--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Dec 02 22:54:26 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/85/CG15829-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/85/CG15829-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/85/CG15829-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/85/CG15829-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -531.58 -552.49
2 -531.63 -553.18
--------------------------------------
TOTAL -531.60 -552.89
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/85/CG15829-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/85/CG15829-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/85/CG15829-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.746025 0.086223 0.282839 1.332027 0.691944 729.47 778.93 1.000
r(A<->C){all} 0.016801 0.000332 0.000001 0.052564 0.010866 812.33 829.78 1.000
r(A<->G){all} 0.143191 0.014017 0.009679 0.399299 0.105011 269.55 291.32 1.003
r(A<->T){all} 0.098938 0.008971 0.000024 0.290434 0.070173 177.09 192.42 1.000
r(C<->G){all} 0.046308 0.001258 0.000001 0.113571 0.038388 321.32 440.32 1.000
r(C<->T){all} 0.595002 0.033495 0.264043 0.914290 0.610883 131.33 188.33 1.000
r(G<->T){all} 0.099762 0.005429 0.000171 0.240737 0.081829 259.85 320.37 1.000
pi(A){all} 0.274094 0.000750 0.224018 0.330308 0.273607 978.39 1009.85 1.001
pi(C){all} 0.299995 0.000833 0.245800 0.356319 0.299186 1157.32 1193.05 1.000
pi(G){all} 0.287220 0.000800 0.232026 0.341683 0.286438 1254.78 1269.64 1.001
pi(T){all} 0.138690 0.000466 0.098836 0.181435 0.137597 500.84 726.50 1.000
alpha{1,2} 0.139888 0.009491 0.000496 0.305965 0.126651 747.88 757.04 1.001
alpha{3} 0.883340 0.276789 0.162795 1.944694 0.765161 1085.35 1187.91 1.000
pinvar{all} 0.644240 0.013961 0.410498 0.832324 0.667211 512.35 513.34 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -459.638409
Model 2: PositiveSelection -459.638409
Model 0: one-ratio -467.870452
Model 3: discrete -459.271559
Model 7: beta -459.29781
Model 8: beta&w>1 -459.29787
Model 0 vs 1 16.464085999999952
Model 2 vs 1 0.0
Model 8 vs 7 1.199999999244028E-4
>C1
MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
>C2
MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTAEDAKAYYIEVYKKYAPQYE
>C3
MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTAEDAKAYYIEVYKKYAPQYE
>C4
MPTFEEIVEKAKNFKNLPTKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTIDDAKAYYIEVYKKYAAQYE
>C5
MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
>C6
MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
>C7
MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
>C8
MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTAEDAKKYYIEVYKKYAPQYE
>C9
MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
>C10
MPTFEEIVEKAKSFKNLPTKEEFLEFYGYYKQATVGDCNIDEPEDEEKKA
RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=10, Len=82
C1 MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
C2 MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
C3 MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
C4 MPTFEEIVEKAKNFKNLPTKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
C5 MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
C6 MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
C7 MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
C8 MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
C9 MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
C10 MPTFEEIVEKAKSFKNLPTKEEFLEFYGYYKQATVGDCNIDEPEDEEKKA
************.*****:*********************:*********
C1 RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
C2 RYNAWKSKAGLTAEDAKAYYIEVYKKYAPQYE
C3 RYNAWKSKAGLTAEDAKAYYIEVYKKYAPQYE
C4 RYNAWKSKAGLTIDDAKAYYIEVYKKYAAQYE
C5 RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
C6 RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
C7 RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
C8 RYNAWKSKAGLTAEDAKKYYIEVYKKYAPQYE
C9 RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
C10 RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
************ :*** **********.***
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 82 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 82 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7380]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [7380]--->[7380]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/85/CG15829-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.490 Mb, Max= 30.687 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
>C2
MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTAEDAKAYYIEVYKKYAPQYE
>C3
MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTAEDAKAYYIEVYKKYAPQYE
>C4
MPTFEEIVEKAKNFKNLPTKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTIDDAKAYYIEVYKKYAAQYE
>C5
MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
>C6
MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
>C7
MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
>C8
MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTAEDAKKYYIEVYKKYAPQYE
>C9
MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
>C10
MPTFEEIVEKAKSFKNLPTKEEFLEFYGYYKQATVGDCNIDEPEDEEKKA
RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
FORMAT of file /tmp/tmp6127650356675810522aln Not Supported[FATAL:T-COFFEE]
>C1
MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
>C2
MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTAEDAKAYYIEVYKKYAPQYE
>C3
MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTAEDAKAYYIEVYKKYAPQYE
>C4
MPTFEEIVEKAKNFKNLPTKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTIDDAKAYYIEVYKKYAAQYE
>C5
MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
>C6
MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
>C7
MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
>C8
MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTAEDAKKYYIEVYKKYAPQYE
>C9
MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
>C10
MPTFEEIVEKAKSFKNLPTKEEFLEFYGYYKQATVGDCNIDEPEDEEKKA
RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:82 S:100 BS:82
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# PW_SEQ_DISTANCES
BOT 0 1 98.78 C1 C2 98.78
TOP 1 0 98.78 C2 C1 98.78
BOT 0 2 98.78 C1 C3 98.78
TOP 2 0 98.78 C3 C1 98.78
BOT 0 3 96.34 C1 C4 96.34
TOP 3 0 96.34 C4 C1 96.34
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 0 6 100.00 C1 C7 100.00
TOP 6 0 100.00 C7 C1 100.00
BOT 0 7 97.56 C1 C8 97.56
TOP 7 0 97.56 C8 C1 97.56
BOT 0 8 100.00 C1 C9 100.00
TOP 8 0 100.00 C9 C1 100.00
BOT 0 9 96.34 C1 C10 96.34
TOP 9 0 96.34 C10 C1 96.34
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 95.12 C2 C4 95.12
TOP 3 1 95.12 C4 C2 95.12
BOT 1 4 98.78 C2 C5 98.78
TOP 4 1 98.78 C5 C2 98.78
BOT 1 5 98.78 C2 C6 98.78
TOP 5 1 98.78 C6 C2 98.78
BOT 1 6 98.78 C2 C7 98.78
TOP 6 1 98.78 C7 C2 98.78
BOT 1 7 98.78 C2 C8 98.78
TOP 7 1 98.78 C8 C2 98.78
BOT 1 8 98.78 C2 C9 98.78
TOP 8 1 98.78 C9 C2 98.78
BOT 1 9 95.12 C2 C10 95.12
TOP 9 1 95.12 C10 C2 95.12
BOT 2 3 95.12 C3 C4 95.12
TOP 3 2 95.12 C4 C3 95.12
BOT 2 4 98.78 C3 C5 98.78
TOP 4 2 98.78 C5 C3 98.78
BOT 2 5 98.78 C3 C6 98.78
TOP 5 2 98.78 C6 C3 98.78
BOT 2 6 98.78 C3 C7 98.78
TOP 6 2 98.78 C7 C3 98.78
BOT 2 7 98.78 C3 C8 98.78
TOP 7 2 98.78 C8 C3 98.78
BOT 2 8 98.78 C3 C9 98.78
TOP 8 2 98.78 C9 C3 98.78
BOT 2 9 95.12 C3 C10 95.12
TOP 9 2 95.12 C10 C3 95.12
BOT 3 4 96.34 C4 C5 96.34
TOP 4 3 96.34 C5 C4 96.34
BOT 3 5 96.34 C4 C6 96.34
TOP 5 3 96.34 C6 C4 96.34
BOT 3 6 96.34 C4 C7 96.34
TOP 6 3 96.34 C7 C4 96.34
BOT 3 7 93.90 C4 C8 93.90
TOP 7 3 93.90 C8 C4 93.90
BOT 3 8 96.34 C4 C9 96.34
TOP 8 3 96.34 C9 C4 96.34
BOT 3 9 95.12 C4 C10 95.12
TOP 9 3 95.12 C10 C4 95.12
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
BOT 4 6 100.00 C5 C7 100.00
TOP 6 4 100.00 C7 C5 100.00
BOT 4 7 97.56 C5 C8 97.56
TOP 7 4 97.56 C8 C5 97.56
BOT 4 8 100.00 C5 C9 100.00
TOP 8 4 100.00 C9 C5 100.00
BOT 4 9 96.34 C5 C10 96.34
TOP 9 4 96.34 C10 C5 96.34
BOT 5 6 100.00 C6 C7 100.00
TOP 6 5 100.00 C7 C6 100.00
BOT 5 7 97.56 C6 C8 97.56
TOP 7 5 97.56 C8 C6 97.56
BOT 5 8 100.00 C6 C9 100.00
TOP 8 5 100.00 C9 C6 100.00
BOT 5 9 96.34 C6 C10 96.34
TOP 9 5 96.34 C10 C6 96.34
BOT 6 7 97.56 C7 C8 97.56
TOP 7 6 97.56 C8 C7 97.56
BOT 6 8 100.00 C7 C9 100.00
TOP 8 6 100.00 C9 C7 100.00
BOT 6 9 96.34 C7 C10 96.34
TOP 9 6 96.34 C10 C7 96.34
BOT 7 8 97.56 C8 C9 97.56
TOP 8 7 97.56 C9 C8 97.56
BOT 7 9 93.90 C8 C10 93.90
TOP 9 7 93.90 C10 C8 93.90
BOT 8 9 96.34 C9 C10 96.34
TOP 9 8 96.34 C10 C9 96.34
AVG 0 C1 * 98.64
AVG 1 C2 * 98.10
AVG 2 C3 * 98.10
AVG 3 C4 * 95.66
AVG 4 C5 * 98.64
AVG 5 C6 * 98.64
AVG 6 C7 * 98.64
AVG 7 C8 * 97.02
AVG 8 C9 * 98.64
AVG 9 C10 * 95.66
TOT TOT * 97.78
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCCCACCTTTGAGGAGATCGTCGAGAAGGCCAAGAACTTCAAGAACCT
C2 ATGCCCACCTTTGAGGAGATCGTCGAGAAGGCCAAGAACTTCAAGAACCT
C3 ATGCCCACCTTTGAGGAGATCGTCGAGAAGGCCAAGAACTTCAAGAACCT
C4 ATGCCCACCTTTGAGGAGATCGTCGAGAAGGCCAAGAACTTCAAGAACCT
C5 ATGCCCACCTTTGAGGAGATCGTCGAGAAGGCCAAGAACTTCAAGAACCT
C6 ATGCCCACCTTTGAGGAGATCGTCGAGAAGGCCAAGAACTTCAAGAACCT
C7 ATGCCCACCTTTGAGGAGATTGTCGAGAAGGCCAAGAACTTCAAGAACCT
C8 ATGCCCACCTTTGAAGAGATCGTCGAGAAGGCCAAGAACTTCAAGAACCT
C9 ATGCCCACCTTTGAGGAGATCGTCGAGAAGGCCAAGAACTTCAAGAACCT
C10 ATGCCCACCTTTGAGGAGATCGTCGAGAAGGCCAAGAGCTTCAAGAACCT
**************.***** ****************.************
C1 GCCTAGCAAGGAGGAGTTCCTCGAGTTCTACGGCTACTACAAGCAGGCCA
C2 GCCCAGCAAGGAGGAGTTCCTCGAGTTCTACGGCTACTACAAGCAGGCCA
C3 GCCCAGCAAGGAGGAGTTCCTCGAGTTCTACGGCTACTACAAGCAGGCCA
C4 GCCCACCAAGGAGGAGTTCCTCGAGTTCTACGGCTACTACAAGCAGGCCA
C5 GCCCAGCAAGGAGGAGTTCCTCGAGTTCTACGGCTACTACAAACAGGCCA
C6 GCCCAGCAAGGAGGAGTTCCTCGAGTTCTACGGCTACTACAAGCAGGCCA
C7 GCCCAGCAAGGAGGAGTTCCTCGAGTTCTACGGCTACTACAAGCAGGCCA
C8 GCCCTCCAAGGAGGAGTTCCTCGAGTTCTACGGCTACTACAAGCAGGCCA
C9 GCCCTCCAAGGAGGAGTTCCTCGAGTTCTACGGCTACTACAAGCAGGCCA
C10 GCCCACCAAGGAGGAGTTCCTCGAGTTCTACGGCTACTACAAGCAGGCCA
*** : ************************************.*******
C1 CCGTCGGCGACTGCAACATCGAGGAGCCGGAAGATGAGGAGAAGAAGGCC
C2 CCGTCGGCGACTGCAACATCGAGGAGCCGGAGGATGAGGAGAAGAAGGCT
C3 CCGTCGGCGACTGCAACATCGAGGAGCCGGAGGATGAGGAGAAGAAGGCC
C4 CCGTCGGCGACTGCAACATCGAGGAGCCGGAGGATGAGGAGAAGAAGGCC
C5 CCGTCGGCGACTGCAACATCGAGGAGCCGGAGGATGAGGAGAAGAAGGCC
C6 CCGTGGGCGACTGCAACATCGAGGAGCCGGAGGATGAGGAGAAGAAGGCC
C7 CCGTTGGTGACTGCAACATCGAGGAGCCAGAGGATGAGGAGAAGAAGGCC
C8 CCGTTGGCGATTGCAACATCGAGGAGCCGGAGGACGAGGAGAAGAAGGCC
C9 CCGTCGGCGACTGCAACATCGAGGAGCCGGAGGACGAGGAGAAGAAGGCC
C10 CCGTCGGCGACTGCAACATCGATGAGCCGGAGGACGAGGAGAAGAAGGCC
**** ** ** *********** *****.**.** **************
C1 CGCTACAACGCCTGGAAGAGCAAGGCCGGTCTGACCGCCGATGATGCCAA
C2 CGCTACAACGCCTGGAAGAGCAAGGCCGGTCTGACCGCCGAGGATGCCAA
C3 CGCTACAACGCCTGGAAGAGCAAGGCCGGTCTGACCGCCGAGGATGCCAA
C4 CGCTACAACGCCTGGAAGAGCAAGGCCGGTCTGACCATCGACGATGCCAA
C5 CGCTACAATGCCTGGAAGAGCAAGGCCGGTCTGACCGCCGATGATGCCAA
C6 CGCTACAACGCCTGGAAGAGCAAGGCCGGTCTGACCGCCGACGATGCCAA
C7 CGCTACAATGCCTGGAAGAGCAAGGCCGGTCTGACCGCCGATGATGCCAA
C8 CGCTACAATGCCTGGAAGAGCAAGGCCGGTCTGACCGCCGAGGATGCCAA
C9 CGCTACAATGCGTGGAAGAGCAAGGCCGGTCTGACCGCCGACGATGCCAA
C10 CGCTACAATGCCTGGAAGAGCAAGGCCGGTCTGACCGCCGACGATGCCAA
******** ** ************************. *** ********
C1 GGCCTACTACATCGAGGTCTACAAGAAGTACGCTCCCCAGTACGAA
C2 GGCCTACTACATCGAGGTCTACAAGAAGTACGCTCCCCAGTACGAA
C3 GGCCTACTACATCGAGGTCTACAAGAAGTACGCTCCCCAGTACGAA
C4 GGCCTACTACATCGAGGTCTACAAGAAGTACGCTGCCCAGTACGAA
C5 GGCCTACTACATCGAGGTCTACAAGAAGTACGCTCCCCAGTACGAA
C6 GGCTTACTACATCGAGGTCTACAAGAAGTACGCTCCCCAGTACGAA
C7 GGCCTACTACATCGAGGTCTACAAGAAGTACGCTCCCCAGTACGAA
C8 GAAGTACTACATCGAGGTCTACAAGAAGTACGCTCCCCAGTACGAA
C9 GGCCTACTACATCGAGGTCTACAAGAAGTACGCTCCCCAGTACGAA
C10 GGCCTACTACATCGAGGTCTACAAGAAGTACGCTCCCCAGTACGAA
*.. ****************************** ***********
>C1
ATGCCCACCTTTGAGGAGATCGTCGAGAAGGCCAAGAACTTCAAGAACCT
GCCTAGCAAGGAGGAGTTCCTCGAGTTCTACGGCTACTACAAGCAGGCCA
CCGTCGGCGACTGCAACATCGAGGAGCCGGAAGATGAGGAGAAGAAGGCC
CGCTACAACGCCTGGAAGAGCAAGGCCGGTCTGACCGCCGATGATGCCAA
GGCCTACTACATCGAGGTCTACAAGAAGTACGCTCCCCAGTACGAA
>C2
ATGCCCACCTTTGAGGAGATCGTCGAGAAGGCCAAGAACTTCAAGAACCT
GCCCAGCAAGGAGGAGTTCCTCGAGTTCTACGGCTACTACAAGCAGGCCA
CCGTCGGCGACTGCAACATCGAGGAGCCGGAGGATGAGGAGAAGAAGGCT
CGCTACAACGCCTGGAAGAGCAAGGCCGGTCTGACCGCCGAGGATGCCAA
GGCCTACTACATCGAGGTCTACAAGAAGTACGCTCCCCAGTACGAA
>C3
ATGCCCACCTTTGAGGAGATCGTCGAGAAGGCCAAGAACTTCAAGAACCT
GCCCAGCAAGGAGGAGTTCCTCGAGTTCTACGGCTACTACAAGCAGGCCA
CCGTCGGCGACTGCAACATCGAGGAGCCGGAGGATGAGGAGAAGAAGGCC
CGCTACAACGCCTGGAAGAGCAAGGCCGGTCTGACCGCCGAGGATGCCAA
GGCCTACTACATCGAGGTCTACAAGAAGTACGCTCCCCAGTACGAA
>C4
ATGCCCACCTTTGAGGAGATCGTCGAGAAGGCCAAGAACTTCAAGAACCT
GCCCACCAAGGAGGAGTTCCTCGAGTTCTACGGCTACTACAAGCAGGCCA
CCGTCGGCGACTGCAACATCGAGGAGCCGGAGGATGAGGAGAAGAAGGCC
CGCTACAACGCCTGGAAGAGCAAGGCCGGTCTGACCATCGACGATGCCAA
GGCCTACTACATCGAGGTCTACAAGAAGTACGCTGCCCAGTACGAA
>C5
ATGCCCACCTTTGAGGAGATCGTCGAGAAGGCCAAGAACTTCAAGAACCT
GCCCAGCAAGGAGGAGTTCCTCGAGTTCTACGGCTACTACAAACAGGCCA
CCGTCGGCGACTGCAACATCGAGGAGCCGGAGGATGAGGAGAAGAAGGCC
CGCTACAATGCCTGGAAGAGCAAGGCCGGTCTGACCGCCGATGATGCCAA
GGCCTACTACATCGAGGTCTACAAGAAGTACGCTCCCCAGTACGAA
>C6
ATGCCCACCTTTGAGGAGATCGTCGAGAAGGCCAAGAACTTCAAGAACCT
GCCCAGCAAGGAGGAGTTCCTCGAGTTCTACGGCTACTACAAGCAGGCCA
CCGTGGGCGACTGCAACATCGAGGAGCCGGAGGATGAGGAGAAGAAGGCC
CGCTACAACGCCTGGAAGAGCAAGGCCGGTCTGACCGCCGACGATGCCAA
GGCTTACTACATCGAGGTCTACAAGAAGTACGCTCCCCAGTACGAA
>C7
ATGCCCACCTTTGAGGAGATTGTCGAGAAGGCCAAGAACTTCAAGAACCT
GCCCAGCAAGGAGGAGTTCCTCGAGTTCTACGGCTACTACAAGCAGGCCA
CCGTTGGTGACTGCAACATCGAGGAGCCAGAGGATGAGGAGAAGAAGGCC
CGCTACAATGCCTGGAAGAGCAAGGCCGGTCTGACCGCCGATGATGCCAA
GGCCTACTACATCGAGGTCTACAAGAAGTACGCTCCCCAGTACGAA
>C8
ATGCCCACCTTTGAAGAGATCGTCGAGAAGGCCAAGAACTTCAAGAACCT
GCCCTCCAAGGAGGAGTTCCTCGAGTTCTACGGCTACTACAAGCAGGCCA
CCGTTGGCGATTGCAACATCGAGGAGCCGGAGGACGAGGAGAAGAAGGCC
CGCTACAATGCCTGGAAGAGCAAGGCCGGTCTGACCGCCGAGGATGCCAA
GAAGTACTACATCGAGGTCTACAAGAAGTACGCTCCCCAGTACGAA
>C9
ATGCCCACCTTTGAGGAGATCGTCGAGAAGGCCAAGAACTTCAAGAACCT
GCCCTCCAAGGAGGAGTTCCTCGAGTTCTACGGCTACTACAAGCAGGCCA
CCGTCGGCGACTGCAACATCGAGGAGCCGGAGGACGAGGAGAAGAAGGCC
CGCTACAATGCGTGGAAGAGCAAGGCCGGTCTGACCGCCGACGATGCCAA
GGCCTACTACATCGAGGTCTACAAGAAGTACGCTCCCCAGTACGAA
>C10
ATGCCCACCTTTGAGGAGATCGTCGAGAAGGCCAAGAGCTTCAAGAACCT
GCCCACCAAGGAGGAGTTCCTCGAGTTCTACGGCTACTACAAGCAGGCCA
CCGTCGGCGACTGCAACATCGATGAGCCGGAGGACGAGGAGAAGAAGGCC
CGCTACAATGCCTGGAAGAGCAAGGCCGGTCTGACCGCCGACGATGCCAA
GGCCTACTACATCGAGGTCTACAAGAAGTACGCTCCCCAGTACGAA
>C1
MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
>C2
MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTAEDAKAYYIEVYKKYAPQYE
>C3
MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTAEDAKAYYIEVYKKYAPQYE
>C4
MPTFEEIVEKAKNFKNLPTKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTIDDAKAYYIEVYKKYAAQYE
>C5
MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
>C6
MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
>C7
MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
>C8
MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTAEDAKKYYIEVYKKYAPQYE
>C9
MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
>C10
MPTFEEIVEKAKSFKNLPTKEEFLEFYGYYKQATVGDCNIDEPEDEEKKA
RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/85/CG15829-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 10 taxa and 246 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Taxon 10 -> C10
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1480718968
Setting output file names to "/opt/ADOPS/85/CG15829-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 2069706577
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 6980945902
Seed = 523151980
Swapseed = 1480718968
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 8 unique site patterns
Division 2 has 8 unique site patterns
Division 3 has 19 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -847.161168 -- -24.412588
Chain 2 -- -853.942249 -- -24.412588
Chain 3 -- -858.635602 -- -24.412588
Chain 4 -- -851.988790 -- -24.412588
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -853.211516 -- -24.412588
Chain 2 -- -852.344355 -- -24.412588
Chain 3 -- -854.133495 -- -24.412588
Chain 4 -- -852.444612 -- -24.412588
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-847.161] (-853.942) (-858.636) (-851.989) * [-853.212] (-852.344) (-854.133) (-852.445)
500 -- (-540.384) [-547.078] (-548.718) (-558.297) * [-551.119] (-553.486) (-541.296) (-545.700) -- 0:00:00
1000 -- (-550.564) [-549.077] (-551.103) (-550.083) * [-538.119] (-541.775) (-556.737) (-553.206) -- 0:00:00
1500 -- [-546.276] (-541.197) (-556.652) (-557.926) * (-540.545) (-551.497) (-550.348) [-534.147] -- 0:00:00
2000 -- (-542.709) (-536.269) (-551.054) [-542.099] * [-529.975] (-540.691) (-539.054) (-541.693) -- 0:00:00
2500 -- [-531.797] (-549.944) (-543.833) (-549.941) * (-544.534) (-535.991) [-536.095] (-542.494) -- 0:00:00
3000 -- (-543.229) (-546.013) (-554.660) [-540.354] * [-535.449] (-547.129) (-555.492) (-543.383) -- 0:00:00
3500 -- [-529.055] (-558.429) (-553.583) (-550.544) * (-543.447) [-540.570] (-541.883) (-540.790) -- 0:00:00
4000 -- (-533.608) (-546.580) [-535.468] (-541.380) * (-550.481) [-538.112] (-536.345) (-544.406) -- 0:00:00
4500 -- (-532.627) (-551.202) (-548.212) [-541.153] * (-540.332) (-543.857) [-540.462] (-537.213) -- 0:03:41
5000 -- (-532.174) (-556.386) [-539.172] (-551.121) * (-549.756) (-555.405) (-553.690) [-532.003] -- 0:03:19
Average standard deviation of split frequencies: 0.089791
5500 -- (-544.123) (-534.755) (-531.816) [-549.404] * (-554.983) (-545.245) [-540.411] (-537.042) -- 0:03:00
6000 -- (-551.102) [-539.080] (-546.694) (-539.132) * (-548.478) (-541.779) [-535.158] (-531.924) -- 0:02:45
6500 -- (-536.294) [-541.839] (-534.450) (-549.758) * (-558.553) [-542.216] (-537.873) (-549.763) -- 0:02:32
7000 -- (-557.241) [-533.472] (-547.234) (-543.918) * [-537.167] (-555.280) (-546.966) (-546.384) -- 0:02:21
7500 -- (-554.159) (-546.718) [-535.697] (-543.100) * (-549.275) (-557.323) [-535.752] (-551.534) -- 0:02:12
8000 -- (-554.228) [-540.059] (-539.935) (-552.868) * (-548.717) (-541.713) [-529.807] (-557.730) -- 0:02:04
8500 -- (-543.988) (-545.450) (-541.037) [-537.192] * (-543.482) (-562.106) [-553.355] (-549.242) -- 0:01:56
9000 -- (-545.491) [-539.792] (-538.444) (-549.346) * [-542.096] (-558.488) (-537.250) (-562.749) -- 0:01:50
9500 -- (-551.771) [-539.786] (-532.684) (-539.940) * (-552.074) (-555.415) (-545.037) [-556.727] -- 0:01:44
10000 -- [-543.554] (-538.116) (-543.262) (-546.082) * (-549.713) (-560.126) [-531.838] (-544.191) -- 0:01:39
Average standard deviation of split frequencies: 0.085115
10500 -- (-546.467) (-543.355) (-545.170) [-531.495] * [-544.216] (-571.015) (-539.809) (-545.826) -- 0:03:08
11000 -- (-555.631) [-544.359] (-541.779) (-549.943) * (-545.470) (-559.008) [-530.128] (-550.985) -- 0:02:59
11500 -- (-543.523) [-535.666] (-539.439) (-554.525) * (-551.420) (-554.626) (-537.816) [-547.374] -- 0:02:51
12000 -- (-547.348) (-537.749) [-543.370] (-559.712) * (-545.245) (-549.109) [-536.935] (-558.856) -- 0:02:44
12500 -- (-555.964) (-542.764) (-551.648) [-535.103] * (-554.054) (-542.382) [-541.486] (-562.951) -- 0:02:38
13000 -- (-556.772) [-542.435] (-550.407) (-557.024) * (-549.405) (-549.411) [-534.270] (-550.464) -- 0:02:31
13500 -- (-547.609) (-531.769) (-551.191) [-542.265] * (-545.038) (-544.463) [-534.698] (-545.833) -- 0:02:26
14000 -- (-544.611) [-526.774] (-560.539) (-541.916) * (-544.768) (-555.720) [-546.555] (-555.423) -- 0:02:20
14500 -- (-550.587) [-536.695] (-551.102) (-547.188) * [-545.891] (-548.577) (-542.324) (-552.766) -- 0:02:15
15000 -- (-539.542) [-531.594] (-554.662) (-547.935) * [-540.163] (-544.115) (-553.090) (-541.376) -- 0:02:11
Average standard deviation of split frequencies: 0.070149
15500 -- (-556.551) [-535.997] (-558.170) (-548.566) * [-539.366] (-541.174) (-553.680) (-542.342) -- 0:02:07
16000 -- (-547.461) (-542.271) (-553.249) [-541.523] * [-536.195] (-555.223) (-561.912) (-544.139) -- 0:02:03
16500 -- (-538.290) (-540.859) (-547.725) [-544.840] * [-547.933] (-540.301) (-554.013) (-554.988) -- 0:02:58
17000 -- (-542.247) (-540.187) (-553.209) [-541.797] * (-547.009) (-540.796) [-546.092] (-552.531) -- 0:02:53
17500 -- (-555.952) (-531.631) [-550.139] (-548.114) * [-531.225] (-546.428) (-554.062) (-555.114) -- 0:02:48
18000 -- (-556.982) [-529.973] (-553.096) (-545.274) * (-544.444) (-555.388) (-551.411) [-544.346] -- 0:02:43
18500 -- (-557.752) (-537.869) (-548.908) [-539.024] * (-543.120) (-546.455) (-547.599) [-541.141] -- 0:02:39
19000 -- (-552.170) (-531.027) (-549.494) [-530.287] * (-546.764) (-538.133) (-543.634) [-534.511] -- 0:02:34
19500 -- (-554.345) (-535.910) (-547.400) [-530.035] * (-544.821) [-548.721] (-545.721) (-547.548) -- 0:02:30
20000 -- (-549.718) [-538.674] (-551.476) (-546.068) * [-539.891] (-552.900) (-557.760) (-552.886) -- 0:02:27
Average standard deviation of split frequencies: 0.056482
20500 -- (-548.702) [-538.366] (-550.899) (-536.083) * [-538.295] (-557.547) (-551.160) (-545.160) -- 0:02:23
21000 -- (-551.814) [-528.096] (-551.251) (-544.578) * (-558.128) (-563.972) [-549.678] (-547.526) -- 0:02:19
21500 -- (-550.571) [-548.041] (-548.542) (-549.438) * (-545.529) (-548.047) [-548.031] (-544.803) -- 0:02:16
22000 -- (-547.653) (-531.591) (-554.569) [-546.165] * [-540.278] (-555.206) (-546.620) (-545.431) -- 0:02:13
22500 -- (-553.358) [-541.605] (-552.838) (-547.392) * (-554.169) [-545.961] (-552.440) (-540.123) -- 0:02:53
23000 -- (-557.314) [-546.634] (-553.817) (-546.879) * (-546.736) (-541.892) [-544.117] (-546.370) -- 0:02:49
23500 -- (-554.353) [-540.232] (-549.662) (-549.060) * (-546.973) (-554.962) [-538.707] (-557.563) -- 0:02:46
24000 -- (-550.066) [-535.032] (-558.504) (-555.399) * (-554.661) (-551.085) [-545.671] (-554.717) -- 0:02:42
24500 -- [-548.232] (-544.202) (-554.809) (-561.782) * [-550.565] (-558.051) (-546.585) (-547.599) -- 0:02:39
25000 -- (-549.135) [-531.891] (-540.437) (-554.082) * (-549.497) [-539.784] (-545.968) (-545.167) -- 0:02:36
Average standard deviation of split frequencies: 0.050162
25500 -- (-545.655) (-546.141) (-557.654) [-547.056] * [-534.769] (-554.900) (-538.717) (-553.919) -- 0:02:32
26000 -- (-546.695) (-540.681) (-548.358) [-545.886] * (-553.787) [-543.532] (-544.925) (-550.715) -- 0:02:29
26500 -- (-547.441) [-545.141] (-548.265) (-541.191) * (-548.875) (-553.051) (-542.763) [-545.587] -- 0:02:26
27000 -- [-548.079] (-552.581) (-542.982) (-545.448) * (-538.730) (-555.994) [-538.193] (-544.469) -- 0:02:24
27500 -- (-547.878) (-540.338) (-551.275) [-546.751] * [-538.087] (-546.177) (-544.745) (-553.834) -- 0:02:21
28000 -- (-548.823) (-553.054) [-545.915] (-540.782) * [-540.728] (-551.094) (-538.846) (-556.348) -- 0:02:18
28500 -- (-550.555) [-554.656] (-548.243) (-550.682) * [-542.410] (-551.847) (-549.130) (-540.943) -- 0:02:50
29000 -- (-547.232) (-544.020) [-534.914] (-553.804) * (-541.111) (-549.263) [-544.158] (-555.533) -- 0:02:47
29500 -- (-543.786) [-541.310] (-549.470) (-549.294) * [-530.999] (-540.913) (-539.110) (-542.170) -- 0:02:44
30000 -- (-543.710) [-536.222] (-549.197) (-542.838) * (-545.441) (-551.758) [-549.556] (-554.101) -- 0:02:41
Average standard deviation of split frequencies: 0.048121
30500 -- (-539.336) [-535.731] (-551.095) (-545.804) * (-539.568) (-547.246) [-539.940] (-548.329) -- 0:02:38
31000 -- (-555.798) (-538.210) (-541.613) [-546.136] * [-542.085] (-544.926) (-541.284) (-545.224) -- 0:02:36
31500 -- (-539.488) (-556.652) (-545.441) [-544.536] * [-534.447] (-553.834) (-550.863) (-542.982) -- 0:02:33
32000 -- (-541.604) (-553.527) (-550.048) [-532.317] * (-550.531) [-547.537] (-551.530) (-543.959) -- 0:02:31
32500 -- [-543.656] (-548.330) (-546.207) (-538.527) * (-539.418) (-545.045) (-555.197) [-535.816] -- 0:02:28
33000 -- (-548.430) (-542.136) (-552.129) [-537.787] * [-539.965] (-547.745) (-552.892) (-536.923) -- 0:02:26
33500 -- [-550.800] (-559.859) (-546.088) (-552.630) * (-541.719) (-556.193) (-548.890) [-544.183] -- 0:02:24
34000 -- (-542.144) (-535.416) (-542.924) [-541.630] * (-551.732) (-546.811) (-550.252) [-542.049] -- 0:02:22
34500 -- [-545.542] (-553.266) (-543.849) (-552.457) * (-541.943) [-538.680] (-556.955) (-545.676) -- 0:02:47
35000 -- (-549.269) (-561.327) [-540.545] (-545.457) * (-559.263) [-544.113] (-547.713) (-547.336) -- 0:02:45
Average standard deviation of split frequencies: 0.044896
35500 -- (-539.103) (-543.961) (-544.958) [-539.149] * (-547.838) (-550.836) [-545.336] (-554.143) -- 0:02:43
36000 -- [-535.976] (-544.326) (-540.098) (-550.569) * [-539.328] (-558.159) (-550.856) (-544.850) -- 0:02:40
36500 -- (-543.235) [-543.991] (-541.738) (-535.476) * [-551.064] (-552.184) (-543.655) (-541.957) -- 0:02:38
37000 -- [-550.879] (-553.354) (-549.419) (-547.690) * [-544.716] (-544.738) (-536.394) (-549.024) -- 0:02:36
37500 -- (-554.381) [-530.737] (-546.272) (-553.808) * (-552.958) [-540.603] (-552.746) (-551.263) -- 0:02:34
38000 -- (-544.619) [-539.110] (-558.363) (-543.101) * (-557.644) [-541.409] (-544.510) (-549.982) -- 0:02:31
38500 -- (-547.441) [-545.179] (-563.882) (-544.501) * (-542.300) (-552.778) [-548.026] (-544.464) -- 0:02:29
39000 -- (-552.338) [-537.538] (-550.024) (-549.536) * (-550.357) (-551.961) (-546.578) [-546.247] -- 0:02:27
39500 -- [-539.243] (-539.762) (-540.699) (-554.105) * (-544.451) (-555.813) [-538.339] (-537.611) -- 0:02:25
40000 -- (-551.890) [-537.303] (-553.208) (-544.035) * [-546.390] (-559.717) (-542.588) (-547.905) -- 0:02:24
Average standard deviation of split frequencies: 0.043148
40500 -- [-534.636] (-550.463) (-549.239) (-546.345) * [-544.635] (-545.540) (-548.395) (-558.810) -- 0:02:45
41000 -- [-533.730] (-540.808) (-560.115) (-546.162) * (-549.595) (-549.463) [-545.035] (-534.488) -- 0:02:43
41500 -- (-543.067) (-536.653) [-543.487] (-556.910) * (-549.366) (-562.813) [-554.533] (-554.744) -- 0:02:41
42000 -- (-541.906) (-545.043) [-547.345] (-545.462) * (-539.944) (-551.757) (-556.704) [-544.951] -- 0:02:39
42500 -- (-552.090) (-535.472) (-552.210) [-550.405] * [-534.676] (-541.163) (-551.904) (-543.015) -- 0:02:37
43000 -- (-544.610) [-545.897] (-551.853) (-546.652) * (-544.928) (-557.305) [-540.966] (-539.483) -- 0:02:35
43500 -- (-552.537) (-546.558) [-549.547] (-538.494) * [-557.203] (-559.886) (-545.115) (-541.186) -- 0:02:33
44000 -- [-544.165] (-550.540) (-546.195) (-549.786) * (-547.586) (-547.383) (-552.110) [-539.880] -- 0:02:32
44500 -- (-546.202) (-549.247) (-554.606) [-543.108] * (-541.441) (-554.413) (-537.676) [-535.373] -- 0:02:30
45000 -- (-545.486) (-542.826) [-548.573] (-548.621) * [-535.522] (-551.495) (-541.287) (-555.173) -- 0:02:28
Average standard deviation of split frequencies: 0.041883
45500 -- (-549.246) (-540.955) (-541.230) [-539.055] * (-541.199) (-542.962) [-543.624] (-551.677) -- 0:02:26
46000 -- (-550.148) [-544.066] (-548.892) (-553.726) * [-535.961] (-559.448) (-543.337) (-544.682) -- 0:02:45
46500 -- (-553.801) [-540.999] (-545.049) (-546.945) * (-561.244) (-544.339) (-543.689) [-537.698] -- 0:02:44
47000 -- (-548.574) (-543.407) (-547.995) [-542.953] * (-544.453) (-549.354) (-548.958) [-536.499] -- 0:02:42
47500 -- (-550.670) [-530.416] (-537.548) (-549.668) * (-546.073) (-553.251) (-553.155) [-538.093] -- 0:02:40
48000 -- (-554.442) (-536.854) [-532.892] (-551.358) * [-550.209] (-556.313) (-559.606) (-532.637) -- 0:02:38
48500 -- (-550.789) (-536.677) (-543.752) [-544.571] * (-543.185) (-544.915) (-537.106) [-540.405] -- 0:02:36
49000 -- (-557.205) (-544.619) [-542.377] (-555.117) * [-538.571] (-557.342) (-544.578) (-545.852) -- 0:02:35
49500 -- (-547.464) [-536.905] (-532.839) (-548.823) * (-536.385) [-540.365] (-547.407) (-539.746) -- 0:02:33
50000 -- (-545.379) (-539.214) [-544.543] (-553.174) * (-538.960) [-543.989] (-557.061) (-547.102) -- 0:02:32
Average standard deviation of split frequencies: 0.048635
50500 -- [-545.270] (-541.275) (-542.063) (-552.572) * (-540.019) (-555.703) (-544.129) [-534.935] -- 0:02:30
51000 -- (-537.613) [-544.592] (-550.932) (-557.588) * [-539.622] (-544.203) (-550.266) (-536.332) -- 0:02:28
51500 -- [-541.527] (-550.323) (-552.210) (-541.205) * (-552.937) (-551.858) (-553.654) [-538.933] -- 0:02:27
52000 -- (-552.718) [-549.532] (-548.916) (-544.165) * (-542.352) [-531.250] (-537.483) (-541.106) -- 0:02:44
52500 -- [-539.883] (-547.241) (-549.912) (-545.971) * (-544.590) (-550.921) (-546.673) [-551.585] -- 0:02:42
53000 -- [-536.354] (-549.040) (-546.299) (-561.069) * (-543.514) (-545.624) (-546.311) [-537.566] -- 0:02:40
53500 -- [-541.438] (-541.409) (-549.749) (-563.074) * (-544.431) (-555.777) [-539.846] (-547.290) -- 0:02:39
54000 -- (-547.368) (-547.597) [-540.811] (-561.809) * (-549.132) (-559.156) (-545.873) [-539.299] -- 0:02:37
54500 -- (-544.249) [-546.881] (-552.465) (-552.716) * (-541.071) (-545.860) (-547.555) [-535.690] -- 0:02:36
55000 -- [-542.334] (-552.689) (-547.227) (-546.084) * (-555.732) (-545.026) [-545.704] (-538.251) -- 0:02:34
Average standard deviation of split frequencies: 0.045036
55500 -- [-541.191] (-551.877) (-544.376) (-542.705) * (-549.710) [-541.083] (-556.674) (-543.081) -- 0:02:33
56000 -- (-544.498) (-560.613) [-545.392] (-542.450) * (-547.524) (-533.050) (-546.418) [-542.419] -- 0:02:31
56500 -- (-549.817) (-550.701) [-546.373] (-539.322) * [-548.387] (-541.519) (-548.998) (-531.577) -- 0:02:30
57000 -- (-547.689) (-552.562) [-539.958] (-557.739) * (-549.566) (-546.750) (-540.955) [-533.098] -- 0:02:28
57500 -- (-550.023) [-535.652] (-547.308) (-553.328) * (-540.106) (-571.048) (-543.260) [-539.791] -- 0:02:27
58000 -- [-538.228] (-546.710) (-545.345) (-541.880) * (-535.844) (-546.187) [-533.693] (-539.543) -- 0:02:42
58500 -- (-552.836) (-550.044) (-539.235) [-543.241] * (-540.211) (-546.359) (-557.988) [-540.076] -- 0:02:40
59000 -- (-554.509) (-546.748) [-541.512] (-555.838) * (-535.093) [-535.865] (-538.948) (-549.714) -- 0:02:39
59500 -- (-542.087) (-551.212) (-554.461) [-543.420] * (-541.107) [-544.674] (-541.724) (-534.173) -- 0:02:38
60000 -- [-535.681] (-556.156) (-539.810) (-541.726) * (-541.541) (-560.244) [-546.535] (-533.925) -- 0:02:36
Average standard deviation of split frequencies: 0.044291
60500 -- (-541.954) (-550.607) [-542.299] (-543.346) * [-530.213] (-546.970) (-543.828) (-541.648) -- 0:02:35
61000 -- (-544.082) (-553.633) [-548.453] (-547.043) * (-543.348) (-556.247) (-538.646) [-541.375] -- 0:02:33
61500 -- [-536.049] (-545.852) (-544.070) (-550.474) * [-541.239] (-560.482) (-545.154) (-542.605) -- 0:02:32
62000 -- [-537.530] (-547.839) (-543.742) (-549.391) * [-538.863] (-550.380) (-545.859) (-538.424) -- 0:02:31
62500 -- (-536.339) (-549.243) [-538.034] (-566.521) * (-548.954) [-546.117] (-543.774) (-533.944) -- 0:02:30
63000 -- (-540.703) (-556.413) (-545.750) [-550.273] * (-546.957) (-547.664) (-536.369) [-531.173] -- 0:02:28
63500 -- (-553.958) (-554.316) [-539.278] (-547.848) * (-549.188) [-535.409] (-550.311) (-532.490) -- 0:02:27
64000 -- (-545.898) [-541.690] (-545.168) (-553.323) * (-546.301) [-536.862] (-548.045) (-541.921) -- 0:02:40
64500 -- (-545.671) [-549.750] (-545.402) (-548.860) * [-539.200] (-538.448) (-558.466) (-542.108) -- 0:02:39
65000 -- (-550.258) [-539.086] (-537.236) (-546.183) * (-536.134) [-532.252] (-556.884) (-545.065) -- 0:02:38
Average standard deviation of split frequencies: 0.039284
65500 -- (-546.708) [-560.440] (-553.293) (-555.809) * (-545.825) (-540.805) (-552.787) [-541.548] -- 0:02:36
66000 -- (-543.624) [-541.762] (-541.723) (-555.529) * (-538.985) [-541.990] (-535.473) (-548.779) -- 0:02:35
66500 -- (-544.179) (-559.719) [-539.321] (-538.196) * (-542.144) [-540.480] (-545.493) (-546.894) -- 0:02:34
67000 -- (-543.484) (-549.490) [-532.434] (-545.001) * (-534.392) (-550.138) (-545.774) [-541.748] -- 0:02:33
67500 -- (-551.511) (-550.636) [-542.978] (-544.770) * [-532.586] (-549.510) (-542.430) (-539.410) -- 0:02:31
68000 -- (-550.677) (-559.190) [-553.265] (-542.872) * (-540.408) (-546.495) [-530.736] (-561.272) -- 0:02:30
68500 -- (-543.115) (-542.500) (-553.526) [-548.604] * (-548.054) (-548.604) (-554.582) [-542.697] -- 0:02:29
69000 -- [-540.703] (-554.823) (-536.667) (-552.222) * (-543.210) [-544.485] (-553.981) (-551.356) -- 0:02:28
69500 -- (-556.891) (-550.482) [-544.443] (-543.131) * (-542.468) [-548.986] (-549.276) (-552.910) -- 0:02:27
70000 -- [-544.050] (-551.596) (-544.801) (-538.340) * (-543.440) (-556.828) [-557.271] (-556.006) -- 0:02:39
Average standard deviation of split frequencies: 0.033725
70500 -- (-545.477) (-553.673) [-544.325] (-540.084) * (-541.986) (-563.507) (-545.650) [-548.895] -- 0:02:38
71000 -- [-547.885] (-547.229) (-548.102) (-553.133) * [-543.358] (-551.231) (-550.396) (-548.157) -- 0:02:37
71500 -- [-539.090] (-547.467) (-553.020) (-553.621) * [-551.341] (-543.010) (-549.314) (-544.872) -- 0:02:35
72000 -- (-546.788) (-548.770) [-539.349] (-554.408) * [-544.518] (-534.889) (-553.097) (-545.293) -- 0:02:34
72500 -- [-541.417] (-549.276) (-552.240) (-551.385) * (-555.833) [-541.851] (-548.738) (-547.011) -- 0:02:33
73000 -- [-537.329] (-560.649) (-540.973) (-540.331) * [-537.340] (-544.033) (-548.036) (-549.736) -- 0:02:32
73500 -- [-538.360] (-544.484) (-552.496) (-544.025) * (-551.487) [-535.298] (-560.513) (-547.880) -- 0:02:31
74000 -- (-551.490) [-543.353] (-552.027) (-536.048) * (-553.339) (-554.951) (-553.142) [-542.797] -- 0:02:30
74500 -- [-533.892] (-542.045) (-559.216) (-538.183) * [-541.870] (-561.613) (-547.216) (-539.455) -- 0:02:29
75000 -- [-545.363] (-547.492) (-549.251) (-537.333) * (-546.593) (-543.489) [-536.683] (-549.352) -- 0:02:28
Average standard deviation of split frequencies: 0.032736
75500 -- (-539.626) (-546.441) (-554.037) [-536.558] * (-536.969) [-540.997] (-548.154) (-540.276) -- 0:02:26
76000 -- (-534.842) (-554.089) (-548.948) [-550.302] * (-554.079) (-544.542) (-534.196) [-537.195] -- 0:02:38
76500 -- (-540.934) (-558.746) (-552.319) [-536.664] * (-552.940) [-533.028] (-543.324) (-550.643) -- 0:02:36
77000 -- (-555.760) (-547.603) (-546.307) [-540.685] * (-550.577) (-554.092) [-538.961] (-554.315) -- 0:02:35
77500 -- (-555.026) [-534.435] (-554.437) (-541.020) * (-556.961) (-556.322) (-553.921) [-540.342] -- 0:02:34
78000 -- [-546.694] (-542.925) (-546.429) (-543.859) * (-553.412) [-537.950] (-543.579) (-545.556) -- 0:02:33
78500 -- (-553.827) (-546.937) (-545.756) [-536.568] * (-544.980) [-536.761] (-547.327) (-548.029) -- 0:02:32
79000 -- [-540.006] (-537.016) (-552.839) (-539.307) * (-549.213) [-534.035] (-539.472) (-552.443) -- 0:02:31
79500 -- [-536.241] (-546.959) (-555.097) (-547.420) * (-551.285) [-536.957] (-549.438) (-546.851) -- 0:02:30
80000 -- [-539.953] (-544.171) (-545.605) (-552.370) * (-548.579) [-545.208] (-551.119) (-543.006) -- 0:02:29
Average standard deviation of split frequencies: 0.031282
80500 -- (-547.290) (-554.237) (-550.932) [-541.110] * (-555.037) [-533.702] (-540.106) (-547.145) -- 0:02:28
81000 -- [-542.195] (-547.258) (-546.763) (-545.846) * (-553.358) (-542.609) [-534.809] (-555.225) -- 0:02:27
81500 -- (-547.321) (-550.931) [-542.758] (-544.234) * (-550.017) [-544.843] (-549.314) (-543.872) -- 0:02:26
82000 -- (-550.192) [-543.287] (-549.611) (-534.657) * (-551.433) (-543.497) (-544.156) [-543.788] -- 0:02:36
82500 -- (-544.873) (-552.534) (-553.046) [-538.793] * (-560.577) [-539.148] (-547.063) (-548.086) -- 0:02:35
83000 -- (-544.967) (-553.462) (-561.757) [-538.588] * (-558.887) (-548.958) [-535.690] (-545.738) -- 0:02:34
83500 -- (-532.777) [-544.199] (-553.744) (-546.260) * (-553.760) (-543.449) (-533.260) [-539.245] -- 0:02:33
84000 -- (-540.900) (-550.551) (-547.023) [-544.559] * [-551.409] (-540.899) (-539.712) (-540.855) -- 0:02:32
84500 -- [-534.564] (-538.304) (-551.497) (-548.864) * (-547.643) (-542.164) [-543.533] (-545.357) -- 0:02:31
85000 -- [-547.461] (-551.800) (-549.571) (-530.590) * (-557.015) (-545.256) [-536.959] (-557.849) -- 0:02:30
Average standard deviation of split frequencies: 0.025580
85500 -- (-537.121) (-560.149) [-541.296] (-548.143) * (-548.774) [-546.514] (-548.773) (-546.189) -- 0:02:29
86000 -- (-541.676) [-548.383] (-556.483) (-546.428) * [-536.397] (-555.484) (-539.170) (-546.041) -- 0:02:28
86500 -- (-548.672) (-544.170) [-555.033] (-551.684) * (-554.456) (-546.520) [-531.074] (-551.361) -- 0:02:27
87000 -- [-545.663] (-535.103) (-564.341) (-546.906) * (-548.043) (-540.293) [-539.239] (-548.148) -- 0:02:26
87500 -- [-539.191] (-546.962) (-549.988) (-550.116) * [-542.934] (-533.849) (-541.695) (-558.373) -- 0:02:26
88000 -- [-545.409] (-552.475) (-555.559) (-551.544) * (-554.443) (-541.962) (-538.264) [-547.643] -- 0:02:35
88500 -- (-552.089) (-549.293) (-553.717) [-553.626] * (-559.431) [-536.536] (-546.320) (-555.702) -- 0:02:34
89000 -- (-539.319) (-555.404) (-551.272) [-551.647] * (-550.397) [-541.331] (-550.696) (-549.081) -- 0:02:33
89500 -- (-559.393) (-550.937) (-555.063) [-538.463] * (-540.779) (-544.679) (-546.106) [-541.920] -- 0:02:32
90000 -- (-554.080) (-555.518) [-535.544] (-536.545) * (-541.288) (-554.181) (-535.083) [-544.946] -- 0:02:31
Average standard deviation of split frequencies: 0.027091
90500 -- [-544.666] (-554.625) (-558.446) (-546.442) * (-546.327) (-553.548) (-559.145) [-550.932] -- 0:02:30
91000 -- (-547.490) [-540.969] (-543.094) (-548.106) * (-535.080) (-560.167) [-541.286] (-558.732) -- 0:02:29
91500 -- (-557.037) [-536.883] (-551.871) (-540.547) * (-546.002) [-541.701] (-540.674) (-554.849) -- 0:02:28
92000 -- (-548.838) (-537.688) (-543.263) [-538.003] * (-553.084) (-547.983) [-544.033] (-549.825) -- 0:02:28
92500 -- (-549.410) (-541.815) (-549.884) [-536.752] * (-544.435) (-541.266) [-542.984] (-546.848) -- 0:02:27
93000 -- (-547.563) [-542.495] (-553.820) (-543.083) * (-544.545) (-546.115) (-549.927) [-545.459] -- 0:02:26
93500 -- (-560.326) [-535.963] (-545.987) (-539.062) * (-543.565) (-542.595) [-545.712] (-545.942) -- 0:02:25
94000 -- (-548.182) [-536.331] (-549.413) (-545.213) * [-540.844] (-546.981) (-544.811) (-545.250) -- 0:02:34
94500 -- (-541.440) (-556.454) [-552.263] (-548.717) * (-544.914) [-538.868] (-552.402) (-545.628) -- 0:02:33
95000 -- (-552.997) [-540.164] (-543.321) (-552.035) * (-538.599) (-542.224) (-547.440) [-547.222] -- 0:02:32
Average standard deviation of split frequencies: 0.028946
95500 -- (-542.191) [-545.711] (-551.009) (-541.500) * [-533.991] (-552.154) (-546.547) (-550.452) -- 0:02:31
96000 -- (-550.457) [-533.995] (-551.751) (-543.205) * [-547.043] (-541.780) (-542.647) (-551.602) -- 0:02:30
96500 -- (-549.857) [-544.312] (-540.305) (-536.837) * [-542.904] (-550.269) (-543.982) (-553.672) -- 0:02:29
97000 -- (-549.096) (-550.594) (-546.895) [-536.070] * (-543.338) (-542.359) (-549.303) [-547.430] -- 0:02:28
97500 -- (-550.796) (-531.467) (-554.082) [-535.648] * (-545.680) (-548.856) [-538.386] (-537.064) -- 0:02:28
98000 -- (-546.204) (-547.337) (-543.949) [-545.014] * (-535.615) (-556.970) (-555.181) [-537.616] -- 0:02:27
98500 -- [-536.101] (-547.824) (-546.954) (-547.417) * (-550.810) (-552.348) [-540.470] (-541.035) -- 0:02:26
99000 -- (-541.465) (-545.403) (-546.912) [-538.080] * (-548.125) (-548.801) [-541.182] (-539.232) -- 0:02:25
99500 -- [-547.981] (-553.686) (-549.805) (-549.479) * (-538.504) (-553.781) (-553.615) [-546.443] -- 0:02:33
100000 -- (-545.015) (-551.415) [-535.958] (-540.242) * [-544.321] (-541.092) (-558.663) (-533.663) -- 0:02:33
Average standard deviation of split frequencies: 0.026016
100500 -- [-543.547] (-546.798) (-562.235) (-544.673) * [-540.016] (-546.359) (-545.092) (-539.183) -- 0:02:32
101000 -- (-549.156) (-545.113) (-557.077) [-543.597] * (-542.424) (-550.499) (-550.838) [-539.957] -- 0:02:31
101500 -- (-551.102) [-539.833] (-560.841) (-539.365) * [-537.480] (-548.521) (-554.480) (-541.024) -- 0:02:30
102000 -- (-552.372) [-531.536] (-542.640) (-538.971) * (-551.245) (-543.055) (-546.602) [-549.819] -- 0:02:29
102500 -- (-554.237) [-540.003] (-555.434) (-536.007) * (-560.878) (-549.181) (-544.646) [-535.767] -- 0:02:28
103000 -- (-552.516) (-542.762) (-545.199) [-543.463] * (-542.625) (-550.536) [-541.481] (-534.957) -- 0:02:28
103500 -- (-549.600) [-545.441] (-555.113) (-533.505) * [-544.508] (-543.168) (-551.542) (-539.633) -- 0:02:27
104000 -- (-547.987) (-550.027) (-548.834) [-536.734] * (-548.028) [-541.993] (-560.617) (-556.608) -- 0:02:26
104500 -- (-551.035) (-546.734) (-551.428) [-538.547] * (-542.748) (-555.708) (-552.676) [-540.672] -- 0:02:25
105000 -- (-558.519) [-548.003] (-558.119) (-539.638) * (-543.312) (-543.530) [-546.992] (-554.411) -- 0:02:24
Average standard deviation of split frequencies: 0.026160
105500 -- (-549.228) (-541.077) (-546.285) [-543.456] * [-542.109] (-551.520) (-538.236) (-549.120) -- 0:02:32
106000 -- (-546.722) (-552.721) (-549.128) [-535.980] * [-543.511] (-549.991) (-543.041) (-553.646) -- 0:02:31
106500 -- (-563.710) (-543.140) (-548.258) [-540.621] * [-542.724] (-551.150) (-549.076) (-547.902) -- 0:02:31
107000 -- [-544.074] (-541.995) (-552.349) (-543.578) * [-547.937] (-542.007) (-551.736) (-551.433) -- 0:02:30
107500 -- (-551.619) (-542.738) [-547.654] (-538.092) * (-549.170) (-549.534) (-550.557) [-541.701] -- 0:02:29
108000 -- (-546.237) (-542.744) (-550.331) [-541.651] * (-544.135) (-542.853) [-543.352] (-544.353) -- 0:02:28
108500 -- (-554.687) [-534.041] (-551.863) (-538.639) * (-553.440) (-546.413) [-536.683] (-537.191) -- 0:02:27
109000 -- (-562.261) (-545.965) (-550.872) [-534.747] * (-556.801) (-544.058) (-544.862) [-539.488] -- 0:02:27
109500 -- (-546.125) (-545.086) [-540.201] (-548.171) * (-550.850) (-553.887) [-535.660] (-540.890) -- 0:02:26
110000 -- (-549.879) [-534.897] (-543.207) (-550.804) * (-545.629) (-557.965) (-552.030) [-535.243] -- 0:02:25
Average standard deviation of split frequencies: 0.028487
110500 -- (-548.233) (-552.843) (-553.802) [-530.983] * [-546.633] (-553.983) (-536.179) (-557.311) -- 0:02:24
111000 -- [-541.429] (-543.217) (-549.524) (-545.936) * [-540.884] (-549.439) (-539.125) (-541.620) -- 0:02:24
111500 -- [-542.865] (-552.075) (-550.630) (-541.080) * (-543.318) (-547.905) [-539.785] (-540.758) -- 0:02:31
112000 -- (-546.435) (-546.853) (-561.896) [-541.312] * (-540.668) [-543.113] (-546.945) (-546.275) -- 0:02:30
112500 -- (-546.842) (-546.672) (-541.097) [-542.543] * (-547.546) [-540.670] (-536.369) (-551.664) -- 0:02:29
113000 -- [-545.698] (-546.212) (-552.048) (-543.989) * (-552.195) (-547.243) [-530.359] (-553.344) -- 0:02:29
113500 -- (-549.239) [-530.837] (-556.517) (-550.206) * [-539.016] (-555.676) (-542.734) (-552.665) -- 0:02:28
114000 -- (-546.829) [-538.531] (-549.630) (-545.035) * (-553.801) [-545.069] (-546.848) (-543.488) -- 0:02:27
114500 -- (-550.393) (-538.010) (-549.334) [-539.447] * [-542.372] (-542.857) (-547.311) (-536.683) -- 0:02:26
115000 -- (-533.077) [-541.291] (-556.744) (-540.317) * (-548.042) (-548.907) [-538.755] (-546.495) -- 0:02:26
Average standard deviation of split frequencies: 0.027177
115500 -- [-540.802] (-551.116) (-541.654) (-537.357) * (-552.153) [-537.828] (-543.143) (-541.395) -- 0:02:25
116000 -- [-540.777] (-545.650) (-550.107) (-537.330) * (-558.454) (-548.552) (-539.719) [-531.121] -- 0:02:24
116500 -- [-543.269] (-548.232) (-556.248) (-544.324) * (-550.867) [-544.992] (-549.115) (-540.576) -- 0:02:24
117000 -- (-547.921) [-540.434] (-548.835) (-530.670) * (-536.732) (-554.498) [-540.431] (-548.792) -- 0:02:30
117500 -- (-545.516) (-542.411) (-550.098) [-538.578] * [-537.015] (-557.974) (-547.094) (-541.955) -- 0:02:30
118000 -- (-546.611) (-545.496) (-547.369) [-536.508] * (-540.940) (-539.993) (-554.233) [-542.246] -- 0:02:29
118500 -- (-542.908) (-557.384) [-547.069] (-558.683) * (-554.519) (-544.738) (-551.773) [-531.769] -- 0:02:28
119000 -- (-543.029) (-549.800) [-541.325] (-538.427) * (-543.491) (-545.647) (-540.543) [-545.013] -- 0:02:28
119500 -- (-546.121) (-544.350) (-549.801) [-529.667] * [-544.603] (-542.244) (-537.255) (-553.172) -- 0:02:27
120000 -- (-545.378) (-556.271) (-544.821) [-533.595] * [-532.026] (-542.319) (-544.295) (-544.666) -- 0:02:26
Average standard deviation of split frequencies: 0.029170
120500 -- (-536.498) (-553.219) (-550.490) [-534.200] * (-539.221) (-543.086) (-540.991) [-543.683] -- 0:02:25
121000 -- (-544.762) (-547.896) (-556.876) [-540.419] * [-540.037] (-557.809) (-552.794) (-545.540) -- 0:02:25
121500 -- (-548.150) (-539.761) (-566.242) [-541.302] * (-551.115) [-547.736] (-558.855) (-539.746) -- 0:02:24
122000 -- (-549.722) (-545.565) (-559.079) [-535.400] * [-545.352] (-548.354) (-562.074) (-543.235) -- 0:02:23
122500 -- (-545.241) (-544.298) (-556.360) [-530.109] * (-547.856) (-552.744) [-542.822] (-544.871) -- 0:02:23
123000 -- (-555.325) (-548.810) [-545.525] (-540.108) * (-548.157) (-556.751) [-551.553] (-537.353) -- 0:02:29
123500 -- (-541.864) (-552.220) (-548.684) [-530.148] * (-542.694) (-543.126) (-550.933) [-545.114] -- 0:02:29
124000 -- (-543.154) [-540.982] (-545.386) (-535.241) * (-547.945) (-548.677) (-556.003) [-544.683] -- 0:02:28
124500 -- (-537.842) [-534.236] (-547.277) (-537.317) * (-557.415) (-546.967) (-550.812) [-533.913] -- 0:02:27
125000 -- (-547.370) [-545.222] (-546.423) (-529.154) * (-550.915) (-544.256) [-540.804] (-542.963) -- 0:02:27
Average standard deviation of split frequencies: 0.028185
125500 -- (-556.294) (-555.472) (-535.749) [-531.565] * (-547.971) (-547.830) (-539.435) [-533.179] -- 0:02:26
126000 -- (-546.080) (-545.589) (-539.959) [-536.032] * (-549.997) (-555.700) (-551.459) [-539.488] -- 0:02:25
126500 -- (-539.809) (-554.400) (-541.438) [-534.078] * (-541.644) (-562.397) [-538.687] (-546.027) -- 0:02:25
127000 -- (-551.654) (-548.058) (-544.747) [-531.871] * [-538.268] (-554.157) (-548.541) (-538.591) -- 0:02:24
127500 -- [-542.180] (-552.914) (-542.016) (-536.550) * (-548.897) (-545.459) (-547.822) [-528.126] -- 0:02:23
128000 -- (-552.192) (-548.741) (-544.433) [-540.360] * (-532.952) (-551.900) (-549.677) [-541.420] -- 0:02:23
128500 -- (-541.881) (-546.270) (-546.540) [-533.398] * (-544.673) (-545.839) [-534.382] (-534.735) -- 0:02:22
129000 -- (-546.044) (-558.863) [-543.749] (-545.614) * (-539.286) (-555.836) [-534.413] (-542.953) -- 0:02:28
129500 -- (-557.386) (-554.519) [-537.815] (-551.046) * (-551.409) [-540.824] (-539.749) (-546.771) -- 0:02:27
130000 -- (-547.524) (-555.278) (-541.936) [-544.988] * (-548.284) (-544.665) (-537.715) [-545.352] -- 0:02:27
Average standard deviation of split frequencies: 0.028140
130500 -- (-552.760) (-546.658) [-538.347] (-539.489) * (-547.251) (-547.949) (-542.550) [-537.957] -- 0:02:26
131000 -- (-544.735) [-550.854] (-555.749) (-535.917) * [-539.468] (-547.875) (-547.971) (-547.625) -- 0:02:25
131500 -- (-543.493) (-557.706) (-539.929) [-542.685] * (-553.782) (-548.815) (-550.607) [-543.588] -- 0:02:25
132000 -- (-556.836) (-550.860) (-546.585) [-544.186] * (-555.521) (-552.197) (-539.910) [-540.198] -- 0:02:24
132500 -- (-548.725) (-549.390) [-537.319] (-544.548) * (-545.553) (-560.319) [-537.560] (-546.557) -- 0:02:24
133000 -- (-553.200) (-552.838) [-545.569] (-550.101) * (-538.937) (-556.091) [-535.930] (-537.701) -- 0:02:23
133500 -- (-558.514) (-554.922) [-544.096] (-542.930) * (-548.952) (-542.323) (-550.245) [-533.421] -- 0:02:22
134000 -- (-548.150) (-559.966) [-530.597] (-560.405) * [-532.658] (-550.606) (-555.946) (-538.663) -- 0:02:22
134500 -- (-550.899) (-554.883) [-544.370] (-542.224) * [-540.700] (-543.566) (-558.574) (-541.616) -- 0:02:21
135000 -- (-553.262) (-561.369) [-536.022] (-552.466) * (-540.752) [-544.747] (-546.200) (-545.252) -- 0:02:27
Average standard deviation of split frequencies: 0.028192
135500 -- (-548.917) (-556.924) [-548.738] (-551.611) * [-541.368] (-556.014) (-550.587) (-553.692) -- 0:02:26
136000 -- (-556.517) (-553.386) (-558.113) [-540.829] * (-541.532) (-539.526) (-564.123) [-542.338] -- 0:02:26
136500 -- (-546.013) (-560.509) (-535.249) [-539.548] * (-553.338) [-544.098] (-556.188) (-540.580) -- 0:02:25
137000 -- (-551.856) (-556.542) (-550.808) [-538.914] * [-542.159] (-546.656) (-554.270) (-539.150) -- 0:02:24
137500 -- [-538.917] (-555.163) (-547.774) (-545.718) * (-539.957) (-549.577) [-542.830] (-549.484) -- 0:02:24
138000 -- (-545.824) (-562.468) [-539.989] (-535.250) * (-549.299) (-542.908) [-543.897] (-562.341) -- 0:02:23
138500 -- (-552.033) (-558.108) [-537.703] (-542.815) * (-544.167) (-553.382) (-542.940) [-536.305] -- 0:02:23
139000 -- (-553.607) (-550.830) [-546.415] (-537.041) * (-545.915) [-554.853] (-539.435) (-539.121) -- 0:02:22
139500 -- (-549.631) (-544.400) (-555.864) [-542.634] * (-539.542) [-539.458] (-542.933) (-533.910) -- 0:02:21
140000 -- (-538.877) (-558.323) (-547.382) [-543.895] * (-542.874) [-548.044] (-542.770) (-545.880) -- 0:02:21
Average standard deviation of split frequencies: 0.028820
140500 -- (-547.913) [-546.450] (-543.536) (-550.278) * (-557.267) (-558.220) [-544.282] (-547.768) -- 0:02:20
141000 -- (-550.017) (-560.229) [-532.233] (-545.489) * (-554.325) (-546.723) [-537.024] (-566.535) -- 0:02:26
141500 -- [-548.714] (-549.057) (-540.671) (-544.147) * (-533.707) (-552.695) [-544.674] (-556.324) -- 0:02:25
142000 -- (-543.188) [-546.454] (-541.063) (-551.124) * (-539.540) (-550.819) (-558.462) [-542.934] -- 0:02:25
142500 -- (-543.909) (-564.219) [-529.858] (-547.051) * (-557.380) [-544.170] (-550.723) (-551.858) -- 0:02:24
143000 -- (-554.305) (-551.950) [-537.957] (-542.824) * (-550.778) (-550.386) (-546.432) [-545.228] -- 0:02:23
143500 -- (-543.549) (-545.281) [-528.829] (-546.555) * (-551.743) (-552.667) (-551.374) [-539.077] -- 0:02:23
144000 -- (-544.328) (-553.180) [-533.255] (-544.417) * (-542.707) [-547.987] (-555.851) (-541.597) -- 0:02:22
144500 -- (-558.148) (-559.171) [-541.742] (-540.784) * (-543.022) (-554.761) (-542.979) [-530.637] -- 0:02:22
145000 -- (-542.273) (-556.747) (-536.091) [-540.956] * (-550.371) (-557.000) (-545.246) [-542.423] -- 0:02:21
Average standard deviation of split frequencies: 0.025830
145500 -- [-547.216] (-546.847) (-548.000) (-554.420) * (-544.083) (-559.498) [-556.403] (-549.313) -- 0:02:20
146000 -- (-553.245) (-556.114) [-534.139] (-535.192) * (-557.553) (-553.424) [-537.120] (-535.194) -- 0:02:20
146500 -- (-547.328) (-547.670) [-545.167] (-544.978) * (-549.488) (-562.082) (-540.896) [-543.839] -- 0:02:19
147000 -- (-549.240) (-544.890) (-553.381) [-542.974] * (-544.764) (-555.889) (-544.700) [-547.765] -- 0:02:25
147500 -- (-543.987) [-533.330] (-552.428) (-547.322) * [-551.692] (-550.899) (-542.646) (-554.612) -- 0:02:24
148000 -- (-548.678) (-543.741) [-549.827] (-536.978) * (-550.020) (-546.146) [-539.111] (-546.055) -- 0:02:23
148500 -- (-544.594) [-526.319] (-552.983) (-541.503) * (-547.170) (-551.796) [-543.151] (-550.333) -- 0:02:23
149000 -- [-540.864] (-543.433) (-557.969) (-544.216) * (-558.047) (-551.922) (-547.371) [-544.488] -- 0:02:22
149500 -- (-547.994) [-538.148] (-555.698) (-546.142) * (-555.317) (-548.582) [-536.032] (-540.099) -- 0:02:22
150000 -- (-552.969) (-538.011) [-549.930] (-554.155) * [-545.636] (-550.363) (-546.358) (-540.027) -- 0:02:21
Average standard deviation of split frequencies: 0.026986
150500 -- (-556.125) (-543.685) (-557.650) [-539.723] * (-555.893) (-553.762) (-534.516) [-538.976] -- 0:02:21
151000 -- (-546.079) [-545.385] (-551.505) (-546.204) * (-542.312) (-545.021) (-553.595) [-545.117] -- 0:02:20
151500 -- (-536.810) [-536.379] (-541.480) (-536.078) * (-546.852) (-547.469) (-544.889) [-533.621] -- 0:02:20
152000 -- [-533.173] (-547.336) (-554.762) (-545.253) * [-537.963] (-555.550) (-553.647) (-548.740) -- 0:02:19
152500 -- (-539.350) [-533.092] (-563.345) (-547.258) * (-541.939) (-553.555) [-548.875] (-544.041) -- 0:02:24
153000 -- (-547.743) (-534.743) (-562.270) [-538.756] * [-546.634] (-540.527) (-554.518) (-564.206) -- 0:02:23
153500 -- [-541.192] (-529.677) (-542.003) (-549.914) * (-544.969) (-555.342) (-543.566) [-535.888] -- 0:02:23
154000 -- (-551.568) [-535.522] (-542.322) (-550.394) * [-537.815] (-560.563) (-553.521) (-532.941) -- 0:02:22
154500 -- (-551.287) (-552.335) [-543.580] (-545.010) * [-546.441] (-547.131) (-550.232) (-549.780) -- 0:02:22
155000 -- (-550.370) (-559.576) (-555.573) [-534.203] * [-528.122] (-557.340) (-551.363) (-538.658) -- 0:02:21
Average standard deviation of split frequencies: 0.025686
155500 -- (-551.115) [-551.848] (-545.705) (-533.350) * [-544.514] (-553.190) (-532.636) (-545.138) -- 0:02:21
156000 -- [-538.266] (-549.871) (-548.990) (-541.075) * (-545.246) (-547.946) [-532.851] (-545.118) -- 0:02:20
156500 -- (-539.598) (-543.690) (-545.705) [-538.054] * [-546.435] (-543.710) (-545.276) (-547.965) -- 0:02:20
157000 -- (-545.654) (-548.775) (-559.612) [-535.755] * (-551.061) (-555.840) (-541.562) [-542.382] -- 0:02:19
157500 -- [-539.793] (-544.821) (-548.879) (-531.990) * (-552.820) [-548.005] (-550.011) (-549.232) -- 0:02:19
158000 -- (-545.836) [-540.593] (-561.017) (-539.045) * (-549.883) (-538.875) [-543.461] (-547.457) -- 0:02:18
158500 -- (-539.801) (-550.745) (-545.907) [-540.053] * (-551.959) (-546.127) [-542.414] (-557.283) -- 0:02:23
159000 -- [-545.625] (-540.659) (-544.936) (-550.932) * (-549.899) (-547.476) [-549.154] (-547.824) -- 0:02:22
159500 -- (-549.349) (-553.207) (-549.462) [-544.869] * (-535.352) (-548.811) [-533.692] (-551.313) -- 0:02:22
160000 -- [-547.113] (-555.057) (-555.890) (-553.560) * [-538.543] (-548.937) (-544.995) (-561.582) -- 0:02:21
Average standard deviation of split frequencies: 0.027384
160500 -- (-540.812) (-553.346) (-555.228) [-552.138] * (-558.140) (-543.951) [-540.077] (-547.021) -- 0:02:21
161000 -- [-539.023] (-550.703) (-552.581) (-546.688) * (-555.317) (-546.820) [-532.929] (-540.488) -- 0:02:20
161500 -- (-543.292) [-545.068] (-552.523) (-544.314) * (-561.196) (-557.083) [-540.906] (-550.787) -- 0:02:20
162000 -- (-545.091) [-540.032] (-557.530) (-548.921) * (-536.652) (-557.808) [-541.946] (-545.507) -- 0:02:19
162500 -- (-545.635) [-539.452] (-550.597) (-553.179) * (-544.139) (-548.411) [-534.211] (-540.884) -- 0:02:19
163000 -- [-538.435] (-544.092) (-553.713) (-542.179) * (-545.304) (-552.660) (-546.559) [-550.196] -- 0:02:18
163500 -- (-546.411) (-539.874) (-542.173) [-539.475] * (-545.104) (-545.123) (-540.201) [-539.791] -- 0:02:18
164000 -- [-540.366] (-540.156) (-556.118) (-555.939) * (-541.867) (-556.605) [-548.139] (-550.863) -- 0:02:17
164500 -- (-559.823) (-536.023) (-563.256) [-535.693] * (-541.733) (-545.493) [-543.293] (-555.021) -- 0:02:22
165000 -- (-550.280) (-539.765) (-558.666) [-532.248] * [-531.231] (-555.269) (-545.331) (-552.794) -- 0:02:21
Average standard deviation of split frequencies: 0.027155
165500 -- (-547.705) [-539.818] (-556.783) (-539.133) * [-547.487] (-554.676) (-537.851) (-548.230) -- 0:02:21
166000 -- (-544.944) [-543.691] (-545.292) (-537.664) * (-543.149) [-537.179] (-537.791) (-549.480) -- 0:02:20
166500 -- [-549.151] (-541.676) (-559.368) (-532.984) * [-544.569] (-552.989) (-537.007) (-552.195) -- 0:02:20
167000 -- (-552.884) [-534.408] (-546.270) (-544.102) * (-551.733) (-545.974) (-555.847) [-541.761] -- 0:02:19
167500 -- (-552.874) [-543.308] (-550.046) (-544.774) * (-558.668) [-544.212] (-555.830) (-547.015) -- 0:02:19
168000 -- (-549.237) [-531.154] (-546.335) (-537.411) * (-554.815) (-554.731) (-542.933) [-543.942] -- 0:02:18
168500 -- (-542.385) (-537.916) (-548.907) [-540.054] * [-546.670] (-546.391) (-542.806) (-543.582) -- 0:02:18
169000 -- (-551.504) [-535.370] (-548.208) (-541.430) * (-548.296) (-558.743) (-547.077) [-546.736] -- 0:02:17
169500 -- (-540.121) [-536.480] (-551.656) (-541.791) * (-552.510) (-555.232) (-541.853) [-537.984] -- 0:02:17
170000 -- (-538.375) [-538.357] (-549.011) (-535.089) * [-535.267] (-551.912) (-540.720) (-556.477) -- 0:02:16
Average standard deviation of split frequencies: 0.028312
170500 -- (-559.270) (-540.506) (-547.156) [-539.756] * (-538.419) (-556.328) [-542.583] (-554.176) -- 0:02:21
171000 -- (-538.260) [-533.135] (-543.979) (-548.443) * [-536.414] (-547.087) (-552.006) (-558.910) -- 0:02:20
171500 -- (-541.946) [-543.885] (-546.628) (-542.056) * [-531.021] (-556.719) (-550.725) (-544.352) -- 0:02:20
172000 -- (-553.389) [-542.410] (-544.534) (-534.675) * [-539.007] (-551.461) (-550.250) (-551.093) -- 0:02:19
172500 -- (-553.103) (-542.524) [-545.352] (-536.341) * (-537.889) (-549.297) [-539.636] (-556.700) -- 0:02:19
173000 -- (-543.647) [-540.636] (-552.476) (-546.768) * [-537.774] (-546.761) (-544.699) (-548.653) -- 0:02:18
173500 -- (-552.509) [-548.367] (-555.008) (-544.171) * [-529.493] (-545.993) (-539.327) (-547.353) -- 0:02:18
174000 -- (-558.913) [-538.200] (-548.466) (-550.894) * [-535.240] (-551.283) (-545.165) (-547.273) -- 0:02:17
174500 -- (-549.859) [-529.362] (-553.970) (-537.077) * (-536.571) (-554.567) (-544.253) [-541.277] -- 0:02:17
175000 -- (-544.533) (-532.338) (-557.752) [-545.886] * (-538.143) (-551.758) [-540.474] (-541.947) -- 0:02:16
Average standard deviation of split frequencies: 0.028291
175500 -- (-543.008) [-532.908] (-539.705) (-542.819) * (-539.285) (-549.907) [-533.778] (-548.127) -- 0:02:16
176000 -- (-552.430) (-543.581) [-539.341] (-551.530) * (-540.783) (-555.164) (-530.500) [-540.338] -- 0:02:15
176500 -- (-547.902) (-538.533) (-551.566) [-539.469] * (-544.512) (-564.650) [-540.827] (-546.744) -- 0:02:19
177000 -- [-542.638] (-545.235) (-554.467) (-555.970) * (-541.786) [-545.078] (-544.530) (-552.480) -- 0:02:19
177500 -- [-544.539] (-543.787) (-556.594) (-543.381) * (-551.605) (-548.137) [-534.656] (-551.729) -- 0:02:19
178000 -- (-546.787) (-552.146) [-546.230] (-550.588) * (-547.991) (-559.369) (-537.079) [-552.500] -- 0:02:18
178500 -- (-546.629) (-549.288) (-550.858) [-540.259] * (-548.713) [-546.915] (-542.101) (-546.364) -- 0:02:18
179000 -- [-538.899] (-538.492) (-539.865) (-530.129) * (-540.765) [-545.997] (-545.725) (-559.057) -- 0:02:17
179500 -- (-548.452) (-535.964) [-541.264] (-540.010) * (-552.377) (-547.965) [-537.843] (-545.682) -- 0:02:17
180000 -- (-561.468) [-537.106] (-551.265) (-550.972) * (-551.692) (-543.985) (-554.836) [-536.233] -- 0:02:16
Average standard deviation of split frequencies: 0.028354
180500 -- (-548.397) [-539.140] (-552.869) (-550.427) * (-532.353) [-541.507] (-549.720) (-546.004) -- 0:02:16
181000 -- (-553.794) [-539.799] (-553.466) (-532.788) * (-540.103) (-555.583) [-548.069] (-543.856) -- 0:02:15
181500 -- (-553.707) (-534.994) (-548.570) [-543.689] * [-537.346] (-547.452) (-550.409) (-553.221) -- 0:02:15
182000 -- (-553.928) [-545.899] (-549.754) (-544.657) * (-543.353) (-550.267) (-546.013) [-542.423] -- 0:02:14
182500 -- [-538.434] (-539.492) (-548.311) (-541.279) * (-535.828) (-561.991) (-546.819) [-543.247] -- 0:02:18
183000 -- [-548.155] (-540.217) (-551.984) (-540.447) * (-547.225) [-544.189] (-538.094) (-548.096) -- 0:02:18
183500 -- (-545.742) (-545.628) (-548.617) [-538.870] * (-538.830) (-553.222) [-540.517] (-549.126) -- 0:02:17
184000 -- (-550.145) (-547.733) [-540.745] (-548.921) * [-539.277] (-541.460) (-542.765) (-544.269) -- 0:02:17
184500 -- (-539.216) [-532.981] (-548.980) (-545.976) * (-542.438) (-567.204) [-538.703] (-548.128) -- 0:02:17
185000 -- (-550.611) [-534.120] (-530.199) (-548.989) * (-542.406) (-552.006) [-536.690] (-536.993) -- 0:02:16
Average standard deviation of split frequencies: 0.025344
185500 -- (-553.876) (-535.642) (-551.866) [-535.142] * (-541.554) (-544.684) [-534.619] (-538.651) -- 0:02:16
186000 -- (-547.269) (-545.847) [-541.744] (-550.124) * [-535.155] (-544.513) (-546.713) (-551.588) -- 0:02:15
186500 -- (-540.392) (-541.060) (-546.097) [-536.458] * [-540.834] (-554.845) (-543.244) (-550.878) -- 0:02:15
187000 -- [-541.334] (-552.153) (-544.541) (-543.374) * [-546.816] (-552.854) (-535.351) (-537.771) -- 0:02:14
187500 -- (-556.982) [-541.967] (-552.330) (-545.943) * (-539.178) [-542.612] (-543.420) (-551.575) -- 0:02:14
188000 -- (-549.046) (-553.738) (-545.021) [-542.043] * (-547.530) (-547.351) [-540.396] (-555.080) -- 0:02:13
188500 -- (-537.710) (-550.876) (-546.524) [-535.662] * [-543.882] (-559.231) (-546.072) (-557.520) -- 0:02:17
189000 -- (-537.877) (-547.872) [-544.762] (-546.438) * (-540.916) (-552.416) [-548.954] (-548.142) -- 0:02:17
189500 -- (-550.441) (-544.431) [-535.920] (-552.186) * (-541.298) (-548.630) [-548.896] (-546.378) -- 0:02:16
190000 -- (-540.167) (-536.500) [-544.484] (-543.524) * (-557.722) (-560.423) (-553.264) [-538.958] -- 0:02:16
Average standard deviation of split frequencies: 0.023415
190500 -- (-549.514) [-534.975] (-546.903) (-541.952) * (-543.917) (-563.422) [-542.581] (-537.076) -- 0:02:15
191000 -- (-552.049) (-543.012) (-550.411) [-532.763] * (-542.901) (-541.143) [-540.367] (-548.050) -- 0:02:15
191500 -- (-564.740) [-541.792] (-546.603) (-541.210) * [-541.679] (-539.347) (-556.713) (-547.141) -- 0:02:15
192000 -- (-557.937) [-536.481] (-549.721) (-541.692) * (-548.631) (-550.658) [-540.872] (-544.799) -- 0:02:14
192500 -- (-556.559) (-543.864) (-555.679) [-540.766] * [-535.718] (-548.704) (-545.306) (-542.203) -- 0:02:14
193000 -- (-563.293) (-548.403) (-545.877) [-538.822] * [-542.150] (-547.288) (-556.953) (-539.744) -- 0:02:13
193500 -- (-562.179) (-536.487) [-544.973] (-540.105) * (-537.379) (-553.352) (-552.391) [-540.721] -- 0:02:13
194000 -- (-554.098) (-541.520) (-546.033) [-534.454] * (-545.973) (-557.257) (-544.594) [-551.831] -- 0:02:17
194500 -- (-567.117) (-554.258) (-547.658) [-538.469] * (-543.604) (-544.339) [-554.229] (-550.777) -- 0:02:16
195000 -- (-555.386) (-538.153) (-549.393) [-541.025] * (-561.097) (-541.227) [-543.523] (-548.616) -- 0:02:16
Average standard deviation of split frequencies: 0.023570
195500 -- (-558.679) [-538.388] (-547.013) (-544.608) * (-548.529) [-532.318] (-547.539) (-544.771) -- 0:02:15
196000 -- (-545.308) (-541.308) (-547.736) [-547.940] * (-551.838) (-544.107) (-545.132) [-543.643] -- 0:02:15
196500 -- (-560.434) (-546.002) (-555.304) [-542.641] * (-532.594) (-543.416) (-548.441) [-546.639] -- 0:02:14
197000 -- (-555.268) (-545.117) (-565.917) [-538.510] * [-548.622] (-541.087) (-536.541) (-547.488) -- 0:02:14
197500 -- (-555.519) (-540.602) (-557.542) [-536.190] * [-543.842] (-543.983) (-545.576) (-542.595) -- 0:02:14
198000 -- (-542.851) [-537.836] (-552.420) (-537.637) * [-540.938] (-556.318) (-536.316) (-545.985) -- 0:02:13
198500 -- [-542.864] (-546.528) (-556.130) (-542.282) * [-537.897] (-558.071) (-547.559) (-543.796) -- 0:02:13
199000 -- (-549.408) (-542.822) (-556.989) [-537.349] * (-543.758) (-549.698) (-548.803) [-533.265] -- 0:02:12
199500 -- (-548.575) [-546.169] (-556.169) (-548.480) * (-545.350) (-560.304) [-544.628] (-548.984) -- 0:02:12
200000 -- (-539.359) (-544.898) (-543.281) [-543.340] * (-543.468) [-543.450] (-540.310) (-545.642) -- 0:02:16
Average standard deviation of split frequencies: 0.022396
200500 -- [-538.797] (-556.243) (-528.551) (-545.328) * (-558.691) (-549.533) [-535.640] (-535.896) -- 0:02:15
201000 -- (-550.365) (-555.000) (-553.398) [-542.155] * (-547.272) (-553.815) [-532.646] (-539.975) -- 0:02:15
201500 -- (-549.980) [-537.147] (-546.638) (-542.562) * (-546.272) [-541.757] (-544.733) (-558.939) -- 0:02:14
202000 -- (-556.746) (-543.596) (-544.766) [-538.186] * (-545.866) (-550.346) (-549.663) [-538.513] -- 0:02:14
202500 -- (-557.413) [-541.234] (-547.095) (-537.109) * (-563.063) [-537.375] (-541.872) (-542.977) -- 0:02:13
203000 -- (-553.092) (-543.810) [-546.768] (-535.573) * (-565.306) (-547.383) [-540.440] (-555.401) -- 0:02:13
203500 -- (-546.838) [-535.682] (-559.921) (-537.360) * (-555.052) (-551.738) (-545.218) [-546.926] -- 0:02:13
204000 -- (-529.900) [-537.213] (-552.140) (-542.685) * (-549.528) [-541.050] (-549.283) (-536.137) -- 0:02:12
204500 -- [-540.272] (-543.377) (-542.597) (-544.030) * (-547.777) (-540.274) (-545.401) [-536.923] -- 0:02:12
205000 -- [-530.747] (-544.934) (-550.191) (-548.719) * (-544.185) (-554.798) (-553.242) [-536.094] -- 0:02:11
Average standard deviation of split frequencies: 0.023313
205500 -- (-538.703) [-536.783] (-557.741) (-545.274) * (-556.719) [-544.675] (-549.507) (-544.953) -- 0:02:11
206000 -- (-553.483) (-534.064) [-547.156] (-547.755) * (-557.683) (-540.515) (-551.229) [-541.247] -- 0:02:14
206500 -- [-538.992] (-546.658) (-540.270) (-534.630) * (-549.104) (-543.302) [-547.461] (-544.886) -- 0:02:14
207000 -- (-540.559) [-550.198] (-544.538) (-552.179) * (-556.052) (-545.222) [-542.671] (-551.775) -- 0:02:14
207500 -- (-553.996) [-543.489] (-537.524) (-547.178) * [-539.260] (-541.763) (-545.186) (-552.647) -- 0:02:13
208000 -- [-537.980] (-547.383) (-536.370) (-547.812) * (-539.678) [-552.784] (-550.139) (-553.241) -- 0:02:13
208500 -- (-543.326) (-549.515) [-546.805] (-541.267) * (-551.166) [-547.997] (-546.876) (-572.118) -- 0:02:12
209000 -- (-550.605) [-542.781] (-560.798) (-543.781) * (-543.221) [-542.527] (-559.379) (-548.818) -- 0:02:12
209500 -- [-539.136] (-540.288) (-556.106) (-548.768) * (-540.935) (-545.703) (-547.470) [-548.271] -- 0:02:12
210000 -- (-544.704) [-536.899] (-541.019) (-551.707) * [-537.316] (-542.213) (-553.814) (-550.417) -- 0:02:11
Average standard deviation of split frequencies: 0.024754
210500 -- [-540.024] (-538.628) (-546.434) (-539.897) * [-534.284] (-560.959) (-553.397) (-543.220) -- 0:02:11
211000 -- (-556.052) (-545.116) [-542.626] (-546.559) * (-549.138) (-538.544) [-538.308] (-560.631) -- 0:02:10
211500 -- (-550.496) (-534.788) [-541.900] (-551.812) * (-557.353) (-539.338) (-542.077) [-545.152] -- 0:02:10
212000 -- (-539.197) (-550.476) [-530.339] (-548.326) * (-556.504) [-537.814] (-540.920) (-541.962) -- 0:02:13
212500 -- (-548.929) [-535.486] (-532.778) (-547.689) * (-543.212) (-545.798) [-543.184] (-552.392) -- 0:02:13
213000 -- (-555.271) [-537.615] (-541.411) (-548.307) * [-546.899] (-548.536) (-558.568) (-544.470) -- 0:02:13
213500 -- (-549.951) [-540.888] (-539.653) (-539.435) * (-540.668) [-545.333] (-551.434) (-545.548) -- 0:02:12
214000 -- [-541.378] (-552.145) (-547.466) (-551.392) * (-538.175) [-532.173] (-548.619) (-539.873) -- 0:02:12
214500 -- (-539.323) (-538.281) (-558.120) [-537.729] * [-537.703] (-550.548) (-548.199) (-557.008) -- 0:02:11
215000 -- (-549.566) [-541.507] (-549.121) (-543.808) * [-536.775] (-552.500) (-548.674) (-560.609) -- 0:02:11
Average standard deviation of split frequencies: 0.024880
215500 -- (-539.794) [-543.028] (-557.166) (-538.308) * [-535.346] (-546.977) (-545.490) (-543.565) -- 0:02:11
216000 -- (-552.925) (-548.955) (-548.125) [-544.019] * (-541.355) (-553.447) [-549.697] (-548.906) -- 0:02:10
216500 -- [-536.891] (-547.984) (-536.743) (-541.378) * [-536.091] (-548.541) (-555.779) (-546.450) -- 0:02:10
217000 -- (-546.876) (-544.316) [-541.981] (-538.249) * (-534.263) [-545.072] (-552.052) (-544.835) -- 0:02:09
217500 -- (-545.924) (-549.389) (-540.696) [-537.152] * (-548.286) [-535.398] (-536.705) (-542.189) -- 0:02:09
218000 -- (-555.276) (-541.101) [-549.689] (-545.907) * (-539.859) (-547.082) (-542.933) [-541.473] -- 0:02:12
218500 -- [-538.888] (-541.290) (-549.309) (-540.355) * (-538.195) [-546.069] (-551.035) (-550.456) -- 0:02:12
219000 -- (-539.232) (-547.389) (-543.651) [-535.389] * (-544.001) (-536.485) [-538.076] (-549.108) -- 0:02:11
219500 -- (-544.929) (-544.620) [-549.272] (-542.117) * (-539.333) (-539.933) [-542.605] (-549.094) -- 0:02:11
220000 -- (-549.802) (-547.426) [-538.840] (-541.611) * (-538.038) [-554.461] (-549.321) (-545.104) -- 0:02:11
Average standard deviation of split frequencies: 0.023232
220500 -- (-551.492) (-548.726) (-533.016) [-542.186] * (-544.315) (-545.929) (-548.275) [-551.306] -- 0:02:10
221000 -- (-543.158) (-538.903) [-537.649] (-547.011) * (-541.331) [-533.890] (-549.300) (-549.637) -- 0:02:10
221500 -- (-544.467) [-538.270] (-536.700) (-538.045) * (-537.509) (-558.152) [-548.942] (-558.623) -- 0:02:10
222000 -- (-554.635) (-537.901) [-538.010] (-540.305) * (-551.586) (-553.511) [-541.297] (-553.606) -- 0:02:09
222500 -- (-550.382) (-546.885) [-547.810] (-538.814) * (-549.336) [-534.103] (-541.924) (-559.864) -- 0:02:09
223000 -- [-545.768] (-545.329) (-530.227) (-549.101) * [-545.847] (-541.390) (-535.065) (-554.666) -- 0:02:08
223500 -- (-547.324) (-545.067) (-536.911) [-541.101] * [-544.212] (-542.997) (-548.276) (-555.551) -- 0:02:12
224000 -- (-552.510) (-536.481) [-537.635] (-546.978) * (-549.070) (-542.659) [-543.333] (-553.257) -- 0:02:11
224500 -- [-538.182] (-549.342) (-542.331) (-554.262) * (-544.491) (-541.224) [-539.750] (-553.507) -- 0:02:11
225000 -- (-545.140) [-534.706] (-537.694) (-541.950) * [-537.144] (-538.418) (-530.561) (-556.283) -- 0:02:10
Average standard deviation of split frequencies: 0.021438
225500 -- [-539.376] (-539.357) (-541.419) (-542.912) * (-548.494) (-545.898) [-539.895] (-558.903) -- 0:02:10
226000 -- [-538.929] (-557.508) (-549.863) (-539.532) * (-561.979) (-550.445) [-539.141] (-563.575) -- 0:02:10
226500 -- (-546.822) [-537.482] (-545.095) (-549.472) * (-554.277) (-548.064) [-539.530] (-549.374) -- 0:02:09
227000 -- (-545.123) (-544.793) [-539.751] (-552.117) * [-553.770] (-559.338) (-547.403) (-543.271) -- 0:02:09
227500 -- (-543.095) [-529.673] (-559.701) (-547.578) * (-538.273) (-549.687) [-538.655] (-544.331) -- 0:02:09
228000 -- (-550.328) [-537.653] (-553.241) (-541.462) * (-541.519) [-551.787] (-539.016) (-543.951) -- 0:02:08
228500 -- (-556.311) [-539.561] (-556.898) (-539.083) * (-549.165) (-548.148) [-536.421] (-559.876) -- 0:02:08
229000 -- (-547.250) [-536.028] (-543.802) (-545.816) * (-548.173) (-546.576) [-537.186] (-548.792) -- 0:02:07
229500 -- (-548.606) (-532.734) (-543.930) [-546.760] * (-551.159) (-551.215) (-537.885) [-539.543] -- 0:02:10
230000 -- (-551.791) [-534.301] (-548.512) (-542.734) * (-546.372) (-550.785) [-540.065] (-546.929) -- 0:02:10
Average standard deviation of split frequencies: 0.022753
230500 -- (-552.249) [-533.284] (-551.308) (-534.462) * (-545.106) (-552.481) (-543.551) [-536.274] -- 0:02:10
231000 -- [-545.487] (-551.275) (-549.326) (-538.668) * (-544.533) (-548.616) [-536.307] (-555.003) -- 0:02:09
231500 -- (-544.100) [-536.235] (-538.336) (-541.186) * [-538.867] (-540.330) (-546.141) (-546.140) -- 0:02:09
232000 -- (-538.413) [-536.181] (-540.105) (-548.415) * [-532.094] (-546.719) (-545.031) (-545.170) -- 0:02:09
232500 -- (-552.522) (-543.444) (-544.987) [-538.998] * [-533.259] (-543.918) (-553.873) (-547.799) -- 0:02:08
233000 -- (-545.839) (-541.122) (-543.793) [-530.094] * [-536.253] (-539.979) (-547.048) (-552.189) -- 0:02:08
233500 -- (-552.010) [-535.419] (-546.256) (-539.834) * [-538.925] (-545.093) (-543.577) (-555.686) -- 0:02:08
234000 -- (-552.022) [-539.139] (-547.640) (-541.784) * (-536.224) [-544.257] (-539.174) (-562.923) -- 0:02:07
234500 -- (-536.230) (-535.856) [-546.042] (-544.122) * [-537.681] (-561.404) (-529.533) (-547.837) -- 0:02:07
235000 -- (-542.557) (-534.883) (-551.003) [-539.164] * [-543.235] (-552.976) (-542.935) (-547.729) -- 0:02:06
Average standard deviation of split frequencies: 0.021306
235500 -- (-546.369) (-554.776) (-544.290) [-536.295] * [-540.388] (-552.090) (-539.262) (-544.207) -- 0:02:09
236000 -- [-542.529] (-547.509) (-560.398) (-543.327) * (-542.285) (-552.062) [-548.005] (-542.203) -- 0:02:09
236500 -- [-536.767] (-543.850) (-550.018) (-544.014) * [-537.490] (-562.854) (-540.711) (-548.616) -- 0:02:09
237000 -- [-540.683] (-553.208) (-547.891) (-540.512) * [-534.933] (-551.275) (-539.778) (-556.758) -- 0:02:08
237500 -- [-544.667] (-560.168) (-541.445) (-545.212) * (-548.239) (-544.012) [-538.589] (-551.514) -- 0:02:08
238000 -- (-533.637) (-545.730) [-545.459] (-532.854) * (-546.841) (-537.563) (-538.943) [-541.954] -- 0:02:08
238500 -- (-545.451) [-542.702] (-543.769) (-542.141) * [-530.573] (-558.990) (-539.631) (-548.530) -- 0:02:07
239000 -- (-544.151) (-543.531) (-540.803) [-536.755] * (-545.880) (-557.182) (-541.925) [-539.212] -- 0:02:07
239500 -- (-551.888) (-541.967) (-547.543) [-533.082] * [-540.371] (-553.700) (-543.517) (-541.357) -- 0:02:07
240000 -- (-561.075) (-540.877) (-551.575) [-536.288] * [-544.593] (-546.254) (-535.527) (-536.075) -- 0:02:06
Average standard deviation of split frequencies: 0.020707
240500 -- (-553.339) [-540.605] (-552.283) (-546.597) * (-536.505) (-558.385) (-551.095) [-536.851] -- 0:02:06
241000 -- (-545.873) (-546.011) [-543.771] (-534.764) * (-541.991) (-552.104) (-544.054) [-533.561] -- 0:02:09
241500 -- (-548.039) (-544.528) [-538.595] (-544.580) * [-541.514] (-557.457) (-552.774) (-535.771) -- 0:02:08
242000 -- (-542.121) (-542.112) [-537.710] (-554.457) * [-544.457] (-540.843) (-548.199) (-545.643) -- 0:02:08
242500 -- (-548.358) (-543.315) [-538.889] (-547.748) * (-558.036) (-555.653) (-539.421) [-530.728] -- 0:02:08
243000 -- (-542.404) (-549.286) [-538.162] (-543.698) * (-552.877) (-544.932) (-540.554) [-539.691] -- 0:02:07
243500 -- (-541.351) (-551.642) [-531.194] (-533.557) * (-547.699) (-555.098) (-539.254) [-542.900] -- 0:02:07
244000 -- (-553.036) [-544.094] (-551.993) (-539.785) * (-544.984) (-552.114) (-541.861) [-540.247] -- 0:02:07
244500 -- (-550.208) [-537.023] (-551.892) (-555.644) * (-545.789) (-548.261) (-538.661) [-525.991] -- 0:02:06
245000 -- (-545.232) (-551.534) [-545.699] (-539.324) * (-537.731) (-557.856) (-536.800) [-538.348] -- 0:02:06
Average standard deviation of split frequencies: 0.019752
245500 -- (-530.931) (-552.145) (-556.195) [-539.497] * (-547.009) (-552.843) (-540.813) [-540.226] -- 0:02:06
246000 -- (-550.972) (-554.738) (-544.648) [-544.626] * (-558.843) (-553.979) (-541.191) [-546.404] -- 0:02:05
246500 -- (-548.491) (-546.400) [-544.975] (-558.678) * (-552.539) (-556.741) [-542.845] (-536.702) -- 0:02:05
247000 -- [-533.723] (-548.684) (-548.922) (-538.426) * (-549.087) [-538.153] (-552.483) (-553.192) -- 0:02:08
247500 -- (-543.609) (-545.930) (-554.178) [-544.832] * (-556.823) (-545.914) [-534.510] (-547.036) -- 0:02:07
248000 -- [-542.679] (-553.975) (-543.522) (-539.609) * (-560.766) (-557.593) [-534.745] (-545.563) -- 0:02:07
248500 -- (-543.957) (-548.728) [-544.219] (-540.117) * (-550.704) (-551.686) [-542.587] (-545.004) -- 0:02:07
249000 -- (-547.302) [-539.708] (-556.049) (-551.347) * (-557.401) (-549.603) (-552.838) [-549.171] -- 0:02:06
249500 -- (-537.794) (-554.508) (-537.668) [-532.811] * (-553.414) (-550.910) [-540.613] (-551.131) -- 0:02:06
250000 -- (-533.890) (-555.577) (-542.371) [-540.838] * (-552.814) (-558.422) [-541.925] (-533.422) -- 0:02:06
Average standard deviation of split frequencies: 0.019684
250500 -- [-540.146] (-546.363) (-547.752) (-556.975) * [-539.624] (-552.014) (-552.893) (-544.346) -- 0:02:05
251000 -- [-538.708] (-543.321) (-546.601) (-542.704) * (-551.797) (-556.756) (-538.367) [-537.522] -- 0:02:05
251500 -- (-545.704) (-551.103) [-543.153] (-542.910) * (-539.951) (-554.407) [-535.618] (-547.573) -- 0:02:04
252000 -- (-549.955) (-546.693) [-541.490] (-550.673) * (-548.028) (-550.674) (-542.540) [-540.417] -- 0:02:04
252500 -- (-551.706) (-548.668) [-536.167] (-556.367) * (-560.126) (-549.787) [-541.497] (-545.561) -- 0:02:04
253000 -- [-541.529] (-548.078) (-547.187) (-546.616) * (-554.055) (-547.285) (-549.916) [-537.497] -- 0:02:06
253500 -- (-545.882) (-551.581) [-535.327] (-546.078) * (-555.359) (-541.640) (-544.362) [-537.568] -- 0:02:06
254000 -- (-547.557) (-550.192) [-528.574] (-539.465) * (-546.182) (-550.093) [-541.067] (-536.780) -- 0:02:06
254500 -- (-544.592) (-552.151) [-543.733] (-553.197) * [-533.746] (-550.087) (-533.028) (-543.585) -- 0:02:05
255000 -- (-548.886) (-543.246) (-545.670) [-536.511] * [-536.182] (-544.349) (-550.788) (-537.310) -- 0:02:05
Average standard deviation of split frequencies: 0.019220
255500 -- (-546.063) (-556.300) [-537.514] (-541.412) * (-538.571) [-531.016] (-551.190) (-541.309) -- 0:02:05
256000 -- (-549.063) (-551.774) [-534.387] (-540.948) * (-535.234) [-543.462] (-551.792) (-547.589) -- 0:02:04
256500 -- (-549.049) [-545.103] (-538.252) (-550.550) * [-541.703] (-559.777) (-547.061) (-561.617) -- 0:02:04
257000 -- (-539.694) (-535.807) [-544.327] (-551.267) * [-533.642] (-545.775) (-563.886) (-542.701) -- 0:02:04
257500 -- (-549.097) (-546.736) [-542.137] (-550.468) * (-552.153) [-551.085] (-547.131) (-545.944) -- 0:02:03
258000 -- (-552.215) (-552.085) (-544.250) [-533.609] * (-545.588) (-541.316) [-543.500] (-559.482) -- 0:02:03
258500 -- (-553.194) (-548.673) [-544.327] (-546.822) * (-551.760) (-546.819) [-546.746] (-543.223) -- 0:02:03
259000 -- [-546.908] (-555.429) (-549.038) (-545.567) * (-553.267) (-548.189) (-546.768) [-537.345] -- 0:02:05
259500 -- (-550.894) (-540.436) [-541.264] (-554.061) * [-538.392] (-539.290) (-545.387) (-538.602) -- 0:02:05
260000 -- (-556.287) (-544.573) [-539.410] (-542.597) * [-542.893] (-542.465) (-548.875) (-548.037) -- 0:02:05
Average standard deviation of split frequencies: 0.018763
260500 -- (-545.413) (-546.607) [-533.682] (-546.082) * (-557.126) (-550.543) [-542.054] (-549.226) -- 0:02:04
261000 -- (-551.768) (-549.566) (-540.261) [-535.261] * (-546.645) (-548.010) [-530.179] (-545.104) -- 0:02:04
261500 -- (-545.311) (-561.922) (-543.439) [-538.748] * [-538.510] (-547.570) (-553.774) (-546.227) -- 0:02:04
262000 -- (-549.735) (-546.053) [-534.504] (-551.238) * (-550.203) (-556.582) (-545.154) [-541.320] -- 0:02:03
262500 -- (-555.286) (-549.546) (-537.865) [-536.378] * (-548.089) [-539.690] (-561.175) (-544.790) -- 0:02:03
263000 -- (-554.616) (-555.584) [-535.354] (-547.731) * (-554.090) (-552.200) [-542.257] (-537.905) -- 0:02:03
263500 -- (-556.492) (-552.145) [-542.128] (-544.977) * (-549.350) (-558.169) [-540.963] (-551.853) -- 0:02:02
264000 -- (-552.980) (-543.530) [-540.993] (-545.521) * [-545.865] (-556.694) (-538.209) (-544.713) -- 0:02:02
264500 -- (-557.300) (-543.876) [-531.117] (-545.570) * (-550.409) (-554.768) (-541.273) [-535.415] -- 0:02:05
265000 -- (-551.910) [-543.559] (-541.437) (-541.602) * [-548.377] (-546.198) (-550.109) (-558.833) -- 0:02:04
Average standard deviation of split frequencies: 0.019494
265500 -- (-548.206) (-553.853) (-546.538) [-542.511] * (-555.362) (-546.575) [-542.436] (-549.138) -- 0:02:04
266000 -- (-552.781) (-545.524) (-538.779) [-536.247] * (-543.205) (-555.069) [-541.948] (-545.705) -- 0:02:04
266500 -- (-555.620) [-549.016] (-548.807) (-543.339) * [-549.637] (-561.348) (-555.021) (-545.633) -- 0:02:03
267000 -- (-550.706) (-556.322) [-542.673] (-543.371) * (-548.347) [-538.735] (-543.319) (-559.528) -- 0:02:03
267500 -- (-547.793) (-550.934) [-545.138] (-538.806) * (-542.999) (-542.348) [-543.264] (-546.902) -- 0:02:03
268000 -- (-552.437) [-542.244] (-555.436) (-556.809) * (-546.648) (-565.118) [-539.847] (-549.600) -- 0:02:02
268500 -- (-549.319) (-546.801) (-550.052) [-547.031] * (-550.468) (-544.550) (-543.726) [-547.852] -- 0:02:02
269000 -- (-548.306) [-540.601] (-554.306) (-537.529) * (-547.851) (-546.534) (-547.637) [-540.215] -- 0:02:02
269500 -- (-547.229) (-547.489) (-540.339) [-526.511] * (-555.937) [-547.532] (-548.347) (-540.227) -- 0:02:01
270000 -- (-543.003) (-538.760) (-552.376) [-534.602] * [-554.887] (-556.011) (-556.783) (-544.953) -- 0:02:01
Average standard deviation of split frequencies: 0.019978
270500 -- [-548.528] (-536.674) (-560.088) (-547.094) * (-545.613) (-548.993) [-543.692] (-547.747) -- 0:02:04
271000 -- (-553.118) [-534.111] (-551.262) (-541.999) * (-538.341) (-543.951) (-551.287) [-534.703] -- 0:02:03
271500 -- [-543.592] (-541.031) (-549.196) (-561.531) * (-557.559) (-553.055) [-540.175] (-537.706) -- 0:02:03
272000 -- (-546.019) (-544.111) [-539.581] (-537.332) * (-550.914) (-548.433) (-534.899) [-534.918] -- 0:02:03
272500 -- (-542.552) [-539.362] (-554.354) (-562.307) * (-548.376) (-550.894) (-539.316) [-534.286] -- 0:02:02
273000 -- (-548.914) [-538.218] (-533.932) (-560.190) * (-555.290) (-555.325) (-539.378) [-534.717] -- 0:02:02
273500 -- (-547.641) (-554.344) [-543.091] (-556.503) * (-555.467) (-552.059) (-533.669) [-544.683] -- 0:02:02
274000 -- (-543.305) [-542.918] (-547.600) (-557.382) * (-547.681) (-547.180) (-532.268) [-536.759] -- 0:02:01
274500 -- (-544.417) [-536.067] (-550.332) (-559.823) * (-536.128) (-546.085) (-544.177) [-539.920] -- 0:02:01
275000 -- (-551.610) [-538.814] (-551.862) (-547.015) * (-550.192) (-551.509) (-540.220) [-544.772] -- 0:02:01
Average standard deviation of split frequencies: 0.020603
275500 -- (-542.989) (-543.838) (-546.797) [-553.973] * (-546.665) [-537.708] (-544.773) (-540.711) -- 0:02:00
276000 -- (-547.138) (-546.504) (-541.783) [-555.736] * (-556.678) (-553.284) (-544.346) [-544.787] -- 0:02:00
276500 -- (-548.648) (-543.621) [-537.930] (-553.634) * (-546.671) (-536.636) [-545.689] (-540.227) -- 0:02:02
277000 -- (-554.855) [-544.001] (-546.582) (-559.335) * (-556.666) (-541.786) (-553.170) [-541.938] -- 0:02:02
277500 -- (-539.156) (-559.569) (-559.125) [-547.543] * (-549.050) (-550.180) [-535.508] (-542.547) -- 0:02:02
278000 -- (-545.359) [-536.751] (-543.133) (-553.248) * [-553.028] (-553.709) (-535.157) (-553.595) -- 0:02:02
278500 -- (-543.762) [-540.853] (-543.939) (-542.806) * (-544.925) (-532.697) (-534.018) [-537.058] -- 0:02:01
279000 -- (-551.556) [-545.074] (-549.450) (-543.930) * (-540.776) (-550.289) [-547.597] (-554.151) -- 0:02:01
279500 -- (-558.681) (-558.063) (-544.271) [-537.123] * (-545.678) (-545.006) [-539.710] (-555.877) -- 0:02:01
280000 -- (-559.941) (-552.384) (-554.451) [-545.359] * (-549.575) (-548.779) (-542.388) [-535.561] -- 0:02:00
Average standard deviation of split frequencies: 0.021947
280500 -- (-549.190) (-546.308) (-550.988) [-554.396] * (-551.486) (-550.673) [-546.971] (-554.504) -- 0:02:00
281000 -- (-546.012) (-539.029) (-547.708) [-549.342] * (-545.459) (-550.766) [-539.973] (-545.286) -- 0:02:00
281500 -- (-540.162) [-539.984] (-545.505) (-541.740) * (-555.046) (-552.898) [-535.268] (-553.976) -- 0:01:59
282000 -- (-554.451) (-560.361) (-544.373) [-540.052] * (-546.798) (-552.657) (-538.925) [-545.126] -- 0:01:59
282500 -- (-547.277) (-546.431) [-538.944] (-548.435) * (-544.961) (-560.114) (-544.782) [-536.638] -- 0:02:01
283000 -- (-551.534) (-546.908) (-543.127) [-547.813] * (-547.649) (-552.577) (-545.488) [-534.980] -- 0:02:01
283500 -- (-552.966) (-547.001) [-537.489] (-545.247) * (-558.661) (-554.093) [-545.523] (-552.212) -- 0:02:01
284000 -- (-534.576) (-540.972) (-555.750) [-541.576] * (-552.817) (-553.118) (-539.928) [-534.980] -- 0:02:01
284500 -- (-546.204) (-538.239) (-544.595) [-529.623] * (-548.661) [-539.430] (-550.480) (-543.408) -- 0:02:00
285000 -- [-542.815] (-543.842) (-552.735) (-538.825) * (-553.421) (-539.356) (-539.884) [-536.832] -- 0:02:00
Average standard deviation of split frequencies: 0.019161
285500 -- (-553.305) (-531.956) (-540.744) [-535.520] * (-568.761) (-543.365) [-538.755] (-540.034) -- 0:02:00
286000 -- (-550.970) [-545.798] (-565.217) (-539.419) * (-556.360) (-547.382) (-534.831) [-528.764] -- 0:01:59
286500 -- [-533.234] (-554.889) (-546.628) (-532.099) * (-551.548) (-541.488) (-545.091) [-540.295] -- 0:01:59
287000 -- (-532.780) (-553.634) (-552.416) [-531.582] * (-553.808) (-542.539) (-547.784) [-539.589] -- 0:01:59
287500 -- (-559.793) [-544.694] (-554.173) (-531.532) * (-554.007) (-562.860) (-549.752) [-534.419] -- 0:01:58
288000 -- (-546.298) (-546.092) (-550.887) [-538.432] * (-548.576) [-539.034] (-539.566) (-548.115) -- 0:01:58
288500 -- [-535.032] (-546.256) (-567.625) (-537.557) * (-544.008) (-556.178) [-546.628] (-538.915) -- 0:02:00
289000 -- (-538.157) (-558.529) (-558.020) [-530.102] * (-557.369) [-534.890] (-545.063) (-549.706) -- 0:02:00
289500 -- (-549.666) (-556.469) (-552.558) [-526.510] * (-550.827) [-540.794] (-543.688) (-541.314) -- 0:02:00
290000 -- (-549.305) (-557.014) (-547.397) [-533.030] * (-553.498) [-547.120] (-546.973) (-543.740) -- 0:01:59
Average standard deviation of split frequencies: 0.022010
290500 -- [-543.384] (-561.391) (-541.823) (-530.910) * (-547.722) (-567.734) [-539.707] (-538.999) -- 0:01:59
291000 -- [-541.659] (-555.733) (-547.430) (-539.802) * (-546.242) [-540.602] (-542.394) (-545.380) -- 0:01:59
291500 -- [-532.831] (-545.555) (-542.259) (-533.629) * (-538.101) [-537.002] (-545.813) (-533.864) -- 0:01:59
292000 -- [-536.519] (-546.464) (-546.791) (-547.362) * (-543.284) (-551.121) (-554.128) [-539.087] -- 0:01:58
292500 -- (-548.688) (-544.264) [-538.004] (-556.809) * (-545.941) (-559.665) (-542.310) [-540.973] -- 0:01:58
293000 -- [-541.835] (-541.950) (-561.872) (-543.391) * [-544.831] (-548.488) (-549.845) (-542.147) -- 0:01:58
293500 -- (-537.027) [-539.706] (-549.737) (-548.956) * (-543.023) (-555.818) [-537.744] (-563.262) -- 0:01:57
294000 -- (-541.107) (-547.730) (-545.113) [-543.006] * (-548.989) [-538.229] (-535.274) (-548.390) -- 0:01:57
294500 -- [-539.455] (-552.511) (-542.333) (-537.458) * (-540.488) (-542.043) (-551.337) [-540.731] -- 0:01:59
295000 -- [-544.709] (-550.584) (-550.185) (-547.379) * [-541.399] (-542.592) (-552.021) (-546.193) -- 0:01:59
Average standard deviation of split frequencies: 0.023775
295500 -- [-544.687] (-545.928) (-545.344) (-544.802) * (-543.108) [-546.919] (-551.135) (-547.651) -- 0:01:59
296000 -- (-557.519) [-545.957] (-553.248) (-543.153) * (-543.002) (-545.829) [-536.990] (-545.926) -- 0:01:58
296500 -- [-543.468] (-533.659) (-550.786) (-543.525) * [-541.956] (-543.012) (-540.138) (-552.134) -- 0:01:58
297000 -- (-554.291) [-541.197] (-548.972) (-537.542) * (-543.853) (-541.690) (-555.623) [-546.798] -- 0:01:58
297500 -- (-553.511) (-550.896) (-550.471) [-535.472] * [-533.253] (-542.606) (-552.258) (-551.105) -- 0:01:58
298000 -- [-548.876] (-540.210) (-552.821) (-544.882) * [-541.375] (-543.897) (-557.202) (-552.709) -- 0:01:57
298500 -- [-545.964] (-554.996) (-555.214) (-548.026) * (-540.387) [-537.050] (-557.906) (-561.716) -- 0:01:57
299000 -- (-567.346) (-559.498) (-544.760) [-541.630] * (-542.777) (-549.728) [-535.805] (-539.667) -- 0:01:57
299500 -- (-553.117) (-547.664) [-549.379] (-540.811) * (-546.292) (-548.053) (-554.955) [-536.733] -- 0:01:56
300000 -- [-540.457] (-551.736) (-556.824) (-537.104) * (-549.016) (-545.223) [-538.018] (-546.003) -- 0:01:56
Average standard deviation of split frequencies: 0.024190
300500 -- (-550.111) [-550.077] (-553.414) (-539.101) * (-553.760) (-539.594) (-546.494) [-541.636] -- 0:01:58
301000 -- (-546.838) (-561.671) (-556.825) [-544.034] * (-547.725) [-531.984] (-543.724) (-542.870) -- 0:01:58
301500 -- [-540.743] (-552.654) (-547.454) (-548.068) * (-557.517) [-531.038] (-548.877) (-539.047) -- 0:01:58
302000 -- [-539.257] (-549.147) (-545.116) (-554.508) * (-536.414) [-537.677] (-538.640) (-545.819) -- 0:01:57
302500 -- [-538.916] (-541.753) (-539.906) (-549.058) * [-548.306] (-539.617) (-549.040) (-550.481) -- 0:01:57
303000 -- (-542.444) [-536.578] (-549.717) (-547.511) * [-535.638] (-541.069) (-555.134) (-537.094) -- 0:01:57
303500 -- (-531.553) [-529.642] (-551.231) (-543.752) * [-533.917] (-544.469) (-548.105) (-547.114) -- 0:01:57
304000 -- [-542.866] (-536.200) (-556.630) (-540.142) * [-533.306] (-546.669) (-542.303) (-540.698) -- 0:01:56
304500 -- (-549.259) [-543.764] (-550.755) (-551.638) * [-558.187] (-565.407) (-550.305) (-544.765) -- 0:01:56
305000 -- [-536.844] (-539.620) (-550.999) (-554.751) * [-542.153] (-539.543) (-545.821) (-547.181) -- 0:01:56
Average standard deviation of split frequencies: 0.023493
305500 -- [-540.526] (-559.032) (-552.331) (-533.468) * (-537.826) (-544.761) (-551.434) [-535.530] -- 0:01:55
306000 -- (-539.908) (-541.158) (-544.884) [-531.169] * (-538.952) (-542.728) (-556.258) [-543.631] -- 0:01:57
306500 -- [-533.356] (-544.864) (-565.178) (-529.229) * (-540.678) [-541.577] (-539.874) (-548.707) -- 0:01:57
307000 -- [-536.730] (-541.524) (-554.635) (-545.848) * (-552.328) [-535.529] (-542.276) (-542.327) -- 0:01:57
307500 -- [-528.932] (-547.465) (-552.869) (-540.568) * (-547.364) (-544.704) [-548.237] (-538.926) -- 0:01:57
308000 -- [-543.570] (-549.901) (-555.487) (-545.663) * (-543.491) [-535.268] (-531.538) (-543.118) -- 0:01:56
308500 -- [-546.610] (-554.329) (-537.748) (-541.140) * (-545.039) (-548.266) (-533.798) [-537.983] -- 0:01:56
309000 -- [-530.475] (-552.901) (-549.570) (-547.377) * (-546.309) (-538.532) [-535.434] (-546.410) -- 0:01:56
309500 -- [-544.752] (-557.355) (-551.041) (-549.195) * (-542.284) [-535.354] (-544.177) (-544.735) -- 0:01:56
310000 -- [-538.523] (-543.779) (-540.729) (-549.056) * (-541.388) (-542.813) (-551.459) [-543.618] -- 0:01:55
Average standard deviation of split frequencies: 0.025290
310500 -- (-536.932) (-547.740) (-543.888) [-539.126] * [-535.161] (-549.345) (-537.827) (-555.288) -- 0:01:55
311000 -- [-536.232] (-556.522) (-555.929) (-540.459) * [-543.281] (-542.737) (-543.295) (-537.187) -- 0:01:55
311500 -- (-547.963) (-554.513) (-540.778) [-534.412] * [-529.403] (-555.753) (-536.151) (-535.928) -- 0:01:54
312000 -- (-538.885) (-555.378) [-534.029] (-542.405) * [-540.795] (-551.402) (-537.262) (-547.250) -- 0:01:56
312500 -- (-536.472) (-547.250) (-555.281) [-535.081] * (-554.681) (-553.177) (-545.240) [-536.500] -- 0:01:56
313000 -- (-538.365) (-549.411) (-551.563) [-539.868] * (-542.520) [-537.053] (-535.607) (-538.962) -- 0:01:56
313500 -- [-543.878] (-539.596) (-549.063) (-543.473) * (-539.313) (-546.846) [-536.080] (-544.717) -- 0:01:56
314000 -- [-535.180] (-546.988) (-541.583) (-533.062) * [-535.920] (-547.557) (-548.180) (-544.749) -- 0:01:55
314500 -- (-542.910) (-551.386) [-535.616] (-551.521) * [-539.497] (-549.145) (-535.415) (-544.188) -- 0:01:55
315000 -- [-534.859] (-547.791) (-549.421) (-538.484) * (-553.461) [-540.218] (-550.041) (-538.064) -- 0:01:55
Average standard deviation of split frequencies: 0.026554
315500 -- [-543.239] (-551.092) (-552.752) (-548.154) * [-541.056] (-548.706) (-550.242) (-541.810) -- 0:01:54
316000 -- (-537.078) (-548.557) (-557.599) [-540.968] * (-557.242) (-545.876) [-542.652] (-537.070) -- 0:01:54
316500 -- (-543.101) (-556.172) (-539.475) [-537.520] * (-548.769) [-531.613] (-549.696) (-547.650) -- 0:01:54
317000 -- (-538.509) (-556.284) [-549.598] (-544.163) * (-542.651) (-536.596) (-539.470) [-546.608] -- 0:01:54
317500 -- (-544.063) [-547.961] (-548.082) (-557.759) * (-541.285) [-534.743] (-541.140) (-544.666) -- 0:01:53
318000 -- [-530.892] (-556.165) (-550.367) (-544.362) * (-547.063) [-537.987] (-536.031) (-538.275) -- 0:01:55
318500 -- (-537.777) (-543.002) (-538.776) [-540.577] * [-535.523] (-543.384) (-542.260) (-544.529) -- 0:01:55
319000 -- [-538.813] (-552.477) (-567.977) (-549.066) * (-533.185) [-541.519] (-547.363) (-549.570) -- 0:01:55
319500 -- (-538.337) (-547.480) (-557.042) [-541.272] * (-540.609) (-552.278) (-554.068) [-547.140] -- 0:01:55
320000 -- [-547.757] (-550.028) (-553.169) (-549.751) * (-548.114) [-534.546] (-547.730) (-545.728) -- 0:01:54
Average standard deviation of split frequencies: 0.023981
320500 -- [-542.601] (-553.303) (-543.063) (-559.283) * (-549.465) [-531.320] (-540.292) (-551.668) -- 0:01:54
321000 -- (-539.758) [-541.487] (-553.128) (-550.587) * (-541.336) [-543.726] (-544.639) (-548.833) -- 0:01:54
321500 -- (-544.748) (-546.546) [-535.633] (-549.765) * (-542.909) (-548.379) [-541.297] (-546.006) -- 0:01:53
322000 -- [-536.880] (-551.138) (-553.654) (-555.744) * (-543.498) [-538.999] (-546.038) (-557.997) -- 0:01:53
322500 -- (-543.523) [-548.129] (-551.650) (-539.539) * [-534.810] (-538.495) (-553.837) (-553.199) -- 0:01:53
323000 -- [-535.862] (-551.039) (-550.678) (-546.397) * (-537.752) [-538.505] (-545.778) (-543.669) -- 0:01:53
323500 -- (-540.792) (-540.945) (-554.825) [-536.006] * [-540.053] (-554.644) (-543.622) (-541.594) -- 0:01:52
324000 -- [-534.987] (-547.435) (-551.379) (-546.996) * [-534.844] (-556.559) (-543.840) (-541.609) -- 0:01:54
324500 -- [-538.766] (-559.899) (-547.665) (-548.228) * [-531.256] (-547.421) (-550.885) (-550.694) -- 0:01:54
325000 -- (-543.410) (-553.242) [-543.790] (-555.387) * [-539.408] (-555.254) (-532.452) (-548.928) -- 0:01:54
Average standard deviation of split frequencies: 0.022865
325500 -- (-544.119) (-554.535) [-549.493] (-542.592) * (-546.100) (-554.317) [-544.642] (-556.210) -- 0:01:53
326000 -- (-539.401) (-550.940) (-545.513) [-544.162] * [-542.387] (-535.154) (-553.375) (-553.354) -- 0:01:53
326500 -- (-540.101) (-552.823) (-547.451) [-548.912] * [-547.108] (-550.300) (-552.784) (-540.001) -- 0:01:53
327000 -- (-545.808) (-558.801) [-532.426] (-544.022) * (-552.713) (-548.186) [-537.916] (-557.660) -- 0:01:53
327500 -- (-546.495) (-545.332) [-535.583] (-547.142) * (-546.838) [-530.759] (-549.712) (-558.920) -- 0:01:52
328000 -- (-550.532) (-549.368) [-536.214] (-550.230) * (-551.450) [-536.184] (-543.882) (-560.422) -- 0:01:52
328500 -- (-544.282) (-548.796) [-539.191] (-540.769) * (-546.129) (-553.065) (-560.108) [-537.744] -- 0:01:52
329000 -- (-536.047) (-555.777) [-538.644] (-558.200) * (-553.125) [-534.578] (-554.328) (-542.699) -- 0:01:52
329500 -- (-536.942) (-558.952) [-537.462] (-539.801) * (-541.248) [-534.338] (-549.405) (-552.557) -- 0:01:53
330000 -- (-544.383) (-545.942) [-530.474] (-547.834) * (-547.246) [-534.788] (-543.161) (-548.757) -- 0:01:53
Average standard deviation of split frequencies: 0.022097
330500 -- (-548.032) (-549.990) [-543.833] (-550.327) * (-550.676) (-532.624) [-540.824] (-552.001) -- 0:01:53
331000 -- (-553.652) (-557.475) (-539.528) [-540.513] * (-532.937) [-533.007] (-546.363) (-542.575) -- 0:01:53
331500 -- (-545.199) (-546.887) [-539.813] (-545.524) * (-545.458) (-537.734) (-554.029) [-539.655] -- 0:01:52
332000 -- (-548.891) (-548.621) [-542.276] (-549.523) * (-545.292) [-548.026] (-548.946) (-556.031) -- 0:01:52
332500 -- (-546.750) (-548.525) [-537.025] (-544.341) * (-543.747) [-536.807] (-557.768) (-538.985) -- 0:01:52
333000 -- (-542.140) (-560.666) [-537.956] (-539.708) * (-547.974) [-540.253] (-550.388) (-545.257) -- 0:01:52
333500 -- (-544.514) (-551.752) (-550.427) [-540.469] * (-535.386) [-540.125] (-552.533) (-543.423) -- 0:01:51
334000 -- [-542.128] (-553.072) (-537.714) (-544.947) * [-536.013] (-549.291) (-548.831) (-532.478) -- 0:01:51
334500 -- (-556.078) (-545.953) [-541.431] (-538.928) * [-529.398] (-546.341) (-546.605) (-543.180) -- 0:01:51
335000 -- [-545.590] (-549.587) (-540.848) (-542.712) * (-541.788) (-536.679) [-546.019] (-555.041) -- 0:01:51
Average standard deviation of split frequencies: 0.024252
335500 -- (-545.318) (-548.001) [-539.876] (-550.628) * [-539.100] (-543.631) (-551.893) (-548.287) -- 0:01:52
336000 -- (-535.902) [-546.968] (-547.877) (-558.586) * (-541.178) [-542.886] (-551.249) (-543.249) -- 0:01:52
336500 -- (-536.179) (-541.563) (-543.779) [-539.712] * (-537.147) [-534.555] (-545.827) (-548.634) -- 0:01:52
337000 -- [-538.136] (-547.963) (-554.978) (-539.364) * (-561.672) (-543.690) (-548.680) [-543.634] -- 0:01:52
337500 -- [-539.318] (-546.548) (-554.801) (-539.050) * (-542.683) (-529.680) (-550.176) [-541.808] -- 0:01:51
338000 -- [-548.536] (-543.819) (-546.478) (-536.137) * (-548.173) (-536.864) (-542.328) [-536.776] -- 0:01:51
338500 -- (-546.572) [-534.264] (-547.787) (-546.205) * (-559.295) (-544.648) [-540.651] (-545.391) -- 0:01:51
339000 -- [-539.809] (-554.529) (-535.271) (-543.052) * (-541.165) [-530.727] (-555.922) (-549.010) -- 0:01:51
339500 -- (-539.116) (-545.216) (-540.859) [-537.228] * [-534.862] (-544.251) (-556.368) (-554.402) -- 0:01:50
340000 -- [-546.279] (-556.061) (-555.508) (-541.875) * [-550.782] (-547.407) (-546.845) (-547.271) -- 0:01:50
Average standard deviation of split frequencies: 0.023155
340500 -- (-539.110) (-562.012) [-549.260] (-547.843) * (-550.093) (-542.958) (-556.810) [-547.176] -- 0:01:50
341000 -- [-537.977] (-554.266) (-544.935) (-536.916) * [-537.398] (-536.047) (-551.253) (-550.803) -- 0:01:50
341500 -- [-547.661] (-558.629) (-545.881) (-539.041) * (-549.737) [-540.902] (-552.682) (-545.022) -- 0:01:51
342000 -- (-550.876) (-553.740) [-534.306] (-554.931) * [-546.444] (-544.619) (-550.195) (-552.576) -- 0:01:51
342500 -- (-539.473) (-554.978) (-537.896) [-536.353] * (-557.159) (-543.020) [-544.919] (-555.226) -- 0:01:51
343000 -- [-539.454] (-557.275) (-539.476) (-548.205) * (-543.031) [-542.723] (-554.505) (-567.389) -- 0:01:51
343500 -- [-541.772] (-572.050) (-538.070) (-536.904) * [-544.940] (-544.556) (-547.865) (-543.853) -- 0:01:50
344000 -- [-545.002] (-541.281) (-532.623) (-554.772) * (-554.991) [-543.895] (-548.745) (-550.815) -- 0:01:50
344500 -- (-542.371) (-551.119) [-537.777] (-534.816) * [-544.653] (-542.797) (-547.177) (-548.773) -- 0:01:50
345000 -- (-546.666) (-555.193) (-551.604) [-535.312] * (-551.527) [-538.237] (-548.389) (-544.766) -- 0:01:50
Average standard deviation of split frequencies: 0.022344
345500 -- (-553.271) (-551.724) [-531.951] (-544.427) * (-547.088) (-540.380) [-536.783] (-556.358) -- 0:01:49
346000 -- (-546.205) (-552.211) [-535.862] (-556.291) * (-543.826) [-540.526] (-534.626) (-557.067) -- 0:01:49
346500 -- [-540.532] (-552.192) (-553.400) (-547.596) * (-541.659) (-546.345) [-537.964] (-551.418) -- 0:01:49
347000 -- (-544.587) (-553.154) (-556.577) [-538.829] * (-553.559) (-543.370) [-542.791] (-563.010) -- 0:01:49
347500 -- [-537.910] (-556.173) (-549.511) (-538.941) * [-547.283] (-544.282) (-558.393) (-541.642) -- 0:01:50
348000 -- (-544.887) (-565.925) [-535.879] (-542.738) * (-554.093) [-537.238] (-559.183) (-547.554) -- 0:01:50
348500 -- (-542.575) (-551.692) (-557.176) [-550.172] * [-546.497] (-536.719) (-541.583) (-553.505) -- 0:01:50
349000 -- (-546.255) (-546.032) (-549.783) [-551.952] * (-540.525) [-538.940] (-544.572) (-548.674) -- 0:01:50
349500 -- (-538.033) (-550.597) (-549.782) [-540.577] * (-544.555) [-542.406] (-552.603) (-544.096) -- 0:01:49
350000 -- (-543.200) (-555.528) (-551.188) [-530.165] * (-549.515) (-542.389) (-545.062) [-548.688] -- 0:01:49
Average standard deviation of split frequencies: 0.021240
350500 -- [-543.846] (-556.863) (-554.960) (-539.696) * [-539.800] (-542.553) (-552.472) (-550.569) -- 0:01:49
351000 -- (-544.117) (-561.410) [-543.166] (-541.617) * [-540.554] (-546.155) (-551.024) (-547.980) -- 0:01:49
351500 -- [-538.202] (-555.805) (-554.812) (-532.994) * [-539.177] (-548.172) (-550.557) (-559.317) -- 0:01:48
352000 -- (-537.042) [-539.780] (-556.338) (-551.249) * (-545.265) [-542.374] (-537.110) (-559.214) -- 0:01:48
352500 -- (-534.905) (-541.503) (-552.057) [-538.939] * [-544.499] (-538.856) (-551.743) (-546.140) -- 0:01:48
353000 -- (-539.871) (-545.412) (-551.772) [-536.994] * [-537.089] (-546.399) (-541.067) (-552.846) -- 0:01:48
353500 -- [-538.093] (-545.075) (-555.463) (-548.316) * [-535.541] (-537.658) (-549.550) (-552.865) -- 0:01:49
354000 -- (-545.648) [-541.500] (-553.274) (-539.372) * [-549.118] (-540.883) (-555.920) (-558.823) -- 0:01:49
354500 -- [-532.437] (-545.187) (-544.741) (-540.279) * (-554.600) [-539.315] (-543.769) (-551.957) -- 0:01:49
355000 -- [-539.631] (-555.392) (-547.878) (-554.155) * (-547.733) (-537.840) (-555.097) [-547.614] -- 0:01:49
Average standard deviation of split frequencies: 0.021275
355500 -- [-534.678] (-553.248) (-548.523) (-549.332) * (-554.647) (-551.298) (-545.867) [-539.811] -- 0:01:48
356000 -- (-551.509) (-549.940) (-551.389) [-545.337] * (-548.519) [-542.702] (-551.408) (-548.998) -- 0:01:48
356500 -- (-552.008) [-543.661] (-562.431) (-548.942) * (-551.525) [-537.757] (-553.353) (-559.240) -- 0:01:48
357000 -- (-546.661) (-544.893) [-545.311] (-559.050) * (-546.209) (-537.516) [-542.950] (-547.306) -- 0:01:48
357500 -- [-535.068] (-550.609) (-539.911) (-561.505) * (-548.760) (-541.714) [-542.273] (-543.694) -- 0:01:47
358000 -- [-533.260] (-551.158) (-536.586) (-551.762) * (-550.145) (-551.885) [-539.146] (-558.386) -- 0:01:47
358500 -- (-540.257) [-538.759] (-551.194) (-554.212) * (-559.130) (-538.096) (-546.234) [-546.466] -- 0:01:47
359000 -- (-542.240) [-537.485] (-546.088) (-551.459) * [-531.605] (-547.974) (-557.967) (-540.518) -- 0:01:47
359500 -- (-541.687) [-533.557] (-551.668) (-548.870) * (-553.315) (-545.723) (-564.432) [-538.168] -- 0:01:48
360000 -- (-548.102) (-545.279) (-557.237) [-543.180] * (-550.654) [-536.653] (-542.706) (-547.218) -- 0:01:48
Average standard deviation of split frequencies: 0.019954
360500 -- (-545.174) [-548.294] (-547.164) (-536.840) * (-546.182) (-553.044) (-551.390) [-542.835] -- 0:01:48
361000 -- (-542.926) (-543.169) (-566.793) [-538.916] * [-536.651] (-561.560) (-550.510) (-548.375) -- 0:01:47
361500 -- (-541.534) (-552.437) [-546.349] (-544.234) * [-537.713] (-541.488) (-547.030) (-555.537) -- 0:01:47
362000 -- [-541.809] (-550.461) (-547.687) (-548.427) * [-541.591] (-549.830) (-542.730) (-546.985) -- 0:01:47
362500 -- (-547.861) (-540.872) (-546.625) [-544.158] * (-545.896) [-536.796] (-554.735) (-545.595) -- 0:01:47
363000 -- (-541.977) (-551.610) (-561.844) [-542.492] * [-537.933] (-545.404) (-547.668) (-548.099) -- 0:01:47
363500 -- (-546.581) (-551.159) (-548.427) [-548.069] * [-545.525] (-548.157) (-548.747) (-543.833) -- 0:01:46
364000 -- (-562.311) [-539.038] (-541.514) (-545.660) * (-545.679) [-540.246] (-545.765) (-545.392) -- 0:01:46
364500 -- (-560.934) (-545.461) (-543.296) [-536.378] * (-542.829) (-541.118) (-555.346) [-545.065] -- 0:01:46
365000 -- (-549.081) (-551.754) [-541.392] (-548.209) * [-545.296] (-557.747) (-541.642) (-545.258) -- 0:01:47
Average standard deviation of split frequencies: 0.019835
365500 -- [-542.342] (-542.704) (-548.094) (-546.178) * (-546.665) (-533.834) [-542.817] (-550.859) -- 0:01:47
366000 -- (-551.872) (-557.386) [-536.679] (-559.592) * (-539.502) [-544.634] (-545.936) (-540.624) -- 0:01:47
366500 -- (-542.400) (-538.578) [-548.141] (-555.788) * (-544.813) (-553.529) [-545.463] (-553.977) -- 0:01:47
367000 -- [-547.311] (-540.698) (-550.544) (-545.468) * (-544.581) (-550.795) [-530.976] (-532.137) -- 0:01:46
367500 -- (-543.653) (-544.478) [-528.308] (-558.891) * (-551.954) (-544.861) [-550.272] (-542.125) -- 0:01:46
368000 -- (-550.153) (-545.015) [-537.468] (-549.618) * (-560.824) (-543.337) [-531.802] (-548.026) -- 0:01:46
368500 -- (-543.473) (-556.649) [-533.809] (-552.582) * [-540.943] (-547.346) (-536.785) (-552.553) -- 0:01:46
369000 -- [-538.173] (-549.828) (-551.099) (-553.293) * (-545.293) (-562.280) [-533.195] (-550.633) -- 0:01:46
369500 -- (-552.065) [-551.076] (-546.664) (-550.233) * (-547.586) [-549.438] (-540.966) (-542.735) -- 0:01:45
370000 -- (-550.728) [-542.137] (-565.775) (-548.121) * (-540.908) (-554.565) [-540.461] (-545.121) -- 0:01:45
Average standard deviation of split frequencies: 0.019331
370500 -- (-543.593) [-535.931] (-550.673) (-552.191) * [-538.894] (-552.141) (-548.999) (-546.584) -- 0:01:45
371000 -- [-543.907] (-549.769) (-547.458) (-550.475) * [-542.050] (-538.336) (-549.125) (-546.882) -- 0:01:46
371500 -- (-549.315) [-545.709] (-555.920) (-553.434) * (-558.223) [-543.556] (-544.589) (-534.143) -- 0:01:46
372000 -- [-538.605] (-536.769) (-537.553) (-550.262) * (-544.609) (-539.308) [-538.956] (-541.595) -- 0:01:46
372500 -- (-553.521) [-534.729] (-536.801) (-542.931) * (-550.390) (-549.001) [-537.506] (-545.713) -- 0:01:46
373000 -- (-543.683) [-537.039] (-542.599) (-547.528) * (-540.830) (-538.048) [-542.406] (-545.684) -- 0:01:45
373500 -- (-542.434) [-542.854] (-544.842) (-558.941) * (-548.553) (-548.369) (-543.073) [-543.593] -- 0:01:45
374000 -- (-542.967) [-536.735] (-559.126) (-547.830) * [-545.333] (-538.366) (-534.345) (-548.113) -- 0:01:45
374500 -- (-554.535) (-543.936) (-556.239) [-550.092] * (-548.046) [-539.417] (-561.164) (-548.808) -- 0:01:45
375000 -- (-552.281) (-541.888) (-544.728) [-548.615] * (-547.913) (-548.540) [-551.371] (-545.979) -- 0:01:45
Average standard deviation of split frequencies: 0.019725
375500 -- (-547.100) [-531.425] (-549.508) (-543.906) * (-554.083) (-553.177) (-548.068) [-539.493] -- 0:01:44
376000 -- (-537.920) [-537.571] (-558.283) (-549.122) * (-547.176) [-533.554] (-542.606) (-552.388) -- 0:01:44
376500 -- (-538.662) [-533.172] (-552.924) (-551.675) * [-537.251] (-544.466) (-548.091) (-543.364) -- 0:01:44
377000 -- [-545.007] (-548.155) (-550.131) (-545.404) * (-550.751) [-542.597] (-548.119) (-545.155) -- 0:01:45
377500 -- (-535.226) (-560.181) [-541.226] (-534.696) * (-551.873) [-541.519] (-546.791) (-552.800) -- 0:01:45
378000 -- (-558.929) [-541.536] (-553.890) (-544.450) * (-548.615) [-546.330] (-548.572) (-553.582) -- 0:01:45
378500 -- (-551.682) (-545.057) (-541.496) [-554.569] * (-562.238) (-559.717) (-543.357) [-543.080] -- 0:01:45
379000 -- (-543.473) [-542.013] (-560.374) (-555.616) * (-540.084) [-539.731] (-545.542) (-550.776) -- 0:01:44
379500 -- [-539.154] (-546.077) (-562.355) (-558.976) * (-543.609) [-541.850] (-552.464) (-543.466) -- 0:01:44
380000 -- (-540.586) [-541.634] (-547.051) (-554.412) * (-551.678) (-544.005) [-544.463] (-558.493) -- 0:01:44
Average standard deviation of split frequencies: 0.019401
380500 -- (-540.113) [-535.564] (-541.592) (-556.004) * (-549.926) (-544.470) (-545.291) [-543.295] -- 0:01:44
381000 -- (-544.000) [-536.287] (-553.927) (-548.638) * (-552.826) (-558.228) [-547.938] (-549.464) -- 0:01:43
381500 -- [-536.998] (-535.607) (-552.766) (-560.169) * (-548.880) (-532.690) (-546.989) [-549.300] -- 0:01:43
382000 -- (-545.911) [-548.392] (-550.468) (-544.679) * (-562.874) [-540.538] (-551.175) (-541.075) -- 0:01:43
382500 -- (-555.352) [-532.867] (-543.962) (-542.200) * (-548.462) (-541.703) (-546.897) [-539.940] -- 0:01:43
383000 -- (-545.777) [-536.153] (-548.605) (-537.171) * (-544.209) (-542.786) [-547.765] (-535.702) -- 0:01:44
383500 -- (-547.353) [-540.541] (-555.735) (-557.078) * (-552.436) (-540.120) (-541.877) [-541.461] -- 0:01:44
384000 -- (-555.827) (-543.301) [-546.534] (-542.539) * (-553.048) (-547.696) (-530.267) [-537.883] -- 0:01:44
384500 -- (-550.387) (-539.491) (-546.192) [-541.688] * (-553.999) [-535.312] (-557.962) (-552.551) -- 0:01:44
385000 -- [-538.303] (-540.244) (-547.877) (-545.093) * (-552.544) (-549.116) (-549.492) [-540.452] -- 0:01:43
Average standard deviation of split frequencies: 0.020354
385500 -- [-539.501] (-538.694) (-537.676) (-551.040) * (-557.108) (-539.915) (-549.090) [-551.025] -- 0:01:43
386000 -- (-538.522) [-531.088] (-545.054) (-559.439) * (-546.963) [-538.892] (-555.143) (-555.308) -- 0:01:43
386500 -- [-548.320] (-541.793) (-548.036) (-537.263) * (-539.596) (-540.855) [-541.230] (-544.901) -- 0:01:43
387000 -- (-548.121) (-546.441) (-549.111) [-541.846] * [-548.750] (-538.897) (-536.449) (-555.631) -- 0:01:42
387500 -- [-533.855] (-545.396) (-555.245) (-542.262) * [-533.225] (-551.289) (-541.195) (-551.771) -- 0:01:42
388000 -- [-528.146] (-537.315) (-554.023) (-548.836) * (-552.241) (-540.545) [-540.434] (-539.999) -- 0:01:42
388500 -- (-543.098) (-542.492) (-553.471) [-533.882] * (-547.272) (-545.857) (-558.097) [-537.084] -- 0:01:42
389000 -- (-548.799) (-543.778) (-552.187) [-531.311] * (-545.489) (-557.667) (-547.732) [-539.665] -- 0:01:43
389500 -- (-545.691) [-536.962] (-549.407) (-540.607) * (-551.834) (-548.274) (-547.100) [-530.113] -- 0:01:43
390000 -- (-549.994) [-541.772] (-550.127) (-546.572) * (-544.254) [-538.500] (-557.165) (-552.630) -- 0:01:43
Average standard deviation of split frequencies: 0.019387
390500 -- (-555.701) (-543.726) [-546.169] (-555.213) * (-545.828) (-545.587) (-552.498) [-533.258] -- 0:01:43
391000 -- (-544.639) [-542.772] (-553.571) (-559.180) * (-557.656) [-540.506] (-555.719) (-550.557) -- 0:01:42
391500 -- [-547.323] (-535.609) (-552.870) (-554.718) * (-540.501) (-543.187) [-544.002] (-533.356) -- 0:01:42
392000 -- [-553.068] (-546.857) (-551.365) (-558.055) * (-552.763) (-536.709) (-554.050) [-539.702] -- 0:01:42
392500 -- (-551.844) (-550.890) (-549.962) [-543.190] * (-551.444) (-538.907) (-545.059) [-535.597] -- 0:01:42
393000 -- (-553.652) [-536.935] (-554.946) (-539.330) * (-538.362) (-540.769) [-533.882] (-542.801) -- 0:01:41
393500 -- (-551.021) [-537.109] (-557.522) (-545.689) * (-550.889) (-541.609) (-556.202) [-535.058] -- 0:01:41
394000 -- (-550.441) [-540.236] (-552.968) (-550.026) * [-536.887] (-542.886) (-556.971) (-552.542) -- 0:01:41
394500 -- (-548.112) [-537.000] (-550.955) (-551.175) * [-540.607] (-547.512) (-543.276) (-545.435) -- 0:01:41
395000 -- (-544.289) (-549.369) [-537.648] (-546.762) * (-528.649) (-549.725) [-532.929] (-544.559) -- 0:01:42
Average standard deviation of split frequencies: 0.018729
395500 -- [-535.443] (-547.166) (-540.953) (-541.803) * (-529.389) (-557.402) (-562.372) [-547.025] -- 0:01:42
396000 -- (-545.409) [-541.492] (-545.232) (-553.636) * [-542.678] (-543.600) (-563.157) (-548.509) -- 0:01:42
396500 -- (-557.624) [-533.872] (-544.648) (-541.020) * [-536.938] (-552.824) (-541.658) (-549.420) -- 0:01:41
397000 -- (-566.859) [-539.261] (-539.488) (-539.233) * [-540.423] (-558.339) (-544.692) (-542.703) -- 0:01:41
397500 -- (-554.246) (-539.788) [-532.716] (-547.418) * (-544.958) (-552.219) [-530.681] (-540.106) -- 0:01:41
398000 -- (-549.878) (-549.208) (-553.370) [-539.409] * (-541.421) (-541.958) [-539.679] (-544.156) -- 0:01:41
398500 -- (-548.402) (-550.165) (-544.149) [-538.173] * (-546.654) (-550.934) (-551.128) [-538.793] -- 0:01:41
399000 -- (-545.019) (-543.721) [-542.392] (-539.424) * (-550.828) (-558.481) [-537.152] (-551.185) -- 0:01:40
399500 -- (-548.548) (-549.967) [-540.542] (-553.926) * (-534.712) (-544.289) [-534.126] (-548.014) -- 0:01:40
400000 -- (-551.981) (-538.122) (-541.172) [-544.327] * (-546.790) (-549.832) [-541.323] (-547.577) -- 0:01:40
Average standard deviation of split frequencies: 0.018040
400500 -- (-556.992) [-537.062] (-544.085) (-543.176) * (-543.040) (-556.623) (-558.552) [-534.348] -- 0:01:41
401000 -- (-552.346) (-548.017) [-536.326] (-538.613) * (-543.127) (-552.002) [-543.752] (-546.617) -- 0:01:41
401500 -- (-547.101) (-545.467) [-539.648] (-540.654) * [-540.603] (-548.691) (-552.081) (-537.963) -- 0:01:41
402000 -- [-538.971] (-549.380) (-539.554) (-563.539) * (-541.118) [-537.176] (-552.512) (-547.690) -- 0:01:41
402500 -- [-545.154] (-555.736) (-545.500) (-539.788) * (-541.927) [-533.163] (-559.869) (-539.251) -- 0:01:40
403000 -- (-553.552) [-544.623] (-552.021) (-547.805) * (-542.685) [-536.667] (-561.297) (-543.336) -- 0:01:40
403500 -- (-551.732) (-547.659) (-542.115) [-543.866] * (-542.603) (-533.559) (-548.843) [-537.009] -- 0:01:40
404000 -- (-548.609) [-545.205] (-542.150) (-551.207) * (-536.891) (-542.074) (-551.639) [-537.550] -- 0:01:40
404500 -- [-543.178] (-541.921) (-539.992) (-549.708) * (-550.988) (-548.983) [-554.324] (-556.982) -- 0:01:40
405000 -- (-546.111) [-540.526] (-552.981) (-546.499) * (-542.785) (-548.482) (-549.757) [-529.863] -- 0:01:39
Average standard deviation of split frequencies: 0.017803
405500 -- (-548.223) (-549.167) (-555.476) [-536.981] * (-549.071) (-543.851) (-549.282) [-542.377] -- 0:01:39
406000 -- (-555.424) (-549.012) [-536.188] (-538.027) * (-546.330) [-540.916] (-541.686) (-550.574) -- 0:01:39
406500 -- (-552.774) [-545.345] (-546.991) (-539.739) * (-538.623) (-543.174) [-541.449] (-549.728) -- 0:01:40
407000 -- (-547.977) (-541.165) [-531.793] (-549.318) * (-551.824) (-544.547) [-533.821] (-545.258) -- 0:01:40
407500 -- (-532.035) [-537.119] (-546.434) (-551.371) * (-553.999) (-540.448) (-539.669) [-529.231] -- 0:01:40
408000 -- (-544.613) (-550.644) [-538.970] (-547.763) * (-545.065) (-551.437) [-533.936] (-546.991) -- 0:01:40
408500 -- (-543.229) (-551.826) [-536.885] (-546.509) * (-551.686) (-545.344) (-537.730) [-534.838] -- 0:01:39
409000 -- (-551.873) (-542.136) (-558.414) [-541.656] * (-547.645) (-553.984) (-538.806) [-549.084] -- 0:01:39
409500 -- [-536.584] (-543.767) (-541.854) (-550.832) * [-542.582] (-533.165) (-548.160) (-546.123) -- 0:01:39
410000 -- [-547.465] (-548.588) (-532.859) (-550.524) * [-540.567] (-552.487) (-537.983) (-542.281) -- 0:01:39
Average standard deviation of split frequencies: 0.018826
410500 -- (-543.248) (-547.967) [-538.680] (-540.692) * (-542.796) (-543.922) (-541.133) [-542.719] -- 0:01:39
411000 -- (-546.212) (-546.750) (-550.353) [-541.730] * [-542.608] (-549.978) (-542.542) (-531.569) -- 0:01:38
411500 -- (-545.484) (-544.427) [-544.198] (-550.238) * (-544.386) (-544.816) (-552.022) [-543.014] -- 0:01:38
412000 -- (-529.519) [-539.290] (-542.929) (-554.991) * (-549.479) (-538.144) (-551.206) [-528.306] -- 0:01:38
412500 -- [-542.006] (-541.128) (-550.165) (-559.220) * (-531.521) (-549.601) (-549.299) [-539.705] -- 0:01:39
413000 -- (-543.707) [-533.983] (-550.905) (-545.089) * (-539.854) (-549.477) (-553.962) [-540.679] -- 0:01:39
413500 -- [-546.021] (-542.517) (-551.354) (-547.642) * [-539.377] (-555.007) (-542.760) (-554.930) -- 0:01:39
414000 -- [-536.636] (-556.066) (-555.153) (-545.779) * [-536.669] (-541.911) (-558.647) (-534.288) -- 0:01:39
414500 -- (-543.945) (-541.403) (-551.089) [-555.571] * [-538.199] (-546.612) (-549.530) (-538.479) -- 0:01:38
415000 -- (-540.732) [-537.528] (-541.672) (-546.089) * (-539.942) (-545.434) [-541.102] (-541.257) -- 0:01:38
Average standard deviation of split frequencies: 0.019037
415500 -- (-541.798) (-545.093) [-543.384] (-540.408) * (-541.907) (-549.267) [-533.536] (-546.393) -- 0:01:38
416000 -- (-536.202) [-539.162] (-540.350) (-554.853) * (-549.735) (-554.844) [-542.118] (-546.633) -- 0:01:38
416500 -- (-534.983) (-539.510) [-545.903] (-556.976) * (-539.361) (-556.505) [-541.592] (-553.289) -- 0:01:38
417000 -- (-542.445) [-535.566] (-565.132) (-548.536) * (-555.173) (-550.180) [-552.015] (-547.200) -- 0:01:37
417500 -- (-545.486) [-533.944] (-540.794) (-548.594) * (-554.590) [-546.355] (-546.539) (-541.706) -- 0:01:37
418000 -- (-532.661) [-527.117] (-545.356) (-545.069) * (-545.369) [-552.331] (-534.649) (-539.877) -- 0:01:37
418500 -- (-534.473) [-542.207] (-550.616) (-550.688) * [-538.574] (-553.469) (-550.178) (-536.942) -- 0:01:38
419000 -- (-539.609) [-541.852] (-546.354) (-545.531) * [-536.190] (-551.716) (-542.196) (-540.679) -- 0:01:38
419500 -- (-538.870) [-537.258] (-542.871) (-552.242) * (-542.293) (-554.090) [-541.612] (-545.336) -- 0:01:38
420000 -- (-554.222) [-537.339] (-547.998) (-549.670) * (-547.745) (-554.423) [-537.748] (-548.848) -- 0:01:38
Average standard deviation of split frequencies: 0.018677
420500 -- (-548.979) [-539.070] (-540.927) (-554.548) * (-554.629) (-549.137) (-543.208) [-532.810] -- 0:01:37
421000 -- (-537.509) [-537.829] (-557.786) (-547.694) * (-560.968) (-545.475) [-544.353] (-536.500) -- 0:01:37
421500 -- (-546.497) [-537.010] (-548.656) (-551.254) * (-549.250) (-552.472) (-531.357) [-540.987] -- 0:01:37
422000 -- (-544.497) [-530.593] (-552.668) (-545.759) * (-553.492) (-552.295) (-543.827) [-532.891] -- 0:01:37
422500 -- (-545.407) (-538.960) [-531.478] (-538.066) * (-544.899) [-542.713] (-543.757) (-541.292) -- 0:01:37
423000 -- (-539.730) [-531.759] (-546.225) (-548.689) * (-553.111) (-554.548) [-536.368] (-547.576) -- 0:01:36
423500 -- (-540.626) [-531.016] (-544.121) (-547.862) * (-540.471) (-545.764) [-532.904] (-547.618) -- 0:01:36
424000 -- (-553.256) (-548.639) [-540.765] (-549.673) * (-546.483) (-544.106) (-539.886) [-547.549] -- 0:01:36
424500 -- [-545.557] (-542.222) (-540.605) (-545.110) * [-536.573] (-559.350) (-548.858) (-544.477) -- 0:01:37
425000 -- (-539.582) (-550.394) [-542.548] (-544.030) * (-551.228) (-551.652) [-538.676] (-550.156) -- 0:01:37
Average standard deviation of split frequencies: 0.019771
425500 -- [-535.567] (-542.285) (-540.964) (-549.067) * [-539.638] (-561.122) (-547.374) (-553.781) -- 0:01:37
426000 -- (-546.531) [-535.610] (-543.902) (-537.440) * (-548.049) [-548.663] (-537.836) (-556.739) -- 0:01:37
426500 -- (-542.955) (-546.059) [-538.293] (-547.050) * (-546.374) (-548.863) [-537.928] (-540.025) -- 0:01:36
427000 -- (-542.237) (-545.756) [-534.601] (-551.042) * (-553.088) (-558.578) (-541.289) [-539.598] -- 0:01:36
427500 -- (-545.703) [-541.990] (-542.378) (-550.112) * (-543.390) (-552.443) [-530.770] (-543.786) -- 0:01:36
428000 -- (-548.074) [-539.386] (-536.871) (-555.220) * [-551.748] (-551.176) (-553.819) (-558.596) -- 0:01:36
428500 -- (-554.695) (-537.775) (-549.122) [-542.280] * (-547.163) (-546.057) [-539.149] (-555.796) -- 0:01:36
429000 -- (-544.392) (-549.907) (-546.514) [-527.652] * (-548.817) [-536.231] (-549.516) (-545.145) -- 0:01:35
429500 -- (-560.737) [-544.020] (-551.943) (-547.261) * (-549.998) (-545.314) [-540.036] (-551.684) -- 0:01:35
430000 -- [-544.824] (-554.638) (-553.757) (-552.337) * (-555.337) (-543.681) [-539.312] (-556.967) -- 0:01:36
Average standard deviation of split frequencies: 0.019776
430500 -- (-539.481) (-550.665) (-549.914) [-547.144] * (-550.576) (-543.472) [-527.798] (-544.772) -- 0:01:36
431000 -- (-543.559) [-530.734] (-535.216) (-554.476) * (-547.128) (-561.809) [-535.633] (-555.203) -- 0:01:36
431500 -- (-532.501) [-532.710] (-545.238) (-558.420) * [-552.748] (-559.155) (-547.923) (-549.862) -- 0:01:36
432000 -- (-537.934) [-539.432] (-553.828) (-548.826) * (-544.578) (-550.922) (-551.850) [-544.329] -- 0:01:35
432500 -- (-547.964) [-536.185] (-556.958) (-556.863) * (-549.568) (-544.433) [-553.046] (-543.385) -- 0:01:35
433000 -- [-542.309] (-554.357) (-545.983) (-541.907) * (-555.318) (-547.536) (-550.706) [-539.865] -- 0:01:35
433500 -- [-536.310] (-554.744) (-544.616) (-546.360) * [-543.439] (-545.496) (-550.446) (-549.364) -- 0:01:35
434000 -- [-536.610] (-549.614) (-549.529) (-536.810) * [-540.938] (-542.268) (-545.014) (-545.837) -- 0:01:35
434500 -- (-543.178) [-542.467] (-550.820) (-540.595) * (-542.518) (-545.294) (-551.062) [-541.200] -- 0:01:35
435000 -- [-545.383] (-555.261) (-535.325) (-540.097) * (-545.867) (-547.880) [-548.838] (-537.713) -- 0:01:34
Average standard deviation of split frequencies: 0.019390
435500 -- (-542.274) (-545.469) (-547.817) [-534.650] * (-548.759) (-542.493) (-546.646) [-545.363] -- 0:01:34
436000 -- (-555.050) (-539.028) (-546.646) [-536.477] * (-555.681) (-549.267) (-541.205) [-544.640] -- 0:01:35
436500 -- (-541.580) [-541.554] (-551.808) (-549.856) * (-548.362) (-553.129) [-540.915] (-545.713) -- 0:01:35
437000 -- (-544.858) (-532.128) [-537.046] (-540.491) * (-550.612) (-536.366) [-535.579] (-539.639) -- 0:01:35
437500 -- (-538.369) (-534.875) (-547.896) [-537.759] * (-545.225) (-549.513) [-537.779] (-544.453) -- 0:01:35
438000 -- (-538.853) [-538.199] (-543.906) (-541.193) * (-564.162) [-542.825] (-538.344) (-556.704) -- 0:01:34
438500 -- (-547.019) (-549.266) (-547.861) [-531.346] * (-547.815) (-546.523) [-538.040] (-544.059) -- 0:01:34
439000 -- (-537.917) (-558.665) [-540.817] (-542.163) * [-543.756] (-551.371) (-549.039) (-547.360) -- 0:01:34
439500 -- [-538.510] (-549.362) (-544.990) (-545.916) * [-535.175] (-558.413) (-536.586) (-551.717) -- 0:01:34
440000 -- (-540.311) (-547.568) [-537.302] (-539.615) * (-541.444) [-540.737] (-554.256) (-543.477) -- 0:01:34
Average standard deviation of split frequencies: 0.020860
440500 -- (-548.545) (-542.304) [-538.207] (-551.606) * (-541.210) [-532.062] (-547.273) (-552.720) -- 0:01:33
441000 -- (-543.441) (-547.760) [-542.217] (-538.674) * [-540.379] (-545.557) (-538.650) (-544.014) -- 0:01:33
441500 -- (-539.717) [-547.173] (-546.517) (-549.589) * (-543.751) (-557.228) (-547.159) [-559.144] -- 0:01:33
442000 -- (-541.730) (-552.031) (-535.334) [-540.487] * (-555.602) [-549.948] (-550.824) (-545.339) -- 0:01:34
442500 -- [-535.058] (-541.811) (-547.589) (-546.876) * [-541.056] (-549.621) (-542.646) (-544.861) -- 0:01:34
443000 -- [-535.164] (-558.497) (-539.426) (-547.191) * [-545.215] (-557.915) (-542.585) (-546.165) -- 0:01:34
443500 -- (-537.468) (-540.308) (-543.406) [-537.557] * (-553.727) (-556.553) (-545.722) [-538.780] -- 0:01:34
444000 -- (-538.904) (-544.301) (-541.251) [-533.061] * (-542.552) (-559.525) (-546.867) [-545.583] -- 0:01:33
444500 -- [-541.159] (-549.496) (-550.974) (-540.175) * (-545.617) (-551.795) [-540.356] (-544.382) -- 0:01:33
445000 -- (-546.281) (-551.281) [-546.125] (-540.746) * (-542.368) (-545.892) [-545.679] (-548.604) -- 0:01:33
Average standard deviation of split frequencies: 0.020223
445500 -- [-549.329] (-553.679) (-535.878) (-553.430) * (-554.871) (-558.402) (-547.606) [-551.514] -- 0:01:33
446000 -- (-549.537) [-550.262] (-541.356) (-552.941) * (-554.784) (-561.779) [-533.005] (-548.261) -- 0:01:33
446500 -- (-557.166) (-538.429) (-542.251) [-534.420] * (-550.318) (-550.688) [-545.549] (-537.412) -- 0:01:32
447000 -- (-554.417) (-550.287) [-545.850] (-546.038) * (-552.484) (-548.198) (-536.418) [-529.692] -- 0:01:32
447500 -- (-552.120) (-553.281) (-549.217) [-526.463] * (-545.882) (-545.840) [-544.163] (-550.898) -- 0:01:32
448000 -- (-545.454) (-550.519) [-536.160] (-549.147) * (-550.583) (-548.432) [-531.285] (-546.780) -- 0:01:33
448500 -- (-549.249) (-552.974) (-540.230) [-540.197] * (-552.625) (-552.553) [-537.611] (-552.196) -- 0:01:33
449000 -- (-548.083) (-553.708) (-538.065) [-543.786] * (-543.900) (-548.622) [-531.024] (-548.100) -- 0:01:33
449500 -- (-556.559) (-545.889) (-545.166) [-542.311] * (-549.858) (-557.192) [-534.507] (-544.937) -- 0:01:33
450000 -- [-543.808] (-546.962) (-555.288) (-540.956) * (-552.810) (-561.613) [-535.160] (-550.859) -- 0:01:32
Average standard deviation of split frequencies: 0.019316
450500 -- (-543.160) [-533.563] (-536.835) (-554.631) * [-543.746] (-554.097) (-537.414) (-552.850) -- 0:01:32
451000 -- (-545.926) (-549.610) [-526.770] (-535.531) * (-546.180) (-558.702) [-528.686] (-561.742) -- 0:01:32
451500 -- (-548.582) [-542.363] (-551.923) (-557.729) * (-545.715) (-555.175) [-537.110] (-556.111) -- 0:01:32
452000 -- (-546.597) [-536.695] (-547.546) (-557.412) * (-545.621) (-547.399) (-547.734) [-544.049] -- 0:01:32
452500 -- (-545.501) [-536.026] (-541.033) (-553.907) * (-539.291) (-551.155) (-544.299) [-545.144] -- 0:01:31
453000 -- (-548.532) (-540.200) [-537.562] (-548.995) * [-552.429] (-541.811) (-540.619) (-547.572) -- 0:01:31
453500 -- (-549.220) [-531.810] (-541.733) (-553.717) * (-542.491) [-540.794] (-553.908) (-543.895) -- 0:01:31
454000 -- [-543.580] (-541.313) (-544.166) (-551.714) * (-541.629) (-549.979) (-553.760) [-536.059] -- 0:01:32
454500 -- (-545.249) [-544.054] (-550.358) (-549.805) * (-551.921) (-558.132) (-545.021) [-537.245] -- 0:01:32
455000 -- (-543.498) (-536.619) [-537.316] (-545.003) * (-551.948) (-559.988) (-533.781) [-531.273] -- 0:01:32
Average standard deviation of split frequencies: 0.019091
455500 -- [-548.660] (-546.326) (-549.460) (-540.868) * [-541.624] (-556.204) (-554.231) (-540.649) -- 0:01:32
456000 -- (-551.445) (-553.197) [-538.566] (-549.213) * [-533.485] (-553.372) (-538.510) (-534.912) -- 0:01:31
456500 -- (-559.918) (-545.213) [-542.258] (-550.509) * [-538.831] (-546.234) (-546.436) (-545.005) -- 0:01:31
457000 -- (-540.794) (-553.735) [-537.810] (-558.261) * (-536.974) (-544.222) [-540.073] (-541.043) -- 0:01:31
457500 -- (-543.338) (-550.902) [-547.616] (-543.430) * (-546.175) (-551.589) (-541.292) [-539.906] -- 0:01:31
458000 -- (-552.873) [-538.211] (-545.843) (-551.809) * [-544.738] (-540.135) (-547.669) (-547.263) -- 0:01:31
458500 -- (-550.270) [-539.218] (-538.849) (-553.468) * (-545.809) (-541.884) (-554.702) [-532.074] -- 0:01:30
459000 -- (-545.380) [-545.167] (-546.851) (-546.045) * (-547.489) (-554.515) [-548.830] (-545.646) -- 0:01:30
459500 -- (-540.753) (-539.136) [-537.358] (-547.747) * (-550.985) (-553.050) [-544.961] (-539.273) -- 0:01:31
460000 -- (-548.146) (-552.795) [-543.552] (-563.573) * (-546.588) (-551.608) [-544.259] (-537.877) -- 0:01:31
Average standard deviation of split frequencies: 0.018556
460500 -- [-536.556] (-552.213) (-539.769) (-551.042) * (-554.848) (-542.860) (-545.137) [-533.511] -- 0:01:31
461000 -- [-535.306] (-558.624) (-540.065) (-539.674) * [-535.128] (-547.377) (-544.352) (-539.121) -- 0:01:31
461500 -- (-562.720) (-543.460) [-543.741] (-549.524) * [-538.592] (-543.567) (-534.497) (-549.760) -- 0:01:31
462000 -- [-543.915] (-559.163) (-550.077) (-549.583) * (-534.833) (-552.511) [-539.570] (-551.281) -- 0:01:30
462500 -- [-535.446] (-546.504) (-542.763) (-546.149) * (-550.050) (-546.753) (-543.256) [-539.815] -- 0:01:30
463000 -- (-542.819) (-539.225) [-543.038] (-545.446) * (-551.938) (-549.122) [-546.609] (-541.245) -- 0:01:30
463500 -- (-541.650) (-555.498) [-543.452] (-550.171) * (-549.784) (-542.607) [-554.276] (-552.759) -- 0:01:30
464000 -- [-534.819] (-543.486) (-543.796) (-551.620) * (-543.250) (-548.590) (-540.781) [-543.031] -- 0:01:30
464500 -- (-536.110) (-551.366) [-549.540] (-547.155) * (-543.652) (-547.934) (-554.342) [-539.667] -- 0:01:31
465000 -- (-532.311) (-546.247) (-540.033) [-538.509] * (-552.996) [-545.434] (-552.808) (-550.143) -- 0:01:30
Average standard deviation of split frequencies: 0.018141
465500 -- (-544.197) (-542.259) (-549.124) [-550.784] * (-554.864) (-549.534) (-545.216) [-537.918] -- 0:01:30
466000 -- (-540.554) (-560.973) (-549.795) [-550.423] * (-541.395) (-555.043) (-546.874) [-544.070] -- 0:01:30
466500 -- (-543.617) (-539.701) (-543.949) [-547.698] * [-539.270] (-564.161) (-540.396) (-542.614) -- 0:01:30
467000 -- [-532.603] (-547.878) (-540.512) (-554.065) * (-541.528) (-545.434) [-547.442] (-547.825) -- 0:01:30
467500 -- [-529.136] (-557.869) (-548.047) (-546.839) * (-547.228) (-549.920) (-544.393) [-545.958] -- 0:01:29
468000 -- (-549.243) (-547.821) (-552.051) [-546.240] * (-547.213) (-552.490) [-544.719] (-537.395) -- 0:01:29
468500 -- [-531.063] (-552.221) (-554.003) (-546.237) * (-544.999) (-561.257) (-542.617) [-530.147] -- 0:01:29
469000 -- [-534.154] (-541.614) (-550.781) (-553.651) * (-545.965) (-557.880) [-538.049] (-548.023) -- 0:01:29
469500 -- [-530.568] (-542.974) (-554.228) (-543.837) * (-546.949) (-551.354) [-536.470] (-543.024) -- 0:01:30
470000 -- [-541.385] (-544.975) (-542.824) (-553.992) * (-542.292) (-549.672) (-542.088) [-534.885] -- 0:01:30
Average standard deviation of split frequencies: 0.016626
470500 -- (-535.051) (-545.391) (-545.013) [-548.468] * (-555.052) (-543.982) (-545.647) [-536.413] -- 0:01:30
471000 -- (-539.068) (-540.881) (-565.050) [-546.776] * (-545.454) (-543.517) [-541.986] (-545.147) -- 0:01:29
471500 -- (-539.536) (-551.848) [-554.393] (-550.485) * [-538.600] (-550.597) (-544.651) (-548.207) -- 0:01:29
472000 -- (-549.639) (-547.749) (-553.890) [-556.079] * [-542.171] (-554.135) (-550.299) (-550.768) -- 0:01:29
472500 -- (-555.466) [-536.939] (-551.370) (-555.019) * [-545.843] (-537.102) (-542.293) (-556.203) -- 0:01:29
473000 -- (-549.795) (-547.179) [-539.640] (-536.648) * (-545.662) (-534.636) [-544.418] (-546.258) -- 0:01:29
473500 -- [-535.077] (-555.009) (-550.268) (-549.205) * (-540.051) [-541.186] (-553.844) (-544.938) -- 0:01:28
474000 -- (-547.085) (-553.210) (-557.967) [-553.562] * (-548.357) (-539.108) [-543.683] (-547.338) -- 0:01:28
474500 -- [-530.421] (-547.041) (-553.768) (-539.224) * [-545.504] (-547.249) (-544.976) (-547.171) -- 0:01:28
475000 -- [-536.441] (-548.657) (-560.359) (-540.535) * (-545.268) (-559.753) [-542.917] (-547.728) -- 0:01:28
Average standard deviation of split frequencies: 0.016308
475500 -- (-545.590) (-552.958) (-555.917) [-533.534] * [-546.132] (-554.836) (-543.174) (-539.386) -- 0:01:29
476000 -- (-549.465) (-546.785) (-553.660) [-539.873] * (-542.516) (-541.525) [-540.750] (-548.972) -- 0:01:29
476500 -- (-551.957) (-552.611) [-553.548] (-550.856) * (-541.732) (-543.119) [-540.784] (-533.116) -- 0:01:28
477000 -- (-547.999) (-550.951) (-552.296) [-533.443] * (-540.970) [-542.753] (-543.850) (-539.788) -- 0:01:28
477500 -- (-544.719) (-555.722) (-552.258) [-537.937] * (-543.902) (-538.659) (-545.597) [-535.238] -- 0:01:28
478000 -- (-541.194) (-544.941) (-548.764) [-531.777] * (-544.194) [-538.010] (-551.255) (-547.836) -- 0:01:28
478500 -- [-539.994] (-551.727) (-547.151) (-538.777) * (-549.165) (-551.167) (-550.628) [-536.707] -- 0:01:28
479000 -- (-542.009) (-561.811) [-547.995] (-537.418) * (-540.242) (-561.187) (-547.578) [-541.220] -- 0:01:28
479500 -- (-556.987) [-554.259] (-536.237) (-541.160) * (-541.582) (-543.290) (-550.163) [-545.501] -- 0:01:27
480000 -- (-531.967) (-544.471) (-544.352) [-539.349] * [-534.767] (-543.776) (-554.880) (-544.036) -- 0:01:27
Average standard deviation of split frequencies: 0.016252
480500 -- (-539.904) (-553.123) [-542.408] (-561.414) * [-536.329] (-547.363) (-544.164) (-555.386) -- 0:01:27
481000 -- (-551.761) (-551.543) [-540.497] (-561.664) * [-546.812] (-543.932) (-556.618) (-546.024) -- 0:01:27
481500 -- (-536.198) (-561.413) [-544.722] (-550.414) * [-536.040] (-549.743) (-547.760) (-547.981) -- 0:01:28
482000 -- (-545.427) (-545.489) (-542.929) [-551.815] * (-543.307) [-548.419] (-553.335) (-546.247) -- 0:01:28
482500 -- (-546.751) (-549.263) [-542.207] (-555.937) * [-534.936] (-556.140) (-545.631) (-539.913) -- 0:01:27
483000 -- (-551.631) (-548.993) (-546.377) [-538.618] * [-547.539] (-551.021) (-553.713) (-547.579) -- 0:01:27
483500 -- (-543.765) (-551.877) [-557.477] (-560.194) * [-547.494] (-547.358) (-547.661) (-540.804) -- 0:01:27
484000 -- (-561.457) (-553.150) (-552.645) [-543.369] * [-537.190] (-547.436) (-542.579) (-547.517) -- 0:01:27
484500 -- (-540.312) (-553.114) [-545.066] (-550.166) * (-552.772) [-539.414] (-552.094) (-546.836) -- 0:01:27
485000 -- [-538.092] (-548.511) (-539.775) (-568.392) * (-552.884) (-550.038) (-547.301) [-539.124] -- 0:01:27
Average standard deviation of split frequencies: 0.015067
485500 -- (-533.938) [-546.239] (-549.428) (-560.668) * (-549.895) [-543.958] (-553.529) (-545.985) -- 0:01:26
486000 -- [-531.035] (-551.139) (-551.251) (-555.605) * (-559.698) (-543.639) (-552.587) [-539.720] -- 0:01:26
486500 -- [-535.863] (-550.208) (-558.115) (-536.613) * [-547.687] (-540.229) (-548.920) (-544.166) -- 0:01:26
487000 -- (-542.972) (-550.007) (-548.357) [-536.537] * (-547.135) (-548.239) (-548.587) [-535.781] -- 0:01:27
487500 -- (-540.556) [-538.347] (-546.190) (-537.222) * [-541.550] (-552.667) (-550.875) (-542.559) -- 0:01:27
488000 -- (-547.129) (-550.189) [-531.021] (-544.724) * (-543.529) (-547.567) (-541.268) [-541.132] -- 0:01:27
488500 -- (-551.308) (-548.638) [-544.246] (-552.738) * (-539.448) (-556.379) [-540.648] (-540.528) -- 0:01:26
489000 -- (-537.316) [-538.195] (-554.281) (-539.577) * (-531.357) (-552.455) [-540.700] (-538.179) -- 0:01:26
489500 -- [-540.984] (-544.295) (-559.243) (-538.742) * (-544.230) (-555.410) (-552.512) [-538.813] -- 0:01:26
490000 -- (-567.703) [-534.852] (-554.776) (-550.784) * [-546.543] (-551.852) (-542.152) (-540.814) -- 0:01:26
Average standard deviation of split frequencies: 0.014603
490500 -- (-550.634) (-542.661) (-555.224) [-542.042] * [-548.015] (-544.125) (-540.087) (-542.105) -- 0:01:26
491000 -- (-548.629) (-537.551) [-539.995] (-533.633) * [-546.274] (-549.990) (-550.028) (-548.050) -- 0:01:26
491500 -- (-539.273) (-547.559) (-551.802) [-534.839] * (-536.074) (-544.229) (-547.724) [-538.795] -- 0:01:25
492000 -- (-546.043) (-545.545) (-546.312) [-548.424] * [-540.759] (-549.284) (-538.437) (-543.568) -- 0:01:25
492500 -- (-544.542) (-538.179) (-550.605) [-531.039] * (-544.900) (-546.511) (-549.115) [-538.576] -- 0:01:25
493000 -- (-554.120) [-542.048] (-545.167) (-534.766) * (-542.850) [-557.408] (-552.886) (-549.095) -- 0:01:26
493500 -- (-551.010) (-525.561) (-541.820) [-537.401] * (-547.731) (-557.736) (-548.418) [-539.927] -- 0:01:26
494000 -- (-545.994) [-530.562] (-543.596) (-538.396) * (-542.955) (-554.286) (-539.995) [-541.957] -- 0:01:26
494500 -- (-552.981) (-540.901) [-535.546] (-547.577) * (-546.621) (-544.493) (-547.824) [-545.947] -- 0:01:25
495000 -- (-547.882) [-533.517] (-546.900) (-537.549) * (-547.017) (-545.970) [-535.504] (-541.837) -- 0:01:25
Average standard deviation of split frequencies: 0.014867
495500 -- (-549.618) [-546.510] (-544.258) (-546.594) * (-547.789) [-542.807] (-553.447) (-542.058) -- 0:01:25
496000 -- (-551.729) (-533.431) (-546.955) [-540.975] * (-551.870) (-554.403) [-537.208] (-543.229) -- 0:01:25
496500 -- [-539.780] (-547.787) (-537.120) (-554.842) * (-548.919) (-555.326) (-537.364) [-544.977] -- 0:01:25
497000 -- (-542.855) (-547.754) [-543.738] (-546.438) * (-542.879) (-555.826) [-540.717] (-549.417) -- 0:01:25
497500 -- (-555.399) (-544.288) [-545.119] (-542.763) * (-552.746) (-542.505) (-544.005) [-549.141] -- 0:01:24
498000 -- (-555.309) (-547.605) (-547.722) [-544.645] * (-544.472) (-543.666) [-545.083] (-552.423) -- 0:01:24
498500 -- (-547.101) (-544.568) [-542.667] (-541.706) * [-549.595] (-540.268) (-539.796) (-542.920) -- 0:01:24
499000 -- [-544.737] (-553.086) (-542.598) (-537.719) * [-540.503] (-551.076) (-545.268) (-538.883) -- 0:01:25
499500 -- [-543.183] (-541.051) (-537.171) (-546.721) * (-553.406) (-556.877) [-539.138] (-547.895) -- 0:01:25
500000 -- (-546.074) (-537.900) [-538.142] (-547.386) * (-545.350) (-530.165) [-543.876] (-537.494) -- 0:01:25
Average standard deviation of split frequencies: 0.014863
500500 -- (-559.484) [-538.822] (-539.376) (-536.926) * (-554.548) (-546.844) (-538.557) [-541.036] -- 0:01:24
501000 -- (-562.489) [-543.785] (-547.531) (-539.814) * (-558.762) (-541.220) [-538.580] (-554.921) -- 0:01:24
501500 -- (-538.448) (-549.061) (-535.851) [-530.850] * (-543.384) (-554.240) [-530.723] (-545.438) -- 0:01:24
502000 -- (-549.474) (-555.656) [-536.123] (-544.582) * [-547.052] (-549.097) (-536.885) (-541.787) -- 0:01:24
502500 -- [-540.149] (-548.154) (-534.298) (-549.353) * (-549.289) [-547.506] (-554.457) (-548.926) -- 0:01:24
503000 -- [-538.365] (-541.708) (-539.752) (-545.544) * (-548.990) (-555.669) (-538.683) [-538.213] -- 0:01:23
503500 -- (-546.133) (-550.520) (-542.734) [-543.992] * (-544.657) [-549.128] (-552.215) (-539.706) -- 0:01:23
504000 -- (-546.534) (-544.176) (-537.581) [-545.991] * [-541.363] (-553.439) (-550.136) (-539.777) -- 0:01:23
504500 -- (-537.978) (-553.790) [-542.325] (-546.626) * (-539.702) [-546.608] (-553.172) (-552.653) -- 0:01:23
505000 -- (-547.308) [-542.904] (-562.864) (-544.907) * (-540.705) (-555.200) [-536.531] (-547.711) -- 0:01:24
Average standard deviation of split frequencies: 0.014773
505500 -- (-543.988) (-554.043) [-550.313] (-543.875) * (-547.258) (-551.688) [-533.868] (-562.578) -- 0:01:24
506000 -- (-548.802) (-551.880) (-539.678) [-536.305] * (-547.480) [-537.709] (-537.377) (-558.521) -- 0:01:23
506500 -- (-550.587) (-550.756) [-544.914] (-549.194) * [-548.559] (-541.210) (-529.412) (-546.153) -- 0:01:23
507000 -- (-555.004) [-543.710] (-549.454) (-544.926) * [-543.409] (-545.245) (-551.964) (-552.817) -- 0:01:23
507500 -- (-544.363) (-560.368) (-550.676) [-529.006] * [-556.890] (-543.958) (-554.220) (-555.037) -- 0:01:23
508000 -- [-546.707] (-552.065) (-553.179) (-540.924) * (-548.254) (-550.027) (-554.521) [-543.259] -- 0:01:23
508500 -- (-545.217) (-552.370) (-551.138) [-535.210] * (-561.493) (-543.804) (-563.234) [-541.127] -- 0:01:23
509000 -- (-549.440) (-545.361) (-550.329) [-542.914] * (-544.730) (-566.445) (-552.202) [-538.734] -- 0:01:22
509500 -- (-544.620) (-541.624) (-551.606) [-531.249] * (-541.139) [-543.236] (-546.818) (-548.024) -- 0:01:22
510000 -- (-541.038) (-555.408) (-535.738) [-538.649] * (-551.403) (-545.449) (-542.836) [-543.410] -- 0:01:22
Average standard deviation of split frequencies: 0.014506
510500 -- (-550.033) (-547.362) (-541.880) [-542.837] * (-545.340) (-552.991) [-539.177] (-540.418) -- 0:01:22
511000 -- (-550.597) [-539.537] (-550.791) (-548.693) * (-551.577) (-558.171) (-557.081) [-534.489] -- 0:01:23
511500 -- (-549.779) (-541.504) [-548.313] (-544.103) * (-557.786) (-549.077) [-531.793] (-555.046) -- 0:01:23
512000 -- [-548.367] (-555.862) (-543.399) (-548.212) * (-552.427) (-558.114) (-554.981) [-550.865] -- 0:01:22
512500 -- (-552.834) (-554.181) (-546.018) [-534.142] * (-550.672) (-533.970) [-536.004] (-547.228) -- 0:01:22
513000 -- (-556.443) (-545.419) (-552.024) [-535.404] * (-551.112) [-534.806] (-549.633) (-549.328) -- 0:01:22
513500 -- (-556.638) [-540.764] (-541.653) (-557.336) * [-540.630] (-543.951) (-539.881) (-555.041) -- 0:01:22
514000 -- (-550.478) (-553.235) (-547.012) [-540.641] * (-544.780) [-532.992] (-545.770) (-554.440) -- 0:01:22
514500 -- (-555.537) (-551.826) [-540.664] (-537.029) * [-536.292] (-537.269) (-547.193) (-544.149) -- 0:01:22
515000 -- (-550.069) [-538.374] (-542.101) (-537.532) * (-559.027) (-538.484) (-538.844) [-546.917] -- 0:01:21
Average standard deviation of split frequencies: 0.014682
515500 -- (-549.236) (-557.701) (-546.794) [-546.630] * (-543.576) [-533.351] (-531.682) (-543.192) -- 0:01:21
516000 -- [-550.339] (-550.830) (-553.639) (-543.358) * (-545.960) (-538.798) [-543.755] (-556.056) -- 0:01:21
516500 -- (-556.132) (-543.150) [-544.542] (-555.463) * (-551.695) (-539.159) (-547.599) [-542.554] -- 0:01:21
517000 -- (-550.428) (-551.552) (-544.503) [-543.662] * (-548.812) [-542.673] (-549.844) (-557.596) -- 0:01:22
517500 -- (-563.261) (-549.310) [-549.245] (-541.842) * (-540.796) [-542.218] (-565.548) (-549.135) -- 0:01:22
518000 -- (-549.198) [-540.439] (-547.205) (-546.372) * [-532.115] (-534.092) (-548.367) (-540.406) -- 0:01:21
518500 -- (-551.376) (-550.893) [-537.300] (-547.026) * (-538.061) [-536.539] (-551.750) (-540.742) -- 0:01:21
519000 -- [-550.779] (-553.016) (-551.733) (-542.516) * [-536.770] (-533.524) (-554.252) (-543.036) -- 0:01:21
519500 -- [-542.973] (-545.837) (-540.367) (-540.522) * (-554.557) [-538.282] (-546.558) (-546.219) -- 0:01:21
520000 -- [-543.206] (-553.974) (-552.923) (-549.508) * (-553.542) (-536.275) [-544.607] (-541.812) -- 0:01:21
Average standard deviation of split frequencies: 0.014417
520500 -- (-542.348) (-546.558) (-548.836) [-540.398] * (-548.374) [-534.921] (-550.688) (-545.361) -- 0:01:21
521000 -- (-546.701) (-549.941) (-539.298) [-547.197] * (-551.510) (-541.863) [-533.869] (-554.045) -- 0:01:20
521500 -- (-553.330) [-549.841] (-540.528) (-558.866) * [-544.728] (-551.654) (-545.404) (-540.936) -- 0:01:20
522000 -- (-549.868) (-543.479) [-548.878] (-551.176) * (-547.727) (-546.499) (-541.610) [-537.523] -- 0:01:20
522500 -- (-559.125) (-543.622) [-547.027] (-549.885) * (-547.808) [-540.192] (-554.899) (-559.869) -- 0:01:21
523000 -- (-546.083) (-548.554) (-556.766) [-550.027] * (-542.755) [-527.493] (-550.088) (-558.959) -- 0:01:21
523500 -- (-545.721) (-549.079) [-545.531] (-548.222) * (-545.712) [-537.001] (-557.850) (-544.796) -- 0:01:21
524000 -- (-557.446) (-549.747) (-538.480) [-537.443] * (-541.798) (-552.800) (-558.834) [-538.534] -- 0:01:20
524500 -- [-544.150] (-547.718) (-550.720) (-553.334) * [-540.156] (-550.654) (-551.788) (-537.106) -- 0:01:20
525000 -- [-543.629] (-553.666) (-554.588) (-545.702) * [-537.736] (-546.729) (-541.520) (-551.922) -- 0:01:20
Average standard deviation of split frequencies: 0.013443
525500 -- (-541.924) [-546.402] (-554.822) (-546.066) * (-549.592) [-545.823] (-557.410) (-543.406) -- 0:01:20
526000 -- (-552.048) (-552.413) (-554.582) [-536.258] * (-538.897) (-550.719) (-538.243) [-538.078] -- 0:01:20
526500 -- (-544.558) (-547.682) (-539.453) [-556.979] * [-541.090] (-556.343) (-542.011) (-549.679) -- 0:01:20
527000 -- (-547.290) (-552.144) (-536.551) [-538.754] * [-537.485] (-550.372) (-555.330) (-550.770) -- 0:01:19
527500 -- (-538.471) (-544.270) [-535.679] (-556.283) * [-536.775] (-552.748) (-550.705) (-552.269) -- 0:01:19
528000 -- (-540.999) (-550.622) [-533.703] (-548.443) * (-546.349) [-548.477] (-542.570) (-544.304) -- 0:01:19
528500 -- (-548.237) (-544.824) [-539.125] (-552.429) * [-538.750] (-544.857) (-544.734) (-556.903) -- 0:01:20
529000 -- (-543.030) [-539.076] (-555.664) (-558.399) * (-545.608) (-556.030) (-541.297) [-538.970] -- 0:01:20
529500 -- (-549.538) (-547.309) [-541.993] (-557.177) * (-548.151) (-547.514) (-537.019) [-541.864] -- 0:01:19
530000 -- (-554.163) (-549.790) [-531.450] (-553.038) * (-543.219) [-549.939] (-540.448) (-554.827) -- 0:01:19
Average standard deviation of split frequencies: 0.012710
530500 -- (-542.062) [-536.738] (-543.414) (-542.306) * (-550.488) (-547.683) (-537.716) [-540.843] -- 0:01:19
531000 -- (-544.607) [-541.883] (-554.051) (-547.447) * (-551.591) (-551.568) (-534.127) [-531.626] -- 0:01:19
531500 -- (-557.961) (-541.343) [-546.835] (-554.034) * (-557.272) (-536.007) [-540.193] (-539.887) -- 0:01:19
532000 -- (-554.290) [-536.566] (-549.096) (-543.158) * (-542.891) [-536.893] (-538.551) (-545.228) -- 0:01:19
532500 -- (-545.596) (-532.823) [-541.423] (-548.316) * [-543.759] (-537.246) (-537.094) (-561.117) -- 0:01:19
533000 -- (-559.053) (-546.228) (-550.732) [-550.731] * (-536.010) [-529.393] (-548.955) (-548.367) -- 0:01:18
533500 -- (-544.708) (-536.101) (-542.792) [-542.343] * (-547.016) [-536.111] (-550.838) (-538.236) -- 0:01:18
534000 -- (-558.012) (-554.088) (-541.686) [-539.695] * (-544.449) (-552.537) [-542.962] (-541.115) -- 0:01:18
534500 -- (-547.332) (-552.982) [-539.500] (-543.022) * (-545.660) (-549.797) (-544.061) [-541.843] -- 0:01:19
535000 -- (-552.770) (-547.804) [-542.887] (-550.681) * [-554.689] (-549.051) (-542.161) (-553.822) -- 0:01:19
Average standard deviation of split frequencies: 0.011907
535500 -- [-552.147] (-543.836) (-538.106) (-550.542) * [-559.502] (-547.408) (-551.904) (-543.167) -- 0:01:18
536000 -- (-544.981) (-547.388) [-540.929] (-535.484) * [-548.734] (-550.600) (-545.202) (-548.965) -- 0:01:18
536500 -- (-539.335) (-543.250) (-541.204) [-545.794] * [-545.038] (-548.961) (-542.368) (-546.676) -- 0:01:18
537000 -- (-539.331) [-544.579] (-547.294) (-556.843) * (-546.653) (-536.640) [-535.679] (-554.018) -- 0:01:18
537500 -- (-544.147) [-537.927] (-545.360) (-548.831) * (-543.285) (-539.000) [-532.297] (-551.122) -- 0:01:18
538000 -- (-547.601) (-542.929) (-549.768) [-548.402] * (-553.328) (-544.064) [-536.327] (-558.475) -- 0:01:18
538500 -- (-541.983) [-534.820] (-543.887) (-557.689) * (-550.710) (-547.818) (-550.161) [-547.589] -- 0:01:17
539000 -- (-549.811) (-555.438) [-539.706] (-539.108) * (-554.122) (-543.562) [-535.817] (-540.393) -- 0:01:17
539500 -- (-547.787) [-548.632] (-559.511) (-536.573) * (-545.030) [-537.528] (-543.210) (-552.062) -- 0:01:17
540000 -- (-551.239) (-536.345) (-549.711) [-546.245] * [-543.035] (-550.610) (-538.459) (-548.001) -- 0:01:17
Average standard deviation of split frequencies: 0.011871
540500 -- (-558.041) (-555.924) (-545.593) [-547.309] * (-537.876) (-546.518) (-551.451) [-542.164] -- 0:01:18
541000 -- (-549.185) (-556.216) [-543.590] (-557.353) * (-546.621) (-538.333) (-552.545) [-541.464] -- 0:01:18
541500 -- [-535.268] (-539.994) (-530.909) (-558.860) * (-546.225) (-549.940) [-541.370] (-560.575) -- 0:01:17
542000 -- (-552.403) (-550.609) (-538.669) [-541.386] * (-550.684) (-542.509) (-543.366) [-554.407] -- 0:01:17
542500 -- (-545.629) (-552.762) [-533.975] (-551.119) * (-551.558) (-540.212) (-541.873) [-540.428] -- 0:01:17
543000 -- (-543.626) [-543.362] (-540.427) (-554.808) * (-548.733) (-548.596) (-544.747) [-534.781] -- 0:01:17
543500 -- [-541.485] (-547.985) (-534.138) (-544.925) * (-556.575) (-544.821) (-535.717) [-537.419] -- 0:01:17
544000 -- (-546.446) (-545.793) (-550.572) [-538.633] * (-540.301) (-545.445) (-547.010) [-539.095] -- 0:01:17
544500 -- (-552.528) [-542.158] (-536.728) (-550.335) * (-545.883) [-542.025] (-548.634) (-546.287) -- 0:01:16
545000 -- (-547.834) [-535.612] (-543.132) (-550.576) * (-543.575) (-539.774) [-550.632] (-538.562) -- 0:01:16
Average standard deviation of split frequencies: 0.011755
545500 -- [-537.851] (-538.484) (-539.821) (-559.408) * (-553.814) (-541.626) (-541.279) [-539.309] -- 0:01:16
546000 -- (-543.078) (-545.823) [-537.074] (-549.761) * (-549.371) (-550.966) (-555.844) [-542.724] -- 0:01:16
546500 -- (-555.898) (-540.917) (-553.511) [-547.334] * (-551.184) (-549.863) [-546.330] (-545.417) -- 0:01:17
547000 -- (-538.959) (-544.239) (-542.483) [-538.459] * (-551.338) [-543.420] (-548.260) (-541.449) -- 0:01:17
547500 -- (-547.599) (-548.584) [-542.565] (-544.308) * (-552.726) [-543.467] (-544.784) (-545.368) -- 0:01:16
548000 -- (-553.725) (-546.596) [-531.280] (-543.419) * (-544.280) (-540.697) (-544.525) [-547.021] -- 0:01:16
548500 -- [-543.622] (-535.643) (-544.398) (-550.724) * (-564.409) (-541.938) (-536.728) [-536.628] -- 0:01:16
549000 -- [-532.717] (-558.102) (-545.310) (-552.798) * (-561.674) (-543.681) [-532.593] (-551.813) -- 0:01:16
549500 -- (-554.574) [-550.628] (-544.642) (-549.570) * (-542.631) (-540.653) [-534.549] (-543.048) -- 0:01:16
550000 -- (-558.339) (-554.915) (-542.952) [-532.921] * (-540.247) (-544.763) [-537.605] (-538.301) -- 0:01:16
Average standard deviation of split frequencies: 0.011458
550500 -- (-551.099) (-552.824) [-538.564] (-546.532) * (-543.325) (-535.972) [-540.870] (-558.979) -- 0:01:15
551000 -- (-541.101) (-538.702) (-537.830) [-531.054] * (-552.316) [-536.977] (-542.530) (-557.370) -- 0:01:15
551500 -- [-541.565] (-548.829) (-539.641) (-551.483) * (-549.812) [-538.400] (-544.027) (-545.702) -- 0:01:15
552000 -- [-538.912] (-562.186) (-545.071) (-536.559) * [-532.304] (-545.326) (-558.901) (-542.307) -- 0:01:15
552500 -- (-541.281) (-550.564) [-536.712] (-561.160) * [-535.818] (-546.254) (-552.849) (-553.674) -- 0:01:16
553000 -- (-540.007) (-551.190) [-543.861] (-544.945) * (-543.576) (-536.807) (-548.899) [-537.778] -- 0:01:15
553500 -- (-539.254) (-546.269) (-547.448) [-532.742] * (-545.804) (-547.383) (-552.142) [-542.546] -- 0:01:15
554000 -- [-544.620] (-549.203) (-544.840) (-546.442) * [-530.817] (-548.044) (-553.183) (-539.951) -- 0:01:15
554500 -- (-537.762) (-546.264) (-543.575) [-544.437] * [-537.731] (-551.423) (-546.856) (-559.264) -- 0:01:15
555000 -- (-543.850) (-558.779) (-542.839) [-530.655] * (-539.017) (-543.976) [-535.216] (-552.370) -- 0:01:15
Average standard deviation of split frequencies: 0.011413
555500 -- [-533.517] (-547.977) (-544.027) (-548.591) * [-542.318] (-544.592) (-555.833) (-549.237) -- 0:01:15
556000 -- [-534.540] (-545.571) (-536.086) (-541.254) * (-548.558) (-551.191) (-540.932) [-546.257] -- 0:01:15
556500 -- (-549.406) (-543.546) (-549.727) [-536.737] * (-545.097) [-534.493] (-538.897) (-544.629) -- 0:01:14
557000 -- (-543.601) [-540.262] (-537.444) (-546.017) * (-545.453) (-547.487) [-544.022] (-546.652) -- 0:01:14
557500 -- (-540.089) (-555.114) (-550.194) [-529.223] * (-543.396) (-547.118) [-544.883] (-542.645) -- 0:01:14
558000 -- (-536.129) (-541.073) (-550.257) [-539.438] * (-555.559) (-546.277) (-547.722) [-531.166] -- 0:01:15
558500 -- (-529.827) (-544.156) [-541.660] (-547.341) * (-552.637) (-550.331) [-533.276] (-545.708) -- 0:01:15
559000 -- [-529.621] (-553.350) (-543.210) (-540.842) * (-536.104) [-542.046] (-549.571) (-554.996) -- 0:01:14
559500 -- (-540.064) (-556.498) (-555.506) [-545.186] * (-549.674) (-537.831) [-539.944] (-546.275) -- 0:01:14
560000 -- [-545.105] (-558.879) (-555.478) (-555.039) * (-544.954) [-531.886] (-547.111) (-551.994) -- 0:01:14
Average standard deviation of split frequencies: 0.011900
560500 -- (-537.632) [-541.698] (-549.562) (-554.005) * (-552.063) [-538.999] (-543.303) (-554.838) -- 0:01:14
561000 -- (-543.267) (-550.615) (-548.914) [-538.035] * [-537.913] (-535.601) (-549.953) (-552.087) -- 0:01:14
561500 -- [-539.342] (-543.415) (-539.980) (-532.385) * (-547.977) (-542.862) (-549.287) [-534.334] -- 0:01:14
562000 -- (-546.326) (-551.365) [-538.670] (-550.649) * (-550.078) (-541.830) (-542.698) [-541.610] -- 0:01:14
562500 -- (-542.777) [-548.449] (-547.814) (-541.286) * [-552.834] (-549.967) (-543.107) (-549.189) -- 0:01:13
563000 -- (-544.088) (-555.862) (-547.895) [-537.265] * (-543.141) (-555.540) [-532.521] (-550.193) -- 0:01:13
563500 -- (-533.598) (-546.089) (-554.823) [-530.584] * (-549.717) [-550.902] (-541.221) (-553.318) -- 0:01:13
564000 -- (-530.401) [-541.438] (-549.749) (-541.527) * [-547.100] (-546.839) (-554.843) (-542.388) -- 0:01:14
564500 -- (-537.383) (-543.854) (-552.347) [-547.125] * [-540.918] (-539.157) (-551.084) (-550.428) -- 0:01:14
565000 -- (-549.330) (-555.353) (-549.843) [-529.321] * (-545.736) (-549.670) [-540.077] (-539.777) -- 0:01:13
Average standard deviation of split frequencies: 0.011724
565500 -- (-555.031) (-547.314) (-534.636) [-546.526] * (-556.934) [-539.099] (-546.621) (-533.141) -- 0:01:13
566000 -- (-547.503) (-546.029) [-543.529] (-536.570) * (-541.246) [-541.412] (-559.638) (-549.420) -- 0:01:13
566500 -- (-555.378) [-530.586] (-548.366) (-549.917) * (-544.480) (-545.702) (-551.305) [-537.156] -- 0:01:13
567000 -- (-553.402) (-552.732) (-542.300) [-547.594] * (-547.207) (-548.639) (-545.867) [-536.692] -- 0:01:13
567500 -- (-544.871) (-547.128) [-541.645] (-547.799) * (-555.635) (-541.950) (-560.250) [-544.912] -- 0:01:13
568000 -- (-548.850) (-544.930) (-542.414) [-555.078] * (-543.385) [-543.182] (-552.610) (-542.433) -- 0:01:13
568500 -- (-546.041) [-536.323] (-560.681) (-544.569) * [-538.889] (-539.301) (-560.208) (-544.528) -- 0:01:12
569000 -- (-543.062) [-544.090] (-551.946) (-540.894) * (-547.991) (-541.992) (-555.486) [-543.652] -- 0:01:12
569500 -- (-554.300) (-548.086) [-546.559] (-536.271) * (-536.161) (-548.325) [-548.314] (-548.623) -- 0:01:12
570000 -- [-539.855] (-555.749) (-560.011) (-550.395) * (-542.439) [-548.070] (-545.149) (-549.331) -- 0:01:13
Average standard deviation of split frequencies: 0.011565
570500 -- (-547.232) (-553.812) [-542.150] (-546.879) * [-539.367] (-550.241) (-547.515) (-550.476) -- 0:01:13
571000 -- (-536.074) (-568.584) [-552.974] (-546.028) * (-551.487) (-546.439) [-547.943] (-551.912) -- 0:01:12
571500 -- [-537.811] (-544.352) (-546.700) (-544.130) * (-550.703) (-552.707) [-548.762] (-540.961) -- 0:01:12
572000 -- (-556.977) (-547.288) [-549.744] (-560.042) * (-550.595) (-546.111) (-549.554) [-544.534] -- 0:01:12
572500 -- [-548.923] (-545.492) (-544.383) (-545.475) * (-552.308) (-543.049) (-550.145) [-535.471] -- 0:01:12
573000 -- (-542.456) (-562.169) (-544.462) [-546.810] * (-545.494) (-540.402) (-546.080) [-547.264] -- 0:01:12
573500 -- (-536.025) (-550.421) [-545.024] (-549.084) * [-538.600] (-550.681) (-547.259) (-557.252) -- 0:01:12
574000 -- (-541.524) (-540.799) [-537.720] (-553.001) * (-552.821) (-544.060) (-551.693) [-532.560] -- 0:01:11
574500 -- [-540.491] (-551.419) (-546.799) (-546.675) * (-546.314) [-545.717] (-555.280) (-550.293) -- 0:01:11
575000 -- (-541.980) (-545.876) [-535.624] (-560.654) * [-533.553] (-537.526) (-548.176) (-557.038) -- 0:01:11
Average standard deviation of split frequencies: 0.010702
575500 -- [-548.027] (-542.092) (-547.173) (-551.292) * (-543.224) [-533.333] (-553.463) (-562.738) -- 0:01:11
576000 -- (-541.549) (-552.028) (-548.511) [-538.440] * [-544.131] (-548.590) (-545.323) (-554.181) -- 0:01:12
576500 -- (-542.311) (-545.368) (-556.314) [-542.591] * (-547.995) [-534.965] (-549.755) (-541.604) -- 0:01:11
577000 -- (-544.581) (-550.613) [-549.070] (-552.103) * [-542.275] (-533.070) (-550.247) (-553.284) -- 0:01:11
577500 -- (-542.798) (-550.124) (-541.283) [-534.863] * (-546.614) (-540.188) [-548.151] (-554.687) -- 0:01:11
578000 -- (-541.320) (-550.359) (-559.479) [-541.665] * (-546.831) (-542.868) [-545.649] (-561.560) -- 0:01:11
578500 -- (-545.045) (-542.905) [-547.821] (-552.491) * (-549.938) [-539.903] (-544.621) (-557.420) -- 0:01:11
579000 -- (-552.546) (-548.518) [-546.694] (-543.630) * (-541.447) [-539.475] (-548.750) (-547.392) -- 0:01:11
579500 -- [-543.665] (-531.396) (-545.301) (-553.177) * (-550.025) [-540.189] (-542.457) (-548.237) -- 0:01:11
580000 -- (-537.276) [-530.171] (-549.869) (-548.198) * [-544.759] (-548.940) (-554.981) (-547.627) -- 0:01:10
Average standard deviation of split frequencies: 0.011888
580500 -- (-542.312) [-543.551] (-538.831) (-551.406) * [-536.502] (-533.889) (-548.193) (-559.162) -- 0:01:10
581000 -- (-557.181) (-537.155) [-530.936] (-543.380) * (-543.836) [-538.899] (-538.102) (-544.595) -- 0:01:10
581500 -- (-549.545) (-549.627) [-546.495] (-553.732) * (-541.672) [-534.301] (-546.710) (-550.449) -- 0:01:10
582000 -- (-543.850) (-553.053) [-547.307] (-548.612) * (-536.992) (-537.354) (-556.521) [-544.348] -- 0:01:11
582500 -- [-540.584] (-547.947) (-545.844) (-550.842) * (-546.844) [-537.804] (-553.441) (-567.078) -- 0:01:10
583000 -- [-534.858] (-549.076) (-553.624) (-549.037) * (-552.471) [-538.816] (-548.798) (-553.880) -- 0:01:10
583500 -- (-544.822) (-553.326) [-537.335] (-543.624) * (-544.303) [-530.387] (-551.840) (-550.364) -- 0:01:10
584000 -- (-540.848) (-551.277) [-546.286] (-545.330) * (-541.234) [-536.932] (-558.568) (-553.504) -- 0:01:10
584500 -- (-540.394) [-540.304] (-545.417) (-549.899) * (-541.113) (-543.622) (-549.806) [-547.400] -- 0:01:10
585000 -- [-542.354] (-545.379) (-553.566) (-547.489) * (-535.259) [-533.921] (-546.495) (-549.430) -- 0:01:10
Average standard deviation of split frequencies: 0.011386
585500 -- (-542.894) (-550.973) (-537.141) [-540.398] * (-539.436) [-527.311] (-547.527) (-564.860) -- 0:01:10
586000 -- (-548.262) (-544.665) (-552.434) [-546.548] * [-542.727] (-542.869) (-552.454) (-553.665) -- 0:01:09
586500 -- (-546.237) (-546.720) [-537.401] (-557.411) * (-546.305) [-530.818] (-542.069) (-544.736) -- 0:01:09
587000 -- (-543.317) (-555.452) [-537.286] (-553.873) * (-548.019) (-548.687) [-542.789] (-543.712) -- 0:01:09
587500 -- (-541.616) (-547.339) (-544.235) [-542.756] * [-547.077] (-550.864) (-547.861) (-550.540) -- 0:01:09
588000 -- [-545.636] (-530.834) (-550.226) (-536.814) * (-547.689) (-549.883) [-544.813] (-540.909) -- 0:01:10
588500 -- (-544.585) [-537.629] (-548.549) (-530.846) * [-544.624] (-543.510) (-554.455) (-543.011) -- 0:01:09
589000 -- (-540.101) (-545.654) [-542.479] (-541.980) * (-544.320) [-537.705] (-559.246) (-552.666) -- 0:01:09
589500 -- [-542.516] (-545.149) (-553.257) (-552.414) * (-548.604) [-529.174] (-551.072) (-544.465) -- 0:01:09
590000 -- (-548.022) (-553.362) [-533.325] (-540.393) * (-543.749) (-546.779) [-536.795] (-541.683) -- 0:01:09
Average standard deviation of split frequencies: 0.011480
590500 -- (-544.863) (-547.724) (-534.891) [-536.141] * (-541.407) [-551.259] (-543.432) (-547.829) -- 0:01:09
591000 -- (-538.054) [-532.161] (-548.382) (-552.517) * [-543.737] (-548.002) (-538.801) (-546.147) -- 0:01:09
591500 -- (-541.323) (-546.436) [-538.956] (-564.461) * (-543.694) (-555.463) [-542.483] (-539.454) -- 0:01:09
592000 -- (-545.038) (-544.458) [-545.699] (-548.942) * (-550.240) (-542.616) (-544.872) [-537.476] -- 0:01:08
592500 -- (-551.798) (-542.218) [-542.766] (-560.926) * (-548.894) (-550.590) (-540.356) [-530.605] -- 0:01:08
593000 -- [-539.164] (-549.551) (-549.570) (-548.306) * (-546.744) [-529.200] (-550.795) (-551.906) -- 0:01:08
593500 -- (-547.705) (-538.017) [-543.531] (-550.695) * (-541.333) [-535.152] (-549.903) (-543.520) -- 0:01:08
594000 -- (-542.584) [-528.845] (-548.076) (-532.314) * (-543.125) (-548.053) [-549.485] (-549.218) -- 0:01:09
594500 -- (-557.840) [-539.272] (-543.154) (-549.753) * [-541.281] (-545.656) (-548.844) (-539.297) -- 0:01:08
595000 -- (-548.015) [-536.824] (-541.869) (-554.215) * (-543.135) (-547.724) (-549.957) [-529.187] -- 0:01:08
Average standard deviation of split frequencies: 0.011130
595500 -- (-548.910) [-534.710] (-544.620) (-546.682) * [-536.861] (-548.311) (-549.473) (-554.278) -- 0:01:08
596000 -- (-550.608) (-541.737) [-548.554] (-552.708) * (-546.679) [-542.709] (-559.245) (-540.138) -- 0:01:08
596500 -- (-553.496) (-543.024) (-542.509) [-552.840] * [-539.918] (-544.914) (-548.531) (-539.079) -- 0:01:08
597000 -- [-545.593] (-542.303) (-539.429) (-565.604) * (-557.533) (-544.340) [-539.406] (-544.100) -- 0:01:08
597500 -- (-550.176) [-535.257] (-539.762) (-549.542) * (-542.742) (-555.303) (-553.229) [-543.823] -- 0:01:08
598000 -- (-543.473) (-540.514) [-536.904] (-540.457) * (-557.617) (-553.648) (-554.148) [-546.017] -- 0:01:07
598500 -- (-549.906) [-537.192] (-552.232) (-549.803) * (-541.686) [-550.649] (-557.693) (-548.594) -- 0:01:07
599000 -- [-535.278] (-543.582) (-542.357) (-548.720) * (-546.462) [-534.014] (-543.144) (-543.597) -- 0:01:07
599500 -- [-551.630] (-546.066) (-545.498) (-538.282) * (-546.077) (-542.089) (-557.320) [-539.704] -- 0:01:07
600000 -- [-537.249] (-546.293) (-552.018) (-539.804) * (-539.335) (-546.949) (-554.278) [-542.355] -- 0:01:08
Average standard deviation of split frequencies: 0.010323
600500 -- (-542.339) (-548.192) (-552.817) [-534.441] * (-546.640) (-548.802) (-555.281) [-541.665] -- 0:01:07
601000 -- [-538.310] (-542.680) (-549.501) (-554.316) * (-545.513) (-541.954) (-549.749) [-540.323] -- 0:01:07
601500 -- [-540.924] (-549.920) (-549.611) (-549.819) * [-538.889] (-549.293) (-543.878) (-539.410) -- 0:01:07
602000 -- (-538.111) (-549.399) [-544.284] (-553.793) * (-539.417) [-539.367] (-552.854) (-541.817) -- 0:01:07
602500 -- [-544.902] (-547.421) (-549.036) (-556.088) * (-553.180) (-549.868) (-550.707) [-536.093] -- 0:01:07
603000 -- [-533.762] (-541.342) (-537.983) (-551.655) * (-552.345) [-545.147] (-551.133) (-542.868) -- 0:01:07
603500 -- [-528.166] (-551.692) (-545.763) (-547.297) * (-550.358) (-538.914) [-550.049] (-542.832) -- 0:01:07
604000 -- (-529.389) (-549.082) (-538.763) [-534.470] * [-544.400] (-549.277) (-539.832) (-538.898) -- 0:01:06
604500 -- [-538.874] (-547.434) (-550.275) (-551.827) * (-550.536) (-552.240) (-552.113) [-534.336] -- 0:01:06
605000 -- (-536.712) [-538.809] (-552.462) (-543.582) * (-549.168) (-541.541) (-557.664) [-541.510] -- 0:01:06
Average standard deviation of split frequencies: 0.010532
605500 -- [-541.556] (-539.612) (-554.012) (-548.481) * (-536.377) (-547.448) (-554.557) [-535.960] -- 0:01:07
606000 -- (-543.095) (-551.165) [-541.970] (-539.363) * (-556.042) (-549.189) (-546.465) [-533.212] -- 0:01:06
606500 -- (-545.649) (-544.155) (-546.864) [-538.493] * (-558.023) (-540.125) [-545.770] (-548.229) -- 0:01:06
607000 -- (-543.498) [-529.690] (-548.261) (-541.570) * (-546.745) (-544.536) (-545.729) [-542.385] -- 0:01:06
607500 -- (-541.819) (-545.414) (-559.419) [-536.282] * (-536.031) (-558.862) (-544.415) [-537.848] -- 0:01:06
608000 -- [-536.975] (-541.645) (-552.577) (-553.282) * (-538.441) [-543.686] (-551.723) (-544.513) -- 0:01:06
608500 -- (-545.891) (-537.966) [-545.755] (-538.419) * (-549.414) (-541.361) (-550.147) [-546.132] -- 0:01:06
609000 -- (-538.032) [-539.256] (-555.792) (-537.924) * (-552.554) (-547.146) (-551.891) [-538.684] -- 0:01:06
609500 -- (-538.658) [-538.692] (-549.485) (-536.526) * (-535.971) (-550.354) [-546.330] (-544.593) -- 0:01:05
610000 -- (-545.522) (-546.894) (-544.462) [-537.972] * (-552.790) (-553.406) [-542.856] (-541.956) -- 0:01:05
Average standard deviation of split frequencies: 0.010451
610500 -- (-536.427) [-541.512] (-553.498) (-541.592) * (-535.245) (-554.607) (-547.074) [-525.332] -- 0:01:05
611000 -- (-541.984) (-549.220) [-550.514] (-548.347) * [-529.796] (-554.647) (-546.727) (-542.026) -- 0:01:05
611500 -- (-540.135) (-553.512) (-545.197) [-542.067] * (-543.336) (-552.056) (-546.609) [-538.588] -- 0:01:06
612000 -- (-554.297) (-550.650) [-540.225] (-545.557) * (-547.702) (-542.586) [-538.912] (-548.950) -- 0:01:05
612500 -- (-550.355) (-547.251) [-542.180] (-543.799) * (-549.182) [-552.045] (-548.454) (-538.056) -- 0:01:05
613000 -- (-541.361) (-539.022) [-532.457] (-537.728) * (-546.783) [-540.541] (-546.472) (-541.418) -- 0:01:05
613500 -- (-535.972) (-559.140) (-544.279) [-540.564] * (-544.527) (-547.822) (-549.030) [-535.507] -- 0:01:05
614000 -- (-542.526) (-548.802) [-531.706] (-555.868) * (-541.517) (-537.262) (-547.478) [-540.685] -- 0:01:05
614500 -- (-546.750) (-540.563) [-541.404] (-553.342) * (-556.505) (-555.828) (-548.770) [-539.477] -- 0:01:05
615000 -- (-544.156) (-540.362) [-543.664] (-546.167) * (-541.782) [-533.317] (-545.864) (-541.092) -- 0:01:05
Average standard deviation of split frequencies: 0.009566
615500 -- [-536.965] (-532.813) (-544.158) (-545.415) * (-541.172) [-528.996] (-549.719) (-544.676) -- 0:01:04
616000 -- (-543.797) [-543.970] (-552.980) (-550.811) * [-542.038] (-532.674) (-555.663) (-536.266) -- 0:01:04
616500 -- (-536.215) (-544.546) (-556.858) [-549.180] * [-539.304] (-538.310) (-567.236) (-530.795) -- 0:01:04
617000 -- (-541.898) [-543.564] (-548.651) (-560.859) * [-533.565] (-549.002) (-548.091) (-555.509) -- 0:01:04
617500 -- [-540.801] (-545.847) (-562.360) (-557.134) * [-536.595] (-546.259) (-544.553) (-533.295) -- 0:01:05
618000 -- (-539.973) [-541.503] (-547.297) (-540.889) * [-534.456] (-551.889) (-551.631) (-542.715) -- 0:01:04
618500 -- (-549.663) (-542.475) (-561.345) [-538.988] * [-531.861] (-553.185) (-546.236) (-543.171) -- 0:01:04
619000 -- (-543.267) (-545.381) (-547.555) [-540.159] * [-529.958] (-538.982) (-552.349) (-544.248) -- 0:01:04
619500 -- (-558.240) [-543.388] (-547.109) (-536.791) * [-535.930] (-541.942) (-546.718) (-544.837) -- 0:01:04
620000 -- (-546.505) (-551.402) (-537.384) [-539.222] * [-536.947] (-543.967) (-550.923) (-552.653) -- 0:01:04
Average standard deviation of split frequencies: 0.009698
620500 -- [-534.771] (-538.332) (-548.294) (-539.910) * [-543.816] (-538.634) (-538.614) (-550.647) -- 0:01:04
621000 -- [-544.742] (-548.869) (-545.471) (-546.254) * [-540.080] (-540.426) (-554.860) (-560.091) -- 0:01:04
621500 -- (-548.312) (-551.150) [-544.914] (-554.562) * [-541.196] (-541.756) (-546.855) (-549.051) -- 0:01:03
622000 -- (-548.777) (-543.720) (-551.200) [-538.236] * (-553.199) (-544.396) (-536.340) [-538.752] -- 0:01:03
622500 -- (-548.362) (-539.031) (-542.393) [-534.154] * (-542.693) (-551.775) [-530.613] (-540.001) -- 0:01:03
623000 -- (-548.364) (-545.359) (-550.535) [-543.962] * (-547.649) (-542.930) (-552.944) [-533.441] -- 0:01:03
623500 -- (-546.142) (-546.954) (-537.266) [-538.865] * (-539.543) (-545.812) [-538.225] (-534.315) -- 0:01:04
624000 -- (-546.897) (-544.949) (-548.794) [-548.443] * (-545.902) (-544.180) [-540.312] (-548.477) -- 0:01:03
624500 -- (-552.003) (-542.709) (-559.123) [-531.502] * (-541.232) (-542.374) (-545.813) [-535.913] -- 0:01:03
625000 -- (-527.529) (-547.272) (-549.708) [-537.620] * (-551.107) (-541.569) (-533.303) [-542.165] -- 0:01:03
Average standard deviation of split frequencies: 0.010643
625500 -- (-543.916) (-551.754) (-552.413) [-533.192] * (-544.582) (-542.967) [-534.232] (-544.588) -- 0:01:03
626000 -- (-554.557) (-542.978) (-551.225) [-545.803] * (-549.696) (-541.192) [-546.147] (-539.333) -- 0:01:03
626500 -- (-551.166) (-538.968) (-551.064) [-535.572] * (-553.949) (-551.043) (-539.723) [-533.895] -- 0:01:03
627000 -- (-544.964) (-552.010) (-544.474) [-549.216] * (-550.316) (-545.881) (-546.272) [-541.453] -- 0:01:03
627500 -- (-540.270) (-550.551) [-533.124] (-556.472) * [-537.676] (-549.809) (-553.289) (-546.942) -- 0:01:02
628000 -- (-549.970) (-547.996) [-539.226] (-548.344) * (-539.866) [-536.638] (-547.476) (-551.385) -- 0:01:02
628500 -- (-538.064) [-538.987] (-539.029) (-550.990) * (-539.920) (-552.226) (-550.981) [-540.745] -- 0:01:02
629000 -- (-539.116) [-535.114] (-546.414) (-546.976) * (-541.221) (-550.111) (-546.333) [-536.179] -- 0:01:02
629500 -- (-560.286) [-534.903] (-545.714) (-542.697) * [-539.610] (-543.367) (-548.098) (-542.218) -- 0:01:02
630000 -- (-560.853) [-534.469] (-545.558) (-546.425) * (-547.398) (-544.991) (-550.021) [-544.487] -- 0:01:02
Average standard deviation of split frequencies: 0.009984
630500 -- (-545.399) (-552.045) (-544.977) [-548.831] * [-539.462] (-544.625) (-564.802) (-550.400) -- 0:01:02
631000 -- (-549.068) (-545.166) (-543.051) [-538.114] * [-541.353] (-548.496) (-547.944) (-543.997) -- 0:01:02
631500 -- (-554.981) (-557.191) (-547.042) [-539.850] * (-538.236) (-558.831) (-552.616) [-537.191] -- 0:01:02
632000 -- (-546.560) [-539.400] (-551.664) (-539.414) * [-536.396] (-558.680) (-544.152) (-552.385) -- 0:01:02
632500 -- (-540.639) [-535.154] (-548.369) (-547.122) * (-534.021) (-555.007) [-540.363] (-555.850) -- 0:01:02
633000 -- (-546.665) [-541.017] (-555.466) (-543.178) * (-545.667) [-541.236] (-562.343) (-543.592) -- 0:01:02
633500 -- (-547.557) [-539.314] (-545.058) (-544.875) * (-541.780) (-540.018) [-549.606] (-549.326) -- 0:01:01
634000 -- (-543.060) [-537.516] (-545.976) (-542.305) * (-547.841) (-548.787) [-539.538] (-547.764) -- 0:01:01
634500 -- (-542.897) (-538.821) [-550.281] (-545.141) * [-541.848] (-540.232) (-540.309) (-558.063) -- 0:01:01
635000 -- [-540.522] (-544.919) (-554.751) (-559.213) * (-546.041) (-537.344) (-542.883) [-540.613] -- 0:01:02
Average standard deviation of split frequencies: 0.009477
635500 -- [-540.860] (-536.151) (-557.970) (-537.115) * [-542.425] (-532.135) (-559.035) (-541.567) -- 0:01:01
636000 -- [-545.831] (-539.879) (-551.923) (-545.011) * (-541.977) [-539.228] (-552.878) (-559.839) -- 0:01:01
636500 -- (-553.752) [-533.232] (-557.197) (-548.968) * [-539.107] (-551.683) (-555.567) (-560.436) -- 0:01:01
637000 -- (-556.284) (-551.286) (-544.608) [-541.921] * (-545.622) [-539.631] (-545.441) (-545.450) -- 0:01:01
637500 -- (-538.618) (-548.920) (-547.153) [-540.845] * (-544.482) [-535.618] (-551.612) (-543.196) -- 0:01:01
638000 -- (-548.017) (-545.376) [-537.353] (-562.484) * [-553.817] (-551.945) (-540.263) (-544.725) -- 0:01:01
638500 -- (-540.321) [-536.068] (-542.660) (-543.985) * (-540.163) [-542.527] (-551.007) (-546.236) -- 0:01:01
639000 -- (-544.847) [-546.860] (-551.281) (-555.858) * (-550.812) [-535.474] (-546.378) (-548.965) -- 0:01:01
639500 -- [-531.233] (-549.894) (-556.978) (-543.571) * (-548.886) (-558.563) [-537.634] (-549.775) -- 0:01:00
640000 -- [-538.265] (-544.149) (-547.706) (-554.134) * (-552.667) (-550.958) (-549.542) [-547.209] -- 0:01:00
Average standard deviation of split frequencies: 0.009198
640500 -- [-536.456] (-549.822) (-558.833) (-547.029) * [-545.154] (-560.602) (-545.217) (-539.438) -- 0:01:00
641000 -- (-541.479) [-536.414] (-560.389) (-559.002) * (-534.457) (-554.966) [-546.842] (-553.398) -- 0:01:00
641500 -- [-541.416] (-546.971) (-555.639) (-541.422) * (-547.406) (-560.678) [-539.474] (-546.703) -- 0:01:00
642000 -- [-538.402] (-553.443) (-551.658) (-553.084) * (-550.625) (-550.545) [-551.577] (-557.362) -- 0:01:00
642500 -- (-545.632) (-548.259) (-550.239) [-545.380] * (-551.436) (-546.144) (-550.111) [-547.416] -- 0:01:00
643000 -- [-533.709] (-547.745) (-553.527) (-550.490) * (-554.038) (-536.127) [-544.873] (-558.786) -- 0:01:00
643500 -- (-545.502) (-545.492) (-555.510) [-536.693] * [-558.275] (-544.699) (-550.881) (-551.686) -- 0:01:00
644000 -- (-545.632) (-546.382) (-550.029) [-534.192] * (-549.736) (-548.174) (-550.543) [-545.550] -- 0:01:00
644500 -- (-548.232) (-547.142) (-547.003) [-544.549] * (-549.629) (-560.296) (-538.741) [-538.066] -- 0:01:00
645000 -- [-538.251] (-548.309) (-552.518) (-544.153) * (-551.937) (-555.153) (-557.473) [-531.693] -- 0:00:59
Average standard deviation of split frequencies: 0.009382
645500 -- [-540.858] (-540.866) (-548.560) (-536.994) * (-556.942) [-546.496] (-544.741) (-549.520) -- 0:00:59
646000 -- (-548.307) (-558.760) (-561.229) [-541.514] * (-552.787) (-539.323) (-547.288) [-544.827] -- 0:00:59
646500 -- (-556.531) (-547.478) [-538.033] (-542.657) * (-559.876) [-536.245] (-548.222) (-540.958) -- 0:00:59
647000 -- [-543.926] (-537.751) (-549.774) (-549.133) * (-553.285) (-550.538) (-553.861) [-538.467] -- 0:01:00
647500 -- (-547.702) [-534.479] (-552.304) (-546.986) * (-557.958) (-548.740) [-539.959] (-540.826) -- 0:00:59
648000 -- (-549.028) (-543.540) [-553.234] (-540.996) * (-549.042) [-553.447] (-549.028) (-551.845) -- 0:00:59
648500 -- (-554.707) [-541.338] (-546.930) (-539.318) * (-549.623) (-533.383) (-550.492) [-548.168] -- 0:00:59
649000 -- (-537.649) (-544.559) [-537.207] (-544.094) * (-557.173) [-533.056] (-545.863) (-557.778) -- 0:00:59
649500 -- (-537.053) (-552.034) (-550.947) [-535.308] * (-548.911) [-531.279] (-544.561) (-544.256) -- 0:00:59
650000 -- (-535.411) (-543.364) (-550.376) [-540.530] * (-551.405) [-538.083] (-554.514) (-543.798) -- 0:00:59
Average standard deviation of split frequencies: 0.009315
650500 -- [-544.869] (-557.791) (-553.403) (-540.939) * (-551.874) (-560.612) [-542.185] (-547.261) -- 0:00:59
651000 -- (-541.934) [-548.767] (-551.138) (-543.642) * (-550.427) [-540.279] (-553.562) (-553.847) -- 0:00:58
651500 -- (-548.205) [-543.407] (-543.234) (-539.055) * (-543.675) [-540.381] (-547.812) (-539.044) -- 0:00:58
652000 -- [-548.296] (-535.459) (-547.249) (-556.764) * (-555.656) (-537.136) [-531.727] (-550.328) -- 0:00:58
652500 -- [-540.949] (-546.675) (-548.931) (-546.713) * (-548.326) [-534.153] (-539.408) (-553.754) -- 0:00:58
653000 -- [-549.576] (-544.265) (-549.181) (-536.201) * (-554.726) (-547.889) [-540.555] (-547.986) -- 0:00:58
653500 -- [-545.553] (-559.480) (-550.254) (-536.360) * (-549.459) [-531.208] (-553.543) (-534.920) -- 0:00:58
654000 -- (-558.218) (-530.821) [-551.127] (-538.912) * (-550.017) (-542.296) (-548.397) [-533.895] -- 0:00:58
654500 -- (-552.457) [-531.549] (-548.232) (-547.141) * (-543.564) [-536.782] (-545.251) (-546.548) -- 0:00:58
655000 -- (-550.934) (-535.829) (-549.161) [-546.793] * (-557.011) [-531.836] (-544.316) (-545.315) -- 0:00:58
Average standard deviation of split frequencies: 0.008264
655500 -- (-551.896) [-536.101] (-554.361) (-557.601) * (-548.906) [-540.621] (-543.927) (-541.326) -- 0:00:58
656000 -- (-562.862) (-541.519) (-545.058) [-537.240] * (-551.997) (-557.192) [-533.504] (-543.633) -- 0:00:58
656500 -- (-558.289) (-550.611) (-541.356) [-539.652] * (-553.565) (-551.125) (-543.349) [-539.759] -- 0:00:58
657000 -- (-548.440) (-552.551) [-532.461] (-544.359) * (-556.529) [-539.647] (-540.838) (-547.658) -- 0:00:57
657500 -- [-539.492] (-546.652) (-544.890) (-547.168) * (-552.141) (-542.101) [-550.025] (-538.016) -- 0:00:57
658000 -- [-540.163] (-546.160) (-543.738) (-551.056) * (-561.252) (-547.461) [-552.641] (-547.667) -- 0:00:57
658500 -- (-553.107) [-547.377] (-553.731) (-539.280) * (-547.364) [-534.756] (-540.447) (-549.327) -- 0:00:57
659000 -- (-555.038) [-540.882] (-547.170) (-550.837) * [-548.268] (-538.345) (-548.685) (-552.679) -- 0:00:57
659500 -- [-539.634] (-561.311) (-551.521) (-551.574) * (-544.707) [-543.603] (-550.830) (-545.631) -- 0:00:57
660000 -- (-550.143) (-546.214) [-540.089] (-548.228) * (-553.640) (-545.239) (-545.240) [-536.842] -- 0:00:57
Average standard deviation of split frequencies: 0.009166
660500 -- (-545.595) (-541.762) [-543.083] (-551.762) * [-554.438] (-542.220) (-551.430) (-552.797) -- 0:00:57
661000 -- (-542.787) [-536.743] (-543.517) (-539.565) * (-544.764) (-546.321) (-545.837) [-542.921] -- 0:00:57
661500 -- (-546.762) [-541.142] (-547.961) (-543.758) * (-559.159) (-546.480) [-535.502] (-553.810) -- 0:00:57
662000 -- (-541.263) (-558.090) (-542.536) [-542.283] * (-554.383) (-539.839) [-543.395] (-545.668) -- 0:00:57
662500 -- (-543.689) [-547.192] (-545.435) (-551.727) * (-538.031) [-545.918] (-546.307) (-540.513) -- 0:00:57
663000 -- [-544.071] (-542.493) (-537.745) (-545.987) * [-539.235] (-547.289) (-550.805) (-545.030) -- 0:00:56
663500 -- [-540.882] (-552.068) (-544.509) (-536.175) * (-547.041) [-536.766] (-536.375) (-544.604) -- 0:00:56
664000 -- [-538.006] (-560.036) (-548.102) (-553.455) * (-544.378) (-552.145) (-547.192) [-545.294] -- 0:00:56
664500 -- [-540.027] (-552.919) (-545.372) (-548.905) * [-538.717] (-540.437) (-545.765) (-541.288) -- 0:00:56
665000 -- (-543.012) [-537.700] (-546.616) (-547.246) * (-545.128) (-555.902) (-543.324) [-538.413] -- 0:00:56
Average standard deviation of split frequencies: 0.009485
665500 -- (-554.549) [-553.013] (-546.197) (-558.554) * [-546.782] (-553.208) (-545.435) (-553.037) -- 0:00:56
666000 -- (-547.907) (-545.192) [-539.652] (-555.140) * (-558.237) (-557.464) (-549.863) [-533.530] -- 0:00:56
666500 -- [-545.146] (-540.579) (-540.065) (-554.617) * (-540.649) (-553.099) [-539.159] (-542.525) -- 0:00:56
667000 -- (-547.860) (-544.081) [-537.236] (-556.726) * [-536.649] (-549.469) (-562.037) (-543.784) -- 0:00:56
667500 -- [-540.191] (-555.359) (-548.284) (-545.307) * (-539.799) (-547.979) [-542.279] (-547.915) -- 0:00:56
668000 -- (-550.795) (-549.472) (-547.842) [-546.025] * (-553.628) [-537.468] (-551.389) (-542.005) -- 0:00:56
668500 -- (-551.838) (-545.451) (-558.259) [-534.274] * (-553.540) [-542.327] (-546.532) (-541.328) -- 0:00:56
669000 -- (-548.398) (-547.816) (-543.158) [-530.797] * (-548.202) [-541.098] (-541.216) (-535.741) -- 0:00:55
669500 -- [-535.567] (-552.673) (-547.032) (-535.216) * [-549.173] (-538.256) (-546.540) (-533.528) -- 0:00:55
670000 -- (-549.477) (-535.059) (-558.368) [-540.668] * (-540.945) [-533.714] (-554.121) (-546.781) -- 0:00:55
Average standard deviation of split frequencies: 0.008384
670500 -- (-545.419) (-556.975) (-548.175) [-534.136] * (-551.116) (-543.088) (-542.777) [-538.660] -- 0:00:55
671000 -- (-547.580) (-556.747) (-554.836) [-543.498] * (-554.931) (-538.957) (-544.599) [-548.365] -- 0:00:55
671500 -- (-547.622) [-544.123] (-549.108) (-544.936) * (-563.536) (-544.620) (-546.768) [-535.844] -- 0:00:55
672000 -- (-549.821) (-547.751) (-557.835) [-534.101] * (-553.514) [-537.032] (-548.698) (-544.191) -- 0:00:55
672500 -- (-544.860) (-554.846) (-550.079) [-543.877] * (-546.703) [-542.778] (-537.846) (-541.845) -- 0:00:55
673000 -- (-542.077) (-556.650) (-548.693) [-532.993] * (-545.589) [-540.932] (-542.925) (-554.405) -- 0:00:55
673500 -- (-543.599) (-549.134) [-544.776] (-539.044) * (-549.450) [-538.949] (-551.798) (-553.726) -- 0:00:55
674000 -- (-543.844) (-546.840) [-534.941] (-543.964) * (-541.222) [-537.790] (-542.584) (-558.021) -- 0:00:55
674500 -- (-545.418) (-548.950) [-531.249] (-556.573) * [-543.424] (-544.706) (-543.116) (-547.791) -- 0:00:55
675000 -- (-537.446) (-547.821) [-537.664] (-546.185) * (-549.147) (-546.975) (-539.374) [-537.742] -- 0:00:54
Average standard deviation of split frequencies: 0.009280
675500 -- (-544.402) (-558.297) [-542.566] (-548.188) * (-551.334) [-536.825] (-546.302) (-549.349) -- 0:00:54
676000 -- (-545.250) (-548.522) (-538.467) [-541.506] * (-564.401) [-547.593] (-557.239) (-541.818) -- 0:00:54
676500 -- (-552.008) (-551.712) [-541.158] (-541.726) * (-546.574) (-538.884) (-548.026) [-550.743] -- 0:00:54
677000 -- [-543.279] (-557.889) (-539.972) (-540.906) * (-545.102) [-537.020] (-550.487) (-554.709) -- 0:00:54
677500 -- (-544.252) (-546.892) [-548.316] (-545.231) * (-554.112) [-530.279] (-548.959) (-548.633) -- 0:00:54
678000 -- (-549.495) (-556.458) [-539.895] (-554.341) * (-553.840) [-536.597] (-548.753) (-550.932) -- 0:00:54
678500 -- [-546.282] (-556.341) (-544.096) (-551.962) * (-549.249) [-539.893] (-551.011) (-544.358) -- 0:00:54
679000 -- (-558.757) (-554.349) (-548.185) [-540.464] * (-545.786) (-538.842) (-546.969) [-537.490] -- 0:00:54
679500 -- (-551.803) [-533.683] (-531.983) (-546.592) * (-560.312) [-536.887] (-542.333) (-547.713) -- 0:00:54
680000 -- (-552.588) (-539.220) (-544.830) [-537.354] * (-540.369) (-535.006) [-550.954] (-556.156) -- 0:00:54
Average standard deviation of split frequencies: 0.009589
680500 -- (-548.979) (-550.976) (-544.680) [-545.386] * (-553.841) [-533.155] (-544.006) (-554.505) -- 0:00:53
681000 -- (-538.252) (-552.242) (-547.477) [-541.729] * (-553.992) [-540.327] (-544.355) (-550.231) -- 0:00:53
681500 -- (-546.270) (-550.572) (-546.752) [-539.297] * (-553.826) (-535.759) [-537.663] (-553.191) -- 0:00:53
682000 -- (-547.767) [-541.622] (-548.134) (-548.032) * [-540.196] (-536.944) (-551.423) (-550.915) -- 0:00:53
682500 -- (-546.302) [-544.831] (-553.804) (-535.180) * (-547.022) [-539.644] (-551.511) (-551.371) -- 0:00:53
683000 -- (-543.697) (-551.017) [-544.337] (-540.989) * (-542.502) (-544.719) (-558.189) [-541.705] -- 0:00:53
683500 -- (-564.767) [-550.949] (-546.756) (-554.892) * [-544.196] (-550.312) (-548.707) (-544.223) -- 0:00:53
684000 -- (-553.414) (-539.328) [-536.669] (-548.675) * (-557.433) (-545.380) (-550.067) [-540.080] -- 0:00:53
684500 -- (-545.679) (-550.692) [-537.478] (-536.414) * (-533.377) (-545.439) (-559.489) [-539.272] -- 0:00:53
685000 -- (-548.361) [-534.236] (-549.552) (-545.865) * (-539.369) (-547.981) (-550.192) [-529.788] -- 0:00:53
Average standard deviation of split frequencies: 0.009515
685500 -- (-545.484) (-541.708) (-557.178) [-536.923] * (-548.712) [-536.506] (-538.564) (-535.815) -- 0:00:53
686000 -- (-553.056) (-540.247) (-552.041) [-531.019] * (-548.963) [-535.697] (-546.536) (-547.635) -- 0:00:53
686500 -- (-555.121) (-555.423) (-539.299) [-541.711] * (-556.644) [-545.742] (-539.651) (-558.394) -- 0:00:52
687000 -- [-547.432] (-543.066) (-541.313) (-549.974) * (-557.060) [-538.481] (-552.929) (-553.526) -- 0:00:52
687500 -- [-542.704] (-542.826) (-551.391) (-543.669) * (-549.777) [-541.348] (-536.311) (-551.820) -- 0:00:52
688000 -- [-538.411] (-542.972) (-540.179) (-550.507) * (-542.321) [-533.469] (-546.992) (-548.650) -- 0:00:52
688500 -- (-544.256) (-542.325) (-534.571) [-538.587] * (-552.941) (-552.034) [-540.749] (-551.871) -- 0:00:52
689000 -- (-549.509) (-547.834) [-539.447] (-544.684) * [-541.239] (-544.052) (-535.741) (-552.445) -- 0:00:52
689500 -- (-533.136) [-537.380] (-546.006) (-557.194) * (-541.085) (-543.055) [-537.407] (-550.237) -- 0:00:52
690000 -- [-539.280] (-543.380) (-552.862) (-547.638) * (-544.099) [-539.087] (-542.919) (-554.151) -- 0:00:52
Average standard deviation of split frequencies: 0.009083
690500 -- [-532.832] (-555.258) (-545.654) (-552.750) * (-553.512) (-547.897) [-535.512] (-540.973) -- 0:00:52
691000 -- [-537.106] (-561.722) (-542.617) (-543.518) * (-552.617) (-555.132) [-541.193] (-551.108) -- 0:00:52
691500 -- (-542.205) (-560.215) (-533.469) [-544.346] * [-546.692] (-539.851) (-541.191) (-542.436) -- 0:00:52
692000 -- (-543.808) (-549.586) [-536.285] (-547.437) * (-556.926) (-550.424) [-543.220] (-553.840) -- 0:00:52
692500 -- [-537.795] (-545.697) (-536.786) (-548.597) * (-549.771) (-547.751) (-538.052) [-547.221] -- 0:00:51
693000 -- (-539.909) (-547.565) [-535.607] (-542.748) * [-533.899] (-548.516) (-551.880) (-555.143) -- 0:00:51
693500 -- [-535.216] (-555.357) (-543.900) (-540.775) * [-552.433] (-546.822) (-542.681) (-555.320) -- 0:00:51
694000 -- (-545.903) (-543.931) (-550.974) [-547.268] * [-544.999] (-551.064) (-547.141) (-540.205) -- 0:00:51
694500 -- (-545.066) (-553.428) [-546.696] (-553.287) * (-543.959) (-542.005) [-535.107] (-544.001) -- 0:00:51
695000 -- (-546.572) [-542.872] (-552.576) (-543.190) * [-543.528] (-545.558) (-540.123) (-542.634) -- 0:00:51
Average standard deviation of split frequencies: 0.009222
695500 -- (-542.481) (-540.156) [-535.799] (-544.811) * (-543.404) (-554.531) (-536.565) [-542.773] -- 0:00:51
696000 -- (-548.315) (-541.112) [-539.772] (-555.590) * (-564.907) (-541.056) [-534.947] (-548.888) -- 0:00:51
696500 -- (-557.057) (-550.203) (-544.309) [-544.397] * (-551.853) [-549.073] (-541.847) (-552.026) -- 0:00:51
697000 -- (-547.049) (-539.219) [-544.997] (-543.454) * (-545.176) (-542.654) [-547.079] (-553.138) -- 0:00:51
697500 -- (-545.129) (-550.958) [-543.947] (-559.264) * (-552.301) [-550.388] (-540.497) (-550.144) -- 0:00:51
698000 -- (-550.970) [-541.849] (-541.975) (-552.672) * (-552.844) (-549.003) [-539.952] (-563.379) -- 0:00:51
698500 -- (-543.126) [-538.578] (-536.372) (-543.005) * (-556.092) [-545.022] (-554.936) (-550.308) -- 0:00:50
699000 -- (-548.301) [-530.864] (-543.170) (-543.954) * (-554.968) [-531.856] (-550.236) (-559.189) -- 0:00:50
699500 -- (-549.816) [-540.126] (-541.147) (-562.832) * (-537.977) (-545.857) [-535.804] (-539.536) -- 0:00:50
700000 -- (-552.823) [-542.968] (-546.888) (-552.303) * (-534.199) [-544.074] (-561.415) (-548.886) -- 0:00:50
Average standard deviation of split frequencies: 0.009988
700500 -- [-535.818] (-546.280) (-544.663) (-548.487) * (-546.303) (-553.108) (-550.740) [-540.436] -- 0:00:50
701000 -- (-541.373) (-551.129) [-537.975] (-552.370) * (-541.459) [-543.388] (-549.282) (-546.450) -- 0:00:50
701500 -- (-547.738) (-551.066) [-540.440] (-551.032) * [-539.652] (-546.244) (-553.503) (-546.299) -- 0:00:50
702000 -- (-554.078) [-543.928] (-549.624) (-561.933) * [-545.537] (-544.137) (-550.795) (-552.693) -- 0:00:50
702500 -- [-545.997] (-552.695) (-559.901) (-545.607) * [-542.014] (-551.265) (-552.435) (-553.116) -- 0:00:50
703000 -- [-539.799] (-557.468) (-544.044) (-554.504) * (-542.157) (-546.667) [-544.300] (-545.310) -- 0:00:50
703500 -- (-546.173) (-550.457) [-542.497] (-545.660) * (-553.568) [-543.894] (-545.958) (-545.139) -- 0:00:50
704000 -- (-549.265) [-539.257] (-555.578) (-560.522) * (-541.701) [-536.065] (-540.807) (-546.599) -- 0:00:50
704500 -- (-554.552) (-542.570) [-542.318] (-554.479) * (-547.298) (-542.167) (-554.094) [-546.423] -- 0:00:49
705000 -- (-547.294) (-538.022) [-536.065] (-542.868) * [-545.304] (-546.627) (-562.736) (-560.269) -- 0:00:49
Average standard deviation of split frequencies: 0.009553
705500 -- [-547.069] (-555.229) (-544.561) (-550.711) * (-556.801) [-543.811] (-545.294) (-543.921) -- 0:00:49
706000 -- (-556.030) [-536.647] (-547.613) (-559.395) * (-553.704) [-542.594] (-535.925) (-539.525) -- 0:00:49
706500 -- [-546.506] (-556.191) (-546.871) (-548.890) * (-564.091) [-538.172] (-546.346) (-545.662) -- 0:00:49
707000 -- (-550.424) [-543.664] (-548.315) (-545.876) * (-543.635) [-535.823] (-545.136) (-539.086) -- 0:00:49
707500 -- (-548.351) [-533.510] (-548.938) (-543.102) * (-550.499) [-535.654] (-546.558) (-540.433) -- 0:00:49
708000 -- (-549.054) (-539.391) [-539.349] (-553.423) * (-550.469) [-533.615] (-550.413) (-540.237) -- 0:00:49
708500 -- (-550.126) (-552.469) [-541.949] (-553.823) * [-535.403] (-536.800) (-547.161) (-554.436) -- 0:00:49
709000 -- (-546.626) (-552.349) [-537.391] (-546.104) * (-549.742) [-531.129] (-544.867) (-555.015) -- 0:00:49
709500 -- (-555.906) (-552.375) (-539.333) [-548.865] * (-551.395) (-546.832) (-548.913) [-534.899] -- 0:00:49
710000 -- (-554.884) (-558.968) [-547.645] (-543.237) * (-548.221) [-536.885] (-548.942) (-533.682) -- 0:00:49
Average standard deviation of split frequencies: 0.009236
710500 -- (-553.110) (-543.871) (-554.481) [-546.555] * (-547.721) (-540.682) [-544.704] (-544.479) -- 0:00:48
711000 -- [-539.289] (-549.312) (-547.780) (-544.687) * (-542.526) [-540.199] (-545.365) (-538.317) -- 0:00:48
711500 -- [-534.290] (-560.034) (-548.176) (-550.660) * [-532.334] (-538.557) (-548.583) (-538.375) -- 0:00:48
712000 -- (-537.185) (-555.727) (-552.921) [-541.444] * (-545.575) [-545.411] (-550.624) (-550.942) -- 0:00:48
712500 -- (-535.649) (-548.332) (-550.785) [-531.446] * (-550.834) (-554.517) (-547.951) [-533.501] -- 0:00:48
713000 -- (-541.030) (-549.978) (-547.725) [-536.195] * (-538.766) (-557.054) (-553.249) [-539.180] -- 0:00:48
713500 -- [-534.995] (-552.730) (-561.688) (-543.112) * (-546.690) (-551.285) (-550.662) [-545.086] -- 0:00:48
714000 -- [-532.784] (-550.881) (-558.740) (-546.674) * [-533.040] (-550.017) (-544.708) (-546.492) -- 0:00:48
714500 -- (-543.135) (-554.579) (-548.364) [-539.271] * (-557.440) (-538.225) (-553.160) [-541.186] -- 0:00:48
715000 -- (-553.318) (-552.330) (-549.656) [-532.773] * (-543.552) (-544.513) [-548.228] (-537.931) -- 0:00:48
Average standard deviation of split frequencies: 0.009369
715500 -- (-547.510) (-542.098) (-547.977) [-554.093] * (-553.504) (-561.341) (-555.701) [-540.679] -- 0:00:48
716000 -- (-546.908) [-536.798] (-540.963) (-555.288) * (-555.752) [-547.539] (-551.031) (-539.848) -- 0:00:47
716500 -- [-541.602] (-551.184) (-541.814) (-535.779) * (-547.394) (-550.555) [-548.096] (-541.221) -- 0:00:47
717000 -- (-550.091) (-553.528) [-537.197] (-548.174) * (-545.692) (-550.780) (-553.269) [-543.564] -- 0:00:47
717500 -- (-552.261) (-550.698) (-538.115) [-544.934] * (-553.796) [-540.894] (-569.907) (-540.960) -- 0:00:47
718000 -- (-551.456) (-556.815) (-541.280) [-537.364] * (-545.124) [-538.708] (-546.354) (-559.498) -- 0:00:47
718500 -- (-547.045) (-544.936) [-545.242] (-540.745) * (-555.243) (-553.335) (-546.868) [-537.925] -- 0:00:47
719000 -- (-550.590) (-546.097) (-547.300) [-530.053] * (-556.847) (-561.374) [-537.928] (-548.679) -- 0:00:47
719500 -- (-549.067) (-542.631) [-532.307] (-540.488) * (-558.417) (-545.552) [-547.568] (-551.715) -- 0:00:47
720000 -- (-545.851) [-542.584] (-540.807) (-543.006) * (-551.717) (-551.040) [-543.668] (-544.514) -- 0:00:47
Average standard deviation of split frequencies: 0.009208
720500 -- (-542.984) (-550.015) (-551.409) [-542.613] * (-538.648) (-546.952) (-565.934) [-539.535] -- 0:00:47
721000 -- (-547.109) (-553.010) [-538.640] (-539.926) * [-537.978] (-541.648) (-541.479) (-549.826) -- 0:00:47
721500 -- (-545.345) [-542.712] (-545.914) (-546.828) * [-541.664] (-547.916) (-548.637) (-545.319) -- 0:00:47
722000 -- [-545.605] (-542.426) (-555.701) (-545.443) * (-543.574) [-544.464] (-542.827) (-537.173) -- 0:00:46
722500 -- (-548.005) (-556.105) (-549.758) [-527.195] * (-540.894) [-538.498] (-545.848) (-543.882) -- 0:00:46
723000 -- (-556.206) (-553.993) (-547.699) [-539.269] * [-534.531] (-546.313) (-542.037) (-540.479) -- 0:00:46
723500 -- (-551.898) (-556.166) [-545.908] (-537.892) * (-544.286) (-534.742) [-543.371] (-544.423) -- 0:00:46
724000 -- (-549.730) [-542.148] (-547.076) (-545.993) * (-541.264) [-533.674] (-539.284) (-542.327) -- 0:00:46
724500 -- (-544.553) (-546.079) (-544.699) [-535.139] * (-543.072) (-551.639) [-544.586] (-546.714) -- 0:00:46
725000 -- (-550.871) (-548.704) [-546.223] (-544.618) * (-538.381) (-547.416) [-538.183] (-545.566) -- 0:00:46
Average standard deviation of split frequencies: 0.009140
725500 -- (-540.002) (-538.309) [-544.628] (-541.468) * [-537.122] (-560.385) (-553.056) (-545.974) -- 0:00:46
726000 -- (-544.603) (-537.934) (-552.416) [-535.019] * [-544.936] (-546.576) (-553.351) (-542.207) -- 0:00:46
726500 -- [-536.573] (-552.843) (-554.448) (-550.497) * [-539.162] (-549.693) (-546.404) (-551.719) -- 0:00:46
727000 -- [-550.934] (-546.960) (-552.414) (-545.159) * (-541.166) [-543.743] (-553.674) (-544.161) -- 0:00:46
727500 -- (-538.346) (-550.565) [-541.356] (-547.086) * (-539.736) [-534.015] (-551.083) (-545.519) -- 0:00:46
728000 -- (-534.132) [-535.557] (-558.465) (-547.409) * (-541.515) (-543.255) [-548.843] (-555.529) -- 0:00:45
728500 -- (-546.263) [-544.241] (-558.446) (-546.143) * (-553.229) [-539.618] (-546.330) (-541.651) -- 0:00:45
729000 -- (-536.879) (-546.743) [-543.751] (-554.532) * (-547.725) (-546.665) [-544.015] (-541.565) -- 0:00:45
729500 -- (-543.040) [-541.565] (-549.552) (-537.406) * (-548.227) (-548.500) (-549.059) [-546.842] -- 0:00:45
730000 -- [-538.525] (-561.970) (-539.782) (-545.990) * (-544.090) (-554.880) (-548.777) [-543.772] -- 0:00:45
Average standard deviation of split frequencies: 0.009132
730500 -- (-558.249) (-548.716) [-541.693] (-544.929) * (-545.701) (-557.777) (-546.298) [-531.968] -- 0:00:45
731000 -- (-540.034) (-549.536) (-542.310) [-537.052] * (-553.202) (-546.562) (-540.756) [-547.381] -- 0:00:45
731500 -- (-548.997) (-540.069) (-544.078) [-531.412] * [-536.559] (-536.312) (-547.161) (-548.267) -- 0:00:45
732000 -- (-547.984) (-555.830) (-543.445) [-536.716] * (-546.167) [-540.708] (-552.240) (-549.128) -- 0:00:45
732500 -- [-550.554] (-552.031) (-548.302) (-540.280) * [-534.954] (-543.765) (-549.040) (-552.430) -- 0:00:45
733000 -- (-540.967) [-544.270] (-564.513) (-539.603) * [-542.711] (-539.846) (-564.312) (-556.477) -- 0:00:45
733500 -- (-532.916) (-556.344) (-547.754) [-537.384] * (-544.412) (-557.952) [-538.631] (-537.671) -- 0:00:45
734000 -- [-536.066] (-547.888) (-539.988) (-547.659) * (-548.954) (-551.688) (-552.726) [-538.511] -- 0:00:44
734500 -- (-540.202) (-552.639) (-553.154) [-535.626] * (-550.296) [-547.710] (-543.442) (-544.446) -- 0:00:44
735000 -- (-537.171) (-536.248) (-552.499) [-541.898] * (-553.607) [-538.581] (-546.425) (-538.835) -- 0:00:44
Average standard deviation of split frequencies: 0.008425
735500 -- (-546.193) (-541.785) (-549.553) [-531.741] * (-542.674) (-549.477) (-559.962) [-536.640] -- 0:00:44
736000 -- [-533.753] (-535.382) (-553.069) (-539.381) * (-554.954) [-546.986] (-542.914) (-551.521) -- 0:00:44
736500 -- (-551.383) [-534.764] (-547.305) (-552.489) * (-550.845) [-546.520] (-544.428) (-555.141) -- 0:00:44
737000 -- (-542.211) [-536.281] (-550.697) (-548.888) * (-546.547) [-538.018] (-537.306) (-541.869) -- 0:00:44
737500 -- [-538.502] (-545.037) (-543.610) (-549.596) * (-544.853) (-553.746) (-555.474) [-535.163] -- 0:00:44
738000 -- (-557.262) [-533.849] (-544.507) (-549.573) * (-544.641) (-544.469) [-549.420] (-539.165) -- 0:00:44
738500 -- [-545.580] (-538.399) (-546.645) (-546.241) * (-560.420) (-558.052) (-540.341) [-541.302] -- 0:00:44
739000 -- [-544.305] (-544.397) (-552.572) (-544.414) * [-541.857] (-552.042) (-545.074) (-540.374) -- 0:00:44
739500 -- [-542.681] (-540.410) (-556.411) (-547.860) * (-549.905) (-545.789) (-550.517) [-537.066] -- 0:00:44
740000 -- [-535.744] (-546.704) (-548.262) (-532.878) * (-555.567) [-542.165] (-541.955) (-556.539) -- 0:00:43
Average standard deviation of split frequencies: 0.007833
740500 -- [-534.127] (-544.342) (-554.133) (-542.945) * (-548.675) (-544.491) [-549.844] (-547.960) -- 0:00:43
741000 -- (-548.694) [-546.165] (-554.376) (-539.316) * (-552.433) [-547.980] (-550.487) (-537.542) -- 0:00:43
741500 -- (-553.274) (-547.206) [-539.186] (-542.137) * (-549.569) (-547.014) [-550.402] (-552.676) -- 0:00:43
742000 -- [-549.381] (-550.653) (-552.382) (-539.518) * (-546.571) [-545.978] (-563.077) (-541.108) -- 0:00:43
742500 -- [-537.988] (-557.413) (-546.826) (-544.991) * (-542.685) (-552.329) (-551.887) [-539.675] -- 0:00:43
743000 -- (-539.919) [-544.298] (-564.844) (-547.085) * (-545.448) (-553.663) (-557.673) [-538.409] -- 0:00:43
743500 -- (-545.889) (-550.627) [-546.210] (-558.216) * (-556.886) (-545.325) (-557.184) [-541.119] -- 0:00:43
744000 -- (-542.137) (-558.876) [-544.798] (-546.503) * (-546.957) (-556.792) (-553.336) [-534.219] -- 0:00:43
744500 -- (-543.523) (-543.700) (-557.299) [-529.023] * (-540.296) (-548.503) (-545.774) [-544.480] -- 0:00:43
745000 -- (-552.499) (-540.161) (-545.018) [-532.263] * (-541.382) [-545.828] (-539.505) (-540.418) -- 0:00:43
Average standard deviation of split frequencies: 0.008020
745500 -- (-556.081) (-547.272) [-544.083] (-548.093) * (-548.938) (-535.139) [-546.639] (-545.837) -- 0:00:43
746000 -- [-542.590] (-539.906) (-551.327) (-554.235) * (-548.315) [-545.544] (-559.341) (-543.815) -- 0:00:42
746500 -- (-543.596) [-526.811] (-551.901) (-541.983) * (-546.818) [-540.527] (-556.626) (-544.515) -- 0:00:42
747000 -- (-539.161) (-540.232) (-556.619) [-535.191] * [-543.442] (-547.767) (-548.257) (-539.443) -- 0:00:42
747500 -- (-545.745) [-543.578] (-551.659) (-544.782) * (-548.902) (-549.990) (-546.381) [-533.189] -- 0:00:42
748000 -- (-547.624) [-542.728] (-545.776) (-543.434) * (-551.042) (-539.198) [-547.190] (-550.594) -- 0:00:42
748500 -- (-556.679) (-537.566) (-548.414) [-540.369] * (-546.363) (-555.248) [-544.047] (-541.647) -- 0:00:42
749000 -- (-552.114) (-545.355) (-543.237) [-539.926] * [-548.959] (-552.403) (-547.853) (-541.468) -- 0:00:42
749500 -- (-551.843) [-543.266] (-552.424) (-547.611) * [-548.844] (-547.576) (-550.335) (-536.920) -- 0:00:42
750000 -- (-542.388) (-549.147) (-548.625) [-547.609] * (-556.233) (-552.444) (-556.991) [-535.866] -- 0:00:42
Average standard deviation of split frequencies: 0.007536
750500 -- (-552.303) (-536.064) (-544.459) [-545.817] * (-539.308) (-545.656) [-540.222] (-556.820) -- 0:00:42
751000 -- (-544.786) [-535.970] (-553.954) (-537.593) * [-547.179] (-553.115) (-552.309) (-543.983) -- 0:00:42
751500 -- [-540.516] (-534.660) (-543.156) (-554.862) * (-553.179) (-543.148) (-541.370) [-534.141] -- 0:00:41
752000 -- (-546.284) [-531.071] (-545.150) (-546.935) * (-545.857) (-544.922) [-539.749] (-537.137) -- 0:00:41
752500 -- [-546.906] (-549.365) (-541.960) (-549.926) * (-546.279) (-546.478) (-552.283) [-539.856] -- 0:00:41
753000 -- (-556.056) (-547.824) (-544.054) [-543.137] * (-544.188) (-550.327) (-544.647) [-541.789] -- 0:00:41
753500 -- (-543.790) (-546.324) (-558.481) [-541.903] * [-536.188] (-549.953) (-550.042) (-551.326) -- 0:00:41
754000 -- (-540.179) (-555.100) [-539.371] (-549.731) * (-544.304) (-549.472) (-550.184) [-537.683] -- 0:00:41
754500 -- (-545.566) [-535.917] (-546.845) (-546.656) * [-538.820] (-554.246) (-546.374) (-550.417) -- 0:00:41
755000 -- (-543.156) (-548.536) [-548.776] (-551.988) * [-539.939] (-544.241) (-554.465) (-547.147) -- 0:00:41
Average standard deviation of split frequencies: 0.007531
755500 -- [-543.630] (-540.793) (-538.650) (-555.455) * (-546.334) [-545.365] (-551.126) (-549.739) -- 0:00:41
756000 -- (-557.331) [-533.388] (-553.259) (-547.592) * [-535.759] (-548.118) (-556.872) (-545.501) -- 0:00:41
756500 -- (-551.927) [-539.159] (-543.759) (-548.628) * (-542.514) [-540.538] (-547.957) (-541.271) -- 0:00:41
757000 -- (-544.517) [-531.418] (-550.128) (-543.867) * (-537.218) (-559.001) [-540.893] (-548.336) -- 0:00:41
757500 -- (-545.291) [-530.625] (-549.359) (-552.432) * (-554.588) (-558.638) (-542.242) [-542.560] -- 0:00:40
758000 -- (-538.993) (-564.858) [-547.914] (-541.111) * (-550.509) (-550.419) [-541.922] (-548.957) -- 0:00:40
758500 -- [-547.818] (-548.373) (-548.199) (-546.663) * [-543.130] (-548.330) (-547.451) (-550.753) -- 0:00:40
759000 -- (-550.287) [-540.577] (-544.057) (-551.458) * [-542.941] (-550.747) (-550.503) (-541.674) -- 0:00:40
759500 -- (-548.477) [-538.935] (-555.109) (-544.041) * (-546.670) (-550.501) (-539.785) [-541.109] -- 0:00:40
760000 -- (-568.469) [-535.201] (-558.714) (-553.628) * (-552.158) [-533.544] (-549.158) (-540.778) -- 0:00:40
Average standard deviation of split frequencies: 0.007341
760500 -- (-547.315) [-545.951] (-557.591) (-541.944) * [-544.566] (-549.396) (-546.085) (-536.161) -- 0:00:40
761000 -- (-551.304) [-536.331] (-546.412) (-554.550) * (-561.351) [-546.475] (-545.651) (-541.368) -- 0:00:40
761500 -- (-553.002) [-537.867] (-546.044) (-559.425) * (-547.145) (-550.005) [-537.432] (-535.800) -- 0:00:40
762000 -- [-538.637] (-540.568) (-555.393) (-565.022) * (-547.001) (-553.961) (-548.942) [-538.832] -- 0:00:40
762500 -- (-543.482) [-551.474] (-552.006) (-558.144) * [-540.346] (-548.561) (-542.419) (-537.929) -- 0:00:40
763000 -- [-537.316] (-549.032) (-548.426) (-549.049) * [-541.980] (-546.921) (-555.585) (-542.824) -- 0:00:40
763500 -- [-538.932] (-545.479) (-543.905) (-550.207) * (-546.368) [-535.460] (-542.841) (-544.466) -- 0:00:39
764000 -- [-542.371] (-547.276) (-553.006) (-555.098) * (-559.715) (-536.914) (-544.699) [-540.561] -- 0:00:39
764500 -- [-534.828] (-550.490) (-539.316) (-559.058) * (-557.645) (-546.857) (-548.274) [-552.728] -- 0:00:39
765000 -- [-537.841] (-543.680) (-552.070) (-548.324) * (-543.017) (-562.161) [-539.856] (-540.849) -- 0:00:39
Average standard deviation of split frequencies: 0.007338
765500 -- [-533.085] (-538.339) (-537.858) (-556.753) * (-538.510) (-555.740) (-554.431) [-534.351] -- 0:00:39
766000 -- (-542.690) (-548.248) [-549.211] (-555.857) * (-539.429) (-553.897) (-558.524) [-545.169] -- 0:00:39
766500 -- [-544.958] (-550.655) (-534.954) (-551.189) * [-534.183] (-539.922) (-551.333) (-539.621) -- 0:00:39
767000 -- (-549.037) (-553.850) (-540.363) [-544.128] * (-552.027) (-540.681) (-551.085) [-537.425] -- 0:00:39
767500 -- (-553.896) [-540.738] (-554.373) (-551.805) * [-554.417] (-542.417) (-551.442) (-535.251) -- 0:00:39
768000 -- (-548.361) (-544.870) (-556.628) [-538.121] * (-551.424) (-554.683) (-543.198) [-541.475] -- 0:00:39
768500 -- [-546.316] (-547.906) (-551.358) (-550.142) * (-555.381) (-548.383) (-548.609) [-540.584] -- 0:00:39
769000 -- [-541.567] (-546.372) (-555.474) (-556.237) * (-540.797) [-532.747] (-544.293) (-538.284) -- 0:00:39
769500 -- [-534.723] (-553.064) (-551.709) (-552.443) * (-548.946) (-546.780) [-537.319] (-538.142) -- 0:00:38
770000 -- (-554.225) (-560.274) (-542.249) [-544.644] * (-541.253) (-545.770) (-540.938) [-542.123] -- 0:00:38
Average standard deviation of split frequencies: 0.007952
770500 -- (-561.015) [-539.740] (-544.182) (-543.649) * (-548.452) [-535.910] (-542.938) (-536.633) -- 0:00:38
771000 -- (-556.470) [-543.014] (-544.779) (-544.858) * (-546.160) [-538.754] (-548.983) (-543.001) -- 0:00:38
771500 -- (-557.716) (-536.442) (-552.261) [-551.825] * (-544.538) [-531.234] (-549.529) (-545.741) -- 0:00:38
772000 -- (-541.860) (-563.934) [-542.874] (-545.276) * (-545.162) [-542.794] (-555.383) (-538.654) -- 0:00:38
772500 -- [-547.945] (-553.895) (-542.916) (-553.657) * (-543.212) [-533.738] (-550.576) (-533.593) -- 0:00:38
773000 -- (-559.277) [-537.635] (-542.454) (-560.298) * (-547.979) (-544.731) (-553.159) [-544.195] -- 0:00:38
773500 -- [-555.742] (-546.781) (-547.189) (-555.852) * (-552.021) (-541.636) (-543.232) [-538.254] -- 0:00:38
774000 -- (-548.306) (-548.876) (-551.354) [-543.593] * (-542.906) (-548.132) (-541.832) [-545.535] -- 0:00:38
774500 -- (-549.581) (-545.345) (-541.050) [-541.653] * (-544.924) (-543.814) (-544.382) [-541.923] -- 0:00:38
775000 -- (-546.682) (-544.223) (-550.073) [-538.378] * (-546.946) (-548.086) (-552.757) [-542.035] -- 0:00:38
Average standard deviation of split frequencies: 0.007847
775500 -- (-545.588) (-548.757) (-538.850) [-535.497] * (-540.918) (-552.816) (-550.521) [-540.798] -- 0:00:37
776000 -- (-545.628) (-556.461) (-549.903) [-540.701] * [-533.457] (-547.914) (-555.014) (-534.901) -- 0:00:37
776500 -- (-555.880) (-553.379) (-543.187) [-540.104] * (-542.269) [-538.849] (-562.043) (-537.700) -- 0:00:37
777000 -- [-549.316] (-550.022) (-550.492) (-549.696) * [-538.065] (-548.718) (-552.448) (-541.600) -- 0:00:37
777500 -- (-549.555) (-543.267) [-533.532] (-558.966) * (-556.087) (-545.644) (-544.861) [-535.104] -- 0:00:37
778000 -- (-545.525) [-530.663] (-544.124) (-545.553) * (-550.506) (-546.447) (-549.725) [-541.149] -- 0:00:37
778500 -- (-547.405) [-537.058] (-553.372) (-556.706) * (-541.723) (-534.219) (-560.393) [-541.446] -- 0:00:37
779000 -- (-557.188) [-532.822] (-554.227) (-544.706) * [-543.009] (-538.623) (-538.260) (-539.451) -- 0:00:37
779500 -- (-556.118) [-535.928] (-548.354) (-542.755) * (-547.309) (-552.739) (-543.943) [-537.236] -- 0:00:37
780000 -- (-554.017) [-536.246] (-549.598) (-550.955) * [-536.996] (-550.422) (-545.763) (-546.165) -- 0:00:37
Average standard deviation of split frequencies: 0.007850
780500 -- (-551.306) (-538.621) (-553.344) [-539.912] * [-539.107] (-550.184) (-551.662) (-550.778) -- 0:00:37
781000 -- (-550.733) [-532.773] (-552.165) (-547.415) * (-540.070) (-546.545) (-549.227) [-548.706] -- 0:00:37
781500 -- (-552.289) [-536.391] (-539.834) (-547.401) * (-540.971) (-550.011) [-545.265] (-546.886) -- 0:00:36
782000 -- (-549.255) (-531.233) (-554.446) [-543.153] * (-541.916) (-542.536) (-551.152) [-544.543] -- 0:00:36
782500 -- (-549.700) [-538.289] (-552.845) (-548.787) * (-557.104) (-556.956) (-547.898) [-537.289] -- 0:00:36
783000 -- (-549.422) (-543.237) (-546.693) [-546.402] * (-561.063) (-550.669) (-552.521) [-555.669] -- 0:00:36
783500 -- (-545.561) [-545.335] (-549.460) (-538.037) * (-559.398) (-550.429) [-542.816] (-543.609) -- 0:00:36
784000 -- (-550.616) (-560.055) [-548.202] (-538.604) * (-556.088) [-547.444] (-546.397) (-536.614) -- 0:00:36
784500 -- (-555.130) [-537.216] (-542.123) (-540.706) * (-558.710) (-547.581) (-547.143) [-542.575] -- 0:00:36
785000 -- (-542.090) (-554.422) (-551.136) [-543.168] * (-550.563) (-549.982) (-545.957) [-537.062] -- 0:00:36
Average standard deviation of split frequencies: 0.007747
785500 -- (-548.017) (-553.572) [-539.329] (-545.379) * (-553.674) (-541.810) [-536.424] (-552.990) -- 0:00:36
786000 -- [-541.895] (-554.919) (-542.423) (-540.449) * (-561.217) (-552.322) [-545.943] (-543.264) -- 0:00:36
786500 -- (-547.331) [-542.457] (-548.283) (-541.067) * (-546.621) [-548.149] (-557.455) (-556.241) -- 0:00:36
787000 -- (-548.677) [-543.564] (-542.356) (-548.366) * [-541.802] (-543.398) (-555.373) (-551.559) -- 0:00:35
787500 -- (-555.110) (-546.248) (-544.443) [-544.031] * (-553.040) (-541.827) (-545.947) [-543.343] -- 0:00:35
788000 -- (-553.798) [-532.939] (-549.570) (-540.711) * [-535.068] (-559.123) (-551.101) (-556.591) -- 0:00:35
788500 -- (-554.802) (-549.614) (-540.218) [-545.684] * [-534.338] (-545.037) (-549.945) (-550.614) -- 0:00:35
789000 -- (-554.251) (-548.367) (-549.924) [-544.549] * (-546.826) (-541.535) [-547.261] (-551.771) -- 0:00:35
789500 -- [-541.096] (-549.776) (-552.856) (-543.626) * [-533.264] (-559.436) (-554.106) (-545.590) -- 0:00:35
790000 -- (-549.259) (-548.834) [-539.576] (-548.367) * (-543.480) (-556.437) [-538.090] (-551.402) -- 0:00:35
Average standard deviation of split frequencies: 0.007063
790500 -- (-539.491) (-550.428) (-546.138) [-536.946] * [-533.461] (-543.460) (-537.155) (-557.443) -- 0:00:35
791000 -- (-559.703) [-540.470] (-547.162) (-534.407) * [-544.963] (-555.349) (-539.782) (-545.448) -- 0:00:35
791500 -- (-548.956) [-537.557] (-540.163) (-546.198) * (-553.372) (-546.655) [-541.811] (-545.915) -- 0:00:35
792000 -- (-543.968) [-541.732] (-553.106) (-545.301) * (-536.268) (-541.872) [-534.249] (-549.333) -- 0:00:35
792500 -- [-546.308] (-551.591) (-549.803) (-541.724) * (-544.568) (-549.888) [-535.047] (-558.856) -- 0:00:35
793000 -- (-549.226) (-552.911) (-553.374) [-535.434] * (-554.913) (-552.246) (-536.593) [-533.303] -- 0:00:34
793500 -- (-544.106) (-546.378) (-555.013) [-546.573] * (-542.379) [-541.149] (-546.683) (-550.945) -- 0:00:34
794000 -- (-542.298) [-547.038] (-547.344) (-549.527) * (-557.926) [-548.595] (-535.362) (-543.480) -- 0:00:34
794500 -- (-550.675) (-550.388) (-556.863) [-545.837] * (-550.731) (-549.524) [-539.247] (-551.739) -- 0:00:34
795000 -- (-549.402) (-546.775) [-539.125] (-550.629) * (-546.959) [-535.411] (-536.677) (-546.748) -- 0:00:34
Average standard deviation of split frequencies: 0.007353
795500 -- [-546.031] (-546.271) (-552.022) (-546.233) * [-544.810] (-560.188) (-546.923) (-555.977) -- 0:00:34
796000 -- (-545.233) (-550.276) (-541.352) [-546.558] * (-546.009) (-541.221) (-559.335) [-539.370] -- 0:00:34
796500 -- (-567.614) (-542.961) (-543.709) [-538.115] * (-531.301) [-542.730] (-553.759) (-554.642) -- 0:00:34
797000 -- [-537.500] (-550.770) (-539.439) (-546.936) * (-549.385) (-552.793) [-542.256] (-551.428) -- 0:00:34
797500 -- [-549.897] (-550.929) (-548.836) (-541.445) * (-556.058) (-554.982) (-554.208) [-551.068] -- 0:00:34
798000 -- (-549.250) (-544.838) [-541.829] (-545.538) * (-542.490) [-544.292] (-544.481) (-550.217) -- 0:00:34
798500 -- [-533.062] (-543.595) (-552.813) (-544.595) * (-544.724) (-545.871) [-537.397] (-546.697) -- 0:00:34
799000 -- [-537.863] (-538.229) (-554.917) (-544.127) * (-541.624) (-559.657) (-548.132) [-543.997] -- 0:00:33
799500 -- (-534.985) (-540.244) (-547.443) [-545.390] * (-564.374) (-554.641) (-546.086) [-535.329] -- 0:00:33
800000 -- (-545.817) [-540.362] (-552.881) (-555.951) * (-546.862) (-554.333) [-542.152] (-538.879) -- 0:00:33
Average standard deviation of split frequencies: 0.006975
800500 -- (-547.097) [-541.691] (-550.634) (-548.024) * (-543.776) (-561.394) [-549.081] (-537.323) -- 0:00:33
801000 -- [-536.387] (-541.220) (-545.692) (-550.376) * (-551.694) (-545.757) [-540.466] (-546.134) -- 0:00:33
801500 -- [-536.612] (-547.875) (-544.495) (-553.436) * (-546.429) (-544.514) (-560.213) [-554.984] -- 0:00:33
802000 -- [-547.741] (-542.647) (-548.495) (-543.943) * (-560.141) [-540.766] (-540.915) (-536.713) -- 0:00:33
802500 -- [-538.315] (-551.144) (-551.831) (-541.064) * [-536.304] (-546.721) (-548.865) (-545.203) -- 0:00:33
803000 -- [-538.641] (-548.484) (-548.398) (-546.318) * (-543.358) (-556.240) [-541.653] (-552.523) -- 0:00:33
803500 -- (-544.877) (-539.542) [-542.275] (-551.581) * (-541.455) [-546.944] (-549.207) (-546.856) -- 0:00:33
804000 -- (-545.240) (-544.533) (-534.921) [-542.959] * (-550.119) (-547.382) (-553.815) [-548.768] -- 0:00:33
804500 -- (-545.059) (-544.974) [-534.853] (-556.627) * (-552.182) (-540.290) (-554.868) [-536.113] -- 0:00:33
805000 -- [-550.651] (-554.234) (-546.563) (-546.984) * (-554.723) (-545.480) [-537.668] (-544.257) -- 0:00:32
Average standard deviation of split frequencies: 0.006614
805500 -- (-538.608) (-545.323) [-540.089] (-550.722) * (-541.730) [-538.033] (-549.473) (-542.965) -- 0:00:32
806000 -- [-532.307] (-542.330) (-542.054) (-550.683) * (-556.390) (-546.222) (-542.707) [-541.420] -- 0:00:32
806500 -- (-554.075) [-540.477] (-551.167) (-544.295) * (-552.525) (-554.408) (-553.993) [-533.756] -- 0:00:32
807000 -- (-543.999) (-545.948) [-545.401] (-550.100) * (-546.575) (-549.820) [-543.993] (-546.047) -- 0:00:32
807500 -- (-546.672) (-546.207) [-550.120] (-553.371) * (-539.390) (-557.802) (-551.718) [-532.142] -- 0:00:32
808000 -- (-547.096) [-532.318] (-544.433) (-547.886) * (-543.717) (-550.100) (-555.898) [-536.885] -- 0:00:32
808500 -- (-549.255) (-544.330) [-538.238] (-544.925) * (-547.797) (-557.948) (-546.556) [-546.462] -- 0:00:32
809000 -- (-556.901) (-547.937) [-547.220] (-542.262) * (-550.913) (-555.733) (-553.681) [-535.669] -- 0:00:32
809500 -- (-548.408) (-544.484) [-540.699] (-544.923) * [-545.360] (-557.646) (-554.370) (-546.070) -- 0:00:32
810000 -- (-552.329) (-550.128) (-544.307) [-536.318] * (-559.599) [-551.625] (-553.866) (-547.272) -- 0:00:32
Average standard deviation of split frequencies: 0.006665
810500 -- (-550.661) [-533.196] (-542.066) (-539.024) * (-550.481) (-549.944) (-543.436) [-534.407] -- 0:00:32
811000 -- (-546.791) (-548.723) [-537.394] (-539.767) * (-544.869) (-550.680) (-546.020) [-544.551] -- 0:00:31
811500 -- (-550.831) [-535.328] (-533.937) (-550.841) * [-540.653] (-549.470) (-551.581) (-554.057) -- 0:00:31
812000 -- [-540.456] (-552.488) (-536.248) (-543.713) * (-548.796) [-546.567] (-554.932) (-543.215) -- 0:00:31
812500 -- (-561.833) (-539.761) [-542.773] (-550.919) * (-550.900) (-545.673) (-554.548) [-535.694] -- 0:00:31
813000 -- (-552.193) (-539.924) [-538.042] (-547.840) * [-542.093] (-552.598) (-561.796) (-548.736) -- 0:00:31
813500 -- [-544.233] (-544.697) (-532.858) (-545.106) * (-542.322) (-558.973) [-544.811] (-545.614) -- 0:00:31
814000 -- (-532.709) [-543.160] (-550.914) (-551.295) * (-542.419) (-556.879) (-551.067) [-550.919] -- 0:00:31
814500 -- (-545.451) (-539.700) [-544.612] (-544.582) * [-539.883] (-549.420) (-544.790) (-548.572) -- 0:00:31
815000 -- [-539.103] (-547.420) (-533.145) (-545.280) * (-545.196) [-554.453] (-547.433) (-542.998) -- 0:00:31
Average standard deviation of split frequencies: 0.006844
815500 -- (-561.860) [-533.598] (-548.014) (-546.465) * [-533.914] (-546.350) (-559.379) (-543.799) -- 0:00:31
816000 -- (-549.033) (-550.763) [-537.499] (-550.071) * [-539.164] (-549.023) (-546.550) (-541.759) -- 0:00:31
816500 -- (-559.149) [-541.497] (-535.404) (-546.205) * [-532.512] (-557.995) (-553.064) (-543.983) -- 0:00:31
817000 -- (-539.770) [-549.453] (-554.444) (-544.681) * (-552.710) (-555.419) [-536.556] (-540.413) -- 0:00:30
817500 -- (-546.747) [-535.377] (-553.163) (-540.239) * (-550.320) [-545.052] (-551.244) (-560.297) -- 0:00:30
818000 -- (-543.641) (-546.279) (-550.241) [-528.835] * (-547.777) (-545.925) [-543.966] (-546.567) -- 0:00:30
818500 -- (-553.263) (-553.740) (-550.157) [-535.752] * (-555.820) (-552.540) [-543.036] (-545.739) -- 0:00:30
819000 -- (-561.167) (-553.413) (-537.199) [-532.713] * (-557.721) [-531.780] (-540.363) (-546.115) -- 0:00:30
819500 -- (-559.330) (-542.724) (-533.654) [-539.014] * (-555.577) (-546.885) [-540.724] (-534.161) -- 0:00:30
820000 -- (-558.125) (-546.696) (-536.047) [-541.334] * (-554.338) [-552.639] (-547.925) (-553.792) -- 0:00:30
Average standard deviation of split frequencies: 0.007420
820500 -- (-553.464) (-538.611) [-539.630] (-540.005) * (-553.932) (-542.674) [-544.216] (-547.613) -- 0:00:30
821000 -- (-543.490) (-535.484) (-546.813) [-543.726] * (-543.702) (-547.301) [-545.779] (-536.849) -- 0:00:30
821500 -- (-548.737) (-542.135) (-557.324) [-536.905] * [-535.888] (-548.053) (-544.524) (-549.515) -- 0:00:30
822000 -- (-547.700) (-545.218) (-562.492) [-532.543] * [-545.543] (-548.609) (-544.216) (-552.728) -- 0:00:30
822500 -- (-544.744) (-541.374) (-555.950) [-537.729] * [-538.543] (-551.669) (-544.148) (-564.084) -- 0:00:29
823000 -- (-545.930) [-541.756] (-542.759) (-544.356) * (-537.865) (-544.091) (-543.248) [-546.211] -- 0:00:29
823500 -- (-550.938) [-536.025] (-555.145) (-536.706) * (-546.505) (-539.666) [-536.640] (-555.730) -- 0:00:29
824000 -- (-551.404) (-540.488) [-537.280] (-539.003) * (-541.584) (-557.961) (-553.715) [-549.115] -- 0:00:29
824500 -- [-542.446] (-542.277) (-555.001) (-550.164) * (-546.255) (-549.153) (-549.869) [-529.372] -- 0:00:29
825000 -- (-554.220) (-543.986) [-537.813] (-541.016) * (-550.571) (-548.495) [-541.142] (-539.751) -- 0:00:29
Average standard deviation of split frequencies: 0.006761
825500 -- (-553.767) (-537.974) (-547.443) [-548.402] * [-540.487] (-538.191) (-553.261) (-548.174) -- 0:00:29
826000 -- (-538.817) (-555.284) (-550.614) [-544.171] * (-550.937) (-550.505) (-569.845) [-540.407] -- 0:00:29
826500 -- (-542.982) (-552.080) (-554.413) [-537.732] * (-552.181) [-538.934] (-557.766) (-545.640) -- 0:00:29
827000 -- (-549.790) [-543.789] (-545.501) (-543.441) * (-546.727) [-538.106] (-556.951) (-545.131) -- 0:00:29
827500 -- [-543.264] (-550.419) (-548.066) (-548.573) * (-547.682) (-544.972) (-557.541) [-542.785] -- 0:00:29
828000 -- (-559.766) (-528.643) [-537.870] (-549.675) * (-540.316) [-530.426] (-554.607) (-542.933) -- 0:00:29
828500 -- (-545.151) (-539.534) (-551.298) [-531.629] * (-544.831) (-536.749) [-535.063] (-545.002) -- 0:00:28
829000 -- (-546.237) [-547.362] (-549.216) (-539.733) * (-555.745) [-544.289] (-545.970) (-546.199) -- 0:00:28
829500 -- (-555.026) (-540.081) [-541.869] (-552.499) * (-550.210) (-554.204) [-543.998] (-543.681) -- 0:00:28
830000 -- (-540.919) [-537.433] (-557.360) (-554.328) * (-545.574) (-553.234) [-541.418] (-555.879) -- 0:00:28
Average standard deviation of split frequencies: 0.007072
830500 -- [-539.389] (-546.355) (-553.163) (-547.490) * (-542.133) (-551.904) [-541.408] (-549.866) -- 0:00:28
831000 -- (-549.738) (-542.016) [-538.896] (-554.190) * [-534.972] (-554.026) (-546.633) (-543.431) -- 0:00:28
831500 -- (-549.810) [-534.668] (-541.244) (-560.694) * [-535.372] (-548.708) (-538.600) (-549.606) -- 0:00:28
832000 -- (-549.606) [-531.204] (-542.067) (-550.304) * [-539.199] (-542.451) (-540.264) (-552.315) -- 0:00:28
832500 -- (-551.175) [-540.049] (-547.063) (-547.741) * (-552.448) (-549.056) [-539.393] (-539.223) -- 0:00:28
833000 -- (-549.654) [-533.463] (-550.216) (-547.662) * (-549.104) (-548.165) (-538.474) [-545.166] -- 0:00:28
833500 -- (-550.613) (-541.208) (-548.055) [-539.052] * (-542.190) (-550.192) (-545.542) [-541.188] -- 0:00:28
834000 -- (-542.237) (-543.660) (-542.532) [-532.401] * (-544.774) [-548.560] (-548.233) (-543.143) -- 0:00:28
834500 -- (-545.485) (-550.363) [-550.039] (-536.624) * [-536.155] (-548.504) (-545.442) (-546.285) -- 0:00:27
835000 -- (-541.564) (-543.499) [-536.064] (-555.529) * (-546.657) [-542.351] (-557.652) (-551.117) -- 0:00:27
Average standard deviation of split frequencies: 0.007287
835500 -- (-545.567) [-538.605] (-549.373) (-565.987) * (-542.721) (-539.566) (-539.620) [-540.484] -- 0:00:27
836000 -- [-534.535] (-550.519) (-549.491) (-540.034) * (-536.016) (-556.165) (-561.198) [-533.999] -- 0:00:27
836500 -- (-540.182) (-548.732) (-556.890) [-532.614] * (-545.019) (-551.805) [-534.938] (-538.932) -- 0:00:27
837000 -- (-546.838) [-543.585] (-555.368) (-551.593) * (-536.737) (-542.247) (-554.110) [-539.982] -- 0:00:27
837500 -- (-549.456) (-551.164) (-565.726) [-559.237] * (-549.519) (-543.408) (-555.389) [-530.613] -- 0:00:27
838000 -- [-537.615] (-537.880) (-550.730) (-547.352) * (-540.634) (-541.026) (-542.077) [-534.985] -- 0:00:27
838500 -- (-549.441) [-535.545] (-551.893) (-548.494) * (-560.378) [-540.146] (-545.111) (-547.188) -- 0:00:27
839000 -- (-546.919) (-549.303) (-553.551) [-546.145] * (-551.466) [-544.641] (-548.322) (-547.326) -- 0:00:27
839500 -- [-539.917] (-543.944) (-551.584) (-552.917) * (-555.435) (-540.279) [-541.048] (-544.488) -- 0:00:27
840000 -- (-544.620) [-541.485] (-550.843) (-555.123) * (-552.243) [-539.750] (-541.102) (-548.496) -- 0:00:27
Average standard deviation of split frequencies: 0.006815
840500 -- (-545.932) (-548.132) (-551.644) [-537.158] * (-554.341) [-549.384] (-541.586) (-550.833) -- 0:00:26
841000 -- (-550.306) (-545.015) (-552.329) [-540.810] * [-533.214] (-551.053) (-546.958) (-541.501) -- 0:00:26
841500 -- [-547.004] (-551.856) (-544.637) (-546.910) * (-546.160) (-540.819) [-544.272] (-548.795) -- 0:00:26
842000 -- (-552.932) [-539.740] (-550.349) (-547.229) * (-548.548) [-525.855] (-549.372) (-549.908) -- 0:00:26
842500 -- [-543.687] (-545.336) (-548.967) (-562.435) * (-552.609) [-540.422] (-540.078) (-537.945) -- 0:00:26
843000 -- (-543.813) (-536.078) [-547.408] (-546.456) * (-558.760) (-554.195) [-546.260] (-563.535) -- 0:00:26
843500 -- (-540.044) (-550.202) (-545.501) [-543.870] * (-544.611) (-551.750) [-530.608] (-551.222) -- 0:00:26
844000 -- (-530.048) [-538.079] (-545.354) (-549.997) * (-553.501) (-547.654) (-547.334) [-544.013] -- 0:00:26
844500 -- (-532.728) (-551.177) (-547.735) [-540.685] * (-545.388) [-543.237] (-542.075) (-553.033) -- 0:00:26
845000 -- (-541.917) (-548.005) [-553.159] (-553.585) * (-544.675) [-539.352] (-545.803) (-556.438) -- 0:00:26
Average standard deviation of split frequencies: 0.006729
845500 -- (-553.387) [-542.986] (-557.483) (-548.560) * (-554.605) (-539.994) [-547.907] (-552.777) -- 0:00:26
846000 -- (-550.921) (-555.951) (-542.204) [-553.236] * (-544.913) [-540.301] (-544.629) (-556.625) -- 0:00:26
846500 -- (-546.175) [-533.178] (-538.541) (-559.439) * (-558.834) [-542.130] (-547.913) (-549.130) -- 0:00:25
847000 -- (-544.389) [-531.020] (-549.101) (-542.350) * [-540.142] (-550.917) (-552.333) (-551.905) -- 0:00:25
847500 -- [-539.708] (-538.185) (-544.425) (-557.539) * (-542.890) [-534.711] (-555.645) (-550.197) -- 0:00:25
848000 -- (-547.550) [-534.260] (-559.216) (-543.786) * [-542.636] (-548.910) (-540.398) (-546.118) -- 0:00:25
848500 -- (-546.685) [-530.626] (-551.222) (-545.246) * (-545.222) (-540.832) (-552.012) [-548.120] -- 0:00:25
849000 -- (-550.733) [-547.233] (-542.769) (-552.101) * (-545.539) (-541.927) [-537.966] (-539.860) -- 0:00:25
849500 -- (-546.786) [-535.782] (-542.946) (-557.096) * [-539.428] (-543.498) (-563.976) (-545.840) -- 0:00:25
850000 -- (-547.117) [-530.998] (-551.029) (-542.968) * (-548.245) (-548.483) (-545.302) [-552.211] -- 0:00:25
Average standard deviation of split frequencies: 0.007006
850500 -- (-545.751) [-532.473] (-546.713) (-547.824) * (-552.730) [-549.932] (-557.061) (-542.241) -- 0:00:25
851000 -- [-546.131] (-548.906) (-546.429) (-547.784) * (-540.694) (-537.068) [-541.364] (-549.991) -- 0:00:25
851500 -- (-550.435) [-542.387] (-557.517) (-549.952) * (-548.351) (-544.185) [-553.795] (-544.762) -- 0:00:25
852000 -- [-546.481] (-553.749) (-550.123) (-553.022) * (-550.616) (-545.639) (-550.525) [-547.694] -- 0:00:25
852500 -- (-545.435) (-552.379) [-549.339] (-551.563) * (-544.510) [-545.239] (-555.767) (-549.144) -- 0:00:24
853000 -- (-553.322) (-552.833) [-544.642] (-546.706) * [-541.342] (-534.635) (-539.593) (-544.986) -- 0:00:24
853500 -- (-541.517) (-550.773) [-539.419] (-547.435) * (-546.781) [-536.158] (-549.533) (-546.651) -- 0:00:24
854000 -- (-548.620) [-546.607] (-554.103) (-554.615) * (-553.583) [-542.070] (-552.017) (-549.434) -- 0:00:24
854500 -- [-545.337] (-546.564) (-543.090) (-545.888) * (-551.675) [-540.122] (-547.789) (-544.985) -- 0:00:24
855000 -- [-539.893] (-541.885) (-557.083) (-554.533) * (-546.849) [-530.722] (-555.177) (-544.498) -- 0:00:24
Average standard deviation of split frequencies: 0.007081
855500 -- [-534.589] (-539.046) (-554.034) (-546.999) * [-537.420] (-540.258) (-549.874) (-542.979) -- 0:00:24
856000 -- [-537.560] (-547.281) (-563.082) (-550.653) * (-549.749) [-545.326] (-553.710) (-550.276) -- 0:00:24
856500 -- (-541.338) [-542.166] (-559.883) (-556.621) * (-555.430) (-557.237) (-546.219) [-540.322] -- 0:00:24
857000 -- [-542.258] (-553.796) (-555.020) (-560.803) * (-551.990) [-546.775] (-550.164) (-550.568) -- 0:00:24
857500 -- (-545.639) [-541.872] (-548.944) (-541.918) * (-546.996) (-550.345) (-555.082) [-548.302] -- 0:00:24
858000 -- [-535.110] (-553.812) (-554.815) (-541.307) * (-540.944) (-554.803) (-548.380) [-542.508] -- 0:00:23
858500 -- (-542.392) (-548.675) [-544.077] (-553.137) * (-540.831) (-561.472) [-545.766] (-551.959) -- 0:00:23
859000 -- (-543.804) (-562.319) [-538.359] (-546.069) * [-541.903] (-551.848) (-546.190) (-569.017) -- 0:00:23
859500 -- (-547.248) (-549.609) (-540.722) [-544.808] * [-541.170] (-538.517) (-542.602) (-555.302) -- 0:00:23
860000 -- (-555.038) [-541.860] (-556.516) (-548.061) * [-542.755] (-546.544) (-548.947) (-564.779) -- 0:00:23
Average standard deviation of split frequencies: 0.007199
860500 -- (-538.629) [-538.484] (-554.969) (-546.524) * (-538.679) [-545.833] (-541.851) (-558.588) -- 0:00:23
861000 -- (-539.278) [-539.466] (-548.939) (-554.192) * [-535.421] (-535.679) (-548.314) (-550.858) -- 0:00:23
861500 -- (-548.028) (-545.652) [-547.220] (-542.993) * [-541.391] (-548.858) (-544.687) (-543.076) -- 0:00:23
862000 -- [-550.934] (-552.402) (-543.130) (-541.566) * (-538.330) [-549.681] (-553.603) (-544.688) -- 0:00:23
862500 -- (-545.352) (-550.606) [-547.008] (-554.902) * (-545.336) (-543.349) [-549.936] (-560.122) -- 0:00:23
863000 -- [-541.005] (-553.875) (-549.663) (-538.515) * [-551.034] (-543.471) (-549.897) (-552.541) -- 0:00:23
863500 -- (-545.370) [-532.054] (-544.344) (-545.092) * [-542.636] (-550.256) (-556.470) (-546.204) -- 0:00:23
864000 -- (-545.636) [-544.878] (-548.336) (-552.499) * (-550.112) [-545.340] (-544.266) (-544.835) -- 0:00:22
864500 -- (-558.031) (-541.434) (-546.871) [-553.936] * [-536.050] (-546.898) (-548.919) (-546.913) -- 0:00:22
865000 -- (-555.895) [-539.003] (-548.990) (-557.295) * [-538.845] (-545.632) (-550.859) (-553.403) -- 0:00:22
Average standard deviation of split frequencies: 0.007154
865500 -- (-553.764) [-539.718] (-546.133) (-549.351) * (-544.158) (-546.332) [-556.923] (-545.084) -- 0:00:22
866000 -- (-550.076) (-541.775) [-539.268] (-556.058) * [-536.527] (-545.954) (-547.443) (-548.781) -- 0:00:22
866500 -- (-551.422) [-540.330] (-539.430) (-542.459) * (-540.341) (-555.307) [-529.420] (-552.430) -- 0:00:22
867000 -- (-559.007) (-543.869) (-541.107) [-546.115] * (-549.704) (-546.731) [-542.888] (-558.114) -- 0:00:22
867500 -- (-564.575) [-538.084] (-541.706) (-548.957) * (-544.675) (-549.675) [-544.830] (-549.160) -- 0:00:22
868000 -- (-549.878) [-541.951] (-547.993) (-541.619) * (-563.006) (-554.784) [-540.778] (-551.579) -- 0:00:22
868500 -- (-556.462) [-541.207] (-549.082) (-544.258) * (-552.600) (-545.951) [-544.687] (-551.599) -- 0:00:22
869000 -- (-561.099) (-547.398) (-565.730) [-542.105] * (-548.905) [-555.364] (-542.079) (-553.229) -- 0:00:22
869500 -- (-553.407) [-544.166] (-550.133) (-546.342) * (-547.488) (-558.866) [-530.536] (-551.284) -- 0:00:22
870000 -- [-547.604] (-559.635) (-563.351) (-543.254) * (-540.817) (-554.201) [-536.821] (-554.350) -- 0:00:21
Average standard deviation of split frequencies: 0.006807
870500 -- (-549.198) [-547.077] (-554.578) (-535.827) * (-542.560) [-545.656] (-532.759) (-559.495) -- 0:00:21
871000 -- (-549.098) [-535.481] (-558.966) (-556.034) * [-536.593] (-543.624) (-541.852) (-553.714) -- 0:00:21
871500 -- [-544.414] (-557.619) (-561.102) (-550.203) * [-539.761] (-540.250) (-543.658) (-547.625) -- 0:00:21
872000 -- (-543.876) [-539.311] (-567.968) (-554.919) * [-536.766] (-558.704) (-541.519) (-541.137) -- 0:00:21
872500 -- (-548.989) (-544.662) (-559.796) [-539.179] * [-540.730] (-547.566) (-551.307) (-544.714) -- 0:00:21
873000 -- (-554.448) [-542.569] (-547.140) (-542.577) * (-539.519) [-537.832] (-547.705) (-544.934) -- 0:00:21
873500 -- [-545.731] (-547.258) (-545.447) (-546.648) * (-541.954) (-557.417) (-549.425) [-542.057] -- 0:00:21
874000 -- [-538.195] (-553.236) (-544.768) (-554.594) * (-541.499) [-540.634] (-559.983) (-548.017) -- 0:00:21
874500 -- (-546.961) (-548.334) [-540.555] (-553.530) * (-542.826) (-546.309) [-548.321] (-556.325) -- 0:00:21
875000 -- (-547.200) (-543.021) (-551.831) [-545.717] * [-536.372] (-548.719) (-543.151) (-552.678) -- 0:00:21
Average standard deviation of split frequencies: 0.006458
875500 -- (-545.625) [-536.240] (-556.896) (-540.170) * [-539.546] (-554.878) (-540.074) (-535.157) -- 0:00:21
876000 -- (-560.846) [-542.592] (-555.032) (-546.143) * (-541.592) (-552.080) (-550.931) [-536.610] -- 0:00:20
876500 -- (-549.114) (-562.669) [-541.755] (-549.127) * (-536.317) (-559.022) [-551.055] (-559.415) -- 0:00:20
877000 -- (-553.621) (-544.286) (-549.762) [-540.177] * (-549.410) (-551.038) (-548.988) [-543.289] -- 0:00:20
877500 -- [-538.011] (-543.116) (-545.047) (-546.954) * (-542.107) [-535.147] (-541.459) (-539.772) -- 0:00:20
878000 -- (-562.741) (-552.550) [-543.987] (-548.999) * [-539.187] (-534.082) (-539.901) (-550.624) -- 0:00:20
878500 -- (-551.700) (-545.686) [-547.489] (-546.945) * (-548.471) (-557.713) (-544.913) [-539.057] -- 0:00:20
879000 -- (-549.722) [-543.219] (-554.039) (-538.905) * (-541.575) (-548.626) (-542.470) [-536.770] -- 0:00:20
879500 -- (-545.487) (-542.604) [-542.374] (-542.607) * (-549.504) (-536.881) [-543.112] (-548.430) -- 0:00:20
880000 -- (-541.744) [-542.307] (-561.156) (-543.330) * (-539.780) (-557.314) (-547.781) [-549.646] -- 0:00:20
Average standard deviation of split frequencies: 0.006653
880500 -- (-552.369) [-538.853] (-541.893) (-542.197) * [-540.678] (-542.752) (-542.095) (-547.461) -- 0:00:20
881000 -- (-545.342) [-556.180] (-551.861) (-538.204) * (-540.818) (-553.849) (-562.438) [-543.907] -- 0:00:20
881500 -- (-544.124) (-545.860) (-551.749) [-544.313] * (-545.364) (-546.309) (-543.155) [-540.321] -- 0:00:20
882000 -- (-545.021) (-547.435) (-550.142) [-548.163] * [-541.880] (-545.239) (-551.558) (-546.300) -- 0:00:19
882500 -- (-557.501) (-551.030) [-539.999] (-546.145) * [-548.215] (-540.743) (-555.647) (-548.484) -- 0:00:19
883000 -- (-547.977) [-535.499] (-547.332) (-551.536) * (-544.986) [-550.149] (-549.097) (-551.244) -- 0:00:19
883500 -- (-550.254) (-538.758) [-544.070] (-548.777) * (-546.707) (-549.701) (-544.082) [-545.317] -- 0:00:19
884000 -- (-547.029) (-547.532) (-549.792) [-535.386] * (-536.837) [-538.203] (-546.644) (-555.209) -- 0:00:19
884500 -- [-538.831] (-551.651) (-555.567) (-538.310) * [-538.792] (-547.556) (-549.925) (-547.936) -- 0:00:19
885000 -- (-544.909) (-551.705) (-565.419) [-555.016] * [-532.108] (-557.498) (-537.348) (-546.607) -- 0:00:19
Average standard deviation of split frequencies: 0.006613
885500 -- [-545.678] (-555.355) (-565.488) (-544.774) * (-549.569) [-532.480] (-550.867) (-551.766) -- 0:00:19
886000 -- [-542.661] (-546.889) (-564.835) (-536.248) * (-559.278) (-541.878) (-541.900) [-543.662] -- 0:00:19
886500 -- [-533.536] (-546.961) (-556.386) (-557.366) * (-541.291) [-532.285] (-558.009) (-544.119) -- 0:00:19
887000 -- (-543.453) (-548.860) (-550.175) [-543.149] * (-537.334) (-548.624) [-545.999] (-545.018) -- 0:00:19
887500 -- [-536.821] (-560.170) (-552.364) (-536.057) * [-535.647] (-556.999) (-549.657) (-546.269) -- 0:00:19
888000 -- (-565.688) (-556.286) (-543.467) [-544.555] * (-552.916) [-551.442] (-540.812) (-542.550) -- 0:00:18
888500 -- (-539.450) (-554.810) (-562.654) [-530.728] * (-548.495) (-555.816) (-544.515) [-539.307] -- 0:00:18
889000 -- (-557.434) (-550.695) (-548.214) [-534.797] * [-542.118] (-549.315) (-549.714) (-541.986) -- 0:00:18
889500 -- (-560.924) (-541.195) (-553.393) [-535.978] * (-550.777) (-546.961) [-548.631] (-546.863) -- 0:00:18
890000 -- (-550.395) (-549.103) (-543.903) [-532.590] * (-542.204) (-555.769) [-535.272] (-549.790) -- 0:00:18
Average standard deviation of split frequencies: 0.006427
890500 -- [-530.994] (-556.274) (-549.918) (-539.544) * (-540.712) (-545.850) [-544.188] (-546.505) -- 0:00:18
891000 -- [-530.818] (-546.831) (-550.675) (-547.255) * [-533.941] (-553.568) (-542.167) (-542.845) -- 0:00:18
891500 -- (-538.837) (-549.278) (-548.893) [-552.604] * (-553.993) (-547.861) (-534.978) [-535.479] -- 0:00:18
892000 -- (-551.141) (-546.434) (-551.742) [-540.235] * [-540.971] (-551.264) (-539.098) (-543.046) -- 0:00:18
892500 -- (-545.429) (-558.555) (-547.831) [-547.083] * (-552.020) (-547.950) (-546.024) [-533.063] -- 0:00:18
893000 -- (-544.708) [-533.292] (-543.094) (-557.358) * (-549.096) (-547.278) (-555.284) [-541.176] -- 0:00:18
893500 -- [-547.201] (-549.836) (-544.025) (-564.093) * (-544.333) (-553.810) (-559.576) [-546.692] -- 0:00:17
894000 -- (-536.364) [-541.439] (-547.694) (-546.949) * (-540.653) (-543.962) [-542.104] (-551.697) -- 0:00:17
894500 -- (-551.133) (-543.548) (-542.463) [-533.629] * (-541.895) (-551.575) [-542.619] (-551.244) -- 0:00:17
895000 -- (-552.729) (-549.234) (-557.817) [-529.830] * (-547.106) (-545.929) [-541.618] (-556.424) -- 0:00:17
Average standard deviation of split frequencies: 0.006539
895500 -- (-549.992) (-538.823) (-541.987) [-529.249] * [-545.266] (-546.457) (-546.545) (-538.780) -- 0:00:17
896000 -- (-560.163) (-547.129) (-549.567) [-530.444] * [-551.858] (-544.609) (-539.434) (-548.817) -- 0:00:17
896500 -- (-547.180) [-548.136] (-536.708) (-536.679) * (-547.408) (-552.390) [-540.849] (-546.299) -- 0:00:17
897000 -- (-552.582) (-543.613) [-541.976] (-547.541) * [-539.649] (-548.414) (-548.707) (-550.441) -- 0:00:17
897500 -- (-551.211) (-538.923) (-541.242) [-537.832] * (-557.834) (-545.854) (-562.036) [-544.328] -- 0:00:17
898000 -- (-549.398) (-540.817) [-545.692] (-550.691) * (-555.255) (-557.489) (-553.042) [-546.227] -- 0:00:17
898500 -- [-542.225] (-540.404) (-548.139) (-543.498) * (-556.416) [-536.667] (-554.023) (-548.195) -- 0:00:17
899000 -- (-544.056) [-550.057] (-546.704) (-546.250) * (-550.910) (-548.862) (-545.808) [-548.458] -- 0:00:17
899500 -- (-551.105) (-536.476) (-549.992) [-541.380] * (-546.450) (-552.663) [-542.864] (-545.071) -- 0:00:16
900000 -- (-547.743) (-557.189) (-542.017) [-539.158] * (-545.256) (-552.385) [-544.936] (-552.227) -- 0:00:16
Average standard deviation of split frequencies: 0.006767
900500 -- (-551.061) [-537.381] (-542.237) (-549.706) * (-547.999) (-547.836) [-542.515] (-532.098) -- 0:00:16
901000 -- (-542.195) (-541.060) (-544.817) [-543.235] * [-553.628] (-540.339) (-552.017) (-549.147) -- 0:00:16
901500 -- [-543.256] (-541.322) (-551.407) (-552.640) * (-547.381) (-549.604) (-546.198) [-531.026] -- 0:00:16
902000 -- (-543.877) (-552.286) (-534.743) [-531.195] * (-546.579) (-551.293) (-559.713) [-540.373] -- 0:00:16
902500 -- (-547.701) [-545.913] (-541.299) (-535.400) * [-538.091] (-545.706) (-563.592) (-546.427) -- 0:00:16
903000 -- [-537.451] (-552.740) (-541.266) (-554.186) * (-547.015) (-559.869) (-558.376) [-535.121] -- 0:00:16
903500 -- [-549.025] (-553.899) (-535.085) (-542.028) * [-542.725] (-555.753) (-548.014) (-540.646) -- 0:00:16
904000 -- (-546.227) (-540.555) (-541.499) [-540.243] * (-552.002) (-554.010) (-547.827) [-540.876] -- 0:00:16
904500 -- (-534.788) (-541.651) (-554.503) [-548.566] * (-544.467) (-555.253) (-544.862) [-543.226] -- 0:00:16
905000 -- [-542.379] (-539.812) (-547.093) (-547.132) * (-548.090) (-553.785) [-541.586] (-550.300) -- 0:00:16
Average standard deviation of split frequencies: 0.006318
905500 -- (-545.375) [-541.153] (-547.610) (-550.343) * (-548.058) (-552.116) (-534.915) [-543.069] -- 0:00:15
906000 -- (-544.572) (-544.685) [-545.157] (-555.149) * (-537.924) (-545.091) (-554.188) [-543.129] -- 0:00:15
906500 -- (-541.510) (-549.701) (-545.439) [-545.963] * (-538.108) (-547.389) (-551.796) [-533.706] -- 0:00:15
907000 -- (-553.335) (-539.665) [-541.308] (-549.178) * [-548.408] (-554.024) (-561.662) (-539.629) -- 0:00:15
907500 -- (-550.544) [-535.217] (-551.433) (-539.671) * (-538.196) [-536.284] (-556.440) (-543.453) -- 0:00:15
908000 -- (-556.497) (-539.941) (-556.290) [-546.721] * (-550.761) (-543.970) [-540.846] (-544.102) -- 0:00:15
908500 -- (-543.456) [-538.464] (-558.718) (-547.842) * (-548.668) (-541.075) (-545.774) [-533.204] -- 0:00:15
909000 -- (-544.801) (-538.512) (-549.270) [-542.849] * [-532.705] (-551.483) (-534.730) (-541.289) -- 0:00:15
909500 -- (-552.198) (-537.782) [-535.720] (-544.385) * [-530.423] (-552.585) (-539.512) (-539.631) -- 0:00:15
910000 -- (-548.272) [-534.442] (-546.589) (-549.813) * (-531.381) (-551.126) (-537.504) [-547.354] -- 0:00:15
Average standard deviation of split frequencies: 0.005990
910500 -- [-542.836] (-537.144) (-551.185) (-570.927) * (-548.926) (-555.577) (-548.153) [-533.932] -- 0:00:15
911000 -- (-546.216) [-543.040] (-539.289) (-541.759) * (-546.428) [-540.626] (-546.235) (-547.333) -- 0:00:15
911500 -- (-553.859) [-540.711] (-538.997) (-543.687) * (-555.188) (-541.449) [-534.420] (-545.930) -- 0:00:14
912000 -- (-553.014) (-542.078) [-535.551] (-541.183) * (-541.390) (-554.237) (-548.425) [-536.923] -- 0:00:14
912500 -- (-534.539) (-550.319) [-532.776] (-552.215) * [-536.363] (-546.638) (-534.553) (-546.531) -- 0:00:14
913000 -- (-544.976) (-541.244) [-534.406] (-548.165) * (-549.304) (-545.513) (-547.429) [-536.199] -- 0:00:14
913500 -- (-567.915) (-541.109) [-541.264] (-549.416) * (-545.786) [-547.683] (-546.671) (-546.791) -- 0:00:14
914000 -- (-554.717) (-538.750) [-541.535] (-548.275) * (-553.138) [-531.791] (-544.035) (-547.235) -- 0:00:14
914500 -- (-560.594) (-543.974) [-535.878] (-542.503) * (-542.091) [-549.743] (-549.197) (-542.469) -- 0:00:14
915000 -- (-559.275) (-553.232) [-534.992] (-545.417) * [-541.351] (-546.674) (-541.996) (-541.647) -- 0:00:14
Average standard deviation of split frequencies: 0.005771
915500 -- (-557.491) [-546.485] (-543.872) (-544.204) * (-545.703) (-541.697) (-549.133) [-541.458] -- 0:00:14
916000 -- [-557.522] (-553.467) (-545.806) (-556.371) * (-542.698) (-540.868) (-549.098) [-541.780] -- 0:00:14
916500 -- (-547.024) (-542.696) (-547.179) [-544.787] * (-548.287) (-550.053) (-556.795) [-536.469] -- 0:00:14
917000 -- (-553.881) (-537.551) (-544.385) [-543.985] * [-539.778] (-542.321) (-551.535) (-550.454) -- 0:00:14
917500 -- (-546.493) [-537.823] (-551.537) (-545.838) * [-543.888] (-551.628) (-547.040) (-548.007) -- 0:00:13
918000 -- (-547.773) (-547.210) [-537.233] (-549.825) * (-552.168) (-556.531) (-554.148) [-546.387] -- 0:00:13
918500 -- (-545.036) (-552.872) [-546.388] (-538.172) * (-552.895) [-543.424] (-548.824) (-550.221) -- 0:00:13
919000 -- (-555.905) (-553.260) [-542.726] (-548.437) * (-541.468) (-551.833) (-542.476) [-535.630] -- 0:00:13
919500 -- [-542.364] (-541.901) (-553.712) (-542.890) * (-545.765) (-547.195) [-536.797] (-556.396) -- 0:00:13
920000 -- (-552.197) [-534.809] (-556.744) (-561.689) * (-557.328) (-542.774) (-544.108) [-533.180] -- 0:00:13
Average standard deviation of split frequencies: 0.005815
920500 -- (-548.630) [-541.130] (-540.222) (-543.382) * (-560.833) (-545.668) (-543.706) [-536.658] -- 0:00:13
921000 -- (-557.293) (-545.958) (-557.466) [-540.601] * [-540.832] (-547.401) (-542.616) (-534.304) -- 0:00:13
921500 -- (-557.607) (-542.061) (-535.297) [-536.728] * (-549.616) (-560.916) [-539.752] (-545.750) -- 0:00:13
922000 -- (-546.373) (-542.171) (-549.836) [-548.212] * (-541.033) [-541.983] (-538.751) (-554.217) -- 0:00:13
922500 -- (-557.334) (-547.686) [-539.460] (-548.145) * (-547.788) (-534.206) (-543.344) [-534.786] -- 0:00:13
923000 -- (-548.744) (-547.771) [-551.472] (-541.998) * (-547.391) [-541.847] (-556.418) (-545.372) -- 0:00:13
923500 -- (-544.608) [-541.375] (-545.552) (-547.416) * (-551.397) (-548.277) (-547.095) [-552.761] -- 0:00:12
924000 -- (-555.763) [-542.080] (-542.045) (-546.304) * (-543.964) (-546.964) (-551.103) [-537.534] -- 0:00:12
924500 -- (-548.680) (-542.359) (-538.064) [-545.068] * (-552.189) [-549.131] (-537.950) (-552.542) -- 0:00:12
925000 -- (-547.137) (-549.309) [-541.932] (-552.968) * (-544.749) (-544.494) [-535.810] (-554.499) -- 0:00:12
Average standard deviation of split frequencies: 0.006000
925500 -- [-545.151] (-544.559) (-537.964) (-561.091) * [-538.401] (-542.598) (-549.131) (-549.897) -- 0:00:12
926000 -- (-557.378) (-548.044) [-536.347] (-549.462) * [-535.772] (-544.677) (-544.143) (-550.738) -- 0:00:12
926500 -- [-547.874] (-542.764) (-538.706) (-544.508) * (-548.029) (-548.460) [-536.341] (-567.713) -- 0:00:12
927000 -- (-543.855) (-555.355) [-551.470] (-557.791) * (-539.573) [-550.746] (-547.927) (-553.760) -- 0:00:12
927500 -- (-547.119) (-554.493) [-542.274] (-552.656) * (-542.994) (-552.691) [-550.693] (-547.958) -- 0:00:12
928000 -- [-548.531] (-545.564) (-535.718) (-537.915) * (-550.528) [-541.891] (-541.078) (-548.216) -- 0:00:12
928500 -- (-551.038) (-545.022) (-543.178) [-541.713] * (-549.035) [-543.083] (-542.442) (-557.608) -- 0:00:12
929000 -- (-547.654) [-534.371] (-551.874) (-549.012) * (-549.170) [-540.389] (-548.860) (-538.537) -- 0:00:11
929500 -- (-547.786) (-536.898) (-549.303) [-550.877] * [-540.688] (-546.502) (-543.647) (-550.735) -- 0:00:11
930000 -- (-550.474) (-543.798) [-534.712] (-550.206) * [-543.798] (-549.574) (-545.231) (-549.903) -- 0:00:11
Average standard deviation of split frequencies: 0.005806
930500 -- (-544.921) (-542.732) [-534.476] (-544.890) * (-542.396) (-545.924) (-552.559) [-536.755] -- 0:00:11
931000 -- (-543.806) (-543.547) (-550.851) [-547.174] * (-544.686) (-541.257) [-535.614] (-553.018) -- 0:00:11
931500 -- (-546.561) (-542.604) [-539.986] (-553.707) * [-545.870] (-548.113) (-541.630) (-539.054) -- 0:00:11
932000 -- (-557.696) [-536.675] (-540.921) (-555.659) * (-544.631) [-544.672] (-540.761) (-547.549) -- 0:00:11
932500 -- (-547.462) (-537.283) [-543.694] (-550.976) * (-533.885) (-547.123) (-539.363) [-538.850] -- 0:00:11
933000 -- (-552.846) [-533.261] (-547.548) (-548.389) * [-548.631] (-554.636) (-547.379) (-545.574) -- 0:00:11
933500 -- [-537.640] (-540.256) (-542.883) (-542.551) * (-546.312) (-533.290) (-543.555) [-535.384] -- 0:00:11
934000 -- (-544.220) (-560.443) (-544.489) [-532.328] * [-543.311] (-555.300) (-550.092) (-556.021) -- 0:00:11
934500 -- [-531.567] (-557.078) (-552.014) (-536.387) * (-551.454) (-542.476) (-544.083) [-537.985] -- 0:00:11
935000 -- (-548.148) (-549.115) [-545.876] (-540.634) * (-549.422) (-541.511) (-543.893) [-534.237] -- 0:00:10
Average standard deviation of split frequencies: 0.005463
935500 -- (-537.945) (-557.576) [-531.991] (-544.949) * [-545.258] (-542.502) (-553.336) (-551.757) -- 0:00:10
936000 -- (-546.265) (-546.620) (-550.718) [-534.872] * (-547.117) (-537.779) [-537.727] (-552.766) -- 0:00:10
936500 -- (-544.915) [-542.361] (-557.201) (-540.607) * [-541.612] (-543.615) (-532.837) (-553.327) -- 0:00:10
937000 -- [-539.703] (-549.846) (-551.250) (-542.305) * [-536.059] (-547.344) (-539.593) (-550.608) -- 0:00:10
937500 -- (-547.622) (-546.057) (-561.502) [-536.128] * [-537.228] (-549.824) (-540.429) (-553.343) -- 0:00:10
938000 -- (-541.341) (-551.127) (-551.486) [-533.570] * (-554.327) [-536.112] (-555.758) (-537.707) -- 0:00:10
938500 -- (-534.698) (-562.943) (-555.437) [-535.092] * (-543.018) (-538.029) [-535.110] (-533.617) -- 0:00:10
939000 -- [-541.294] (-537.579) (-554.461) (-544.995) * (-539.285) (-544.487) [-532.368] (-543.495) -- 0:00:10
939500 -- (-551.830) (-552.680) (-547.027) [-543.483] * [-543.672] (-542.490) (-548.575) (-548.995) -- 0:00:10
940000 -- [-532.735] (-547.657) (-541.489) (-551.914) * [-549.942] (-532.567) (-546.609) (-540.959) -- 0:00:10
Average standard deviation of split frequencies: 0.005744
940500 -- (-542.352) (-546.320) (-538.702) [-539.092] * (-549.852) [-538.748] (-555.331) (-551.306) -- 0:00:10
941000 -- (-551.939) (-557.328) [-536.666] (-539.338) * [-544.389] (-550.188) (-546.621) (-554.283) -- 0:00:09
941500 -- [-550.749] (-542.304) (-545.672) (-557.213) * (-543.091) (-544.135) (-547.005) [-547.590] -- 0:00:09
942000 -- (-544.773) (-551.630) [-539.457] (-540.573) * (-546.265) (-546.878) [-534.984] (-540.612) -- 0:00:09
942500 -- (-547.593) (-539.095) [-537.075] (-547.280) * (-539.368) (-555.855) [-531.367] (-550.209) -- 0:00:09
943000 -- (-545.478) (-554.957) (-548.051) [-549.081] * [-538.621] (-559.283) (-542.845) (-538.976) -- 0:00:09
943500 -- (-542.107) (-535.056) [-545.487] (-541.193) * (-550.601) (-552.642) [-533.746] (-542.548) -- 0:00:09
944000 -- [-535.171] (-547.320) (-544.601) (-557.364) * (-543.454) (-559.639) [-540.608] (-546.244) -- 0:00:09
944500 -- (-544.182) (-543.646) [-538.898] (-551.615) * [-538.047] (-553.768) (-532.955) (-540.100) -- 0:00:09
945000 -- (-542.355) (-543.045) [-543.136] (-540.705) * (-541.981) (-553.538) (-544.304) [-530.588] -- 0:00:09
Average standard deviation of split frequencies: 0.005405
945500 -- [-542.174] (-542.984) (-552.432) (-544.695) * (-541.243) (-565.533) [-539.347] (-559.390) -- 0:00:09
946000 -- [-534.892] (-550.042) (-546.529) (-544.923) * (-542.976) [-545.031] (-541.944) (-539.033) -- 0:00:09
946500 -- (-539.981) (-553.763) [-536.847] (-556.285) * (-558.958) (-551.170) [-551.050] (-550.278) -- 0:00:09
947000 -- (-552.884) (-536.799) [-539.745] (-550.236) * (-552.005) (-544.280) [-541.742] (-548.025) -- 0:00:08
947500 -- (-534.934) [-537.108] (-543.330) (-550.411) * (-543.004) (-548.194) (-548.264) [-536.989] -- 0:00:08
948000 -- (-548.376) (-550.533) [-535.689] (-548.457) * (-541.187) (-548.984) [-542.442] (-548.913) -- 0:00:08
948500 -- (-557.097) [-538.984] (-543.305) (-537.508) * (-541.464) (-553.732) [-552.018] (-549.811) -- 0:00:08
949000 -- (-540.792) [-533.521] (-537.216) (-545.833) * (-546.203) (-549.606) (-539.013) [-540.532] -- 0:00:08
949500 -- (-547.202) [-530.445] (-547.555) (-554.184) * [-541.365] (-553.716) (-554.951) (-549.928) -- 0:00:08
950000 -- (-557.159) (-549.705) (-548.811) [-542.385] * (-543.720) (-542.452) [-549.607] (-546.075) -- 0:00:08
Average standard deviation of split frequencies: 0.005264
950500 -- (-543.658) [-542.976] (-548.461) (-559.940) * [-540.572] (-553.282) (-559.143) (-536.499) -- 0:00:08
951000 -- (-541.644) [-540.830] (-543.890) (-553.757) * (-542.811) (-552.884) [-531.671] (-537.511) -- 0:00:08
951500 -- (-567.917) [-537.931] (-541.747) (-559.730) * [-544.389] (-555.007) (-547.599) (-538.722) -- 0:00:08
952000 -- (-559.240) [-538.530] (-540.085) (-550.556) * [-536.648] (-552.699) (-559.984) (-547.678) -- 0:00:08
952500 -- (-552.775) (-543.301) [-543.034] (-541.705) * (-535.924) (-549.072) (-551.041) [-536.243] -- 0:00:08
953000 -- (-566.272) (-551.491) (-557.165) [-535.300] * (-555.522) (-549.425) (-542.041) [-550.597] -- 0:00:07
953500 -- (-553.277) [-545.632] (-545.898) (-560.024) * (-549.400) (-543.784) (-544.875) [-542.964] -- 0:00:07
954000 -- (-552.958) (-548.471) [-536.773] (-559.662) * [-541.477] (-546.579) (-544.103) (-548.646) -- 0:00:07
954500 -- (-564.618) (-546.411) [-537.864] (-553.096) * (-543.677) (-549.161) [-546.403] (-547.552) -- 0:00:07
955000 -- (-544.166) (-548.818) [-543.274] (-555.096) * (-540.949) [-548.695] (-547.937) (-549.301) -- 0:00:07
Average standard deviation of split frequencies: 0.005386
955500 -- (-543.374) (-541.754) [-544.306] (-565.090) * (-549.257) [-537.371] (-531.870) (-552.377) -- 0:00:07
956000 -- (-545.036) (-535.924) [-542.583] (-553.138) * [-537.280] (-553.386) (-546.345) (-553.823) -- 0:00:07
956500 -- (-551.122) [-533.707] (-546.633) (-546.495) * (-549.719) (-545.917) (-533.228) [-545.308] -- 0:00:07
957000 -- (-544.668) (-552.559) [-535.631] (-538.910) * (-547.376) (-548.110) [-531.132] (-555.721) -- 0:00:07
957500 -- (-546.274) (-547.050) [-530.592] (-561.060) * (-544.765) (-540.346) [-533.247] (-557.442) -- 0:00:07
958000 -- (-554.661) (-553.041) [-537.979] (-541.014) * (-553.706) (-546.669) [-532.171] (-552.777) -- 0:00:07
958500 -- (-548.241) [-545.434] (-562.497) (-538.235) * [-538.952] (-548.419) (-556.663) (-565.280) -- 0:00:07
959000 -- (-554.574) [-547.600] (-555.889) (-543.983) * (-551.992) [-539.734] (-540.326) (-554.528) -- 0:00:06
959500 -- (-549.816) [-533.379] (-544.541) (-554.253) * (-548.366) [-539.695] (-543.013) (-544.994) -- 0:00:06
960000 -- (-555.739) [-537.893] (-535.979) (-555.561) * (-555.607) [-537.739] (-556.211) (-553.121) -- 0:00:06
Average standard deviation of split frequencies: 0.005058
960500 -- (-549.419) (-534.886) (-546.333) [-549.171] * (-556.147) (-551.153) (-541.578) [-552.482] -- 0:00:06
961000 -- (-546.721) (-549.593) (-554.006) [-537.589] * (-559.176) [-536.315] (-544.772) (-547.713) -- 0:00:06
961500 -- (-550.040) (-540.558) (-554.462) [-540.703] * [-547.900] (-560.070) (-545.011) (-544.650) -- 0:00:06
962000 -- (-548.047) (-541.597) [-542.030] (-554.672) * (-549.795) (-537.394) (-547.155) [-546.417] -- 0:00:06
962500 -- [-545.187] (-549.832) (-540.318) (-550.526) * (-538.534) [-543.129] (-552.949) (-548.508) -- 0:00:06
963000 -- (-541.246) [-533.561] (-540.604) (-557.610) * (-540.476) (-553.165) [-535.494] (-542.015) -- 0:00:06
963500 -- [-541.746] (-543.582) (-560.502) (-554.559) * [-540.851] (-543.871) (-544.578) (-553.445) -- 0:00:06
964000 -- (-541.694) [-537.177] (-549.357) (-557.626) * (-542.710) (-560.277) (-553.215) [-539.898] -- 0:00:06
964500 -- (-546.627) [-539.866] (-542.527) (-553.465) * (-550.829) (-543.581) (-553.986) [-549.664] -- 0:00:05
965000 -- (-545.435) [-537.491] (-543.569) (-546.279) * (-540.990) (-550.533) [-540.471] (-534.566) -- 0:00:05
Average standard deviation of split frequencies: 0.004993
965500 -- (-544.436) (-551.906) (-548.876) [-554.318] * (-551.091) (-555.874) (-546.980) [-542.013] -- 0:00:05
966000 -- [-540.954] (-546.821) (-550.980) (-551.112) * (-538.258) (-550.074) [-536.948] (-543.007) -- 0:00:05
966500 -- (-555.448) (-541.921) (-547.559) [-547.802] * (-562.223) (-555.246) (-540.644) [-536.419] -- 0:00:05
967000 -- (-542.176) [-547.253] (-539.757) (-558.453) * (-543.626) (-561.615) (-547.698) [-536.752] -- 0:00:05
967500 -- [-544.493] (-548.500) (-558.679) (-543.770) * (-542.026) (-541.824) (-544.800) [-537.425] -- 0:00:05
968000 -- (-545.214) (-544.871) [-544.076] (-550.654) * (-548.912) (-545.112) (-542.729) [-536.222] -- 0:00:05
968500 -- [-542.291] (-537.965) (-557.264) (-543.899) * (-558.140) [-535.800] (-560.627) (-529.292) -- 0:00:05
969000 -- [-535.539] (-562.307) (-546.318) (-540.073) * [-544.203] (-540.925) (-551.740) (-542.345) -- 0:00:05
969500 -- (-550.587) (-539.371) [-539.067] (-543.924) * (-543.635) (-547.997) [-530.242] (-540.864) -- 0:00:05
970000 -- (-539.563) (-537.149) (-555.458) [-534.057] * (-551.847) (-547.575) [-536.825] (-535.197) -- 0:00:05
Average standard deviation of split frequencies: 0.005155
970500 -- [-530.767] (-536.466) (-549.512) (-553.258) * (-548.328) (-548.401) (-552.629) [-534.721] -- 0:00:04
971000 -- (-541.250) [-537.566] (-558.251) (-544.006) * (-550.684) (-547.185) (-541.387) [-534.617] -- 0:00:04
971500 -- (-554.843) [-536.005] (-551.941) (-541.806) * (-548.252) (-548.416) [-542.398] (-552.927) -- 0:00:04
972000 -- (-549.170) [-544.679] (-547.177) (-548.621) * (-554.215) (-548.099) [-543.781] (-544.893) -- 0:00:04
972500 -- (-555.040) [-538.102] (-543.643) (-555.349) * (-539.159) [-536.822] (-548.570) (-540.516) -- 0:00:04
973000 -- (-556.007) (-552.514) (-544.266) [-547.299] * [-542.400] (-543.828) (-548.127) (-554.192) -- 0:00:04
973500 -- (-555.640) (-549.035) [-541.844] (-550.290) * [-533.948] (-555.088) (-540.665) (-536.794) -- 0:00:04
974000 -- [-543.483] (-537.883) (-558.503) (-547.607) * (-542.194) (-556.015) (-544.527) [-533.642] -- 0:00:04
974500 -- (-546.494) [-539.618] (-534.554) (-554.659) * (-551.071) (-548.584) (-544.371) [-534.794] -- 0:00:04
975000 -- (-558.737) (-551.788) [-527.223] (-550.625) * [-541.498] (-554.178) (-545.400) (-538.875) -- 0:00:04
Average standard deviation of split frequencies: 0.005313
975500 -- (-546.749) (-546.948) [-533.779] (-551.420) * (-557.137) (-548.829) (-540.749) [-538.124] -- 0:00:04
976000 -- (-549.576) (-546.249) [-540.797] (-539.114) * (-544.730) (-552.133) (-536.231) [-545.983] -- 0:00:04
976500 -- (-569.937) (-546.272) [-540.457] (-553.030) * (-545.809) (-547.926) (-553.433) [-534.653] -- 0:00:03
977000 -- [-543.579] (-542.192) (-541.710) (-557.608) * (-542.355) [-528.169] (-533.703) (-556.458) -- 0:00:03
977500 -- (-560.688) [-544.899] (-537.476) (-546.762) * [-536.645] (-550.080) (-548.881) (-552.524) -- 0:00:03
978000 -- (-541.970) (-550.652) [-544.714] (-552.343) * (-547.868) [-527.490] (-543.588) (-545.996) -- 0:00:03
978500 -- (-549.066) (-556.477) [-535.737] (-539.513) * (-553.405) [-536.311] (-547.091) (-553.847) -- 0:00:03
979000 -- (-539.316) [-549.952] (-535.062) (-547.415) * (-556.354) (-539.709) (-553.911) [-543.913] -- 0:00:03
979500 -- (-543.430) (-554.219) [-542.921] (-554.319) * (-554.553) [-544.555] (-555.553) (-544.909) -- 0:00:03
980000 -- (-546.511) (-556.635) [-541.227] (-542.575) * (-555.370) [-544.203] (-560.783) (-542.649) -- 0:00:03
Average standard deviation of split frequencies: 0.005177
980500 -- (-543.531) (-546.649) [-536.051] (-548.136) * [-537.417] (-551.297) (-544.432) (-561.424) -- 0:00:03
981000 -- (-540.000) (-536.629) [-537.834] (-550.855) * (-553.515) (-548.859) [-547.877] (-557.669) -- 0:00:03
981500 -- (-539.123) (-551.446) [-540.999] (-543.115) * (-540.444) [-541.443] (-546.040) (-558.801) -- 0:00:03
982000 -- (-535.274) [-542.129] (-546.271) (-543.869) * (-549.716) [-547.238] (-546.237) (-539.319) -- 0:00:03
982500 -- (-546.381) (-543.479) [-541.362] (-556.296) * (-552.464) (-541.250) [-536.765] (-549.172) -- 0:00:02
983000 -- (-543.512) (-549.106) [-542.299] (-553.334) * (-546.894) [-536.056] (-548.623) (-553.645) -- 0:00:02
983500 -- (-532.909) (-539.221) [-542.437] (-564.692) * (-539.856) [-528.558] (-556.679) (-566.705) -- 0:00:02
984000 -- (-543.445) [-532.989] (-552.816) (-552.684) * [-546.008] (-552.162) (-551.448) (-552.969) -- 0:00:02
984500 -- (-547.801) (-539.961) [-535.348] (-554.206) * (-556.295) (-540.770) [-537.095] (-550.409) -- 0:00:02
985000 -- (-541.746) (-550.444) [-535.625] (-549.300) * (-552.267) [-541.229] (-540.037) (-548.797) -- 0:00:02
Average standard deviation of split frequencies: 0.005771
985500 -- (-545.518) (-546.797) [-538.116] (-546.304) * (-550.781) [-534.314] (-532.662) (-542.363) -- 0:00:02
986000 -- (-539.828) (-551.199) [-538.749] (-552.406) * (-553.199) (-551.983) [-544.408] (-546.768) -- 0:00:02
986500 -- [-537.729] (-549.175) (-541.143) (-553.631) * (-550.404) [-542.720] (-548.563) (-543.753) -- 0:00:02
987000 -- (-547.204) (-548.703) (-545.051) [-543.322] * (-547.646) [-535.146] (-561.378) (-545.707) -- 0:00:02
987500 -- [-540.130] (-541.752) (-549.846) (-552.633) * (-549.849) [-545.517] (-554.885) (-556.269) -- 0:00:02
988000 -- (-545.437) [-546.074] (-536.033) (-551.559) * (-547.097) [-541.384] (-554.720) (-550.993) -- 0:00:02
988500 -- (-541.125) [-549.013] (-544.550) (-558.457) * (-557.469) (-543.525) (-537.124) [-548.042] -- 0:00:01
989000 -- [-538.146] (-553.163) (-550.616) (-550.214) * (-553.343) (-542.426) [-542.152] (-554.540) -- 0:00:01
989500 -- (-542.847) (-558.130) (-555.562) [-542.985] * (-539.067) [-541.952] (-544.856) (-558.024) -- 0:00:01
990000 -- [-545.857] (-561.191) (-548.337) (-544.588) * (-549.926) [-529.935] (-538.538) (-545.434) -- 0:00:01
Average standard deviation of split frequencies: 0.005914
990500 -- (-554.203) [-544.003] (-555.314) (-544.208) * (-547.400) [-537.336] (-544.457) (-552.494) -- 0:00:01
991000 -- [-539.702] (-548.920) (-559.296) (-547.772) * [-544.681] (-542.523) (-552.020) (-546.731) -- 0:00:01
991500 -- (-556.078) (-547.504) (-544.953) [-548.632] * (-543.181) [-542.603] (-561.853) (-554.358) -- 0:00:01
992000 -- (-547.280) (-546.315) (-550.937) [-552.735] * (-548.320) (-545.680) [-547.473] (-555.063) -- 0:00:01
992500 -- [-541.719] (-541.989) (-551.784) (-549.462) * (-538.738) (-545.242) (-543.473) [-533.022] -- 0:00:01
993000 -- (-540.783) [-546.597] (-559.207) (-556.528) * (-542.973) (-531.885) [-537.553] (-544.082) -- 0:00:01
993500 -- (-545.081) (-548.190) [-543.797] (-560.647) * (-548.366) [-533.943] (-549.930) (-536.571) -- 0:00:01
994000 -- (-540.168) (-553.039) [-550.948] (-543.860) * [-551.109] (-551.393) (-562.683) (-551.316) -- 0:00:01
994500 -- (-536.158) (-544.118) [-545.873] (-555.645) * (-539.083) (-551.262) (-536.161) [-555.057] -- 0:00:00
995000 -- (-549.829) (-550.951) [-545.329] (-544.492) * [-544.129] (-550.763) (-550.487) (-538.349) -- 0:00:00
Average standard deviation of split frequencies: 0.005279
995500 -- (-542.718) [-539.021] (-539.862) (-542.562) * (-546.799) [-553.755] (-551.711) (-538.351) -- 0:00:00
996000 -- [-536.751] (-557.345) (-540.507) (-547.327) * (-539.012) (-551.476) (-557.915) [-537.822] -- 0:00:00
996500 -- [-528.887] (-551.873) (-535.866) (-558.024) * [-548.518] (-552.312) (-548.699) (-550.367) -- 0:00:00
997000 -- (-557.105) [-548.392] (-542.311) (-541.965) * (-537.926) [-547.188] (-557.536) (-558.181) -- 0:00:00
997500 -- (-540.058) (-550.658) (-556.270) [-535.461] * (-538.685) (-559.424) [-536.667] (-555.625) -- 0:00:00
998000 -- [-535.196] (-552.060) (-544.489) (-539.544) * [-549.648] (-544.234) (-540.769) (-536.255) -- 0:00:00
998500 -- [-537.640] (-547.181) (-545.493) (-537.101) * (-542.968) (-546.414) [-546.267] (-552.969) -- 0:00:00
999000 -- (-561.897) (-544.188) (-549.410) [-527.730] * [-535.782] (-542.283) (-546.528) (-554.896) -- 0:00:00
999500 -- (-555.944) [-546.071] (-542.625) (-546.264) * (-538.477) (-553.987) (-546.588) [-548.267] -- 0:00:00
1000000 -- [-543.929] (-545.449) (-552.764) (-528.458) * (-544.118) (-548.998) (-546.998) [-546.620] -- 0:00:00
Average standard deviation of split frequencies: 0.005110
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -543.929369 -- 23.461918
Chain 1 -- -543.929366 -- 23.461918
Chain 2 -- -545.448560 -- 18.797995
Chain 2 -- -545.448558 -- 18.797995
Chain 3 -- -552.764136 -- 16.277438
Chain 3 -- -552.764132 -- 16.277438
Chain 4 -- -528.458227 -- 29.142190
Chain 4 -- -528.458228 -- 29.142190
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -544.117990 -- 22.003755
Chain 1 -- -544.117984 -- 22.003755
Chain 2 -- -548.997595 -- 20.586278
Chain 2 -- -548.997595 -- 20.586278
Chain 3 -- -546.998314 -- 18.577092
Chain 3 -- -546.998314 -- 18.577092
Chain 4 -- -546.619938 -- 18.218945
Chain 4 -- -546.619933 -- 18.218945
Analysis completed in 2 mins 49 seconds
Analysis used 169.15 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -522.10
Likelihood of best state for "cold" chain of run 2 was -522.27
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
57.2 % ( 43 %) Dirichlet(Revmat{all})
78.4 % ( 73 %) Slider(Revmat{all})
40.1 % ( 27 %) Dirichlet(Pi{all})
39.0 % ( 27 %) Slider(Pi{all})
53.5 % ( 21 %) Multiplier(Alpha{1,2})
57.1 % ( 37 %) Multiplier(Alpha{3})
58.5 % ( 31 %) Slider(Pinvar{all})
50.2 % ( 44 %) ExtSPR(Tau{all},V{all})
19.9 % ( 20 %) ExtTBR(Tau{all},V{all})
55.7 % ( 45 %) NNI(Tau{all},V{all})
39.2 % ( 33 %) ParsSPR(Tau{all},V{all})
27.5 % ( 27 %) Multiplier(V{all})
67.6 % ( 58 %) Nodeslider(V{all})
28.0 % ( 17 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
58.2 % ( 59 %) Dirichlet(Revmat{all})
78.7 % ( 66 %) Slider(Revmat{all})
40.4 % ( 24 %) Dirichlet(Pi{all})
38.2 % ( 34 %) Slider(Pi{all})
53.6 % ( 25 %) Multiplier(Alpha{1,2})
56.4 % ( 27 %) Multiplier(Alpha{3})
58.6 % ( 25 %) Slider(Pinvar{all})
50.9 % ( 54 %) ExtSPR(Tau{all},V{all})
20.4 % ( 15 %) ExtTBR(Tau{all},V{all})
56.3 % ( 49 %) NNI(Tau{all},V{all})
40.1 % ( 31 %) ParsSPR(Tau{all},V{all})
27.6 % ( 24 %) Multiplier(V{all})
67.4 % ( 77 %) Nodeslider(V{all})
28.2 % ( 16 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.61 0.33 0.17
2 | 167338 0.65 0.39
3 | 166655 166115 0.69
4 | 166810 166586 166496
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.61 0.34 0.18
2 | 166093 0.66 0.40
3 | 166971 167426 0.69
4 | 166304 166376 166830
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/85/CG15829-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/85/CG15829-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/85/CG15829-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -537.34
| 2 2 |
| 2 * |
| 1 1 2 2 |
| 2 2 12 1 2 1 1 1 1 1 |
|* 1 2 1 2 |
| 1 1 1* 1 1 1 1 1 1 2 2 1 |
| 1 * 2 *2 2 2 2 112 21 2 21 |
| 2 11 1 1 2 1 2 2 1 |
| 21 2 1 * 1 22 2 122 21 |
| 2 2 2 1 21 |
| 2 *1 2 * 1 2122 11 1 |
| 1 * 2 1|
| 2 * 1 1 |
| 2 2 |
| 1 2 2 2|
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -543.58
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/85/CG15829-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/85/CG15829-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/85/CG15829-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -531.58 -552.49
2 -531.63 -553.18
--------------------------------------
TOTAL -531.60 -552.89
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/85/CG15829-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/85/CG15829-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/85/CG15829-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.746025 0.086223 0.282839 1.332027 0.691944 729.47 778.93 1.000
r(A<->C){all} 0.016801 0.000332 0.000001 0.052564 0.010866 812.33 829.78 1.000
r(A<->G){all} 0.143191 0.014017 0.009679 0.399299 0.105011 269.55 291.32 1.003
r(A<->T){all} 0.098938 0.008971 0.000024 0.290434 0.070173 177.09 192.42 1.000
r(C<->G){all} 0.046308 0.001258 0.000001 0.113571 0.038388 321.32 440.32 1.000
r(C<->T){all} 0.595002 0.033495 0.264043 0.914290 0.610883 131.33 188.33 1.000
r(G<->T){all} 0.099762 0.005429 0.000171 0.240737 0.081829 259.85 320.37 1.000
pi(A){all} 0.274094 0.000750 0.224018 0.330308 0.273607 978.39 1009.85 1.001
pi(C){all} 0.299995 0.000833 0.245800 0.356319 0.299186 1157.32 1193.05 1.000
pi(G){all} 0.287220 0.000800 0.232026 0.341683 0.286438 1254.78 1269.64 1.001
pi(T){all} 0.138690 0.000466 0.098836 0.181435 0.137597 500.84 726.50 1.000
alpha{1,2} 0.139888 0.009491 0.000496 0.305965 0.126651 747.88 757.04 1.001
alpha{3} 0.883340 0.276789 0.162795 1.944694 0.765161 1085.35 1187.91 1.000
pinvar{all} 0.644240 0.013961 0.410498 0.832324 0.667211 512.35 513.34 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/85/CG15829-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/85/CG15829-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/85/CG15829-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/85/CG15829-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
10 -- C10
Key to taxon bipartitions (saved to file "/opt/ADOPS/85/CG15829-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
----------------
1 -- .*********
2 -- .*........
3 -- ..*.......
4 -- ...*......
5 -- ....*.....
6 -- .....*....
7 -- ......*...
8 -- .......*..
9 -- ........*.
10 -- .........*
11 -- .**.......
12 -- .......***
13 -- .......**.
14 -- ...*...***
15 -- ....*.*...
16 -- ........**
17 -- ....*.****
18 -- ...*******
19 -- ...**.****
20 -- .**..*....
21 -- .****.****
22 -- .......*.*
23 -- ...*.*....
----------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/85/CG15829-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
11 2051 0.683211 0.010835 0.675550 0.690873 2
12 1859 0.619254 0.017430 0.606929 0.631579 2
13 1720 0.572951 0.010364 0.565623 0.580280 2
14 1152 0.383744 0.000942 0.383078 0.384410 2
15 731 0.243504 0.000471 0.243171 0.243837 2
16 699 0.232845 0.004240 0.229847 0.235843 2
17 543 0.180879 0.001413 0.179880 0.181879 2
18 512 0.170553 0.000942 0.169887 0.171219 2
19 459 0.152898 0.009893 0.145903 0.159893 2
20 444 0.147901 0.000942 0.147235 0.148568 2
21 374 0.124584 0.000000 0.124584 0.124584 2
22 320 0.106596 0.004711 0.103264 0.109927 2
23 311 0.103598 0.004240 0.100600 0.106596 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/85/CG15829-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.042251 0.001136 0.000009 0.106508 0.033428 1.000 2
length{all}[2] 0.025279 0.000568 0.000000 0.072372 0.018184 1.000 2
length{all}[3] 0.016469 0.000373 0.000001 0.054465 0.010281 1.000 2
length{all}[4] 0.079565 0.003089 0.009670 0.187716 0.066015 1.000 2
length{all}[5] 0.029216 0.000735 0.000022 0.081754 0.021164 1.000 2
length{all}[6] 0.045819 0.001217 0.001088 0.109665 0.037409 1.000 2
length{all}[7] 0.062191 0.001813 0.005825 0.146203 0.051265 1.002 2
length{all}[8] 0.158316 0.007947 0.033338 0.333206 0.141385 1.000 2
length{all}[9] 0.041001 0.001535 0.000105 0.117265 0.029334 1.000 2
length{all}[10] 0.054654 0.001903 0.001960 0.140981 0.042866 1.000 2
length{all}[11] 0.028585 0.000696 0.000003 0.081440 0.020834 1.000 2
length{all}[12] 0.046681 0.001477 0.000025 0.118784 0.036097 1.000 2
length{all}[13] 0.042700 0.001664 0.000113 0.120420 0.030953 1.000 2
length{all}[14] 0.039042 0.001070 0.000195 0.106254 0.029438 0.999 2
length{all}[15] 0.022028 0.000690 0.000040 0.067778 0.013705 1.000 2
length{all}[16] 0.034439 0.001151 0.000078 0.104522 0.023226 0.999 2
length{all}[17] 0.029739 0.001059 0.000004 0.079227 0.020768 1.000 2
length{all}[18] 0.022054 0.000590 0.000055 0.069127 0.014439 0.999 2
length{all}[19] 0.024064 0.000692 0.000064 0.070247 0.015942 1.008 2
length{all}[20] 0.023107 0.000698 0.000016 0.074819 0.014687 0.998 2
length{all}[21] 0.020093 0.000587 0.000016 0.059438 0.011776 1.000 2
length{all}[22] 0.022731 0.000923 0.000043 0.072639 0.013779 1.000 2
length{all}[23] 0.023364 0.000529 0.000001 0.071326 0.016304 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005110
Maximum standard deviation of split frequencies = 0.017430
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/---------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C4 (4)
|
|---------------------------------------------------------------------- C5 (5)
|
|---------------------------------------------------------------------- C6 (6)
|
|---------------------------------------------------------------------- C7 (7)
+
| /----------------------- C2 (2)
|----------------------68----------------------+
| \----------------------- C3 (3)
|
| /----------------------- C8 (8)
| /-----------57----------+
| | \----------------------- C9 (9)
\----------62----------+
\----------------------------------------------- C10 (10)
Phylogram (based on average branch lengths):
/------------ C1 (1)
|
|----------------------- C4 (4)
|
|------- C5 (5)
|
|------------- C6 (6)
|
|------------------ C7 (7)
+
| /------ C2 (2)
|------+
| \---- C3 (3)
|
| /------------------------------------------------- C8 (8)
| /----------+
| | \---------- C9 (9)
\-----------+
\--------------- C10 (10)
|----------------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (2217 trees sampled):
50 % credible set contains 716 trees
90 % credible set contains 1917 trees
95 % credible set contains 2067 trees
99 % credible set contains 2187 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 10 ls = 246
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Sequences read..
Counting site patterns.. 0:00
44 patterns at 82 / 82 sites (100.0%), 0:00
Counting codons..
360 bytes for distance
42944 bytes for conP
5984 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 4, 5, 6, 7, (2, 3), ((8, 9), 10)); MP score: 31
85888 bytes for conP, adjusted
0.036978 0.048461 0.023476 0.030068 0.060210 0.013951 0.013193 0.000000 0.028308 0.008234 0.080893 0.020902 0.028759 0.300000 1.300000
ntime & nrate & np: 13 2 15
Bounds (np=15):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 15
lnL0 = -533.717210
Iterating by ming2
Initial: fx= 533.717210
x= 0.03698 0.04846 0.02348 0.03007 0.06021 0.01395 0.01319 0.00000 0.02831 0.00823 0.08089 0.02090 0.02876 0.30000 1.30000
1 h-m-p 0.0000 0.0000 135.8234 ++ 533.717028 m 0.0000 20 | 1/15
2 h-m-p 0.0000 0.0002 218.9264 +YCYYCCC 532.477031 6 0.0001 49 | 1/15
3 h-m-p 0.0001 0.0004 236.5070 +YYYYCC 529.241346 5 0.0003 74 | 1/15
4 h-m-p 0.0000 0.0001 891.7481 +YYCCCC 526.564194 5 0.0001 101 | 1/15
5 h-m-p 0.0001 0.0011 897.8388 +YCYC 517.463316 3 0.0005 124 | 1/15
6 h-m-p 0.0002 0.0012 387.7613 YYCCC 515.198651 4 0.0003 148 | 1/15
7 h-m-p 0.0002 0.0008 120.0375 +YYYCCC 512.991952 5 0.0006 174 | 1/15
8 h-m-p 0.0001 0.0005 434.9610 YCYCCC 510.492534 5 0.0003 200 | 1/15
9 h-m-p 0.0001 0.0007 99.8850 YCYCCC 509.738152 5 0.0004 226 | 1/15
10 h-m-p 0.0004 0.0018 80.2600 YCC 509.450938 2 0.0003 247 | 1/15
11 h-m-p 0.0007 0.0039 30.4310 +YYYCCC 508.485030 5 0.0026 273 | 1/15
12 h-m-p 0.0002 0.0010 350.0805 +YYYCCCC 505.306509 6 0.0007 301 | 1/15
13 h-m-p 0.0000 0.0002 2417.3490 +YYYYYCCCCC 500.364007 9 0.0001 333 | 1/15
14 h-m-p 0.0003 0.0014 121.3781 CYCCC 499.858279 4 0.0005 358 | 1/15
15 h-m-p 0.0031 0.0156 6.8877 YCYCCC 498.996523 5 0.0085 384 | 1/15
16 h-m-p 0.0234 0.1172 1.7184 +YYCYCCCC 493.180683 7 0.0991 414 | 1/15
17 h-m-p 0.0067 0.0335 2.7354 CYCYCC 491.933964 5 0.0148 441 | 1/15
18 h-m-p 0.0504 0.2519 0.2473 CYCCCC 490.028645 5 0.1070 468 | 1/15
19 h-m-p 0.2048 2.2597 0.1291 +CCCCC 485.915941 4 0.7363 509 | 1/15
20 h-m-p 1.0017 5.0084 0.0582 +YYCCCC 481.019812 5 3.2878 550 | 1/15
21 h-m-p 0.3463 1.7315 0.0812 YCCCC 480.050089 4 0.6670 589 | 1/15
22 h-m-p 0.8300 8.0000 0.0653 +YCCC 479.372561 3 2.3100 627 | 1/15
23 h-m-p 1.2495 7.1523 0.1207 +YYCCC 477.959529 4 4.1696 666 | 1/15
24 h-m-p 1.6000 8.0000 0.1395 YYCCC 477.226896 4 2.4611 704 | 1/15
25 h-m-p 1.3730 7.2963 0.2500 YCCCC 476.343575 4 2.5880 743 | 1/15
26 h-m-p 1.6000 8.0000 0.3178 YCCC 475.825785 3 2.4822 780 | 1/15
27 h-m-p 1.6000 8.0000 0.1949 CCCC 475.685881 3 1.9707 818 | 1/15
28 h-m-p 1.6000 8.0000 0.0329 +YCCC 475.619526 3 4.4864 856 | 1/15
29 h-m-p 1.6000 8.0000 0.0071 +YC 475.536617 1 4.1748 890 | 1/15
30 h-m-p 0.7808 8.0000 0.0380 ++ 475.330466 m 8.0000 922 | 1/15
31 h-m-p 1.1165 8.0000 0.2723 YCCC 475.060835 3 2.6171 959 | 1/15
32 h-m-p 1.6000 8.0000 0.0304 YCCC 474.646589 3 3.7945 996 | 1/15
33 h-m-p 0.3608 8.0000 0.3192 ++YCYCCC 473.707776 5 3.9444 1038 | 1/15
34 h-m-p 0.4629 2.3145 0.4145 YCCCC 473.123228 4 0.9678 1077 | 1/15
35 h-m-p 1.5085 7.5426 0.1812 CCCCC 472.382697 4 1.8900 1117 | 1/15
36 h-m-p 1.5069 7.5346 0.0357 YCCC 471.040462 3 2.3672 1154 | 1/15
37 h-m-p 0.4454 5.2864 0.1897 +CYCCC 469.810243 4 2.3508 1194 | 1/15
38 h-m-p 1.1152 5.5761 0.1088 CCCC 469.118956 3 1.5764 1232 | 1/15
39 h-m-p 0.6945 8.0000 0.2469 +YYCC 468.437073 3 2.2834 1269 | 1/15
40 h-m-p 1.6000 8.0000 0.1501 CYC 468.052441 2 1.9129 1304 | 1/15
41 h-m-p 1.6000 8.0000 0.0166 CCC 467.910762 2 1.6857 1340 | 1/15
42 h-m-p 1.6000 8.0000 0.0082 CCC 467.881825 2 1.3087 1376 | 1/15
43 h-m-p 0.3896 8.0000 0.0277 +C 467.871868 0 1.5271 1409 | 1/15
44 h-m-p 1.6000 8.0000 0.0130 CC 467.870999 1 1.4504 1443 | 1/15
45 h-m-p 1.6000 8.0000 0.0035 YC 467.870684 1 3.3072 1476 | 1/15
46 h-m-p 1.6000 8.0000 0.0030 YC 467.870521 1 2.7240 1509 | 1/15
47 h-m-p 1.6000 8.0000 0.0025 C 467.870456 0 1.7759 1541 | 1/15
48 h-m-p 1.6000 8.0000 0.0003 C 467.870452 0 1.3506 1573 | 1/15
49 h-m-p 1.6000 8.0000 0.0000 Y 467.870452 0 1.2688 1605 | 1/15
50 h-m-p 1.6000 8.0000 0.0000 C 467.870452 0 1.6000 1637 | 1/15
51 h-m-p 1.6000 8.0000 0.0000 C 467.870452 0 1.3891 1669 | 1/15
52 h-m-p 1.6000 8.0000 0.0000 C 467.870452 0 2.4499 1701 | 1/15
53 h-m-p 1.6000 8.0000 0.0000 -C 467.870452 0 0.1000 1734 | 1/15
54 h-m-p 0.1052 8.0000 0.0000 ------------Y 467.870452 0 0.0000 1778
Out..
lnL = -467.870452
1779 lfun, 1779 eigenQcodon, 23127 P(t)
Time used: 0:05
Model 1: NearlyNeutral
TREE # 1
(1, 4, 5, 6, 7, (2, 3), ((8, 9), 10)); MP score: 31
0.037152 0.048605 0.023236 0.030338 0.059746 0.013480 0.013055 0.000000 0.027809 0.008105 0.080700 0.020724 0.029060 2.547900 0.700642 0.304419
ntime & nrate & np: 13 2 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 4.776590
np = 16
lnL0 = -486.931604
Iterating by ming2
Initial: fx= 486.931604
x= 0.03715 0.04861 0.02324 0.03034 0.05975 0.01348 0.01306 0.00000 0.02781 0.00811 0.08070 0.02072 0.02906 2.54790 0.70064 0.30442
1 h-m-p 0.0000 0.0000 132.4299 ++ 486.931413 m 0.0000 21 | 1/16
2 h-m-p 0.0000 0.0002 131.5296 ++YCYCCC 486.245506 5 0.0001 50 | 1/16
3 h-m-p 0.0001 0.0007 98.4352 YCYCCC 485.198448 5 0.0004 77 | 1/16
4 h-m-p 0.0001 0.0005 243.6057 +YYCCCCC 482.722926 6 0.0003 107 | 1/16
5 h-m-p 0.0001 0.0003 581.7645 +YCYYYCC 476.405577 6 0.0003 135 | 1/16
6 h-m-p 0.0000 0.0000 5550.6449 +YYCYCC 475.476659 5 0.0000 162 | 1/16
7 h-m-p 0.0001 0.0007 144.0080 YCYCCC 474.399763 5 0.0003 189 | 1/16
8 h-m-p 0.0001 0.0004 198.8645 CCCC 473.988376 3 0.0001 214 | 1/16
9 h-m-p 0.0001 0.0004 74.5136 YCCC 473.854444 3 0.0001 238 | 1/16
10 h-m-p 0.0007 0.0077 13.9678 CCC 473.797462 2 0.0006 261 | 1/16
11 h-m-p 0.0010 0.0208 8.5407 +YCCC 473.666563 3 0.0028 286 | 1/16
12 h-m-p 0.0019 0.0096 5.4295 CCCCC 473.533861 4 0.0029 313 | 1/16
13 h-m-p 0.0011 0.0084 14.2600 +YYCC 472.924871 3 0.0041 337 | 1/16
14 h-m-p 0.0004 0.0022 53.8667 CCCCC 472.628563 4 0.0005 364 | 1/16
15 h-m-p 0.0018 0.0126 15.6537 +YYCCC 471.380092 4 0.0062 390 | 1/16
16 h-m-p 0.0763 0.9064 1.2768 +YCYCCCC 468.260991 6 0.4388 420 | 1/16
17 h-m-p 0.1694 0.8468 1.7653 CYC 466.806418 2 0.1912 442 | 1/16
18 h-m-p 0.2484 1.2421 0.1665 YCCCCC 465.479772 5 0.5776 470 | 1/16
19 h-m-p 0.1670 2.8467 0.5758 +CCCC 464.843098 3 0.8279 511 | 1/16
20 h-m-p 0.4789 2.3945 0.3631 CCCCC 464.313513 4 0.7617 553 | 1/16
21 h-m-p 0.7318 3.6591 0.1342 CCCC 464.015812 3 0.9799 593 | 1/16
22 h-m-p 0.7134 3.5672 0.1121 CCCC 463.844752 3 0.8583 633 | 1/16
23 h-m-p 1.6000 8.0000 0.0467 CYC 463.713378 2 1.3581 670 | 1/16
24 h-m-p 1.6000 8.0000 0.0141 CCC 463.580736 2 1.8765 708 | 1/16
25 h-m-p 0.8859 8.0000 0.0299 +YC 463.462419 1 2.2257 744 | 1/16
26 h-m-p 1.6000 8.0000 0.0190 CC 463.384560 1 1.3094 780 | 1/16
27 h-m-p 0.3207 7.3717 0.0777 +CCCC 463.330448 3 1.6934 821 | 1/16
28 h-m-p 1.6000 8.0000 0.0052 CCC 463.262232 2 2.5337 859 | 1/16
29 h-m-p 0.1826 8.0000 0.0720 ++YCC 463.187052 2 2.2096 898 | 1/16
30 h-m-p 1.6000 8.0000 0.0065 CCC 463.153052 2 2.0008 936 | 1/16
31 h-m-p 0.4283 8.0000 0.0302 ++YC 463.091831 1 5.1897 973 | 1/16
32 h-m-p 1.6000 8.0000 0.0375 +CCC 462.907851 2 5.9258 1012 | 1/16
33 h-m-p 1.6000 8.0000 0.0822 +YCCC 462.318360 3 5.4912 1052 | 1/16
34 h-m-p 0.8577 4.2884 0.0337 +YCYCCC 461.746101 5 2.4227 1095 | 1/16
35 h-m-p 0.2349 3.8977 0.3474 +CCCC 461.145093 3 1.5849 1136 | 1/16
36 h-m-p 0.5677 2.8383 0.1187 YCCCCC 460.594644 5 1.1734 1179 | 1/16
37 h-m-p 0.8388 4.1939 0.0306 CCCC 460.160400 3 1.1915 1219 | 1/16
38 h-m-p 0.1753 3.8187 0.2079 +YCCCC 459.892609 4 1.3715 1261 | 1/16
39 h-m-p 1.6000 8.0000 0.0513 YCCC 459.764012 3 1.0350 1300 | 1/16
40 h-m-p 0.3983 5.6506 0.1333 +YYC 459.680129 2 1.2675 1337 | 1/16
41 h-m-p 1.6000 8.0000 0.0265 CCC 459.643382 2 1.4447 1375 | 1/16
42 h-m-p 0.6728 8.0000 0.0568 YC 459.638600 1 1.1519 1410 | 1/16
43 h-m-p 1.6000 8.0000 0.0069 YC 459.638411 1 1.0733 1445 | 1/16
44 h-m-p 1.6000 8.0000 0.0001 Y 459.638409 0 1.0904 1479 | 1/16
45 h-m-p 1.6000 8.0000 0.0000 Y 459.638409 0 1.2457 1513 | 1/16
46 h-m-p 1.6000 8.0000 0.0000 C 459.638409 0 1.6000 1547 | 1/16
47 h-m-p 1.6000 8.0000 0.0000 C 459.638409 0 1.6000 1581 | 1/16
48 h-m-p 1.6000 8.0000 0.0000 C 459.638409 0 0.3361 1615 | 1/16
49 h-m-p 0.3310 8.0000 0.0000 -----Y 459.638409 0 0.0001 1654
Out..
lnL = -459.638409
1655 lfun, 4965 eigenQcodon, 43030 P(t)
Time used: 0:13
Model 2: PositiveSelection
TREE # 1
(1, 4, 5, 6, 7, (2, 3), ((8, 9), 10)); MP score: 31
initial w for M2:NSpselection reset.
0.038070 0.048364 0.022999 0.030020 0.060197 0.013241 0.013484 0.000000 0.027926 0.009010 0.081068 0.021785 0.028489 2.784930 0.878998 0.263736 0.186073 2.329016
ntime & nrate & np: 13 3 18
Bounds (np=18):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 2.904641
np = 18
lnL0 = -492.424740
Iterating by ming2
Initial: fx= 492.424740
x= 0.03807 0.04836 0.02300 0.03002 0.06020 0.01324 0.01348 0.00000 0.02793 0.00901 0.08107 0.02178 0.02849 2.78493 0.87900 0.26374 0.18607 2.32902
1 h-m-p 0.0000 0.0000 132.7484 ++ 492.424528 m 0.0000 23 | 1/18
2 h-m-p 0.0000 0.0002 95.3857 ++YCYCCC 492.011109 5 0.0001 54 | 1/18
3 h-m-p 0.0001 0.0006 70.9135 YCCCC 491.624496 4 0.0002 82 | 1/18
4 h-m-p 0.0002 0.0009 88.6355 CYCCC 491.134086 4 0.0003 110 | 1/18
5 h-m-p 0.0004 0.0018 74.0588 +YCYCCC 490.038229 5 0.0010 140 | 1/18
6 h-m-p 0.0001 0.0004 315.8884 ++ 487.160849 m 0.0004 161 | 2/18
7 h-m-p 0.0006 0.0050 133.5642 ++ 485.968957 m 0.0050 182 | 2/18
8 h-m-p -0.0000 -0.0000 117.4834
h-m-p: -8.24888226e-20 -4.12444113e-19 1.17483409e+02 485.968957
.. | 2/18
9 h-m-p 0.0000 0.0043 151.7699 +++YYCCCC 480.663896 5 0.0012 232 | 2/18
10 h-m-p 0.0026 0.0129 37.7600 +YYCCCC 474.303874 5 0.0094 262 | 1/18
11 h-m-p 0.0001 0.0006 225.6767 YYCCC 474.100234 4 0.0000 289 | 1/18
12 h-m-p 0.0002 0.0022 51.7662 +CYCCC 473.237322 4 0.0013 318 | 1/18
13 h-m-p 0.0012 0.0060 26.0374 YCYCCC 472.418630 5 0.0033 347 | 1/18
14 h-m-p 0.0011 0.0087 75.5757 +YYYCCC 470.033797 5 0.0041 376 | 1/18
15 h-m-p 0.0011 0.0057 57.9539 YCCCC 469.235002 4 0.0021 404 | 1/18
16 h-m-p 0.0022 0.0109 36.2954 +YCYCCC 467.878908 5 0.0061 434 | 1/18
17 h-m-p 0.0006 0.0030 65.6895 YCCCC 467.502942 4 0.0012 462 | 1/18
18 h-m-p 0.0012 0.0233 61.1588 YCCC 466.922007 3 0.0022 488 | 1/18
19 h-m-p 0.0022 0.0109 15.9532 CYC 466.811995 2 0.0020 512 | 1/18
20 h-m-p 0.0033 0.0436 9.5663 YC 466.607470 1 0.0079 534 | 1/18
21 h-m-p 0.0050 0.0248 4.4063 CYC 466.593084 2 0.0014 558 | 1/18
22 h-m-p 0.0023 0.1828 2.6377 ++CCCCC 466.164698 4 0.0434 589 | 1/18
23 h-m-p 0.0100 0.0510 11.4654 YCYCCC 464.509722 5 0.0242 618 | 1/18
24 h-m-p 0.1675 0.8374 1.1329 CYCCC 463.271303 4 0.3656 646 | 1/18
25 h-m-p 0.1450 0.7251 1.3430 +YYCYCCC 462.207622 6 0.4770 677 | 1/18
26 h-m-p 0.0905 0.4523 3.0630 +YCYCC 460.787990 4 0.2907 705 | 1/18
27 h-m-p 0.1061 0.5303 0.7099 YCCC 460.384931 3 0.1787 731 | 1/18
28 h-m-p 0.1131 0.5657 0.6161 +YCCC 460.031316 3 0.3643 775 | 1/18
29 h-m-p 0.0168 0.0839 1.0510 ++ 459.901376 m 0.0839 813 | 2/18
30 h-m-p 0.1178 6.6805 0.3877 +CCCC 459.730150 3 0.6552 841 | 2/18
31 h-m-p 0.8827 4.4133 0.1826 YCCC 459.683706 3 0.4839 883 | 2/18
32 h-m-p 0.6031 4.6766 0.1465 YC 459.658838 1 0.4183 921 | 2/18
33 h-m-p 1.2414 6.5532 0.0494 YC 459.648353 1 0.5066 959 | 2/18
34 h-m-p 0.6964 8.0000 0.0359 YC 459.640311 1 0.5629 997 | 2/18
35 h-m-p 1.2878 8.0000 0.0157 C 459.638848 0 0.3211 1034 | 2/18
36 h-m-p 0.5445 8.0000 0.0093 CC 459.638469 1 0.4847 1073 | 2/18
37 h-m-p 1.1835 8.0000 0.0038 YC 459.638417 1 0.7981 1111 | 2/18
38 h-m-p 1.6000 8.0000 0.0017 Y 459.638410 0 0.7650 1148 | 2/18
39 h-m-p 1.6000 8.0000 0.0007 Y 459.638409 0 0.9934 1185 | 2/18
40 h-m-p 1.6000 8.0000 0.0002 Y 459.638409 0 0.7197 1222 | 2/18
41 h-m-p 1.6000 8.0000 0.0000 Y 459.638409 0 1.0622 1259 | 2/18
42 h-m-p 1.6000 8.0000 0.0000 C 459.638409 0 0.4000 1296 | 2/18
43 h-m-p 1.6000 8.0000 0.0000 ----Y 459.638409 0 0.0016 1337
Out..
lnL = -459.638409
1338 lfun, 5352 eigenQcodon, 52182 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -471.660250 S = -444.932152 -18.410527
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 44 patterns 0:24
did 20 / 44 patterns 0:24
did 30 / 44 patterns 0:24
did 40 / 44 patterns 0:24
did 44 / 44 patterns 0:24
Time used: 0:24
Model 3: discrete
TREE # 1
(1, 4, 5, 6, 7, (2, 3), ((8, 9), 10)); MP score: 31
0.037511 0.048747 0.023139 0.030407 0.059747 0.013687 0.013338 0.000000 0.028095 0.008248 0.080685 0.020917 0.028620 2.784930 0.062503 0.014820 0.026013 0.060737 0.104216
ntime & nrate & np: 13 4 19
Bounds (np=19):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 16.056446
np = 19
lnL0 = -468.925251
Iterating by ming2
Initial: fx= 468.925251
x= 0.03751 0.04875 0.02314 0.03041 0.05975 0.01369 0.01334 0.00000 0.02810 0.00825 0.08069 0.02092 0.02862 2.78493 0.06250 0.01482 0.02601 0.06074 0.10422
1 h-m-p 0.0000 0.0000 141.0746 ++ 468.925015 m 0.0000 24 | 1/19
2 h-m-p 0.0000 0.0002 156.7829 ++YYYCCCCC 467.588264 7 0.0002 59 | 1/19
3 h-m-p 0.0000 0.0001 245.6282 ++ 466.517572 m 0.0001 81 | 2/19
4 h-m-p 0.0002 0.0013 72.3286 ++ 464.442808 m 0.0013 103 | 3/19
5 h-m-p 0.0008 0.0040 32.4286 CCC 464.076442 2 0.0012 129 | 3/19
6 h-m-p 0.0007 0.0037 18.1485 CCCC 463.969075 3 0.0009 157 | 3/19
7 h-m-p 0.0011 0.0180 15.3893 CCC 463.856985 2 0.0015 183 | 3/19
8 h-m-p 0.0006 0.0031 12.4235 YYY 463.820469 2 0.0006 207 | 3/19
9 h-m-p 0.0005 0.0219 15.8316 YCCC 463.744418 3 0.0011 234 | 3/19
10 h-m-p 0.0012 0.0300 14.6620 +YCC 463.463287 2 0.0040 260 | 3/19
11 h-m-p 0.0013 0.0065 24.9613 YYC 463.348056 2 0.0011 284 | 3/19
12 h-m-p 0.0010 0.0150 25.9098 CCC 463.210384 2 0.0015 310 | 3/19
13 h-m-p 0.0022 0.0142 18.4130 YCC 463.166462 2 0.0009 335 | 3/19
14 h-m-p 0.0019 0.2052 8.5829 ++CCC 462.696929 2 0.0288 363 | 3/19
15 h-m-p 0.0008 0.0039 77.7146 CCCCC 462.530608 4 0.0010 393 | 3/19
16 h-m-p 0.0062 0.1731 13.1081 ++YYYYYC 460.066699 5 0.0980 422 | 2/19
17 h-m-p 0.0003 0.0013 742.6358 YCCC 460.019913 3 0.0001 449 | 2/19
18 h-m-p 0.3253 3.6593 0.2797 +YYCC 459.640901 3 0.9703 476 | 2/19
19 h-m-p 0.5040 2.5199 0.1038 CCCC 459.508891 3 0.8283 521 | 1/19
20 h-m-p 0.0153 0.0766 2.8182 -YC 459.508218 1 0.0006 562 | 1/19
21 h-m-p 0.0160 8.0000 0.1895 +++CCCC 459.391579 3 1.5089 593 | 1/19
22 h-m-p 1.6000 8.0000 0.1744 CCC 459.321415 2 1.3185 637 | 1/19
23 h-m-p 1.6000 8.0000 0.1252 YC 459.289990 1 1.1568 678 | 1/19
24 h-m-p 1.6000 8.0000 0.0405 CC 459.283736 1 1.3542 720 | 1/19
25 h-m-p 1.6000 8.0000 0.0084 YC 459.281989 1 1.1557 761 | 1/19
26 h-m-p 1.0260 8.0000 0.0094 YC 459.279748 1 1.8705 802 | 1/19
27 h-m-p 0.7434 8.0000 0.0238 +CC 459.274264 1 3.2762 845 | 1/19
28 h-m-p 1.1202 8.0000 0.0695 C 459.271667 0 1.1323 885 | 1/19
29 h-m-p 1.6000 8.0000 0.0066 YC 459.271575 1 1.0692 926 | 1/19
30 h-m-p 1.6000 8.0000 0.0013 Y 459.271569 0 1.1928 966 | 1/19
31 h-m-p 1.6000 8.0000 0.0005 C 459.271568 0 1.5029 1006 | 1/19
32 h-m-p 1.6000 8.0000 0.0003 +Y 459.271566 0 4.1490 1047 | 1/19
33 h-m-p 1.6000 8.0000 0.0006 +C 459.271561 0 5.7633 1088 | 1/19
34 h-m-p 1.6000 8.0000 0.0004 C 459.271559 0 1.3441 1128 | 1/19
35 h-m-p 1.6000 8.0000 0.0002 Y 459.271559 0 1.0127 1168 | 1/19
36 h-m-p 1.6000 8.0000 0.0000 Y 459.271559 0 0.9843 1208 | 1/19
37 h-m-p 1.6000 8.0000 0.0000 C 459.271559 0 1.2817 1248 | 1/19
38 h-m-p 1.6000 8.0000 0.0000 ---Y 459.271559 0 0.0063 1291
Out..
lnL = -459.271559
1292 lfun, 5168 eigenQcodon, 50388 P(t)
Time used: 0:34
Model 7: beta
TREE # 1
(1, 4, 5, 6, 7, (2, 3), ((8, 9), 10)); MP score: 31
0.037481 0.048730 0.022906 0.030134 0.059766 0.013613 0.013332 0.000000 0.027913 0.008291 0.081009 0.020875 0.028863 2.586805 0.942968 1.067294
ntime & nrate & np: 13 1 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 5.093119
np = 16
lnL0 = -485.480836
Iterating by ming2
Initial: fx= 485.480836
x= 0.03748 0.04873 0.02291 0.03013 0.05977 0.01361 0.01333 0.00000 0.02791 0.00829 0.08101 0.02088 0.02886 2.58680 0.94297 1.06729
1 h-m-p 0.0000 0.0000 126.9841 ++ 485.480658 m 0.0000 21 | 1/16
2 h-m-p 0.0000 0.0002 99.5426 ++YCYCC 485.078535 4 0.0001 48 | 1/16
3 h-m-p 0.0002 0.0009 49.3773 CCCCC 484.846483 4 0.0003 75 | 1/16
4 h-m-p 0.0003 0.0017 44.2823 CCCCC 484.614944 4 0.0004 102 | 1/16
5 h-m-p 0.0005 0.0100 36.0314 +YCCC 484.219389 3 0.0014 127 | 1/16
6 h-m-p 0.0007 0.0077 75.3943 +YCYCYCC 479.509543 6 0.0065 157 | 1/16
7 h-m-p 0.0000 0.0000 10336.1468 +CYCCC 476.436859 4 0.0000 184 | 1/16
8 h-m-p 0.0000 0.0000 7074.0785 YCYCCCC 474.572128 6 0.0000 213 | 1/16
9 h-m-p 0.0000 0.0002 100.3902 CCCC 474.533828 3 0.0001 238 | 1/16
10 h-m-p 0.0003 0.0050 17.1738 YCCC 474.465431 3 0.0007 262 | 1/16
11 h-m-p 0.0005 0.0213 25.6261 ++YYYYYC 473.502306 5 0.0077 288 | 1/16
12 h-m-p 0.0017 0.0084 76.7791 CYCCC 472.426300 4 0.0029 314 | 1/16
13 h-m-p 0.0011 0.0057 99.4239 +YYCYCC 470.247902 5 0.0039 341 | 1/16
14 h-m-p 0.0024 0.0119 82.9268 YCCCC 469.835082 4 0.0013 367 | 1/16
15 h-m-p 0.0508 0.2541 1.1961 +YYYYYC 466.907878 5 0.1989 392 | 1/16
16 h-m-p 0.0849 0.4246 1.0363 +YCCCC 463.784072 4 0.2363 419 | 1/16
17 h-m-p 0.1720 0.8601 0.3544 YCYCCC 462.795610 5 0.3729 446 | 1/16
18 h-m-p 0.3152 2.8438 0.4193 YCCCC 462.476280 4 0.5962 487 | 1/16
19 h-m-p 0.3969 2.0953 0.6297 YCCCC 462.018080 4 0.7016 528 | 1/16
20 h-m-p 0.3084 1.5422 0.1588 CCCC 461.757460 3 0.5019 568 | 1/16
21 h-m-p 0.1901 8.0000 0.4193 +YCCC 461.424417 3 1.7101 608 | 1/16
22 h-m-p 1.6000 8.0000 0.1919 YCCC 460.941280 3 3.0923 647 | 1/16
23 h-m-p 0.6855 3.4277 0.6767 YYCCCC 460.636120 5 0.7118 689 | 1/16
24 h-m-p 0.4644 2.3222 0.7500 YCYCCC 460.106647 5 1.3199 732 | 1/16
25 h-m-p 0.1499 0.7494 1.1041 YCCCCC 460.035895 5 0.1763 775 | 1/16
26 h-m-p 0.5270 8.0000 0.3694 +YYCC 459.582968 3 1.7100 799 | 1/16
27 h-m-p 1.2120 6.0598 0.0991 YYCC 459.462470 3 1.0035 837 | 1/16
28 h-m-p 0.2598 3.0768 0.3828 CYC 459.414420 2 0.2990 874 | 1/16
29 h-m-p 0.5419 5.8203 0.2112 CCCC 459.377409 3 0.6975 914 | 1/16
30 h-m-p 1.4587 8.0000 0.1010 YCC 459.360776 2 1.0233 951 | 1/16
31 h-m-p 1.6000 8.0000 0.0252 CCC 459.347456 2 2.1537 989 | 1/16
32 h-m-p 1.6000 8.0000 0.0175 CCC 459.339583 2 1.9277 1027 | 1/16
33 h-m-p 1.6000 8.0000 0.0020 ++ 459.322050 m 8.0000 1061 | 1/16
34 h-m-p 1.6000 8.0000 0.0083 CC 459.310242 1 2.0366 1097 | 1/16
35 h-m-p 1.6000 8.0000 0.0062 YC 459.300798 1 3.9565 1132 | 1/16
36 h-m-p 1.6000 8.0000 0.0125 CC 459.298227 1 1.3662 1168 | 1/16
37 h-m-p 1.6000 8.0000 0.0012 C 459.298082 0 1.6092 1202 | 1/16
38 h-m-p 1.6000 8.0000 0.0005 +YC 459.297905 1 4.0463 1238 | 1/16
39 h-m-p 1.6000 8.0000 0.0010 C 459.297849 0 1.3790 1272 | 1/16
40 h-m-p 1.6000 8.0000 0.0002 Y 459.297832 0 3.3117 1306 | 1/16
41 h-m-p 1.6000 8.0000 0.0004 C 459.297826 0 1.6276 1340 | 1/16
42 h-m-p 1.6000 8.0000 0.0001 ++ 459.297816 m 8.0000 1374 | 1/16
43 h-m-p 1.0300 8.0000 0.0005 C 459.297810 0 1.3644 1408 | 1/16
44 h-m-p 1.6000 8.0000 0.0001 Y 459.297810 0 1.1272 1442 | 1/16
45 h-m-p 1.6000 8.0000 0.0000 Y 459.297810 0 0.9985 1476 | 1/16
46 h-m-p 1.6000 8.0000 0.0000 Y 459.297810 0 1.0430 1510 | 1/16
47 h-m-p 1.6000 8.0000 0.0000 Y 459.297810 0 1.6000 1544 | 1/16
48 h-m-p 1.6000 8.0000 0.0000 -----Y 459.297810 0 0.0004 1583
Out..
lnL = -459.297810
1584 lfun, 17424 eigenQcodon, 205920 P(t)
Time used: 1:16
Model 8: beta&w>1
TREE # 1
(1, 4, 5, 6, 7, (2, 3), ((8, 9), 10)); MP score: 31
initial w for M8:NSbetaw>1 reset.
0.037529 0.048525 0.022860 0.030172 0.059772 0.013597 0.013315 0.000000 0.027819 0.008096 0.080662 0.021179 0.028807 2.581685 0.900000 1.091300 1.180709 2.396835
ntime & nrate & np: 13 2 18
Bounds (np=18):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 3.779316
np = 18
lnL0 = -489.184794
Iterating by ming2
Initial: fx= 489.184794
x= 0.03753 0.04853 0.02286 0.03017 0.05977 0.01360 0.01332 0.00000 0.02782 0.00810 0.08066 0.02118 0.02881 2.58168 0.90000 1.09130 1.18071 2.39683
1 h-m-p 0.0000 0.0000 135.2377 ++ 489.184586 m 0.0000 23 | 1/18
2 h-m-p 0.0000 0.0002 130.7558 ++YCYCCC 488.535537 5 0.0001 54 | 1/18
3 h-m-p 0.0001 0.0007 88.7843 YCYCCC 487.617776 5 0.0004 83 | 1/18
4 h-m-p 0.0001 0.0005 176.2888 +YCCCC 486.523306 4 0.0003 112 | 1/18
5 h-m-p 0.0001 0.0003 123.9098 ++ 485.642428 m 0.0003 133 | 2/18
6 h-m-p 0.0004 0.0041 42.0262 YC 485.257031 1 0.0010 155 | 2/18
7 h-m-p 0.0005 0.0033 82.9269 YCCCC 484.239600 4 0.0012 183 | 2/18
8 h-m-p 0.0006 0.0028 119.3950 YCCCC 483.174627 4 0.0011 211 | 2/18
9 h-m-p 0.0003 0.0015 188.1410 YCCCCC 482.069568 5 0.0007 241 | 2/18
10 h-m-p 0.0005 0.0023 149.1410 CCYC 481.704912 3 0.0004 267 | 2/18
11 h-m-p 0.0003 0.0049 177.1125 +CYYYCYCYCC 474.173679 10 0.0035 303 | 2/18
12 h-m-p 0.0000 0.0001 3907.5740 CYCYCC 473.277278 5 0.0000 333 | 2/18
13 h-m-p 0.0008 0.0039 12.8386 YYYC 473.227421 3 0.0007 357 | 2/18
14 h-m-p 0.0002 0.0072 43.0978 ++YYC 472.583801 2 0.0028 382 | 2/18
15 h-m-p 0.0005 0.0133 246.3476 ++CCC 465.954104 2 0.0080 409 | 2/18
16 h-m-p 0.6519 3.2594 0.2730 YCCC 464.087145 3 1.1320 435 | 2/18
17 h-m-p 0.5825 5.7977 0.5305 +YYCCC 463.271064 4 1.8658 479 | 2/18
18 h-m-p 0.8266 4.1332 0.1718 CCCC 462.872618 3 1.2647 522 | 2/18
19 h-m-p 0.8075 7.5216 0.2691 +YCY 462.515717 2 2.0323 563 | 2/18
20 h-m-p 1.4707 7.3533 0.1835 YYC 462.383908 2 1.2384 602 | 2/18
21 h-m-p 0.8928 6.1657 0.2546 CYC 462.295503 2 0.7750 642 | 2/18
22 h-m-p 1.3122 8.0000 0.1504 +YCCC 462.116029 3 3.3788 685 | 2/18
23 h-m-p 1.3168 8.0000 0.3858 +YCCC 461.675848 3 3.9606 728 | 2/18
24 h-m-p 0.3940 1.9699 1.5487 +YYCYCCC 460.684278 6 1.4005 776 | 2/18
25 h-m-p 0.0190 0.0952 9.2925 CCCCC 460.603107 4 0.0250 805 | 2/18
26 h-m-p 0.0708 0.3538 1.2649 YCYCCC 460.249763 5 0.1593 834 | 2/18
27 h-m-p 0.6125 4.2450 0.3289 YCCC 459.572722 3 0.9642 860 | 2/18
28 h-m-p 1.0589 5.2947 0.1566 CCCCC 459.413225 4 1.3590 905 | 2/18
29 h-m-p 1.6000 8.0000 0.0324 CCC 459.342383 2 2.3883 946 | 2/18
30 h-m-p 1.0567 8.0000 0.0732 CC 459.315126 1 1.0522 985 | 2/18
31 h-m-p 1.6000 8.0000 0.0134 YCC 459.303591 2 1.1842 1025 | 2/18
32 h-m-p 1.5464 8.0000 0.0103 YC 459.300812 1 1.2322 1063 | 2/18
33 h-m-p 1.6000 8.0000 0.0068 YC 459.300052 1 1.0674 1101 | 2/18
34 h-m-p 1.6000 8.0000 0.0012 YC 459.299196 1 3.0085 1139 | 2/18
35 h-m-p 1.6000 8.0000 0.0013 CC 459.298417 1 1.9208 1178 | 2/18
36 h-m-p 1.6000 8.0000 0.0012 C 459.298354 0 1.3856 1215 | 2/18
37 h-m-p 1.6000 8.0000 0.0003 Y 459.298331 0 2.7474 1252 | 2/18
38 h-m-p 1.6000 8.0000 0.0003 C 459.298326 0 1.8942 1289 | 2/18
39 h-m-p 1.3168 8.0000 0.0004 Y 459.298325 0 2.3656 1326 | 2/18
40 h-m-p 1.6000 8.0000 0.0003 C 459.298324 0 2.0577 1363 | 2/18
41 h-m-p 1.2993 8.0000 0.0005 Y 459.298324 0 3.0243 1400 | 2/18
42 h-m-p 1.6000 8.0000 0.0010 ++ 459.298322 m 8.0000 1437 | 2/18
43 h-m-p 0.0631 8.0000 0.1216 ++YC 459.298284 1 2.1742 1477 | 2/18
44 h-m-p 1.3226 6.6128 0.1499 ++ 459.297998 m 6.6128 1514 | 3/18
45 h-m-p 0.4312 8.0000 0.0088 YC 459.297870 1 1.0012 1552 | 3/18
46 h-m-p 1.6000 8.0000 0.0003 Y 459.297870 0 1.0418 1588 | 3/18
47 h-m-p 1.6000 8.0000 0.0000 Y 459.297870 0 1.1128 1624 | 3/18
48 h-m-p 1.6000 8.0000 0.0000 C 459.297870 0 1.4541 1660 | 3/18
49 h-m-p 1.6000 8.0000 0.0000 Y 459.297870 0 1.6000 1696 | 3/18
50 h-m-p 1.6000 8.0000 0.0000 Y 459.297870 0 0.8523 1732 | 3/18
51 h-m-p 1.6000 8.0000 0.0000 Y 459.297870 0 0.4000 1768 | 3/18
52 h-m-p 0.1383 8.0000 0.0000 ----C 459.297870 0 0.0001 1808
Out..
lnL = -459.297870
1809 lfun, 21708 eigenQcodon, 258687 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -473.603755 S = -445.917813 -20.257324
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 44 patterns 2:07
did 20 / 44 patterns 2:07
did 30 / 44 patterns 2:07
did 40 / 44 patterns 2:08
did 44 / 44 patterns 2:08
Time used: 2:08
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=10, Len=82
D_melanogaster_CG15829-PA MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
D_sechellia_CG15829-PA MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
D_simulans_CG15829-PA MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
D_yakuba_CG15829-PA MPTFEEIVEKAKNFKNLPTKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
D_takahashii_CG15829-PA MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
D_biarmipes_CG15829-PA MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
D_eugracilis_CG15829-PA MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
D_ficusphila_CG15829-PA MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
D_rhopaloa_CG15829-PA MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA
D_elegans_CG15829-PA MPTFEEIVEKAKSFKNLPTKEEFLEFYGYYKQATVGDCNIDEPEDEEKKA
************.*****:*********************:*********
D_melanogaster_CG15829-PA RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
D_sechellia_CG15829-PA RYNAWKSKAGLTAEDAKAYYIEVYKKYAPQYE
D_simulans_CG15829-PA RYNAWKSKAGLTAEDAKAYYIEVYKKYAPQYE
D_yakuba_CG15829-PA RYNAWKSKAGLTIDDAKAYYIEVYKKYAAQYE
D_takahashii_CG15829-PA RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
D_biarmipes_CG15829-PA RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
D_eugracilis_CG15829-PA RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
D_ficusphila_CG15829-PA RYNAWKSKAGLTAEDAKKYYIEVYKKYAPQYE
D_rhopaloa_CG15829-PA RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
D_elegans_CG15829-PA RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
************ :*** **********.***
>D_melanogaster_CG15829-PA ATGCCCACCTTTGAGGAGATCGTCGAGAAGGCCAAGAACTTCAAGAACCT GCCTAGCAAGGAGGAGTTCCTCGAGTTCTACGGCTACTACAAGCAGGCCA CCGTCGGCGACTGCAACATCGAGGAGCCGGAAGATGAGGAGAAGAAGGCC CGCTACAACGCCTGGAAGAGCAAGGCCGGTCTGACCGCCGATGATGCCAA GGCCTACTACATCGAGGTCTACAAGAAGTACGCTCCCCAGTACGAA >D_sechellia_CG15829-PA ATGCCCACCTTTGAGGAGATCGTCGAGAAGGCCAAGAACTTCAAGAACCT GCCCAGCAAGGAGGAGTTCCTCGAGTTCTACGGCTACTACAAGCAGGCCA CCGTCGGCGACTGCAACATCGAGGAGCCGGAGGATGAGGAGAAGAAGGCT CGCTACAACGCCTGGAAGAGCAAGGCCGGTCTGACCGCCGAGGATGCCAA GGCCTACTACATCGAGGTCTACAAGAAGTACGCTCCCCAGTACGAA >D_simulans_CG15829-PA ATGCCCACCTTTGAGGAGATCGTCGAGAAGGCCAAGAACTTCAAGAACCT GCCCAGCAAGGAGGAGTTCCTCGAGTTCTACGGCTACTACAAGCAGGCCA CCGTCGGCGACTGCAACATCGAGGAGCCGGAGGATGAGGAGAAGAAGGCC CGCTACAACGCCTGGAAGAGCAAGGCCGGTCTGACCGCCGAGGATGCCAA GGCCTACTACATCGAGGTCTACAAGAAGTACGCTCCCCAGTACGAA >D_yakuba_CG15829-PA ATGCCCACCTTTGAGGAGATCGTCGAGAAGGCCAAGAACTTCAAGAACCT GCCCACCAAGGAGGAGTTCCTCGAGTTCTACGGCTACTACAAGCAGGCCA CCGTCGGCGACTGCAACATCGAGGAGCCGGAGGATGAGGAGAAGAAGGCC CGCTACAACGCCTGGAAGAGCAAGGCCGGTCTGACCATCGACGATGCCAA GGCCTACTACATCGAGGTCTACAAGAAGTACGCTGCCCAGTACGAA >D_takahashii_CG15829-PA ATGCCCACCTTTGAGGAGATCGTCGAGAAGGCCAAGAACTTCAAGAACCT GCCCAGCAAGGAGGAGTTCCTCGAGTTCTACGGCTACTACAAACAGGCCA CCGTCGGCGACTGCAACATCGAGGAGCCGGAGGATGAGGAGAAGAAGGCC CGCTACAATGCCTGGAAGAGCAAGGCCGGTCTGACCGCCGATGATGCCAA GGCCTACTACATCGAGGTCTACAAGAAGTACGCTCCCCAGTACGAA >D_biarmipes_CG15829-PA ATGCCCACCTTTGAGGAGATCGTCGAGAAGGCCAAGAACTTCAAGAACCT GCCCAGCAAGGAGGAGTTCCTCGAGTTCTACGGCTACTACAAGCAGGCCA CCGTGGGCGACTGCAACATCGAGGAGCCGGAGGATGAGGAGAAGAAGGCC CGCTACAACGCCTGGAAGAGCAAGGCCGGTCTGACCGCCGACGATGCCAA GGCTTACTACATCGAGGTCTACAAGAAGTACGCTCCCCAGTACGAA >D_eugracilis_CG15829-PA ATGCCCACCTTTGAGGAGATTGTCGAGAAGGCCAAGAACTTCAAGAACCT GCCCAGCAAGGAGGAGTTCCTCGAGTTCTACGGCTACTACAAGCAGGCCA CCGTTGGTGACTGCAACATCGAGGAGCCAGAGGATGAGGAGAAGAAGGCC CGCTACAATGCCTGGAAGAGCAAGGCCGGTCTGACCGCCGATGATGCCAA GGCCTACTACATCGAGGTCTACAAGAAGTACGCTCCCCAGTACGAA >D_ficusphila_CG15829-PA ATGCCCACCTTTGAAGAGATCGTCGAGAAGGCCAAGAACTTCAAGAACCT GCCCTCCAAGGAGGAGTTCCTCGAGTTCTACGGCTACTACAAGCAGGCCA CCGTTGGCGATTGCAACATCGAGGAGCCGGAGGACGAGGAGAAGAAGGCC CGCTACAATGCCTGGAAGAGCAAGGCCGGTCTGACCGCCGAGGATGCCAA GAAGTACTACATCGAGGTCTACAAGAAGTACGCTCCCCAGTACGAA >D_rhopaloa_CG15829-PA ATGCCCACCTTTGAGGAGATCGTCGAGAAGGCCAAGAACTTCAAGAACCT GCCCTCCAAGGAGGAGTTCCTCGAGTTCTACGGCTACTACAAGCAGGCCA CCGTCGGCGACTGCAACATCGAGGAGCCGGAGGACGAGGAGAAGAAGGCC CGCTACAATGCGTGGAAGAGCAAGGCCGGTCTGACCGCCGACGATGCCAA GGCCTACTACATCGAGGTCTACAAGAAGTACGCTCCCCAGTACGAA >D_elegans_CG15829-PA ATGCCCACCTTTGAGGAGATCGTCGAGAAGGCCAAGAGCTTCAAGAACCT GCCCACCAAGGAGGAGTTCCTCGAGTTCTACGGCTACTACAAGCAGGCCA CCGTCGGCGACTGCAACATCGATGAGCCGGAGGACGAGGAGAAGAAGGCC CGCTACAATGCCTGGAAGAGCAAGGCCGGTCTGACCGCCGACGATGCCAA GGCCTACTACATCGAGGTCTACAAGAAGTACGCTCCCCAGTACGAA
>D_melanogaster_CG15829-PA MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE >D_sechellia_CG15829-PA MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA RYNAWKSKAGLTAEDAKAYYIEVYKKYAPQYE >D_simulans_CG15829-PA MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA RYNAWKSKAGLTAEDAKAYYIEVYKKYAPQYE >D_yakuba_CG15829-PA MPTFEEIVEKAKNFKNLPTKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA RYNAWKSKAGLTIDDAKAYYIEVYKKYAAQYE >D_takahashii_CG15829-PA MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE >D_biarmipes_CG15829-PA MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE >D_eugracilis_CG15829-PA MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE >D_ficusphila_CG15829-PA MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA RYNAWKSKAGLTAEDAKKYYIEVYKKYAPQYE >D_rhopaloa_CG15829-PA MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKA RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE >D_elegans_CG15829-PA MPTFEEIVEKAKSFKNLPTKEEFLEFYGYYKQATVGDCNIDEPEDEEKKA RYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE
#NEXUS
[ID: 6980945902]
begin taxa;
dimensions ntax=10;
taxlabels
D_melanogaster_CG15829-PA
D_sechellia_CG15829-PA
D_simulans_CG15829-PA
D_yakuba_CG15829-PA
D_takahashii_CG15829-PA
D_biarmipes_CG15829-PA
D_eugracilis_CG15829-PA
D_ficusphila_CG15829-PA
D_rhopaloa_CG15829-PA
D_elegans_CG15829-PA
;
end;
begin trees;
translate
1 D_melanogaster_CG15829-PA,
2 D_sechellia_CG15829-PA,
3 D_simulans_CG15829-PA,
4 D_yakuba_CG15829-PA,
5 D_takahashii_CG15829-PA,
6 D_biarmipes_CG15829-PA,
7 D_eugracilis_CG15829-PA,
8 D_ficusphila_CG15829-PA,
9 D_rhopaloa_CG15829-PA,
10 D_elegans_CG15829-PA
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.03342807,4:0.06601496,5:0.02116372,6:0.03740947,7:0.05126548,(2:0.01818359,3:0.01028092)0.683:0.02083392,((8:0.1413851,9:0.02933353)0.573:0.03095326,10:0.04286583)0.619:0.03609731);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.03342807,4:0.06601496,5:0.02116372,6:0.03740947,7:0.05126548,(2:0.01818359,3:0.01028092):0.02083392,((8:0.1413851,9:0.02933353):0.03095326,10:0.04286583):0.03609731);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/85/CG15829-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/85/CG15829-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/85/CG15829-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -531.58 -552.49
2 -531.63 -553.18
--------------------------------------
TOTAL -531.60 -552.89
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/85/CG15829-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/85/CG15829-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/85/CG15829-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.746025 0.086223 0.282839 1.332027 0.691944 729.47 778.93 1.000
r(A<->C){all} 0.016801 0.000332 0.000001 0.052564 0.010866 812.33 829.78 1.000
r(A<->G){all} 0.143191 0.014017 0.009679 0.399299 0.105011 269.55 291.32 1.003
r(A<->T){all} 0.098938 0.008971 0.000024 0.290434 0.070173 177.09 192.42 1.000
r(C<->G){all} 0.046308 0.001258 0.000001 0.113571 0.038388 321.32 440.32 1.000
r(C<->T){all} 0.595002 0.033495 0.264043 0.914290 0.610883 131.33 188.33 1.000
r(G<->T){all} 0.099762 0.005429 0.000171 0.240737 0.081829 259.85 320.37 1.000
pi(A){all} 0.274094 0.000750 0.224018 0.330308 0.273607 978.39 1009.85 1.001
pi(C){all} 0.299995 0.000833 0.245800 0.356319 0.299186 1157.32 1193.05 1.000
pi(G){all} 0.287220 0.000800 0.232026 0.341683 0.286438 1254.78 1269.64 1.001
pi(T){all} 0.138690 0.000466 0.098836 0.181435 0.137597 500.84 726.50 1.000
alpha{1,2} 0.139888 0.009491 0.000496 0.305965 0.126651 747.88 757.04 1.001
alpha{3} 0.883340 0.276789 0.162795 1.944694 0.765161 1085.35 1187.91 1.000
pinvar{all} 0.644240 0.013961 0.410498 0.832324 0.667211 512.35 513.34 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/85/CG15829-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 10 ls = 82
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 3 3 3 3 3 3 | TCC 0 0 0 0 0 0 | TAC 9 9 9 9 9 9 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 0 0 | TCG 0 0 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 1 0 0 0 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 0 0 0 0 0 0
CTC 1 1 1 1 1 1 | CCC 2 3 3 2 3 3 | CAC 0 0 0 0 0 0 | CGC 1 1 1 1 1 1
CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 0 0 0 0 0 0 | CGA 0 0 0 0 0 0
CTG 2 2 2 2 2 2 | CCG 1 1 1 1 1 1 | CAG 2 2 2 2 2 2 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 0 0 0 0 0 0 | Asn AAT 0 0 0 0 1 0 | Ser AGT 0 0 0 0 0 0
ATC 3 3 3 4 3 3 | ACC 3 3 3 4 3 3 | AAC 4 4 4 4 3 4 | AGC 2 2 2 1 2 2
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 0 0 0 0 1 0 | Arg AGA 0 0 0 0 0 0
Met ATG 1 1 1 1 1 1 | ACG 0 0 0 0 0 0 | AAG 12 12 12 12 11 12 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 1 2 1 1 1 2 | Asp GAT 3 2 2 2 3 2 | Gly GGT 1 1 1 1 1 1
GTC 3 3 3 3 3 2 | GCC 8 7 8 8 8 7 | GAC 1 1 1 2 1 2 | GGC 2 2 2 2 2 2
GTA 0 0 0 0 0 0 | GCA 0 0 0 0 0 0 | Glu GAA 2 1 1 1 1 1 | GGA 0 0 0 0 0 0
GTG 0 0 0 0 0 1 | GCG 0 0 0 0 0 0 | GAG 11 13 13 12 12 12 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 | Ser TCT 0 0 0 0 | Tyr TAT 0 0 0 0 | Cys TGT 0 0 0 0
TTC 3 3 3 3 | TCC 0 1 1 0 | TAC 9 9 9 9 | TGC 1 1 1 1
Leu TTA 0 0 0 0 | TCA 0 0 0 0 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0
TTG 0 0 0 0 | TCG 0 0 0 0 | TAG 0 0 0 0 | Trp TGG 1 1 1 1
------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 | Pro CCT 0 0 0 0 | His CAT 0 0 0 0 | Arg CGT 0 0 0 0
CTC 1 1 1 1 | CCC 3 3 3 3 | CAC 0 0 0 0 | CGC 1 1 1 1
CTA 0 0 0 0 | CCA 1 0 0 0 | Gln CAA 0 0 0 0 | CGA 0 0 0 0
CTG 2 2 2 2 | CCG 0 1 1 1 | CAG 2 2 2 2 | CGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Ile ATT 1 0 0 0 | Thr ACT 0 0 0 0 | Asn AAT 1 1 1 1 | Ser AGT 0 0 0 0
ATC 2 3 3 3 | ACC 3 3 3 4 | AAC 3 3 3 2 | AGC 2 1 1 2
ATA 0 0 0 0 | ACA 0 0 0 0 | Lys AAA 0 0 0 0 | Arg AGA 0 0 0 0
Met ATG 1 1 1 1 | ACG 0 0 0 0 | AAG 12 13 12 12 | AGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Val GTT 1 1 0 0 | Ala GCT 1 1 1 1 | Asp GAT 3 2 1 2 | Gly GGT 2 1 1 1
GTC 2 2 3 3 | GCC 8 7 7 8 | GAC 1 1 3 3 | GGC 1 2 2 2
GTA 0 0 0 0 | GCA 0 0 0 0 | Glu GAA 1 2 1 1 | GGA 0 0 0 0
GTG 0 0 0 0 | GCG 0 0 1 0 | GAG 12 12 12 11 | GGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_CG15829-PA
position 1: T:0.18293 C:0.12195 A:0.30488 G:0.39024
position 2: T:0.17073 C:0.19512 A:0.53659 G:0.09756
position 3: T:0.08537 C:0.52439 A:0.02439 G:0.36585
Average T:0.14634 C:0.28049 A:0.28862 G:0.28455
#2: D_sechellia_CG15829-PA
position 1: T:0.18293 C:0.12195 A:0.30488 G:0.39024
position 2: T:0.17073 C:0.19512 A:0.53659 G:0.09756
position 3: T:0.07317 C:0.52439 A:0.01220 G:0.39024
Average T:0.14228 C:0.28049 A:0.28455 G:0.29268
#3: D_simulans_CG15829-PA
position 1: T:0.18293 C:0.12195 A:0.30488 G:0.39024
position 2: T:0.17073 C:0.19512 A:0.53659 G:0.09756
position 3: T:0.06098 C:0.53659 A:0.01220 G:0.39024
Average T:0.13821 C:0.28455 A:0.28455 G:0.29268
#4: D_yakuba_CG15829-PA
position 1: T:0.18293 C:0.10976 A:0.31707 G:0.39024
position 2: T:0.18293 C:0.19512 A:0.53659 G:0.08537
position 3: T:0.06098 C:0.54878 A:0.01220 G:0.37805
Average T:0.14228 C:0.28455 A:0.28862 G:0.28455
#5: D_takahashii_CG15829-PA
position 1: T:0.18293 C:0.12195 A:0.30488 G:0.39024
position 2: T:0.17073 C:0.19512 A:0.53659 G:0.09756
position 3: T:0.08537 C:0.52439 A:0.02439 G:0.36585
Average T:0.14634 C:0.28049 A:0.28862 G:0.28455
#6: D_biarmipes_CG15829-PA
position 1: T:0.18293 C:0.12195 A:0.30488 G:0.39024
position 2: T:0.17073 C:0.19512 A:0.53659 G:0.09756
position 3: T:0.07317 C:0.52439 A:0.01220 G:0.39024
Average T:0.14228 C:0.28049 A:0.28455 G:0.29268
#7: D_eugracilis_CG15829-PA
position 1: T:0.18293 C:0.12195 A:0.30488 G:0.39024
position 2: T:0.17073 C:0.19512 A:0.53659 G:0.09756
position 3: T:0.12195 C:0.48780 A:0.02439 G:0.36585
Average T:0.15854 C:0.26829 A:0.28862 G:0.28455
#8: D_ficusphila_CG15829-PA
position 1: T:0.19512 C:0.12195 A:0.30488 G:0.37805
position 2: T:0.17073 C:0.19512 A:0.54878 G:0.08537
position 3: T:0.08537 C:0.50000 A:0.02439 G:0.39024
Average T:0.15041 C:0.27236 A:0.29268 G:0.28455
#9: D_rhopaloa_CG15829-PA
position 1: T:0.19512 C:0.12195 A:0.29268 G:0.39024
position 2: T:0.17073 C:0.20732 A:0.53659 G:0.08537
position 3: T:0.06098 C:0.53659 A:0.01220 G:0.39024
Average T:0.14228 C:0.28862 A:0.28049 G:0.28862
#10: D_elegans_CG15829-PA
position 1: T:0.18293 C:0.12195 A:0.30488 G:0.39024
position 2: T:0.17073 C:0.20732 A:0.52439 G:0.09756
position 3: T:0.07317 C:0.54878 A:0.01220 G:0.36585
Average T:0.14228 C:0.29268 A:0.28049 G:0.28455
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 10 | Ser S TCT 0 | Tyr Y TAT 0 | Cys C TGT 0
TTC 30 | TCC 2 | TAC 90 | TGC 10
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 0 | TCG 0 | TAG 0 | Trp W TGG 10
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 1 | His H CAT 0 | Arg R CGT 0
CTC 10 | CCC 28 | CAC 0 | CGC 10
CTA 0 | CCA 1 | Gln Q CAA 0 | CGA 0
CTG 20 | CCG 9 | CAG 20 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 1 | Thr T ACT 0 | Asn N AAT 5 | Ser S AGT 0
ATC 30 | ACC 32 | AAC 34 | AGC 17
ATA 0 | ACA 0 | Lys K AAA 1 | Arg R AGA 0
Met M ATG 10 | ACG 0 | AAG 120 | AGG 0
------------------------------------------------------------------------------
Val V GTT 2 | Ala A GCT 12 | Asp D GAT 22 | Gly G GGT 11
GTC 27 | GCC 76 | GAC 16 | GGC 19
GTA 0 | GCA 0 | Glu E GAA 12 | GGA 0
GTG 1 | GCG 1 | GAG 120 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.18537 C:0.12073 A:0.30488 G:0.38902
position 2: T:0.17195 C:0.19756 A:0.53659 G:0.09390
position 3: T:0.07805 C:0.52561 A:0.01707 G:0.37927
Average T:0.14512 C:0.28130 A:0.28618 G:0.28740
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_CG15829-PA
D_sechellia_CG15829-PA 0.0795 (0.0051 0.0640)
D_simulans_CG15829-PA 0.1210 (0.0051 0.0421)-1.0000 (0.0000 0.0207)
D_yakuba_CG15829-PA 0.3225 (0.0206 0.0638) 1.2497 (0.0258 0.0207)-1.0000 (0.0258 0.0000)
D_takahashii_CG15829-PA -1.0000 (0.0000 0.0867) 0.0795 (0.0051 0.0640) 0.1210 (0.0051 0.0421) 0.3225 (0.0206 0.0638)
D_biarmipes_CG15829-PA -1.0000 (0.0000 0.1101) 0.0795 (0.0051 0.0640) 0.1210 (0.0051 0.0421) 0.4907 (0.0206 0.0419)-1.0000 (0.0000 0.1101)
D_eugracilis_CG15829-PA -1.0000 (0.0000 0.1590) 0.0380 (0.0051 0.1340) 0.0463 (0.0051 0.1100) 0.1541 (0.0206 0.1336)-1.0000 (0.0000 0.1101)-1.0000 (0.0000 0.1590)
D_ficusphila_CG15829-PA 0.1658 (0.0284 0.1715) 0.1587 (0.0232 0.1461) 0.1905 (0.0232 0.1217) 0.3222 (0.0391 0.1213) 0.2335 (0.0284 0.1218) 0.2335 (0.0284 0.1218) 0.1944 (0.0284 0.1463)
D_rhopaloa_CG15829-PA 0.0769 (0.0102 0.1331) 0.1791 (0.0154 0.0860) 0.2424 (0.0154 0.0635) 0.3255 (0.0206 0.0634) 0.1189 (0.0102 0.0861) 0.0937 (0.0102 0.1092) 0.0649 (0.0102 0.1578) 0.1849 (0.0180 0.0974)
D_elegans_CG15829-PA 0.1409 (0.0154 0.1093) 0.3240 (0.0206 0.0636) 0.4930 (0.0206 0.0418) 0.6207 (0.0259 0.0417) 0.2419 (0.0154 0.0636) 0.1788 (0.0154 0.0861) 0.1156 (0.0154 0.1332) 0.4524 (0.0338 0.0747) 0.7536 (0.0154 0.0205)
Model 0: one-ratio
TREE # 1: (1, 4, 5, 6, 7, (2, 3), ((8, 9), 10)); MP score: 31
lnL(ntime: 13 np: 15): -467.870452 +0.000000
11..1 11..4 11..5 11..6 11..7 11..12 12..2 12..3 11..13 13..14 14..8 14..9 13..10
0.038241 0.083960 0.013158 0.054072 0.052393 0.027423 0.014012 0.000004 0.039360 0.017412 0.103324 0.014209 0.031320 2.547900 0.052026
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.48889
(1: 0.038241, 4: 0.083960, 5: 0.013158, 6: 0.054072, 7: 0.052393, (2: 0.014012, 3: 0.000004): 0.027423, ((8: 0.103324, 9: 0.014209): 0.017412, 10: 0.031320): 0.039360);
(D_melanogaster_CG15829-PA: 0.038241, D_yakuba_CG15829-PA: 0.083960, D_takahashii_CG15829-PA: 0.013158, D_biarmipes_CG15829-PA: 0.054072, D_eugracilis_CG15829-PA: 0.052393, (D_sechellia_CG15829-PA: 0.014012, D_simulans_CG15829-PA: 0.000004): 0.027423, ((D_ficusphila_CG15829-PA: 0.103324, D_rhopaloa_CG15829-PA: 0.014209): 0.017412, D_elegans_CG15829-PA: 0.031320): 0.039360);
Detailed output identifying parameters
kappa (ts/tv) = 2.54790
omega (dN/dS) = 0.05203
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.038 221.2 24.8 0.0520 0.0045 0.0863 1.0 2.1
11..4 0.084 221.2 24.8 0.0520 0.0099 0.1895 2.2 4.7
11..5 0.013 221.2 24.8 0.0520 0.0015 0.0297 0.3 0.7
11..6 0.054 221.2 24.8 0.0520 0.0064 0.1221 1.4 3.0
11..7 0.052 221.2 24.8 0.0520 0.0062 0.1183 1.4 2.9
11..12 0.027 221.2 24.8 0.0520 0.0032 0.0619 0.7 1.5
12..2 0.014 221.2 24.8 0.0520 0.0016 0.0316 0.4 0.8
12..3 0.000 221.2 24.8 0.0520 0.0000 0.0000 0.0 0.0
11..13 0.039 221.2 24.8 0.0520 0.0046 0.0889 1.0 2.2
13..14 0.017 221.2 24.8 0.0520 0.0020 0.0393 0.5 1.0
14..8 0.103 221.2 24.8 0.0520 0.0121 0.2333 2.7 5.8
14..9 0.014 221.2 24.8 0.0520 0.0017 0.0321 0.4 0.8
13..10 0.031 221.2 24.8 0.0520 0.0037 0.0707 0.8 1.8
tree length for dN: 0.0574
tree length for dS: 1.1037
Time used: 0:05
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 4, 5, 6, 7, (2, 3), ((8, 9), 10)); MP score: 31
lnL(ntime: 13 np: 16): -459.638409 +0.000000
11..1 11..4 11..5 11..6 11..7 11..12 12..2 12..3 11..13 13..14 14..8 14..9 13..10
0.039740 0.089417 0.013687 0.056314 0.054679 0.027453 0.013698 0.000004 0.042026 0.016672 0.107156 0.015304 0.031310 2.784930 0.928877 0.010358
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.50746
(1: 0.039740, 4: 0.089417, 5: 0.013687, 6: 0.056314, 7: 0.054679, (2: 0.013698, 3: 0.000004): 0.027453, ((8: 0.107156, 9: 0.015304): 0.016672, 10: 0.031310): 0.042026);
(D_melanogaster_CG15829-PA: 0.039740, D_yakuba_CG15829-PA: 0.089417, D_takahashii_CG15829-PA: 0.013687, D_biarmipes_CG15829-PA: 0.056314, D_eugracilis_CG15829-PA: 0.054679, (D_sechellia_CG15829-PA: 0.013698, D_simulans_CG15829-PA: 0.000004): 0.027453, ((D_ficusphila_CG15829-PA: 0.107156, D_rhopaloa_CG15829-PA: 0.015304): 0.016672, D_elegans_CG15829-PA: 0.031310): 0.042026);
Detailed output identifying parameters
kappa (ts/tv) = 2.78493
dN/dS (w) for site classes (K=2)
p: 0.92888 0.07112
w: 0.01036 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.040 220.7 25.3 0.0807 0.0061 0.0756 1.3 1.9
11..4 0.089 220.7 25.3 0.0807 0.0137 0.1701 3.0 4.3
11..5 0.014 220.7 25.3 0.0807 0.0021 0.0260 0.5 0.7
11..6 0.056 220.7 25.3 0.0807 0.0087 0.1071 1.9 2.7
11..7 0.055 220.7 25.3 0.0807 0.0084 0.1040 1.9 2.6
11..12 0.027 220.7 25.3 0.0807 0.0042 0.0522 0.9 1.3
12..2 0.014 220.7 25.3 0.0807 0.0021 0.0261 0.5 0.7
12..3 0.000 220.7 25.3 0.0807 0.0000 0.0000 0.0 0.0
11..13 0.042 220.7 25.3 0.0807 0.0065 0.0800 1.4 2.0
13..14 0.017 220.7 25.3 0.0807 0.0026 0.0317 0.6 0.8
14..8 0.107 220.7 25.3 0.0807 0.0165 0.2039 3.6 5.2
14..9 0.015 220.7 25.3 0.0807 0.0024 0.0291 0.5 0.7
13..10 0.031 220.7 25.3 0.0807 0.0048 0.0596 1.1 1.5
Time used: 0:13
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 4, 5, 6, 7, (2, 3), ((8, 9), 10)); MP score: 31
lnL(ntime: 13 np: 18): -459.638409 +0.000000
11..1 11..4 11..5 11..6 11..7 11..12 12..2 12..3 11..13 13..14 14..8 14..9 13..10
0.039740 0.089417 0.013687 0.056314 0.054679 0.027453 0.013697 0.000004 0.042026 0.016672 0.107156 0.015304 0.031310 2.784930 0.928877 0.043275 0.010358 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.50746
(1: 0.039740, 4: 0.089417, 5: 0.013687, 6: 0.056314, 7: 0.054679, (2: 0.013697, 3: 0.000004): 0.027453, ((8: 0.107156, 9: 0.015304): 0.016672, 10: 0.031310): 0.042026);
(D_melanogaster_CG15829-PA: 0.039740, D_yakuba_CG15829-PA: 0.089417, D_takahashii_CG15829-PA: 0.013687, D_biarmipes_CG15829-PA: 0.056314, D_eugracilis_CG15829-PA: 0.054679, (D_sechellia_CG15829-PA: 0.013697, D_simulans_CG15829-PA: 0.000004): 0.027453, ((D_ficusphila_CG15829-PA: 0.107156, D_rhopaloa_CG15829-PA: 0.015304): 0.016672, D_elegans_CG15829-PA: 0.031310): 0.042026);
Detailed output identifying parameters
kappa (ts/tv) = 2.78493
dN/dS (w) for site classes (K=3)
p: 0.92888 0.04327 0.02785
w: 0.01036 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.040 220.7 25.3 0.0807 0.0061 0.0756 1.3 1.9
11..4 0.089 220.7 25.3 0.0807 0.0137 0.1701 3.0 4.3
11..5 0.014 220.7 25.3 0.0807 0.0021 0.0260 0.5 0.7
11..6 0.056 220.7 25.3 0.0807 0.0087 0.1071 1.9 2.7
11..7 0.055 220.7 25.3 0.0807 0.0084 0.1040 1.9 2.6
11..12 0.027 220.7 25.3 0.0807 0.0042 0.0522 0.9 1.3
12..2 0.014 220.7 25.3 0.0807 0.0021 0.0261 0.5 0.7
12..3 0.000 220.7 25.3 0.0807 0.0000 0.0000 0.0 0.0
11..13 0.042 220.7 25.3 0.0807 0.0065 0.0800 1.4 2.0
13..14 0.017 220.7 25.3 0.0807 0.0026 0.0317 0.6 0.8
14..8 0.107 220.7 25.3 0.0807 0.0165 0.2039 3.6 5.2
14..9 0.015 220.7 25.3 0.0807 0.0024 0.0291 0.5 0.7
13..10 0.031 220.7 25.3 0.0807 0.0048 0.0596 1.1 1.5
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG15829-PA)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.463 0.152 0.073 0.052 0.046 0.044 0.043 0.043 0.042 0.042
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.050
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.004 0.065 0.879
sum of density on p0-p1 = 1.000000
Time used: 0:24
Model 3: discrete (3 categories)
TREE # 1: (1, 4, 5, 6, 7, (2, 3), ((8, 9), 10)); MP score: 31
lnL(ntime: 13 np: 19): -459.271559 +0.000000
11..1 11..4 11..5 11..6 11..7 11..12 12..2 12..3 11..13 13..14 14..8 14..9 13..10
0.039245 0.087904 0.013465 0.055634 0.053857 0.027528 0.013834 0.000004 0.041369 0.017460 0.106395 0.014864 0.031295 2.586805 0.381129 0.526435 0.005567 0.005568 0.610824
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.50285
(1: 0.039245, 4: 0.087904, 5: 0.013465, 6: 0.055634, 7: 0.053857, (2: 0.013834, 3: 0.000004): 0.027528, ((8: 0.106395, 9: 0.014864): 0.017460, 10: 0.031295): 0.041369);
(D_melanogaster_CG15829-PA: 0.039245, D_yakuba_CG15829-PA: 0.087904, D_takahashii_CG15829-PA: 0.013465, D_biarmipes_CG15829-PA: 0.055634, D_eugracilis_CG15829-PA: 0.053857, (D_sechellia_CG15829-PA: 0.013834, D_simulans_CG15829-PA: 0.000004): 0.027528, ((D_ficusphila_CG15829-PA: 0.106395, D_rhopaloa_CG15829-PA: 0.014864): 0.017460, D_elegans_CG15829-PA: 0.031295): 0.041369);
Detailed output identifying parameters
kappa (ts/tv) = 2.58680
dN/dS (w) for site classes (K=3)
p: 0.38113 0.52643 0.09244
w: 0.00557 0.00557 0.61082
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.039 221.1 24.9 0.0615 0.0051 0.0836 1.1 2.1
11..4 0.088 221.1 24.9 0.0615 0.0115 0.1872 2.5 4.7
11..5 0.013 221.1 24.9 0.0615 0.0018 0.0287 0.4 0.7
11..6 0.056 221.1 24.9 0.0615 0.0073 0.1185 1.6 3.0
11..7 0.054 221.1 24.9 0.0615 0.0071 0.1147 1.6 2.9
11..12 0.028 221.1 24.9 0.0615 0.0036 0.0586 0.8 1.5
12..2 0.014 221.1 24.9 0.0615 0.0018 0.0295 0.4 0.7
12..3 0.000 221.1 24.9 0.0615 0.0000 0.0000 0.0 0.0
11..13 0.041 221.1 24.9 0.0615 0.0054 0.0881 1.2 2.2
13..14 0.017 221.1 24.9 0.0615 0.0023 0.0372 0.5 0.9
14..8 0.106 221.1 24.9 0.0615 0.0139 0.2266 3.1 5.6
14..9 0.015 221.1 24.9 0.0615 0.0019 0.0317 0.4 0.8
13..10 0.031 221.1 24.9 0.0615 0.0041 0.0667 0.9 1.7
Naive Empirical Bayes (NEB) analysis
Time used: 0:34
Model 7: beta (10 categories)
TREE # 1: (1, 4, 5, 6, 7, (2, 3), ((8, 9), 10)); MP score: 31
lnL(ntime: 13 np: 16): -459.297810 +0.000000
11..1 11..4 11..5 11..6 11..7 11..12 12..2 12..3 11..13 13..14 14..8 14..9 13..10
0.039215 0.087804 0.013459 0.055600 0.053822 0.027547 0.013862 0.000004 0.041482 0.017654 0.106474 0.014825 0.031258 2.581685 0.037493 0.543323
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.50300
(1: 0.039215, 4: 0.087804, 5: 0.013459, 6: 0.055600, 7: 0.053822, (2: 0.013862, 3: 0.000004): 0.027547, ((8: 0.106474, 9: 0.014825): 0.017654, 10: 0.031258): 0.041482);
(D_melanogaster_CG15829-PA: 0.039215, D_yakuba_CG15829-PA: 0.087804, D_takahashii_CG15829-PA: 0.013459, D_biarmipes_CG15829-PA: 0.055600, D_eugracilis_CG15829-PA: 0.053822, (D_sechellia_CG15829-PA: 0.013862, D_simulans_CG15829-PA: 0.000004): 0.027547, ((D_ficusphila_CG15829-PA: 0.106474, D_rhopaloa_CG15829-PA: 0.014825): 0.017654, D_elegans_CG15829-PA: 0.031258): 0.041482);
Detailed output identifying parameters
kappa (ts/tv) = 2.58168
Parameters in M7 (beta):
p = 0.03749 q = 0.54332
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003 0.00145 0.04025 0.57189
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.039 221.1 24.9 0.0614 0.0051 0.0836 1.1 2.1
11..4 0.088 221.1 24.9 0.0614 0.0115 0.1872 2.5 4.7
11..5 0.013 221.1 24.9 0.0614 0.0018 0.0287 0.4 0.7
11..6 0.056 221.1 24.9 0.0614 0.0073 0.1186 1.6 3.0
11..7 0.054 221.1 24.9 0.0614 0.0070 0.1148 1.6 2.9
11..12 0.028 221.1 24.9 0.0614 0.0036 0.0587 0.8 1.5
12..2 0.014 221.1 24.9 0.0614 0.0018 0.0296 0.4 0.7
12..3 0.000 221.1 24.9 0.0614 0.0000 0.0000 0.0 0.0
11..13 0.041 221.1 24.9 0.0614 0.0054 0.0885 1.2 2.2
13..14 0.018 221.1 24.9 0.0614 0.0023 0.0376 0.5 0.9
14..8 0.106 221.1 24.9 0.0614 0.0139 0.2271 3.1 5.7
14..9 0.015 221.1 24.9 0.0614 0.0019 0.0316 0.4 0.8
13..10 0.031 221.1 24.9 0.0614 0.0041 0.0667 0.9 1.7
Time used: 1:16
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 4, 5, 6, 7, (2, 3), ((8, 9), 10)); MP score: 31
lnL(ntime: 13 np: 18): -459.297870 +0.000000
11..1 11..4 11..5 11..6 11..7 11..12 12..2 12..3 11..13 13..14 14..8 14..9 13..10
0.039215 0.087804 0.013459 0.055600 0.053822 0.027547 0.013862 0.000004 0.041482 0.017654 0.106475 0.014825 0.031258 2.581711 0.999990 0.037492 0.543343 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.50301
(1: 0.039215, 4: 0.087804, 5: 0.013459, 6: 0.055600, 7: 0.053822, (2: 0.013862, 3: 0.000004): 0.027547, ((8: 0.106475, 9: 0.014825): 0.017654, 10: 0.031258): 0.041482);
(D_melanogaster_CG15829-PA: 0.039215, D_yakuba_CG15829-PA: 0.087804, D_takahashii_CG15829-PA: 0.013459, D_biarmipes_CG15829-PA: 0.055600, D_eugracilis_CG15829-PA: 0.053822, (D_sechellia_CG15829-PA: 0.013862, D_simulans_CG15829-PA: 0.000004): 0.027547, ((D_ficusphila_CG15829-PA: 0.106475, D_rhopaloa_CG15829-PA: 0.014825): 0.017654, D_elegans_CG15829-PA: 0.031258): 0.041482);
Detailed output identifying parameters
kappa (ts/tv) = 2.58171
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.03749 q = 0.54334
(p1 = 0.00001) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003 0.00145 0.04024 0.57185 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.039 221.1 24.9 0.0614 0.0051 0.0836 1.1 2.1
11..4 0.088 221.1 24.9 0.0614 0.0115 0.1872 2.5 4.7
11..5 0.013 221.1 24.9 0.0614 0.0018 0.0287 0.4 0.7
11..6 0.056 221.1 24.9 0.0614 0.0073 0.1186 1.6 3.0
11..7 0.054 221.1 24.9 0.0614 0.0070 0.1148 1.6 2.9
11..12 0.028 221.1 24.9 0.0614 0.0036 0.0587 0.8 1.5
12..2 0.014 221.1 24.9 0.0614 0.0018 0.0296 0.4 0.7
12..3 0.000 221.1 24.9 0.0614 0.0000 0.0000 0.0 0.0
11..13 0.041 221.1 24.9 0.0614 0.0054 0.0885 1.2 2.2
13..14 0.018 221.1 24.9 0.0614 0.0023 0.0376 0.5 0.9
14..8 0.106 221.1 24.9 0.0614 0.0139 0.2271 3.1 5.6
14..9 0.015 221.1 24.9 0.0614 0.0019 0.0316 0.4 0.8
13..10 0.031 221.1 24.9 0.0614 0.0041 0.0667 0.9 1.7
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG15829-PA)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.998
p : 0.999 0.001 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.001 0.009 0.034 0.077 0.132 0.191 0.250 0.306
ws: 0.488 0.139 0.067 0.049 0.045 0.043 0.043 0.042 0.042 0.042
Time used: 2:08
Model 1: NearlyNeutral -459.638409 Model 2: PositiveSelection -459.638409 Model 0: one-ratio -467.870452 Model 3: discrete -459.271559 Model 7: beta -459.29781 Model 8: beta&w>1 -459.29787 Model 0 vs 1 16.464085999999952 Model 2 vs 1 0.0 Model 8 vs 7 1.199999999244028E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
