [-744.178] (-741.654) (-744.351) (-743.786) -- 0:00:11
893500 -- (-747.938) (-749.738) [-744.887] (-747.619) * [-743.111] (-743.613) (-742.374) (-746.877) -- 0:00:10
894000 -- [-743.643] (-745.996) (-743.384) (-745.616) * (-743.915) [-744.194] (-744.401) (-740.680) -- 0:00:10
894500 -- (-744.982) (-742.396) [-743.129] (-746.187) * (-744.087) [-744.754] (-749.026) (-741.395) -- 0:00:10
895000 -- [-743.652] (-747.566) (-742.301) (-748.013) * (-741.562) (-747.079) [-742.703] (-745.608) -- 0:00:10
Average standard deviation of split frequencies: 0.006313
895500 -- (-742.185) (-745.254) (-744.051) [-742.599] * (-744.638) (-747.700) [-748.547] (-741.752) -- 0:00:10
896000 -- [-741.729] (-745.789) (-743.252) (-746.484) * (-750.112) (-750.575) [-746.892] (-748.639) -- 0:00:10
896500 -- [-743.438] (-747.751) (-745.395) (-747.764) * (-744.162) (-747.994) (-745.064) [-742.078] -- 0:00:10
897000 -- (-746.564) (-748.399) [-745.417] (-745.845) * (-750.541) (-743.897) (-749.740) [-744.733] -- 0:00:10
897500 -- (-752.653) [-747.662] (-748.131) (-746.387) * [-744.069] (-750.229) (-745.859) (-744.780) -- 0:00:10
898000 -- [-741.381] (-742.989) (-741.975) (-751.413) * [-744.502] (-745.984) (-744.979) (-750.408) -- 0:00:10
898500 -- [-742.636] (-748.349) (-745.165) (-746.439) * [-747.244] (-747.397) (-743.823) (-748.545) -- 0:00:10
899000 -- (-745.999) [-743.532] (-743.324) (-753.028) * (-749.557) (-744.473) (-745.724) [-745.588] -- 0:00:10
899500 -- (-742.209) (-743.316) (-744.704) [-746.027] * [-743.487] (-741.105) (-746.819) (-746.933) -- 0:00:10
900000 -- (-750.765) (-747.188) (-747.286) [-744.289] * (-745.730) (-746.032) (-745.376) [-742.336] -- 0:00:10
Average standard deviation of split frequencies: 0.005234
900500 -- (-745.462) (-747.944) [-746.981] (-744.771) * (-747.138) [-747.808] (-756.585) (-749.669) -- 0:00:10
901000 -- (-745.388) [-744.230] (-745.695) (-753.194) * (-741.247) [-747.318] (-741.498) (-748.433) -- 0:00:10
901500 -- [-749.753] (-744.350) (-743.278) (-744.821) * (-745.516) (-740.859) (-742.385) [-752.768] -- 0:00:10
902000 -- [-744.315] (-752.095) (-741.927) (-743.489) * (-745.196) (-759.487) (-750.541) [-743.914] -- 0:00:10
902500 -- (-750.696) (-745.984) [-748.651] (-746.663) * [-744.456] (-745.773) (-742.302) (-748.737) -- 0:00:10
903000 -- [-749.279] (-750.483) (-751.703) (-751.019) * [-747.317] (-740.816) (-747.035) (-739.672) -- 0:00:09
903500 -- (-751.683) (-746.395) (-750.785) [-739.475] * (-753.021) [-743.519] (-743.829) (-739.899) -- 0:00:09
904000 -- (-755.884) (-745.874) (-749.115) [-743.295] * [-747.040] (-748.028) (-746.456) (-749.582) -- 0:00:09
904500 -- [-747.501] (-755.180) (-750.608) (-747.330) * (-750.555) (-744.089) (-745.507) [-742.320] -- 0:00:09
905000 -- (-741.659) (-747.732) (-751.354) [-742.045] * (-747.396) (-749.962) [-745.767] (-748.082) -- 0:00:09
Average standard deviation of split frequencies: 0.006591
905500 -- (-744.357) (-747.789) [-749.251] (-746.481) * (-744.023) [-746.289] (-745.217) (-748.532) -- 0:00:09
906000 -- (-746.947) (-752.977) (-749.258) [-747.499] * [-742.042] (-748.443) (-747.933) (-749.739) -- 0:00:09
906500 -- (-741.344) (-742.230) [-746.407] (-749.648) * (-745.716) [-741.791] (-742.542) (-748.297) -- 0:00:09
907000 -- [-742.607] (-750.050) (-744.334) (-745.951) * [-742.492] (-747.564) (-747.654) (-747.657) -- 0:00:09
907500 -- [-740.704] (-750.598) (-750.036) (-742.740) * [-741.363] (-749.336) (-750.008) (-744.326) -- 0:00:09
908000 -- (-745.469) (-746.163) [-742.058] (-746.842) * [-744.298] (-746.973) (-744.290) (-743.247) -- 0:00:09
908500 -- (-744.570) (-748.929) (-744.725) [-748.705] * (-747.189) [-745.614] (-741.275) (-744.547) -- 0:00:09
909000 -- [-740.223] (-747.548) (-743.383) (-748.420) * (-752.422) (-751.345) [-745.356] (-745.931) -- 0:00:09
909500 -- (-744.186) [-740.491] (-743.135) (-754.063) * (-745.734) (-747.125) (-743.161) [-745.339] -- 0:00:09
910000 -- (-747.491) (-742.486) (-747.327) [-744.361] * (-751.048) (-743.177) (-743.253) [-746.238] -- 0:00:09
Average standard deviation of split frequencies: 0.005435
910500 -- (-750.415) [-742.110] (-754.259) (-742.922) * (-741.298) (-747.810) [-739.922] (-750.863) -- 0:00:09
911000 -- (-748.231) [-746.911] (-742.297) (-751.099) * (-746.834) (-747.297) (-747.362) [-740.000] -- 0:00:09
911500 -- (-749.363) (-741.815) [-748.226] (-745.273) * (-744.923) (-753.057) (-753.104) [-742.195] -- 0:00:09
912000 -- (-750.976) [-742.323] (-743.330) (-745.006) * (-745.382) (-756.884) (-757.052) [-741.929] -- 0:00:09
912500 -- (-753.670) (-746.905) (-745.252) [-745.910] * [-738.788] (-754.730) (-758.569) (-741.842) -- 0:00:09
913000 -- (-746.049) (-746.643) [-745.837] (-747.097) * (-740.703) (-747.906) [-749.669] (-742.061) -- 0:00:08
913500 -- (-755.203) (-746.007) (-744.252) [-741.332] * [-745.635] (-744.007) (-752.808) (-747.182) -- 0:00:08
914000 -- (-753.070) (-744.366) [-746.469] (-746.800) * (-749.295) [-742.021] (-757.955) (-746.536) -- 0:00:08
914500 -- (-754.152) [-747.532] (-746.206) (-741.119) * [-742.918] (-743.328) (-750.730) (-743.609) -- 0:00:08
915000 -- [-749.983] (-742.655) (-748.569) (-745.127) * (-745.013) (-750.736) (-742.729) [-740.920] -- 0:00:08
Average standard deviation of split frequencies: 0.004889
915500 -- (-751.992) (-746.519) [-743.154] (-748.321) * (-743.827) [-744.930] (-748.824) (-741.713) -- 0:00:08
916000 -- (-749.735) (-750.900) (-743.343) [-744.839] * (-756.333) (-743.150) [-744.959] (-745.879) -- 0:00:08
916500 -- (-747.887) (-748.652) [-741.247] (-745.890) * (-753.250) (-746.947) [-741.563] (-744.077) -- 0:00:08
917000 -- (-753.228) (-749.507) [-744.396] (-747.546) * (-752.613) (-742.046) (-745.995) [-750.726] -- 0:00:08
917500 -- (-755.671) (-749.870) (-743.284) [-751.106] * (-747.837) (-744.331) (-742.484) [-742.666] -- 0:00:08
918000 -- (-760.226) (-745.201) [-747.564] (-745.670) * [-754.389] (-744.349) (-744.779) (-746.162) -- 0:00:08
918500 -- (-752.240) (-746.324) [-744.583] (-745.674) * (-749.921) (-750.259) [-741.571] (-744.433) -- 0:00:08
919000 -- (-745.837) (-749.211) (-743.818) [-743.357] * [-751.291] (-744.349) (-748.679) (-747.306) -- 0:00:08
919500 -- (-748.478) (-748.929) [-743.486] (-746.777) * (-746.468) (-741.326) (-746.219) [-741.299] -- 0:00:08
920000 -- (-751.492) (-745.903) (-744.060) [-742.198] * (-744.076) (-747.828) [-745.830] (-747.699) -- 0:00:08
Average standard deviation of split frequencies: 0.004608
920500 -- (-747.539) [-750.592] (-743.384) (-741.260) * (-742.923) [-747.624] (-749.396) (-747.497) -- 0:00:08
921000 -- (-751.464) (-751.998) (-745.448) [-740.608] * (-754.356) (-748.288) [-748.995] (-746.560) -- 0:00:08
921500 -- (-750.866) (-745.177) (-745.375) [-739.785] * (-743.433) (-741.442) [-746.982] (-744.016) -- 0:00:08
922000 -- (-750.382) [-753.744] (-744.192) (-740.775) * (-744.098) (-743.784) [-741.056] (-747.301) -- 0:00:08
922500 -- [-745.218] (-742.630) (-744.882) (-745.614) * (-749.430) (-743.918) (-745.226) [-745.999] -- 0:00:07
923000 -- (-747.036) (-740.641) [-748.167] (-752.497) * [-745.306] (-744.313) (-746.140) (-745.098) -- 0:00:07
923500 -- (-749.734) [-742.609] (-747.598) (-751.602) * (-745.992) (-741.839) [-739.755] (-748.113) -- 0:00:07
924000 -- (-747.260) (-741.904) [-742.045] (-755.939) * (-747.538) [-742.696] (-750.390) (-744.724) -- 0:00:07
924500 -- (-748.334) (-743.589) (-741.028) [-751.017] * (-743.367) (-748.077) (-748.721) [-744.183] -- 0:00:07
925000 -- (-758.916) (-741.978) (-745.463) [-743.800] * [-743.970] (-743.512) (-744.633) (-740.487) -- 0:00:07
Average standard deviation of split frequencies: 0.005600
925500 -- (-752.539) (-746.497) [-744.601] (-746.673) * (-750.524) [-743.630] (-743.862) (-745.309) -- 0:00:07
926000 -- (-757.026) (-741.484) (-745.502) [-744.415] * (-745.065) (-744.334) (-742.973) [-747.861] -- 0:00:07
926500 -- (-751.069) (-746.057) [-742.058] (-748.230) * (-744.516) [-744.821] (-742.671) (-752.149) -- 0:00:07
927000 -- (-755.874) (-751.188) [-744.233] (-742.769) * (-747.952) (-747.669) (-747.709) [-744.845] -- 0:00:07
927500 -- (-751.929) [-749.772] (-743.364) (-746.555) * (-745.592) (-748.098) [-743.065] (-743.996) -- 0:00:07
928000 -- (-751.100) (-750.033) (-744.490) [-743.285] * (-741.378) (-750.341) [-745.881] (-751.874) -- 0:00:07
928500 -- (-746.509) (-750.416) [-747.656] (-744.724) * (-743.286) (-742.214) [-747.977] (-743.907) -- 0:00:07
929000 -- (-747.406) (-748.274) (-749.717) [-744.249] * (-752.807) (-743.430) [-740.505] (-743.164) -- 0:00:07
929500 -- (-746.598) (-748.285) [-747.556] (-744.176) * (-748.849) (-751.188) [-744.917] (-745.209) -- 0:00:07
930000 -- (-743.679) (-743.392) [-745.124] (-746.733) * (-741.117) (-747.205) (-745.667) [-745.100] -- 0:00:07
Average standard deviation of split frequencies: 0.006754
930500 -- (-743.250) (-744.915) [-745.297] (-752.136) * (-745.586) (-749.035) (-746.608) [-746.574] -- 0:00:07
931000 -- [-746.639] (-744.123) (-746.290) (-745.505) * (-740.458) (-746.200) [-744.564] (-742.432) -- 0:00:07
931500 -- (-743.143) [-743.077] (-748.094) (-747.498) * (-746.721) [-747.590] (-749.383) (-745.549) -- 0:00:07
932000 -- (-748.722) (-744.288) (-745.919) [-747.166] * (-751.124) [-746.563] (-749.128) (-747.392) -- 0:00:07
932500 -- (-745.565) [-745.542] (-745.070) (-748.270) * (-753.301) [-744.544] (-744.629) (-746.943) -- 0:00:06
933000 -- (-743.660) [-741.941] (-752.515) (-752.793) * (-754.039) (-750.751) [-750.419] (-743.526) -- 0:00:06
933500 -- [-741.215] (-744.180) (-750.274) (-748.973) * (-749.547) [-744.509] (-748.493) (-748.730) -- 0:00:06
934000 -- [-741.675] (-745.182) (-747.655) (-745.228) * [-749.434] (-757.910) (-742.852) (-744.117) -- 0:00:06
934500 -- (-745.008) (-746.723) (-753.154) [-743.196] * (-745.434) (-750.017) (-746.968) [-746.249] -- 0:00:06
935000 -- (-743.850) [-743.656] (-748.004) (-745.770) * [-751.944] (-752.760) (-747.350) (-745.689) -- 0:00:06
Average standard deviation of split frequencies: 0.005708
935500 -- (-746.362) (-746.881) (-744.008) [-743.998] * (-746.295) (-747.926) [-742.780] (-745.243) -- 0:00:06
936000 -- [-745.791] (-746.284) (-751.466) (-745.118) * (-745.504) (-745.168) [-742.597] (-743.728) -- 0:00:06
936500 -- (-744.957) [-745.968] (-751.347) (-746.359) * (-743.605) (-746.884) [-741.814] (-747.072) -- 0:00:06
937000 -- (-744.271) (-744.125) (-742.513) [-745.442] * [-745.682] (-748.877) (-752.179) (-745.465) -- 0:00:06
937500 -- (-752.642) [-741.618] (-744.139) (-742.643) * [-744.564] (-753.769) (-739.516) (-748.602) -- 0:00:06
938000 -- (-750.290) [-740.723] (-757.207) (-746.010) * (-744.345) (-743.963) (-747.981) [-745.414] -- 0:00:06
938500 -- (-751.333) (-742.582) (-751.839) [-747.702] * (-743.962) (-752.072) (-747.206) [-753.967] -- 0:00:06
939000 -- (-750.740) (-742.632) (-747.349) [-745.183] * (-741.062) (-744.160) (-745.111) [-742.453] -- 0:00:06
939500 -- (-748.005) (-746.158) [-741.397] (-743.550) * [-742.745] (-742.087) (-749.479) (-743.157) -- 0:00:06
940000 -- (-744.955) (-745.651) (-742.808) [-745.877] * [-745.539] (-745.752) (-752.131) (-745.832) -- 0:00:06
Average standard deviation of split frequencies: 0.006014
940500 -- [-748.978] (-741.513) (-749.937) (-743.896) * (-754.927) (-748.075) (-746.998) [-746.404] -- 0:00:06
941000 -- [-755.957] (-744.333) (-751.925) (-747.209) * (-746.117) [-746.278] (-742.824) (-748.479) -- 0:00:06
941500 -- [-745.913] (-744.702) (-747.167) (-749.947) * (-745.946) (-742.046) [-749.959] (-744.560) -- 0:00:06
942000 -- (-743.439) (-744.284) (-749.124) [-749.816] * (-747.040) (-748.266) [-743.309] (-744.240) -- 0:00:05
942500 -- (-746.112) (-748.619) [-743.088] (-742.445) * (-746.458) [-740.475] (-746.217) (-750.990) -- 0:00:05
943000 -- (-750.126) (-747.956) [-744.381] (-742.297) * (-751.194) [-748.252] (-744.258) (-751.719) -- 0:00:05
943500 -- (-744.141) (-749.406) [-749.733] (-747.617) * (-746.270) (-743.955) [-744.167] (-747.968) -- 0:00:05
944000 -- (-747.234) (-742.000) [-746.199] (-743.163) * (-751.395) [-746.727] (-746.656) (-746.910) -- 0:00:05
944500 -- (-742.031) [-746.635] (-743.326) (-747.926) * (-753.119) [-745.028] (-748.348) (-748.986) -- 0:00:05
945000 -- (-744.668) (-745.851) (-745.775) [-748.256] * (-756.452) (-745.969) [-745.023] (-745.013) -- 0:00:05
Average standard deviation of split frequencies: 0.003737
945500 -- [-741.582] (-745.113) (-742.773) (-747.475) * [-749.676] (-750.249) (-745.358) (-743.584) -- 0:00:05
946000 -- (-745.410) [-741.168] (-745.006) (-748.069) * (-743.651) (-751.804) (-746.126) [-746.800] -- 0:00:05
946500 -- (-749.953) (-741.410) [-746.434] (-744.764) * [-745.311] (-744.648) (-744.586) (-750.225) -- 0:00:05
947000 -- (-741.452) (-746.252) (-746.916) [-747.651] * (-742.528) (-751.577) [-744.711] (-746.238) -- 0:00:05
947500 -- [-743.698] (-747.384) (-743.598) (-751.829) * (-744.941) (-752.229) (-743.547) [-746.410] -- 0:00:05
948000 -- (-744.248) [-743.942] (-741.063) (-744.603) * (-742.439) (-753.742) [-740.875] (-746.187) -- 0:00:05
948500 -- (-745.682) (-743.726) (-743.841) [-745.304] * (-744.232) (-751.601) [-745.242] (-746.407) -- 0:00:05
949000 -- (-753.506) [-742.225] (-745.610) (-747.977) * (-751.904) (-749.591) [-745.161] (-748.334) -- 0:00:05
949500 -- (-749.611) [-741.724] (-749.053) (-745.894) * (-758.250) [-747.466] (-743.513) (-754.353) -- 0:00:05
950000 -- (-742.697) (-748.305) [-746.140] (-748.113) * (-753.850) (-744.898) [-742.442] (-743.480) -- 0:00:05
Average standard deviation of split frequencies: 0.003719
950500 -- (-746.918) [-746.425] (-742.701) (-751.046) * (-752.832) [-746.727] (-748.479) (-744.778) -- 0:00:05
951000 -- [-744.788] (-748.038) (-743.224) (-742.884) * (-749.047) (-753.806) [-744.054] (-743.626) -- 0:00:05
951500 -- (-742.377) (-748.136) (-745.761) [-742.621] * (-748.688) [-743.813] (-747.694) (-746.521) -- 0:00:04
952000 -- (-744.760) (-744.287) (-747.935) [-752.277] * (-746.786) [-745.935] (-746.469) (-750.200) -- 0:00:04
952500 -- [-740.432] (-743.473) (-745.479) (-752.785) * (-747.393) (-749.244) (-748.681) [-743.359] -- 0:00:04
953000 -- (-746.765) (-746.351) (-745.647) [-745.898] * (-742.730) (-746.536) [-748.861] (-745.419) -- 0:00:04
953500 -- (-742.247) (-745.226) (-752.472) [-740.707] * (-749.654) (-742.664) [-748.473] (-746.585) -- 0:00:04
954000 -- [-749.981] (-755.503) (-744.555) (-749.493) * [-743.474] (-752.573) (-750.867) (-742.973) -- 0:00:04
954500 -- (-753.849) (-745.737) (-742.062) [-746.271] * (-749.225) (-748.194) [-743.423] (-743.143) -- 0:00:04
955000 -- (-754.457) (-753.173) [-745.678] (-752.159) * (-752.280) (-742.118) (-749.670) [-741.110] -- 0:00:04
Average standard deviation of split frequencies: 0.003698
955500 -- (-743.896) (-742.438) [-746.999] (-752.993) * (-747.232) [-744.274] (-747.547) (-746.889) -- 0:00:04
956000 -- (-745.854) [-744.032] (-744.127) (-745.426) * (-744.899) [-742.197] (-751.342) (-747.225) -- 0:00:04
956500 -- (-747.602) [-744.410] (-746.661) (-745.375) * [-741.875] (-746.269) (-748.602) (-747.061) -- 0:00:04
957000 -- (-742.484) [-743.757] (-743.559) (-745.570) * (-747.481) [-748.660] (-755.675) (-754.434) -- 0:00:04
957500 -- (-745.955) (-748.818) [-740.591] (-742.875) * (-748.667) (-743.356) (-749.535) [-743.895] -- 0:00:04
958000 -- [-742.922] (-741.103) (-742.009) (-742.114) * (-751.360) (-741.076) (-746.150) [-742.653] -- 0:00:04
958500 -- (-750.323) (-748.410) (-748.261) [-744.252] * (-747.630) (-746.103) (-745.813) [-749.452] -- 0:00:04
959000 -- (-746.679) (-742.451) [-744.413] (-739.897) * (-745.639) [-744.060] (-743.631) (-750.572) -- 0:00:04
959500 -- (-745.638) (-746.291) [-743.203] (-741.544) * [-748.691] (-742.150) (-752.375) (-749.316) -- 0:00:04
960000 -- (-743.989) (-744.194) (-745.889) [-741.142] * (-748.441) (-744.519) [-744.779] (-742.158) -- 0:00:04
Average standard deviation of split frequencies: 0.003435
960500 -- (-751.942) (-743.423) (-749.712) [-743.938] * (-745.426) [-742.200] (-746.371) (-745.208) -- 0:00:04
961000 -- (-741.026) (-753.509) [-742.645] (-748.996) * (-744.735) (-747.864) (-748.254) [-748.829] -- 0:00:04
961500 -- (-742.847) (-749.731) (-743.925) [-742.213] * [-743.339] (-746.442) (-750.943) (-749.040) -- 0:00:03
962000 -- (-747.467) (-746.523) (-744.327) [-743.431] * (-749.576) [-744.483] (-750.714) (-747.898) -- 0:00:03
962500 -- (-744.515) (-747.780) [-745.232] (-745.106) * (-746.733) (-742.278) (-747.636) [-744.884] -- 0:00:03
963000 -- (-747.038) (-749.567) [-744.203] (-743.784) * (-745.209) (-750.034) (-742.498) [-741.783] -- 0:00:03
963500 -- (-748.055) (-748.607) (-750.912) [-745.718] * (-742.306) (-743.441) [-745.049] (-748.663) -- 0:00:03
964000 -- (-753.308) [-746.419] (-751.108) (-743.906) * (-744.620) (-740.700) [-743.623] (-746.347) -- 0:00:03
964500 -- (-745.246) (-749.102) [-738.786] (-743.260) * [-746.426] (-744.061) (-743.487) (-742.565) -- 0:00:03
965000 -- (-743.920) (-747.349) (-743.113) [-745.057] * (-746.095) (-745.672) (-743.952) [-742.630] -- 0:00:03
Average standard deviation of split frequencies: 0.003904
965500 -- (-749.394) (-753.354) (-746.531) [-746.253] * [-743.566] (-746.428) (-746.061) (-749.932) -- 0:00:03
966000 -- [-745.526] (-749.930) (-748.212) (-745.001) * (-750.969) (-749.269) (-749.873) [-745.693] -- 0:00:03
966500 -- (-748.213) [-749.855] (-744.232) (-751.164) * [-745.041] (-748.229) (-746.623) (-752.950) -- 0:00:03
967000 -- [-743.314] (-755.343) (-746.476) (-746.239) * [-743.078] (-746.281) (-744.020) (-741.985) -- 0:00:03
967500 -- (-743.075) (-745.295) [-743.853] (-746.721) * (-744.178) (-743.283) [-745.538] (-753.271) -- 0:00:03
968000 -- (-742.301) [-745.924] (-740.773) (-749.964) * (-744.778) (-744.658) [-740.186] (-747.877) -- 0:00:03
968500 -- (-747.862) (-749.280) (-742.042) [-745.041] * (-744.420) [-742.654] (-745.569) (-745.622) -- 0:00:03
969000 -- (-745.723) [-746.992] (-746.204) (-743.789) * (-742.482) (-748.269) [-744.976] (-754.119) -- 0:00:03
969500 -- (-743.421) (-749.657) (-746.851) [-741.594] * (-746.382) (-742.982) [-742.190] (-743.597) -- 0:00:03
970000 -- [-749.028] (-742.946) (-744.101) (-748.231) * (-744.146) [-745.367] (-749.274) (-744.725) -- 0:00:03
Average standard deviation of split frequencies: 0.004128
970500 -- (-746.501) [-741.486] (-743.087) (-742.775) * (-743.633) [-746.734] (-749.627) (-747.061) -- 0:00:03
971000 -- (-748.050) (-741.401) (-743.096) [-743.444] * (-747.873) (-743.349) (-751.223) [-746.559] -- 0:00:02
971500 -- (-751.954) (-738.531) (-745.378) [-741.662] * (-747.314) [-743.014] (-745.828) (-746.673) -- 0:00:02
972000 -- (-750.513) [-739.115] (-746.285) (-745.345) * (-748.718) [-743.168] (-745.649) (-745.603) -- 0:00:02
972500 -- (-749.498) (-741.527) (-744.957) [-744.536] * (-745.960) [-745.595] (-746.641) (-746.589) -- 0:00:02
973000 -- [-742.559] (-747.756) (-748.054) (-752.590) * (-746.748) (-745.611) (-749.595) [-741.721] -- 0:00:02
973500 -- [-749.578] (-750.589) (-744.013) (-743.445) * (-743.329) [-747.233] (-749.271) (-748.548) -- 0:00:02
974000 -- [-745.538] (-742.859) (-749.217) (-740.272) * (-748.413) [-745.936] (-750.608) (-745.631) -- 0:00:02
974500 -- (-745.464) (-744.284) [-744.864] (-746.407) * [-748.243] (-741.636) (-743.313) (-752.921) -- 0:00:02
975000 -- (-752.366) (-747.618) (-746.763) [-741.165] * (-744.405) [-744.309] (-746.766) (-749.389) -- 0:00:02
Average standard deviation of split frequencies: 0.005071
975500 -- (-753.194) (-741.286) (-745.682) [-742.712] * (-744.820) [-745.543] (-746.022) (-744.604) -- 0:00:02
976000 -- (-750.257) (-740.342) (-744.110) [-745.924] * (-742.752) [-744.735] (-747.980) (-742.814) -- 0:00:02
976500 -- [-743.119] (-746.884) (-744.911) (-746.180) * (-748.686) [-745.648] (-746.293) (-747.407) -- 0:00:02
977000 -- (-749.095) (-746.888) (-747.242) [-748.119] * (-749.856) (-742.214) [-744.861] (-746.938) -- 0:00:02
977500 -- (-744.369) (-747.225) [-746.632] (-742.130) * (-741.178) (-750.960) (-743.233) [-745.955] -- 0:00:02
978000 -- (-744.831) (-747.613) (-740.974) [-739.942] * (-741.492) [-749.016] (-751.867) (-741.709) -- 0:00:02
978500 -- (-742.896) (-748.985) (-742.739) [-743.434] * (-748.615) (-747.800) [-746.051] (-746.582) -- 0:00:02
979000 -- (-738.979) (-751.684) (-740.762) [-743.835] * (-746.146) (-745.650) [-742.829] (-742.556) -- 0:00:02
979500 -- (-744.526) (-744.620) (-745.182) [-745.638] * [-748.216] (-748.700) (-751.016) (-747.202) -- 0:00:02
980000 -- (-740.742) (-744.393) (-749.099) [-748.652] * (-740.737) [-755.696] (-744.260) (-743.948) -- 0:00:02
Average standard deviation of split frequencies: 0.004567
980500 -- [-745.285] (-741.651) (-745.314) (-749.998) * (-747.920) (-748.469) (-748.590) [-745.287] -- 0:00:02
981000 -- [-743.260] (-743.987) (-744.053) (-749.098) * (-740.880) (-750.682) (-744.175) [-744.548] -- 0:00:01
981500 -- (-753.446) [-747.515] (-747.836) (-744.071) * [-750.172] (-748.047) (-745.877) (-749.651) -- 0:00:01
982000 -- (-747.003) (-743.572) [-742.342] (-747.622) * (-759.205) [-745.595] (-745.548) (-747.135) -- 0:00:01
982500 -- [-744.897] (-747.433) (-753.898) (-750.045) * [-748.780] (-748.551) (-743.135) (-752.716) -- 0:00:01
983000 -- (-747.969) [-745.319] (-744.811) (-746.596) * (-749.178) [-742.974] (-748.071) (-752.665) -- 0:00:01
983500 -- [-750.234] (-744.382) (-750.721) (-742.710) * (-748.231) (-744.145) [-744.760] (-753.940) -- 0:00:01
984000 -- (-746.189) [-748.595] (-744.193) (-749.036) * (-746.990) [-743.517] (-745.387) (-754.391) -- 0:00:01
984500 -- [-746.706] (-744.676) (-744.664) (-745.046) * [-746.136] (-744.390) (-742.648) (-754.388) -- 0:00:01
985000 -- (-750.445) (-748.344) (-744.838) [-742.395] * (-751.105) (-747.568) (-746.173) [-749.328] -- 0:00:01
Average standard deviation of split frequencies: 0.004303
985500 -- (-749.218) [-744.067] (-744.216) (-755.059) * (-745.694) [-743.693] (-747.127) (-748.564) -- 0:00:01
986000 -- [-743.820] (-747.021) (-743.229) (-744.175) * (-750.333) (-743.248) [-742.098] (-744.300) -- 0:00:01
986500 -- (-744.213) [-741.703] (-743.518) (-741.707) * (-749.868) (-743.359) [-745.195] (-748.110) -- 0:00:01
987000 -- (-761.788) (-748.887) [-742.974] (-747.361) * (-748.339) (-744.729) [-742.165] (-748.630) -- 0:00:01
987500 -- (-753.864) [-743.766] (-745.561) (-756.610) * (-745.437) (-745.491) (-746.890) [-745.845] -- 0:00:01
988000 -- (-748.284) (-747.033) (-742.504) [-743.466] * (-743.252) (-749.095) [-743.522] (-745.499) -- 0:00:01
988500 -- (-745.410) (-745.484) [-741.416] (-748.306) * (-745.589) (-755.026) (-744.379) [-747.619] -- 0:00:01
989000 -- [-746.081] (-746.805) (-742.942) (-746.479) * [-743.915] (-743.929) (-744.318) (-748.355) -- 0:00:01
989500 -- (-740.924) (-744.707) (-748.508) [-747.112] * (-742.150) (-752.668) (-745.975) [-743.290] -- 0:00:01
990000 -- (-753.934) (-745.231) [-739.611] (-747.589) * [-749.649] (-755.314) (-746.663) (-746.335) -- 0:00:01
Average standard deviation of split frequencies: 0.004045
990500 -- (-747.494) [-745.737] (-744.225) (-749.619) * (-747.563) [-742.518] (-744.619) (-754.471) -- 0:00:00
991000 -- (-755.463) (-751.541) (-746.431) [-751.488] * (-749.644) (-743.842) [-746.997] (-742.404) -- 0:00:00
991500 -- [-749.480] (-744.266) (-746.857) (-747.523) * (-742.032) (-748.130) (-749.981) [-741.678] -- 0:00:00
992000 -- [-742.929] (-742.967) (-742.092) (-745.498) * (-742.882) (-741.887) (-746.778) [-750.923] -- 0:00:00
992500 -- [-742.729] (-746.742) (-748.477) (-752.315) * (-745.875) (-743.457) (-743.350) [-741.875] -- 0:00:00
993000 -- [-743.433] (-746.489) (-747.841) (-750.203) * (-748.769) (-746.764) (-751.458) [-748.277] -- 0:00:00
993500 -- [-743.583] (-747.254) (-745.283) (-747.773) * [-743.258] (-751.465) (-747.880) (-747.694) -- 0:00:00
994000 -- [-749.530] (-744.484) (-744.460) (-745.660) * (-744.580) (-751.454) (-745.067) [-745.806] -- 0:00:00
994500 -- [-749.148] (-747.002) (-744.651) (-746.191) * (-753.082) (-743.731) [-742.538] (-746.971) -- 0:00:00
995000 -- (-746.927) (-742.068) [-748.089] (-748.602) * (-750.807) (-747.602) [-743.045] (-746.267) -- 0:00:00
Average standard deviation of split frequencies: 0.003786
995500 -- [-748.790] (-749.195) (-745.101) (-751.486) * (-747.876) (-744.170) (-745.520) [-744.370] -- 0:00:00
996000 -- (-747.254) (-743.368) (-750.013) [-743.409] * (-746.613) (-747.493) (-743.943) [-744.553] -- 0:00:00
996500 -- (-745.655) (-743.461) [-744.457] (-744.893) * (-746.841) (-744.285) (-740.294) [-746.556] -- 0:00:00
997000 -- (-743.764) (-747.208) (-747.581) [-744.305] * (-745.253) (-746.896) [-746.113] (-751.028) -- 0:00:00
997500 -- (-745.421) (-749.987) [-750.995] (-743.038) * (-743.531) [-744.321] (-742.276) (-751.928) -- 0:00:00
998000 -- (-748.481) [-746.725] (-744.160) (-754.889) * (-745.048) (-744.963) (-743.791) [-747.196] -- 0:00:00
998500 -- (-755.174) (-747.282) (-743.110) [-744.954] * [-746.118] (-747.514) (-749.707) (-747.602) -- 0:00:00
999000 -- (-749.208) [-744.836] (-746.832) (-745.417) * (-744.355) (-742.133) (-748.516) [-744.464] -- 0:00:00
999500 -- (-745.412) [-740.954] (-748.804) (-743.688) * [-745.640] (-745.144) (-741.618) (-756.926) -- 0:00:00
1000000 -- (-750.739) (-758.467) (-750.389) [-742.977] * (-747.040) (-743.253) (-747.326) [-751.274] -- 0:00:00
Average standard deviation of split frequencies: 0.004004
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -750.738948 -- 12.487032
Chain 1 -- -750.738948 -- 12.487032
Chain 2 -- -758.467156 -- 11.403617
Chain 2 -- -758.467156 -- 11.403617
Chain 3 -- -750.388922 -- 11.675439
Chain 3 -- -750.388922 -- 11.675439
Chain 4 -- -742.976569 -- 9.292610
Chain 4 -- -742.976569 -- 9.292610
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -747.040444 -- 9.771695
Chain 1 -- -747.040444 -- 9.771695
Chain 2 -- -743.252993 -- 3.790863
Chain 2 -- -743.252993 -- 3.790863
Chain 3 -- -747.326237 -- 13.035872
Chain 3 -- -747.326237 -- 13.035872
Chain 4 -- -751.273565 -- 12.355702
Chain 4 -- -751.273563 -- 12.355702
Analysis completed in 1 mins 43 seconds
Analysis used 102.52 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -737.35
Likelihood of best state for "cold" chain of run 2 was -737.35
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
44.0 % ( 32 %) Dirichlet(Revmat{all})
64.6 % ( 49 %) Slider(Revmat{all})
32.1 % ( 32 %) Dirichlet(Pi{all})
33.0 % ( 22 %) Slider(Pi{all})
59.8 % ( 30 %) Multiplier(Alpha{1,2})
46.4 % ( 23 %) Multiplier(Alpha{3})
65.1 % ( 42 %) Slider(Pinvar{all})
30.2 % ( 32 %) NNI(Tau{all},V{all})
24.1 % ( 27 %) ParsSPR(Tau{all},V{all})
26.4 % ( 26 %) Multiplier(V{all})
40.7 % ( 37 %) Nodeslider(V{all})
26.4 % ( 34 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
44.4 % ( 31 %) Dirichlet(Revmat{all})
64.6 % ( 52 %) Slider(Revmat{all})
32.0 % ( 32 %) Dirichlet(Pi{all})
31.5 % ( 25 %) Slider(Pi{all})
60.0 % ( 28 %) Multiplier(Alpha{1,2})
46.9 % ( 29 %) Multiplier(Alpha{3})
64.9 % ( 43 %) Slider(Pinvar{all})
30.3 % ( 20 %) NNI(Tau{all},V{all})
24.0 % ( 18 %) ParsSPR(Tau{all},V{all})
26.3 % ( 30 %) Multiplier(V{all})
40.6 % ( 36 %) Nodeslider(V{all})
26.2 % ( 28 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.84 0.70 0.58
2 | 166931 0.86 0.72
3 | 166201 166470 0.86
4 | 166881 167441 166076
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.84 0.70 0.58
2 | 166368 0.85 0.72
3 | 166772 166484 0.87
4 | 166829 166704 166843
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -743.83
| 2 1 1 |
| 2 2 2 |
| 1 1 1 * 1 1 2 12 |
| 2 1 1 22 1 2 1 1 |
|112 11 2 2 12 11 2 2 12 2 1 |
|2 1 1 1 * 2 1 1122 221 22 2 |
| 1* 1 1 11 1 12211 * 1|
| 1 2 22 2 2 1 121 2|
| 2 2 1 2 1 *2 2 * 1 2 1 2 2 |
| 22 1 2 12 1 2 2 |
| 2 1 2 1 1 |
| 2 2 |
| |
| |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -747.18
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -742.50 -751.52
2 -742.57 -752.69
--------------------------------------
TOTAL -742.54 -752.27
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/96/CG1840-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.465374 0.014658 0.267025 0.716394 0.444457 1027.48 1154.69 1.000
r(A<->C){all} 0.206571 0.005772 0.070171 0.359691 0.198798 463.96 656.87 1.000
r(A<->G){all} 0.070161 0.000967 0.020661 0.135151 0.065027 866.38 899.90 1.000
r(A<->T){all} 0.122038 0.004655 0.001412 0.2482 