--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Mon Nov 28 23:07:36 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/7/Alg-2-PC/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/7/Alg-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/7/Alg-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/7/Alg-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1243.45 -1253.18
2 -1243.74 -1258.65
--------------------------------------
TOTAL -1243.59 -1257.96
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/7/Alg-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/7/Alg-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/7/Alg-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.615231 0.012892 0.408317 0.841728 0.604583 1356.39 1384.61 1.000
r(A<->C){all} 0.043336 0.000627 0.000310 0.091831 0.039286 830.48 845.41 1.000
r(A<->G){all} 0.270607 0.004223 0.148932 0.398514 0.266191 467.13 746.26 1.001
r(A<->T){all} 0.043400 0.000347 0.012888 0.082716 0.040954 722.99 870.52 1.001
r(C<->G){all} 0.084503 0.001450 0.015533 0.157855 0.080820 800.06 810.26 1.000
r(C<->T){all} 0.520530 0.005577 0.377215 0.664500 0.520673 452.96 708.14 1.000
r(G<->T){all} 0.037624 0.000495 0.000064 0.077993 0.034095 784.56 895.16 1.000
pi(A){all} 0.288147 0.000334 0.252354 0.324943 0.287981 1365.12 1377.64 1.000
pi(C){all} 0.181552 0.000236 0.151278 0.211208 0.181175 1248.24 1316.58 1.000
pi(G){all} 0.213868 0.000275 0.184128 0.247905 0.213722 1115.31 1258.33 1.000
pi(T){all} 0.316434 0.000355 0.278722 0.352112 0.316362 1127.60 1227.03 1.000
alpha{1,2} 0.059305 0.001297 0.000123 0.119659 0.058981 1054.12 1107.56 1.000
alpha{3} 2.134053 0.623356 0.895858 3.731421 2.008896 1219.85 1360.42 1.000
pinvar{all} 0.383823 0.006769 0.219542 0.536139 0.390131 1230.08 1339.94 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1173.497185
Model 2: PositiveSelection -1173.497185
Model 0: one-ratio -1178.199548
Model 3: discrete -1171.792542
Model 7: beta -1172.041339
Model 8: beta&w>1 -1172.041468
Model 0 vs 1 9.40472600000021
Model 2 vs 1 0.0
Model 8 vs 7 2.579999995759863E-4
>C1
MAYNHDGMPDQQFLWDVFQRVDKDRSGHISADELQVALSNGTWSAFNPET
IRLMIGMFDRENKGTVSFKDFGALWKYVTDWQNCFRSFDRDNSGNIDKTE
LKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
FRQHDTDLDGIITIHYEQFLSMVFSLKI
>C2
MAYNHDGMPDQQFLWDVFQRVDKDKSGHISADELQVALSNGTWSAFNPET
IRLMIGMFDRENKGTVSFKDFGALWKYVTDWQNCFRSFDCDNSGNIDKTE
LKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
FRQHDTDMDGIITIHYEQFLSMVFSLKI
>C3
MAYNHDGMPDQQFLWDVFQRVDKDRSGHISADELQVALSNGTWSAFNPET
IRLMIGMFDRENKGTVSFKDFGALWKYVTDWQNCFRSFDRDNSGNIDKTE
LKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
FRQHDTDMDGIITIHYEQFLSMVFSLKI
>C4
MAYNYSGMPDQQFLWDVFQRVDKDSSGHISADELQVALSNGTWSAFNPET
IRLMIGMFDRENRGTVSFQDFGALWKYVTDWQNCFRSFDRDNSGNIDKTE
LKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
FRQHDTDMDGIITIHYEQFLSMVFSLKI
>C5
MAYNHDGMPDQQFLWDVFQRVDKDRSGHISADELQVALSNGTWSAFNPET
IRLMIGMFDRENRGTVSFQDFGALWKYVTDWQNCFRSFDRDNSGNIDKAE
LKTALTSFGYRLSDHLIDILLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
FRQHDTDMDGVITIHYEQFLSMVFSLKI
>C6
MTFQNDGMPDQQFLWDVFQRVDKDRSGHISADELQVALSNGTWSAFNPET
IRLMIGMFDRENTGTVSFQDFGALWKYVTDWQNCFRSFDRDSSGNIDKTE
LKTALTSFGYRLSDHLINVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
FRQHDTDMDGIITIHYEQFLSMVFSLKI
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=178
C1 MAYNHDGMPDQQFLWDVFQRVDKDRSGHISADELQVALSNGTWSAFNPET
C2 MAYNHDGMPDQQFLWDVFQRVDKDKSGHISADELQVALSNGTWSAFNPET
C3 MAYNHDGMPDQQFLWDVFQRVDKDRSGHISADELQVALSNGTWSAFNPET
C4 MAYNYSGMPDQQFLWDVFQRVDKDSSGHISADELQVALSNGTWSAFNPET
C5 MAYNHDGMPDQQFLWDVFQRVDKDRSGHISADELQVALSNGTWSAFNPET
C6 MTFQNDGMPDQQFLWDVFQRVDKDRSGHISADELQVALSNGTWSAFNPET
*::: .****************** *************************
C1 IRLMIGMFDRENKGTVSFKDFGALWKYVTDWQNCFRSFDRDNSGNIDKTE
C2 IRLMIGMFDRENKGTVSFKDFGALWKYVTDWQNCFRSFDCDNSGNIDKTE
C3 IRLMIGMFDRENKGTVSFKDFGALWKYVTDWQNCFRSFDRDNSGNIDKTE
C4 IRLMIGMFDRENRGTVSFQDFGALWKYVTDWQNCFRSFDRDNSGNIDKTE
C5 IRLMIGMFDRENRGTVSFQDFGALWKYVTDWQNCFRSFDRDNSGNIDKAE
C6 IRLMIGMFDRENTGTVSFQDFGALWKYVTDWQNCFRSFDRDSSGNIDKTE
************ *****:******************** *.******:*
C1 LKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
C2 LKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
C3 LKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
C4 LKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
C5 LKTALTSFGYRLSDHLIDILLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
C6 LKTALTSFGYRLSDHLINVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
*****************::*******************************
C1 FRQHDTDLDGIITIHYEQFLSMVFSLKI
C2 FRQHDTDMDGIITIHYEQFLSMVFSLKI
C3 FRQHDTDMDGIITIHYEQFLSMVFSLKI
C4 FRQHDTDMDGIITIHYEQFLSMVFSLKI
C5 FRQHDTDMDGVITIHYEQFLSMVFSLKI
C6 FRQHDTDMDGIITIHYEQFLSMVFSLKI
*******:**:*****************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5340]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [5340]--->[5340]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/7/Alg-2-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.320 Mb, Max= 30.571 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MAYNHDGMPDQQFLWDVFQRVDKDRSGHISADELQVALSNGTWSAFNPET
IRLMIGMFDRENKGTVSFKDFGALWKYVTDWQNCFRSFDRDNSGNIDKTE
LKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
FRQHDTDLDGIITIHYEQFLSMVFSLKI
>C2
MAYNHDGMPDQQFLWDVFQRVDKDKSGHISADELQVALSNGTWSAFNPET
IRLMIGMFDRENKGTVSFKDFGALWKYVTDWQNCFRSFDCDNSGNIDKTE
LKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
FRQHDTDMDGIITIHYEQFLSMVFSLKI
>C3
MAYNHDGMPDQQFLWDVFQRVDKDRSGHISADELQVALSNGTWSAFNPET
IRLMIGMFDRENKGTVSFKDFGALWKYVTDWQNCFRSFDRDNSGNIDKTE
LKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
FRQHDTDMDGIITIHYEQFLSMVFSLKI
>C4
MAYNYSGMPDQQFLWDVFQRVDKDSSGHISADELQVALSNGTWSAFNPET
IRLMIGMFDRENRGTVSFQDFGALWKYVTDWQNCFRSFDRDNSGNIDKTE
LKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
FRQHDTDMDGIITIHYEQFLSMVFSLKI
>C5
MAYNHDGMPDQQFLWDVFQRVDKDRSGHISADELQVALSNGTWSAFNPET
IRLMIGMFDRENRGTVSFQDFGALWKYVTDWQNCFRSFDRDNSGNIDKAE
LKTALTSFGYRLSDHLIDILLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
FRQHDTDMDGVITIHYEQFLSMVFSLKI
>C6
MTFQNDGMPDQQFLWDVFQRVDKDRSGHISADELQVALSNGTWSAFNPET
IRLMIGMFDRENTGTVSFQDFGALWKYVTDWQNCFRSFDRDSSGNIDKTE
LKTALTSFGYRLSDHLINVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
FRQHDTDMDGIITIHYEQFLSMVFSLKI
FORMAT of file /tmp/tmp7328193703640537544aln Not Supported[FATAL:T-COFFEE]
>C1
MAYNHDGMPDQQFLWDVFQRVDKDRSGHISADELQVALSNGTWSAFNPET
IRLMIGMFDRENKGTVSFKDFGALWKYVTDWQNCFRSFDRDNSGNIDKTE
LKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
FRQHDTDLDGIITIHYEQFLSMVFSLKI
>C2
MAYNHDGMPDQQFLWDVFQRVDKDKSGHISADELQVALSNGTWSAFNPET
IRLMIGMFDRENKGTVSFKDFGALWKYVTDWQNCFRSFDCDNSGNIDKTE
LKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
FRQHDTDMDGIITIHYEQFLSMVFSLKI
>C3
MAYNHDGMPDQQFLWDVFQRVDKDRSGHISADELQVALSNGTWSAFNPET
IRLMIGMFDRENKGTVSFKDFGALWKYVTDWQNCFRSFDRDNSGNIDKTE
LKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
FRQHDTDMDGIITIHYEQFLSMVFSLKI
>C4
MAYNYSGMPDQQFLWDVFQRVDKDSSGHISADELQVALSNGTWSAFNPET
IRLMIGMFDRENRGTVSFQDFGALWKYVTDWQNCFRSFDRDNSGNIDKTE
LKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
FRQHDTDMDGIITIHYEQFLSMVFSLKI
>C5
MAYNHDGMPDQQFLWDVFQRVDKDRSGHISADELQVALSNGTWSAFNPET
IRLMIGMFDRENRGTVSFQDFGALWKYVTDWQNCFRSFDRDNSGNIDKAE
LKTALTSFGYRLSDHLIDILLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
FRQHDTDMDGVITIHYEQFLSMVFSLKI
>C6
MTFQNDGMPDQQFLWDVFQRVDKDRSGHISADELQVALSNGTWSAFNPET
IRLMIGMFDRENTGTVSFQDFGALWKYVTDWQNCFRSFDRDSSGNIDKTE
LKTALTSFGYRLSDHLINVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
FRQHDTDMDGIITIHYEQFLSMVFSLKI
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:178 S:100 BS:178
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 98.31 C1 C2 98.31
TOP 1 0 98.31 C2 C1 98.31
BOT 0 2 99.44 C1 C3 99.44
TOP 2 0 99.44 C3 C1 99.44
BOT 0 3 96.63 C1 C4 96.63
TOP 3 0 96.63 C4 C1 96.63
BOT 0 4 96.63 C1 C5 96.63
TOP 4 0 96.63 C5 C1 96.63
BOT 0 5 94.94 C1 C6 94.94
TOP 5 0 94.94 C6 C1 94.94
BOT 1 2 98.88 C2 C3 98.88
TOP 2 1 98.88 C3 C2 98.88
BOT 1 3 96.63 C2 C4 96.63
TOP 3 1 96.63 C4 C2 96.63
BOT 1 4 96.07 C2 C5 96.07
TOP 4 1 96.07 C5 C2 96.07
BOT 1 5 94.38 C2 C6 94.38
TOP 5 1 94.38 C6 C2 94.38
BOT 2 3 97.19 C3 C4 97.19
TOP 3 2 97.19 C4 C3 97.19
BOT 2 4 97.19 C3 C5 97.19
TOP 4 2 97.19 C5 C3 97.19
BOT 2 5 95.51 C3 C6 95.51
TOP 5 2 95.51 C6 C3 95.51
BOT 3 4 96.63 C4 C5 96.63
TOP 4 3 96.63 C5 C4 96.63
BOT 3 5 94.94 C4 C6 94.94
TOP 5 3 94.94 C6 C4 94.94
BOT 4 5 94.38 C5 C6 94.38
TOP 5 4 94.38 C6 C5 94.38
AVG 0 C1 * 97.19
AVG 1 C2 * 96.85
AVG 2 C3 * 97.64
AVG 3 C4 * 96.40
AVG 4 C5 * 96.18
AVG 5 C6 * 94.83
TOT TOT * 96.52
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCCTACAATCATGATGGTATGCCAGACCAGCAATTTCTTTGGGATGT
C2 ATGGCCTACAACCATGATGGTATGCCAGATCAGCAATTTCTTTGGGACGT
C3 ATGGCCTACAACCATGATGGTATGCCAGATCAGCAATTTCTTTGGGACGT
C4 ATGGCGTACAATTATAGTGGAATGCCAGATCAACAATTTCTTTGGGATGT
C5 ATGGCCTACAACCATGATGGAATGCCAGATCAGCAATTTCTTTGGGATGT
C6 ATGACCTTTCAGAATGACGGAATGCCAGATCAACAATTTTTGTGGGATGT
***.* *: .* **.. **:******** **.****** * ***** **
C1 TTTTCAAAGAGTGGATAAAGATAGGAGTGGTCATATATCCGCAGATGAGC
C2 TTTTCAAAGAGTGGATAAAGATAAGAGTGGTCATATATCCGCAGATGAGC
C3 TTTTCAAAGAGTGGATAAAGATAGGAGTGGTCATATATCCGCAGATGAGC
C4 TTTTCAAAGAGTGGACAAAGATAGCAGTGGTCATATATCGGCAGATGAGC
C5 TTTTCAAAGAGTGGACAAAGATAGGAGTGGTCATATATCTGCAGATGAGC
C6 TTTTCAAAGAGTGGACAAAGACAGGAGTGGTCATATTTCCGCTGATGAGC
*************** ***** *. ***********:** **:*******
C1 TACAAGTGGCCCTTTCGAATGGTACCTGGTCTGCATTTAATCCGGAGACT
C2 TACAAGTGGCCCTTTCGAATGGTACCTGGTCTGCATTTAATCCGGAAACT
C3 TACAAGTGGCCCTTTCGAATGGTACCTGGTCTGCATTTAATCCGGAAACT
C4 TACAAGTGGCCCTTTCGAATGGTACATGGTCTGCATTTAATCCGGAAACT
C5 TACAAGTGGCCCTTTCAAATGGTACATGGTCTGCATTTAATCCGGAAACT
C6 TACAAGTGGCCCTTTCGAATGGTACATGGTCTGCATTTAATCCCGAAACG
****************.********.***************** **.**
C1 ATCCGTTTGATGATTGGAATGTTTGATCGTGAAAATAAAGGGACTGTGTC
C2 ATCCGTTTGATGATTGGAATGTTTGATCGTGAAAATAAAGGGACTGTGTC
C3 ATCCGTTTGATGATTGGAATGTTTGATCGTGAAAATAAAGGGACTGTGTC
C4 ATCCGTTTGATGATTGGAATGTTTGATCGTGAAAATAGAGGGACTGTGTC
C5 ATCCGTTTGATGATTGGAATGTTTGATCGTGAAAATAGAGGGACCGTGTC
C6 ATCCGTTTGATGATTGGAATGTTTGATCGCGAAAATACAGGCACCGTATC
***************************** ******* *** ** **.**
C1 CTTTAAAGATTTTGGAGCGTTGTGGAAGTATGTGACGGATTGGCAAAATT
C2 CTTTAAAGATTTTGGAGCGTTGTGGAAGTATGTGACGGATTGGCAAAATT
C3 CTTTAAAGATTTTGGAGCGTTGTGGAAGTATGTGACGGATTGGCAAAATT
C4 CTTTCAAGATTTTGGAGCTTTGTGGAAGTATGTGACGGATTGGCAAAACT
C5 CTTTCAAGATTTTGGAGCTTTGTGGAAGTATGTGACGGATTGGCAAAATT
C6 CTTCCAAGACTTCGGAGCATTATGGAAATACGTGACGGATTGGCAAAATT
*** .**** ** ***** **.*****.** ***************** *
C1 GTTTTCGATCCTTTGATCGTGACAATTCTGGAAATATTGACAAAACTGAG
C2 GTTTTCGATCCTTTGATTGTGACAATTCTGGAAACATTGACAAAACTGAG
C3 GTTTTCGATCCTTTGATCGTGACAATTCTGGAAACATTGACAAAACTGAG
C4 GTTTTCGTTCCTTTGATCGAGACAACTCTGGAAACATTGACAAAACTGAA
C5 GTTTTCGATCCTTTGATCGTGACAACTCTGGAAACATTGACAAAGCTGAG
C6 GCTTTCGATCATTCGATCGCGATAGTTCTGGAAACATTGACAAAACTGAG
* *****:**.** *** * ** *. ******** *********.****.
C1 CTGAAAACAGCACTGACATCATTTGGTTATCGTTTATCTGACCACCTAAT
C2 CTGAAAACAGCATTGACATCATTTGGTTATCGCTTATCTGACCACCTAAT
C3 CTGAAAACAGCATTGACATCATTTGGTTATCGCTTATCTGACCACCTAAT
C4 CTGAAAACAGCACTGACATCATTTGGTTATCGTTTATCTGACCATCTAAT
C5 TTGAAAACAGCACTTACATCATTTGGTTATCGTTTATCTGACCACCTAAT
C6 TTGAAGACAGCGCTGACATCATTTGGGTATCGTTTATCCGACCATTTAAT
****.*****. * *********** ***** ***** ***** ****
C1 CGACGTCTTACTACGAAAATTTGACCGCTTTGGGCGTGGTACAATTCTTT
C2 CGACGTTTTACTTCGGAAATTTGACCGCTTTGGACGTGGTACAATTCTTT
C3 CGACGTTTTACTTCGAAAATTTGACCGCTTTGGACGTGGTACAATTCTTT
C4 CGACGTTTTACTTCGAAAATTTGATCGCTTTGGACGTGGTACAATCCTTT
C5 CGACATTTTACTTCGAAAGTTTGACCGCTTTGGACGTGGTACAATTCTTT
C6 TAACGTTTTGCTACGCAAGTTTGATCGTTTTGGACGTGGTACAATCCTGT
.**.* **.**:** **.***** ** *****.*********** ** *
C1 TCGATGATTTTATTCAATGTTGTATTGTGCTGTATACATTAACAACTGCA
C2 TCGATGATTTTATTCAATGTTGTATTGTGCTATATACGTTAACAACTGCA
C3 TCGATGATTTTATTCAATGTTGTATTGTGCTATATACGTTAACAACTGCA
C4 TTGATGATTTTATTCAATGTTGTATTGTACTATACACGTTAACAACTGCG
C5 TTGATGATTTTATTCAGTGTTGTATTGTACTCTATACGTTAACAACTGCA
C6 TCGATGATTTTATTCAATGTTGCATTGTGCTATATACTTTAACAACTGCA
* **************.***** *****.** ** ** ***********.
C1 TTCCGCCAGCACGACACTGACTTGGATGGGATCATAACCATACATTACGA
C2 TTCCGGCAGCACGACACTGACATGGATGGGATCATAACCATACATTACGA
C3 TTCCGGCAGCACGACACTGACATGGATGGGATCATAACCATACATTACGA
C4 TTCCGCCAGCACGACACTGACATGGATGGGATCATAACCATACATTACGA
C5 TTCCGCCAGCACGACACTGACATGGATGGGGTCATAACCATACATTATGA
C6 TTCCGACAGCACGACACTGATATGGATGGGATCATAACCATACATTATGA
***** ************** :********.**************** **
C1 ACAGTTCTTAAGTATGGTATTTTCGTTAAAAATA
C2 ACAGTTCTTAAGTATGGTATTTTCGTTAAAAATA
C3 ACAGTTCTTAAGTATGGTATTTTCGTTAAAAATA
C4 ACAGTTTTTAAGTATGGTATTTTCGTTAAAAATA
C5 ACAGTTTTTAAGTATGGTATTTTCGTTAAAAATA
C6 ACAATTTTTAAGTATGGTTTTTTCATTAAAAATA
***.** ***********:*****.*********
>C1
ATGGCCTACAATCATGATGGTATGCCAGACCAGCAATTTCTTTGGGATGT
TTTTCAAAGAGTGGATAAAGATAGGAGTGGTCATATATCCGCAGATGAGC
TACAAGTGGCCCTTTCGAATGGTACCTGGTCTGCATTTAATCCGGAGACT
ATCCGTTTGATGATTGGAATGTTTGATCGTGAAAATAAAGGGACTGTGTC
CTTTAAAGATTTTGGAGCGTTGTGGAAGTATGTGACGGATTGGCAAAATT
GTTTTCGATCCTTTGATCGTGACAATTCTGGAAATATTGACAAAACTGAG
CTGAAAACAGCACTGACATCATTTGGTTATCGTTTATCTGACCACCTAAT
CGACGTCTTACTACGAAAATTTGACCGCTTTGGGCGTGGTACAATTCTTT
TCGATGATTTTATTCAATGTTGTATTGTGCTGTATACATTAACAACTGCA
TTCCGCCAGCACGACACTGACTTGGATGGGATCATAACCATACATTACGA
ACAGTTCTTAAGTATGGTATTTTCGTTAAAAATA
>C2
ATGGCCTACAACCATGATGGTATGCCAGATCAGCAATTTCTTTGGGACGT
TTTTCAAAGAGTGGATAAAGATAAGAGTGGTCATATATCCGCAGATGAGC
TACAAGTGGCCCTTTCGAATGGTACCTGGTCTGCATTTAATCCGGAAACT
ATCCGTTTGATGATTGGAATGTTTGATCGTGAAAATAAAGGGACTGTGTC
CTTTAAAGATTTTGGAGCGTTGTGGAAGTATGTGACGGATTGGCAAAATT
GTTTTCGATCCTTTGATTGTGACAATTCTGGAAACATTGACAAAACTGAG
CTGAAAACAGCATTGACATCATTTGGTTATCGCTTATCTGACCACCTAAT
CGACGTTTTACTTCGGAAATTTGACCGCTTTGGACGTGGTACAATTCTTT
TCGATGATTTTATTCAATGTTGTATTGTGCTATATACGTTAACAACTGCA
TTCCGGCAGCACGACACTGACATGGATGGGATCATAACCATACATTACGA
ACAGTTCTTAAGTATGGTATTTTCGTTAAAAATA
>C3
ATGGCCTACAACCATGATGGTATGCCAGATCAGCAATTTCTTTGGGACGT
TTTTCAAAGAGTGGATAAAGATAGGAGTGGTCATATATCCGCAGATGAGC
TACAAGTGGCCCTTTCGAATGGTACCTGGTCTGCATTTAATCCGGAAACT
ATCCGTTTGATGATTGGAATGTTTGATCGTGAAAATAAAGGGACTGTGTC
CTTTAAAGATTTTGGAGCGTTGTGGAAGTATGTGACGGATTGGCAAAATT
GTTTTCGATCCTTTGATCGTGACAATTCTGGAAACATTGACAAAACTGAG
CTGAAAACAGCATTGACATCATTTGGTTATCGCTTATCTGACCACCTAAT
CGACGTTTTACTTCGAAAATTTGACCGCTTTGGACGTGGTACAATTCTTT
TCGATGATTTTATTCAATGTTGTATTGTGCTATATACGTTAACAACTGCA
TTCCGGCAGCACGACACTGACATGGATGGGATCATAACCATACATTACGA
ACAGTTCTTAAGTATGGTATTTTCGTTAAAAATA
>C4
ATGGCGTACAATTATAGTGGAATGCCAGATCAACAATTTCTTTGGGATGT
TTTTCAAAGAGTGGACAAAGATAGCAGTGGTCATATATCGGCAGATGAGC
TACAAGTGGCCCTTTCGAATGGTACATGGTCTGCATTTAATCCGGAAACT
ATCCGTTTGATGATTGGAATGTTTGATCGTGAAAATAGAGGGACTGTGTC
CTTTCAAGATTTTGGAGCTTTGTGGAAGTATGTGACGGATTGGCAAAACT
GTTTTCGTTCCTTTGATCGAGACAACTCTGGAAACATTGACAAAACTGAA
CTGAAAACAGCACTGACATCATTTGGTTATCGTTTATCTGACCATCTAAT
CGACGTTTTACTTCGAAAATTTGATCGCTTTGGACGTGGTACAATCCTTT
TTGATGATTTTATTCAATGTTGTATTGTACTATACACGTTAACAACTGCG
TTCCGCCAGCACGACACTGACATGGATGGGATCATAACCATACATTACGA
ACAGTTTTTAAGTATGGTATTTTCGTTAAAAATA
>C5
ATGGCCTACAACCATGATGGAATGCCAGATCAGCAATTTCTTTGGGATGT
TTTTCAAAGAGTGGACAAAGATAGGAGTGGTCATATATCTGCAGATGAGC
TACAAGTGGCCCTTTCAAATGGTACATGGTCTGCATTTAATCCGGAAACT
ATCCGTTTGATGATTGGAATGTTTGATCGTGAAAATAGAGGGACCGTGTC
CTTTCAAGATTTTGGAGCTTTGTGGAAGTATGTGACGGATTGGCAAAATT
GTTTTCGATCCTTTGATCGTGACAACTCTGGAAACATTGACAAAGCTGAG
TTGAAAACAGCACTTACATCATTTGGTTATCGTTTATCTGACCACCTAAT
CGACATTTTACTTCGAAAGTTTGACCGCTTTGGACGTGGTACAATTCTTT
TTGATGATTTTATTCAGTGTTGTATTGTACTCTATACGTTAACAACTGCA
TTCCGCCAGCACGACACTGACATGGATGGGGTCATAACCATACATTATGA
ACAGTTTTTAAGTATGGTATTTTCGTTAAAAATA
>C6
ATGACCTTTCAGAATGACGGAATGCCAGATCAACAATTTTTGTGGGATGT
TTTTCAAAGAGTGGACAAAGACAGGAGTGGTCATATTTCCGCTGATGAGC
TACAAGTGGCCCTTTCGAATGGTACATGGTCTGCATTTAATCCCGAAACG
ATCCGTTTGATGATTGGAATGTTTGATCGCGAAAATACAGGCACCGTATC
CTTCCAAGACTTCGGAGCATTATGGAAATACGTGACGGATTGGCAAAATT
GCTTTCGATCATTCGATCGCGATAGTTCTGGAAACATTGACAAAACTGAG
TTGAAGACAGCGCTGACATCATTTGGGTATCGTTTATCCGACCATTTAAT
TAACGTTTTGCTACGCAAGTTTGATCGTTTTGGACGTGGTACAATCCTGT
TCGATGATTTTATTCAATGTTGCATTGTGCTATATACTTTAACAACTGCA
TTCCGACAGCACGACACTGATATGGATGGGATCATAACCATACATTATGA
ACAATTTTTAAGTATGGTTTTTTCATTAAAAATA
>C1
MAYNHDGMPDQQFLWDVFQRVDKDRSGHISADELQVALSNGTWSAFNPET
IRLMIGMFDRENKGTVSFKDFGALWKYVTDWQNCFRSFDRDNSGNIDKTE
LKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
FRQHDTDLDGIITIHYEQFLSMVFSLKI
>C2
MAYNHDGMPDQQFLWDVFQRVDKDKSGHISADELQVALSNGTWSAFNPET
IRLMIGMFDRENKGTVSFKDFGALWKYVTDWQNCFRSFDCDNSGNIDKTE
LKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
FRQHDTDMDGIITIHYEQFLSMVFSLKI
>C3
MAYNHDGMPDQQFLWDVFQRVDKDRSGHISADELQVALSNGTWSAFNPET
IRLMIGMFDRENKGTVSFKDFGALWKYVTDWQNCFRSFDRDNSGNIDKTE
LKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
FRQHDTDMDGIITIHYEQFLSMVFSLKI
>C4
MAYNYSGMPDQQFLWDVFQRVDKDSSGHISADELQVALSNGTWSAFNPET
IRLMIGMFDRENRGTVSFQDFGALWKYVTDWQNCFRSFDRDNSGNIDKTE
LKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
FRQHDTDMDGIITIHYEQFLSMVFSLKI
>C5
MAYNHDGMPDQQFLWDVFQRVDKDRSGHISADELQVALSNGTWSAFNPET
IRLMIGMFDRENRGTVSFQDFGALWKYVTDWQNCFRSFDRDNSGNIDKAE
LKTALTSFGYRLSDHLIDILLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
FRQHDTDMDGVITIHYEQFLSMVFSLKI
>C6
MTFQNDGMPDQQFLWDVFQRVDKDRSGHISADELQVALSNGTWSAFNPET
IRLMIGMFDRENTGTVSFQDFGALWKYVTDWQNCFRSFDRDSSGNIDKTE
LKTALTSFGYRLSDHLINVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
FRQHDTDMDGIITIHYEQFLSMVFSLKI
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/7/Alg-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 534 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1480374181
Setting output file names to "/opt/ADOPS/7/Alg-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1836550956
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 9304711243
Seed = 406089873
Swapseed = 1480374181
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 16 unique site patterns
Division 2 has 9 unique site patterns
Division 3 has 47 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1630.694070 -- -24.965149
Chain 2 -- -1568.477572 -- -24.965149
Chain 3 -- -1617.416427 -- -24.965149
Chain 4 -- -1633.001902 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1603.447043 -- -24.965149
Chain 2 -- -1615.953572 -- -24.965149
Chain 3 -- -1603.470759 -- -24.965149
Chain 4 -- -1631.608076 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1630.694] (-1568.478) (-1617.416) (-1633.002) * [-1603.447] (-1615.954) (-1603.471) (-1631.608)
500 -- [-1305.452] (-1314.546) (-1311.779) (-1317.096) * (-1315.072) (-1302.200) (-1302.250) [-1303.688] -- 0:00:00
1000 -- (-1288.931) (-1301.383) (-1301.066) [-1297.282] * (-1297.485) (-1308.568) (-1298.174) [-1293.300] -- 0:00:00
1500 -- [-1266.009] (-1296.103) (-1292.917) (-1298.623) * (-1300.200) (-1296.213) (-1297.640) [-1284.352] -- 0:00:00
2000 -- [-1257.207] (-1279.658) (-1281.923) (-1288.900) * (-1295.348) [-1278.134] (-1286.272) (-1270.450) -- 0:08:19
2500 -- (-1264.756) (-1271.149) [-1267.986] (-1289.530) * (-1293.837) [-1265.437] (-1272.730) (-1266.494) -- 0:06:39
3000 -- [-1263.534] (-1262.246) (-1264.230) (-1290.997) * (-1275.472) (-1256.828) [-1262.771] (-1264.853) -- 0:05:32
3500 -- (-1252.223) [-1260.935] (-1259.490) (-1275.465) * (-1268.335) (-1256.273) [-1247.502] (-1256.012) -- 0:04:44
4000 -- [-1248.210] (-1259.653) (-1265.589) (-1269.291) * (-1264.997) (-1258.218) (-1250.187) [-1245.541] -- 0:04:09
4500 -- (-1251.018) (-1257.799) [-1261.579] (-1251.099) * (-1262.089) (-1261.613) (-1249.189) [-1246.738] -- 0:03:41
5000 -- [-1242.134] (-1253.795) (-1249.832) (-1249.945) * (-1259.355) (-1250.105) (-1247.821) [-1246.391] -- 0:03:19
Average standard deviation of split frequencies: 0.067344
5500 -- (-1251.623) [-1257.880] (-1246.597) (-1256.911) * (-1257.420) [-1244.933] (-1250.771) (-1248.593) -- 0:03:00
6000 -- (-1250.474) (-1245.411) (-1253.323) [-1259.536] * (-1253.781) [-1253.519] (-1261.496) (-1246.963) -- 0:02:45
6500 -- (-1249.603) (-1251.264) [-1243.103] (-1260.886) * (-1255.272) [-1253.555] (-1257.347) (-1248.562) -- 0:02:32
7000 -- (-1246.884) (-1243.278) (-1249.958) [-1252.935] * (-1260.054) [-1246.662] (-1252.354) (-1246.391) -- 0:04:43
7500 -- (-1242.780) (-1245.134) (-1247.637) [-1250.983] * (-1257.325) (-1248.693) [-1253.105] (-1247.771) -- 0:04:24
8000 -- (-1247.149) [-1243.608] (-1249.147) (-1247.886) * (-1256.120) [-1246.488] (-1263.278) (-1243.577) -- 0:04:08
8500 -- (-1251.815) (-1250.863) [-1249.902] (-1259.851) * (-1246.146) (-1246.638) (-1258.807) [-1249.803] -- 0:03:53
9000 -- (-1244.979) [-1245.090] (-1248.010) (-1247.025) * (-1258.748) [-1246.059] (-1261.564) (-1250.292) -- 0:03:40
9500 -- (-1246.660) (-1253.378) [-1248.380] (-1249.910) * [-1252.150] (-1247.128) (-1244.353) (-1248.262) -- 0:03:28
10000 -- (-1244.382) (-1247.160) [-1249.164] (-1256.816) * (-1252.104) (-1262.084) [-1242.701] (-1246.984) -- 0:03:18
Average standard deviation of split frequencies: 0.081023
10500 -- [-1246.338] (-1250.130) (-1243.035) (-1243.717) * (-1252.115) (-1247.052) (-1248.143) [-1250.998] -- 0:03:08
11000 -- (-1241.339) (-1245.285) [-1243.894] (-1256.207) * (-1250.507) (-1243.660) [-1239.706] (-1244.648) -- 0:02:59
11500 -- [-1250.480] (-1252.593) (-1242.458) (-1248.253) * [-1247.774] (-1251.774) (-1244.120) (-1244.745) -- 0:02:51
12000 -- (-1243.491) (-1246.152) [-1246.410] (-1250.847) * (-1248.823) (-1250.886) (-1245.751) [-1243.192] -- 0:04:07
12500 -- (-1244.621) (-1246.645) (-1244.732) [-1243.739] * [-1253.264] (-1245.798) (-1254.914) (-1250.029) -- 0:03:57
13000 -- (-1242.639) [-1245.593] (-1247.226) (-1250.687) * (-1255.176) [-1248.328] (-1252.713) (-1245.672) -- 0:03:47
13500 -- (-1256.681) (-1251.359) (-1245.733) [-1246.457] * (-1249.865) (-1242.184) [-1250.594] (-1248.506) -- 0:03:39
14000 -- (-1247.065) (-1256.692) (-1248.085) [-1244.570] * (-1251.823) (-1245.875) (-1258.039) [-1248.761] -- 0:03:31
14500 -- [-1249.898] (-1246.045) (-1250.185) (-1247.677) * (-1250.016) [-1248.585] (-1253.533) (-1256.178) -- 0:03:23
15000 -- (-1253.201) (-1250.277) (-1248.768) [-1243.244] * [-1249.050] (-1249.118) (-1245.464) (-1256.057) -- 0:03:17
Average standard deviation of split frequencies: 0.053033
15500 -- (-1255.211) [-1247.378] (-1246.016) (-1246.471) * (-1253.677) [-1254.082] (-1245.832) (-1244.395) -- 0:03:10
16000 -- (-1250.158) [-1246.372] (-1248.328) (-1251.590) * (-1246.240) (-1258.119) (-1246.129) [-1246.072] -- 0:03:04
16500 -- (-1252.380) [-1240.247] (-1246.614) (-1255.521) * (-1250.668) (-1251.870) (-1244.631) [-1245.964] -- 0:02:58
17000 -- (-1252.721) [-1247.222] (-1255.347) (-1254.453) * (-1246.553) (-1245.410) (-1249.828) [-1244.425] -- 0:03:51
17500 -- (-1249.632) [-1244.194] (-1246.481) (-1248.942) * (-1248.824) (-1245.274) (-1247.449) [-1251.325] -- 0:03:44
18000 -- (-1251.179) (-1254.713) [-1248.070] (-1252.410) * (-1256.376) (-1246.586) [-1246.658] (-1254.176) -- 0:03:38
18500 -- [-1248.660] (-1247.555) (-1251.015) (-1249.157) * (-1249.662) [-1247.914] (-1246.525) (-1244.002) -- 0:03:32
19000 -- [-1245.067] (-1252.380) (-1244.811) (-1246.978) * [-1256.308] (-1254.343) (-1245.385) (-1262.163) -- 0:03:26
19500 -- [-1252.778] (-1248.463) (-1257.066) (-1249.328) * [-1249.802] (-1252.393) (-1240.426) (-1243.748) -- 0:03:21
20000 -- (-1259.835) (-1249.152) [-1242.773] (-1249.161) * (-1251.042) (-1247.536) (-1247.388) [-1240.300] -- 0:03:16
Average standard deviation of split frequencies: 0.050182
20500 -- [-1247.286] (-1251.747) (-1244.725) (-1245.785) * (-1250.451) [-1248.507] (-1251.378) (-1242.958) -- 0:03:11
21000 -- (-1244.671) (-1253.881) (-1246.639) [-1251.429] * (-1250.600) [-1246.445] (-1245.687) (-1247.240) -- 0:03:06
21500 -- (-1248.214) [-1245.587] (-1251.408) (-1252.007) * (-1255.265) (-1249.448) [-1248.661] (-1247.140) -- 0:03:02
22000 -- [-1249.130] (-1244.152) (-1250.806) (-1253.080) * (-1245.556) (-1254.818) [-1245.332] (-1250.838) -- 0:02:57
22500 -- (-1252.249) [-1247.463] (-1250.664) (-1245.964) * (-1253.370) (-1254.671) (-1243.987) [-1243.425] -- 0:03:37
23000 -- (-1249.308) (-1247.507) [-1254.182] (-1249.487) * (-1250.444) [-1246.351] (-1246.983) (-1249.566) -- 0:03:32
23500 -- (-1252.614) (-1243.975) (-1252.443) [-1246.546] * (-1250.127) (-1255.498) [-1244.839] (-1254.590) -- 0:03:27
24000 -- [-1243.360] (-1248.623) (-1244.235) (-1246.758) * (-1254.793) (-1250.686) [-1244.030] (-1262.569) -- 0:03:23
24500 -- (-1243.627) (-1243.279) [-1246.906] (-1252.391) * (-1246.909) [-1245.960] (-1251.219) (-1256.781) -- 0:03:19
25000 -- [-1248.917] (-1242.508) (-1242.319) (-1249.018) * (-1249.695) (-1249.788) [-1246.310] (-1251.432) -- 0:03:15
Average standard deviation of split frequencies: 0.047140
25500 -- (-1252.072) (-1252.314) [-1251.192] (-1249.414) * [-1248.655] (-1249.228) (-1241.946) (-1254.238) -- 0:03:11
26000 -- (-1250.610) [-1243.120] (-1244.963) (-1248.332) * (-1243.694) [-1248.978] (-1243.291) (-1251.322) -- 0:03:07
26500 -- (-1252.889) (-1245.330) (-1244.640) [-1248.084] * [-1247.786] (-1251.093) (-1249.335) (-1245.397) -- 0:03:03
27000 -- (-1250.335) (-1246.081) [-1246.625] (-1253.743) * (-1252.885) [-1254.735] (-1248.111) (-1253.463) -- 0:03:00
27500 -- (-1248.065) [-1249.949] (-1252.056) (-1249.722) * (-1246.743) (-1250.635) [-1242.264] (-1250.827) -- 0:03:32
28000 -- (-1255.358) (-1247.731) [-1245.258] (-1245.534) * (-1253.034) [-1247.616] (-1247.505) (-1251.890) -- 0:03:28
28500 -- (-1254.680) (-1247.370) (-1245.068) [-1249.626] * (-1249.890) (-1260.212) (-1246.134) [-1252.280] -- 0:03:24
29000 -- (-1257.176) (-1247.753) [-1251.600] (-1249.645) * [-1254.694] (-1251.269) (-1248.109) (-1247.722) -- 0:03:20
29500 -- (-1248.176) [-1247.822] (-1245.897) (-1248.526) * (-1245.238) (-1251.102) [-1246.509] (-1255.324) -- 0:03:17
30000 -- (-1248.623) (-1251.438) [-1252.996] (-1248.101) * (-1249.654) [-1251.233] (-1251.755) (-1248.036) -- 0:03:14
Average standard deviation of split frequencies: 0.046116
30500 -- (-1244.342) (-1245.338) (-1247.634) [-1241.321] * (-1255.093) [-1251.487] (-1252.867) (-1247.449) -- 0:03:10
31000 -- (-1248.623) (-1256.816) (-1248.895) [-1244.698] * (-1254.113) (-1246.556) [-1247.059] (-1246.698) -- 0:03:07
31500 -- (-1252.799) (-1255.612) (-1248.506) [-1245.184] * (-1248.702) [-1249.106] (-1249.220) (-1246.335) -- 0:03:04
32000 -- [-1246.315] (-1253.496) (-1251.080) (-1248.782) * (-1253.643) (-1247.237) [-1250.243] (-1244.644) -- 0:03:01
32500 -- (-1247.499) [-1246.667] (-1242.361) (-1252.038) * [-1248.187] (-1255.329) (-1247.830) (-1243.550) -- 0:02:58
33000 -- (-1250.251) (-1249.872) [-1250.021] (-1259.484) * (-1249.331) (-1248.702) (-1254.827) [-1248.012] -- 0:03:25
33500 -- [-1243.248] (-1244.059) (-1254.457) (-1252.244) * (-1248.934) [-1239.328] (-1258.340) (-1244.537) -- 0:03:21
34000 -- (-1247.923) (-1243.325) (-1246.720) [-1250.744] * [-1248.814] (-1242.899) (-1250.280) (-1247.951) -- 0:03:18
34500 -- (-1243.572) (-1248.748) [-1250.314] (-1251.235) * (-1249.919) (-1247.678) [-1250.217] (-1247.100) -- 0:03:15
35000 -- (-1242.553) (-1258.677) [-1246.162] (-1244.858) * (-1256.308) (-1244.565) (-1248.043) [-1245.815] -- 0:03:13
Average standard deviation of split frequencies: 0.039284
35500 -- (-1243.574) (-1244.827) (-1255.851) [-1244.623] * [-1245.037] (-1249.476) (-1252.036) (-1244.645) -- 0:03:10
36000 -- (-1252.835) [-1253.013] (-1249.664) (-1246.711) * (-1253.946) (-1244.339) [-1248.745] (-1256.694) -- 0:03:07
36500 -- [-1250.232] (-1251.401) (-1250.669) (-1249.677) * (-1247.255) (-1243.604) [-1240.046] (-1252.101) -- 0:03:04
37000 -- (-1247.472) [-1250.539] (-1247.128) (-1249.482) * (-1249.618) (-1248.201) [-1244.767] (-1243.603) -- 0:03:02
37500 -- (-1247.411) [-1253.351] (-1251.832) (-1254.877) * (-1254.837) (-1247.848) (-1245.541) [-1244.887] -- 0:02:59
38000 -- [-1243.109] (-1250.231) (-1256.379) (-1250.462) * (-1258.625) (-1241.804) (-1252.289) [-1245.085] -- 0:03:22
38500 -- [-1248.446] (-1255.508) (-1256.375) (-1254.083) * (-1253.013) [-1243.391] (-1250.603) (-1247.127) -- 0:03:19
39000 -- [-1244.574] (-1249.509) (-1247.139) (-1244.964) * (-1259.074) [-1246.512] (-1250.581) (-1253.921) -- 0:03:17
39500 -- (-1242.348) [-1247.939] (-1250.348) (-1248.446) * (-1248.125) (-1247.028) [-1254.983] (-1246.903) -- 0:03:14
40000 -- (-1245.607) [-1244.303] (-1253.459) (-1249.541) * (-1244.512) (-1248.760) (-1249.175) [-1242.661] -- 0:03:12
Average standard deviation of split frequencies: 0.023184
40500 -- [-1249.759] (-1249.172) (-1252.104) (-1245.358) * (-1246.782) (-1253.242) (-1248.962) [-1247.189] -- 0:03:09
41000 -- (-1251.074) (-1244.816) (-1245.065) [-1247.454] * [-1244.531] (-1254.260) (-1252.637) (-1248.402) -- 0:03:07
41500 -- (-1245.239) [-1246.813] (-1249.720) (-1242.975) * (-1245.397) (-1255.350) [-1245.310] (-1247.925) -- 0:03:04
42000 -- [-1247.093] (-1246.803) (-1253.321) (-1249.352) * (-1248.385) [-1249.005] (-1253.798) (-1253.633) -- 0:03:02
42500 -- (-1243.948) [-1247.910] (-1246.513) (-1244.081) * (-1246.044) [-1245.599] (-1258.591) (-1246.898) -- 0:03:00
43000 -- (-1252.274) [-1244.911] (-1246.648) (-1250.275) * (-1248.906) [-1254.083] (-1259.417) (-1251.432) -- 0:02:58
43500 -- [-1246.455] (-1247.886) (-1246.520) (-1244.569) * (-1252.016) [-1250.255] (-1244.751) (-1245.767) -- 0:03:17
44000 -- (-1249.278) (-1252.197) (-1243.068) [-1253.451] * [-1244.122] (-1256.091) (-1246.212) (-1245.247) -- 0:03:15
44500 -- (-1249.119) (-1245.028) [-1250.271] (-1244.599) * (-1247.795) (-1254.150) (-1247.837) [-1244.108] -- 0:03:13
45000 -- (-1251.464) [-1249.737] (-1243.438) (-1253.473) * (-1250.082) (-1250.974) [-1248.533] (-1246.949) -- 0:03:11
Average standard deviation of split frequencies: 0.034843
45500 -- (-1251.449) (-1249.049) [-1243.776] (-1252.988) * (-1247.895) (-1248.007) (-1246.636) [-1245.514] -- 0:03:08
46000 -- (-1246.979) [-1247.501] (-1250.521) (-1248.104) * (-1248.440) (-1253.215) [-1247.065] (-1251.112) -- 0:03:06
46500 -- (-1246.261) [-1244.910] (-1250.162) (-1253.421) * (-1244.377) (-1250.570) (-1247.211) [-1251.395] -- 0:03:04
47000 -- (-1247.545) (-1242.703) (-1240.859) [-1248.511] * (-1249.432) (-1257.138) [-1245.823] (-1250.115) -- 0:03:02
47500 -- (-1254.310) [-1248.653] (-1250.544) (-1246.678) * [-1241.438] (-1241.644) (-1245.322) (-1245.928) -- 0:03:00
48000 -- (-1249.481) (-1248.985) [-1243.377] (-1245.579) * (-1248.021) (-1243.543) (-1251.543) [-1251.330] -- 0:02:58
48500 -- (-1246.284) (-1244.839) [-1243.655] (-1247.415) * (-1260.281) (-1247.209) [-1252.365] (-1253.305) -- 0:03:16
49000 -- [-1242.621] (-1246.978) (-1248.098) (-1247.813) * [-1246.729] (-1249.904) (-1253.839) (-1251.628) -- 0:03:14
49500 -- (-1245.963) [-1246.690] (-1249.369) (-1252.370) * [-1247.481] (-1255.368) (-1246.181) (-1249.654) -- 0:03:12
50000 -- (-1254.204) (-1248.861) (-1254.133) [-1245.927] * (-1243.594) (-1248.572) [-1247.096] (-1250.953) -- 0:03:10
Average standard deviation of split frequencies: 0.029773
50500 -- (-1262.301) (-1245.367) (-1249.346) [-1247.126] * (-1249.928) [-1247.739] (-1249.429) (-1254.753) -- 0:03:08
51000 -- (-1253.912) [-1246.863] (-1241.096) (-1251.805) * (-1251.369) [-1247.215] (-1253.500) (-1254.882) -- 0:03:06
51500 -- (-1248.550) [-1244.695] (-1246.488) (-1256.550) * (-1248.909) (-1249.270) [-1249.140] (-1254.113) -- 0:03:04
52000 -- (-1251.735) (-1248.381) [-1243.001] (-1244.076) * (-1248.107) (-1246.041) (-1242.964) [-1243.633] -- 0:03:02
52500 -- (-1244.476) [-1247.650] (-1248.619) (-1253.249) * (-1254.398) (-1249.239) [-1250.718] (-1242.495) -- 0:03:00
53000 -- (-1247.233) [-1247.676] (-1252.068) (-1257.401) * (-1246.818) (-1245.156) (-1252.098) [-1247.006] -- 0:02:58
53500 -- (-1244.548) (-1247.904) [-1244.511] (-1248.966) * (-1245.504) [-1249.265] (-1246.688) (-1258.300) -- 0:02:56
54000 -- (-1243.508) (-1247.057) (-1245.546) [-1243.978] * [-1240.997] (-1250.744) (-1256.641) (-1253.690) -- 0:03:12
54500 -- (-1251.515) [-1252.274] (-1242.742) (-1247.580) * (-1257.118) (-1248.285) [-1249.586] (-1246.346) -- 0:03:10
55000 -- [-1250.711] (-1250.280) (-1252.088) (-1246.335) * (-1250.613) [-1244.252] (-1245.293) (-1253.379) -- 0:03:09
Average standard deviation of split frequencies: 0.042090
55500 -- (-1249.637) (-1247.715) (-1249.422) [-1253.831] * (-1246.414) [-1246.662] (-1253.283) (-1250.674) -- 0:03:07
56000 -- [-1245.299] (-1251.040) (-1251.399) (-1245.420) * (-1244.555) (-1253.248) [-1245.863] (-1252.146) -- 0:03:05
56500 -- [-1245.649] (-1251.791) (-1251.315) (-1254.711) * (-1244.788) (-1246.176) [-1240.353] (-1246.932) -- 0:03:03
57000 -- (-1247.075) [-1254.628] (-1254.412) (-1248.890) * (-1243.229) (-1258.483) (-1249.238) [-1250.948] -- 0:03:01
57500 -- [-1249.704] (-1242.867) (-1249.013) (-1251.931) * (-1243.710) (-1254.672) [-1241.334] (-1258.847) -- 0:03:00
58000 -- [-1248.082] (-1244.661) (-1246.743) (-1255.560) * [-1250.832] (-1251.918) (-1248.215) (-1255.993) -- 0:02:58
58500 -- (-1253.220) (-1248.101) [-1253.798] (-1253.520) * (-1254.412) (-1251.106) (-1246.412) [-1249.256] -- 0:02:57
59000 -- [-1243.563] (-1253.892) (-1247.199) (-1249.266) * (-1244.614) (-1245.692) (-1247.635) [-1245.109] -- 0:02:55
59500 -- [-1245.527] (-1251.760) (-1246.580) (-1246.495) * (-1244.792) (-1256.048) (-1248.809) [-1245.805] -- 0:03:09
60000 -- (-1243.182) (-1248.557) (-1248.316) [-1247.536] * (-1248.193) (-1251.480) (-1250.659) [-1248.973] -- 0:03:08
Average standard deviation of split frequencies: 0.031082
60500 -- [-1247.410] (-1253.426) (-1245.502) (-1247.037) * [-1248.978] (-1265.170) (-1249.907) (-1253.365) -- 0:03:06
61000 -- (-1250.851) (-1243.754) [-1245.819] (-1250.654) * (-1251.753) (-1247.342) [-1251.639] (-1249.140) -- 0:03:04
61500 -- (-1270.257) (-1252.219) (-1248.445) [-1246.473] * (-1239.446) (-1251.118) (-1250.105) [-1245.222] -- 0:03:03
62000 -- (-1251.620) (-1250.579) [-1247.219] (-1248.699) * (-1248.975) (-1251.551) (-1247.250) [-1251.592] -- 0:03:01
62500 -- (-1245.264) (-1251.214) [-1247.394] (-1253.117) * (-1247.604) (-1247.938) [-1248.909] (-1259.612) -- 0:03:00
63000 -- (-1246.487) [-1246.964] (-1246.316) (-1246.421) * (-1243.767) [-1242.500] (-1249.445) (-1250.035) -- 0:02:58
63500 -- [-1243.383] (-1248.014) (-1251.506) (-1251.640) * (-1251.264) (-1253.483) (-1250.672) [-1249.466] -- 0:02:56
64000 -- [-1244.242] (-1248.988) (-1244.071) (-1258.479) * (-1245.783) [-1241.232] (-1253.795) (-1248.890) -- 0:02:55
64500 -- (-1253.738) (-1252.331) (-1252.558) [-1247.658] * (-1248.369) [-1246.270] (-1252.590) (-1251.549) -- 0:03:08
65000 -- [-1247.118] (-1241.716) (-1251.271) (-1251.925) * [-1248.288] (-1252.379) (-1258.754) (-1243.812) -- 0:03:07
Average standard deviation of split frequencies: 0.022856
65500 -- (-1252.431) (-1248.637) (-1250.118) [-1244.327] * [-1244.772] (-1249.509) (-1249.436) (-1253.143) -- 0:03:05
66000 -- (-1248.601) [-1245.280] (-1245.312) (-1254.797) * [-1243.329] (-1245.743) (-1248.726) (-1245.268) -- 0:03:03
66500 -- [-1247.075] (-1243.610) (-1244.723) (-1245.954) * [-1249.775] (-1247.171) (-1247.797) (-1244.388) -- 0:03:02
67000 -- [-1242.777] (-1247.758) (-1243.473) (-1247.840) * (-1249.333) (-1251.274) (-1247.017) [-1250.170] -- 0:03:01
67500 -- (-1252.601) [-1253.313] (-1248.258) (-1252.732) * (-1243.524) [-1242.099] (-1247.222) (-1244.954) -- 0:02:59
68000 -- (-1248.524) (-1243.570) (-1253.984) [-1247.026] * (-1252.628) [-1244.927] (-1254.913) (-1252.230) -- 0:02:58
68500 -- [-1245.270] (-1247.464) (-1246.490) (-1248.851) * [-1245.617] (-1244.693) (-1249.757) (-1242.442) -- 0:02:56
69000 -- (-1246.200) (-1251.274) [-1244.602] (-1248.962) * (-1251.600) (-1246.659) [-1247.636] (-1243.929) -- 0:02:55
69500 -- (-1253.129) (-1255.705) [-1247.349] (-1247.779) * [-1245.119] (-1248.691) (-1255.110) (-1248.334) -- 0:02:54
70000 -- (-1245.191) [-1253.478] (-1247.539) (-1243.496) * [-1244.291] (-1247.408) (-1255.824) (-1248.881) -- 0:03:06
Average standard deviation of split frequencies: 0.029352
70500 -- [-1244.200] (-1252.527) (-1248.300) (-1240.811) * (-1244.432) [-1243.980] (-1257.045) (-1253.839) -- 0:03:04
71000 -- (-1254.995) (-1249.683) (-1245.876) [-1244.956] * (-1248.324) [-1244.706] (-1248.325) (-1260.272) -- 0:03:03
71500 -- (-1245.465) (-1249.539) (-1244.335) [-1247.052] * (-1254.893) [-1247.479] (-1248.635) (-1250.285) -- 0:03:01
72000 -- (-1254.157) (-1245.938) [-1246.676] (-1246.623) * (-1246.569) (-1247.586) (-1253.589) [-1247.406] -- 0:03:00
72500 -- [-1245.640] (-1244.637) (-1247.234) (-1249.783) * (-1244.938) [-1248.080] (-1257.072) (-1242.489) -- 0:02:59
73000 -- (-1247.192) (-1248.397) [-1244.097] (-1254.201) * (-1246.817) (-1245.548) [-1243.119] (-1251.634) -- 0:02:57
73500 -- [-1247.033] (-1244.602) (-1250.501) (-1255.218) * [-1249.078] (-1249.704) (-1243.058) (-1247.651) -- 0:02:56
74000 -- [-1251.195] (-1247.073) (-1266.318) (-1244.799) * [-1245.952] (-1250.488) (-1244.797) (-1244.556) -- 0:02:55
74500 -- (-1251.894) [-1244.474] (-1248.169) (-1250.619) * (-1249.689) (-1248.629) [-1248.385] (-1251.061) -- 0:02:53
75000 -- (-1260.727) (-1254.394) [-1246.124] (-1249.071) * [-1245.638] (-1247.310) (-1251.491) (-1248.173) -- 0:03:05
Average standard deviation of split frequencies: 0.033495
75500 -- (-1253.139) [-1245.357] (-1248.893) (-1257.559) * (-1246.922) (-1244.097) [-1244.970] (-1252.352) -- 0:03:03
76000 -- (-1247.497) (-1249.938) [-1247.044] (-1250.204) * (-1249.445) [-1246.856] (-1247.460) (-1249.331) -- 0:03:02
76500 -- (-1249.556) (-1249.647) (-1252.906) [-1242.920] * (-1246.767) (-1251.512) [-1250.460] (-1249.372) -- 0:03:01
77000 -- (-1245.232) (-1250.905) [-1245.666] (-1241.465) * [-1247.514] (-1252.866) (-1243.364) (-1251.033) -- 0:02:59
77500 -- (-1251.827) (-1260.265) (-1245.527) [-1252.390] * (-1249.195) (-1254.039) [-1250.527] (-1262.136) -- 0:02:58
78000 -- [-1245.419] (-1252.239) (-1250.904) (-1248.061) * [-1245.092] (-1247.147) (-1246.874) (-1260.822) -- 0:02:57
78500 -- (-1252.729) (-1254.248) (-1243.533) [-1244.257] * (-1243.904) (-1250.825) (-1242.996) [-1250.642] -- 0:02:56
79000 -- (-1244.776) [-1251.128] (-1251.608) (-1244.804) * (-1247.964) [-1242.633] (-1253.422) (-1247.737) -- 0:02:54
79500 -- (-1254.890) (-1250.076) [-1246.900] (-1249.587) * (-1254.810) (-1249.445) (-1250.653) [-1248.827] -- 0:02:53
80000 -- (-1253.295) [-1248.197] (-1248.808) (-1246.545) * [-1243.401] (-1250.472) (-1249.875) (-1249.952) -- 0:02:52
Average standard deviation of split frequencies: 0.033894
80500 -- (-1251.997) (-1248.477) [-1244.006] (-1248.111) * (-1249.227) [-1246.461] (-1248.403) (-1249.802) -- 0:03:02
81000 -- (-1249.100) (-1243.768) (-1252.104) [-1244.186] * (-1250.888) (-1247.759) (-1246.350) [-1240.781] -- 0:03:01
81500 -- (-1255.715) [-1243.796] (-1246.102) (-1248.954) * [-1251.612] (-1248.256) (-1242.841) (-1243.861) -- 0:03:00
82000 -- (-1251.522) [-1252.421] (-1248.208) (-1247.598) * (-1246.649) (-1244.471) (-1255.319) [-1245.791] -- 0:02:59
82500 -- [-1248.367] (-1254.372) (-1251.329) (-1252.928) * (-1246.468) [-1250.389] (-1248.289) (-1255.280) -- 0:02:57
83000 -- (-1247.516) (-1250.364) [-1247.127] (-1244.751) * (-1244.794) (-1247.223) [-1249.536] (-1244.784) -- 0:02:56
83500 -- (-1248.903) (-1250.020) [-1252.335] (-1255.286) * (-1249.507) (-1254.995) (-1248.306) [-1250.813] -- 0:02:55
84000 -- (-1250.359) [-1249.670] (-1247.965) (-1245.335) * (-1257.209) [-1246.153] (-1245.141) (-1248.406) -- 0:02:54
84500 -- (-1244.577) (-1246.587) [-1246.793] (-1247.881) * (-1255.296) [-1244.493] (-1250.648) (-1248.929) -- 0:02:53
85000 -- (-1250.214) (-1261.340) (-1241.334) [-1250.348] * (-1247.253) (-1248.096) (-1249.208) [-1250.987] -- 0:02:52
Average standard deviation of split frequencies: 0.027407
85500 -- (-1246.039) [-1255.407] (-1250.647) (-1261.222) * [-1242.669] (-1243.381) (-1252.585) (-1251.573) -- 0:03:01
86000 -- (-1250.453) (-1250.596) [-1248.958] (-1247.769) * (-1242.484) [-1242.622] (-1250.783) (-1248.936) -- 0:03:00
86500 -- (-1247.106) (-1244.564) [-1248.393] (-1253.280) * [-1251.197] (-1248.018) (-1250.324) (-1251.614) -- 0:02:59
87000 -- (-1245.887) [-1246.982] (-1244.562) (-1246.694) * (-1255.280) (-1249.357) (-1248.339) [-1251.249] -- 0:02:58
87500 -- (-1252.905) (-1250.261) [-1249.694] (-1251.271) * (-1252.238) [-1250.371] (-1246.965) (-1248.758) -- 0:02:57
88000 -- (-1251.378) (-1253.586) (-1250.136) [-1248.706] * (-1244.982) (-1246.076) [-1243.031] (-1244.267) -- 0:02:56
88500 -- (-1251.408) [-1249.693] (-1254.663) (-1246.695) * (-1244.396) [-1243.437] (-1253.903) (-1250.863) -- 0:02:55
89000 -- (-1250.716) (-1254.642) (-1250.045) [-1244.942] * [-1245.471] (-1260.285) (-1244.010) (-1250.033) -- 0:02:54
89500 -- [-1250.008] (-1252.507) (-1253.736) (-1243.371) * (-1264.538) (-1248.801) [-1259.030] (-1251.944) -- 0:02:52
90000 -- [-1248.854] (-1244.679) (-1257.252) (-1251.670) * (-1254.959) (-1244.219) [-1245.552] (-1248.155) -- 0:02:51
Average standard deviation of split frequencies: 0.029116
90500 -- (-1245.175) (-1248.068) (-1246.391) [-1247.120] * (-1255.873) (-1240.705) [-1253.787] (-1245.251) -- 0:02:50
91000 -- (-1246.997) (-1246.649) (-1247.663) [-1249.230] * (-1245.034) [-1249.296] (-1245.654) (-1247.519) -- 0:02:59
91500 -- (-1250.697) (-1250.961) (-1249.471) [-1250.759] * (-1258.928) [-1245.567] (-1248.780) (-1250.553) -- 0:02:58
92000 -- (-1250.255) (-1248.229) (-1243.692) [-1246.193] * (-1256.225) (-1249.300) [-1247.566] (-1240.238) -- 0:02:57
92500 -- [-1248.949] (-1249.493) (-1245.488) (-1245.799) * (-1248.806) [-1247.606] (-1247.918) (-1245.601) -- 0:02:56
93000 -- (-1249.011) (-1243.826) (-1250.912) [-1245.900] * (-1256.758) (-1253.767) [-1250.037] (-1251.201) -- 0:02:55
93500 -- [-1246.537] (-1249.151) (-1246.620) (-1250.522) * [-1245.447] (-1245.359) (-1250.687) (-1246.143) -- 0:02:54
94000 -- (-1246.016) [-1247.995] (-1253.744) (-1245.324) * [-1245.433] (-1250.287) (-1241.675) (-1248.718) -- 0:02:53
94500 -- (-1253.758) (-1248.712) (-1254.734) [-1250.669] * [-1243.853] (-1248.099) (-1249.028) (-1250.058) -- 0:02:52
95000 -- (-1256.311) [-1247.383] (-1253.314) (-1244.323) * (-1258.223) (-1242.522) [-1245.228] (-1246.167) -- 0:02:51
Average standard deviation of split frequencies: 0.025534
95500 -- (-1255.876) [-1251.084] (-1249.151) (-1250.875) * [-1250.398] (-1248.120) (-1247.552) (-1249.506) -- 0:02:50
96000 -- [-1244.216] (-1252.073) (-1245.337) (-1247.463) * (-1253.789) [-1245.588] (-1249.309) (-1247.116) -- 0:02:58
96500 -- (-1246.619) (-1243.687) [-1249.654] (-1245.507) * (-1250.989) (-1245.158) (-1245.758) [-1247.031] -- 0:02:57
97000 -- (-1252.998) (-1247.195) [-1244.984] (-1242.561) * (-1248.070) (-1255.896) [-1249.142] (-1254.232) -- 0:02:56
97500 -- (-1251.407) (-1246.242) [-1251.684] (-1245.297) * [-1252.103] (-1248.511) (-1250.004) (-1256.023) -- 0:02:55
98000 -- (-1250.843) [-1248.628] (-1248.201) (-1247.103) * (-1255.557) (-1251.484) [-1250.694] (-1248.608) -- 0:02:54
98500 -- [-1247.993] (-1245.043) (-1251.021) (-1248.903) * (-1260.071) [-1247.162] (-1250.955) (-1244.706) -- 0:02:53
99000 -- (-1248.047) (-1246.000) (-1255.488) [-1254.367] * (-1252.732) (-1251.252) [-1251.148] (-1244.550) -- 0:02:52
99500 -- (-1260.293) [-1243.059] (-1246.483) (-1249.893) * [-1255.567] (-1247.999) (-1243.024) (-1251.132) -- 0:02:51
100000 -- (-1249.954) [-1242.331] (-1244.717) (-1243.802) * (-1250.469) [-1247.921] (-1253.444) (-1244.307) -- 0:02:51
Average standard deviation of split frequencies: 0.018731
100500 -- (-1252.897) [-1247.754] (-1244.922) (-1245.070) * (-1247.447) (-1254.196) [-1244.932] (-1251.252) -- 0:02:50
101000 -- (-1257.427) (-1249.964) [-1253.016] (-1255.612) * (-1245.075) (-1243.622) (-1247.907) [-1247.344] -- 0:02:49
101500 -- (-1253.319) (-1247.866) [-1245.552] (-1246.900) * (-1246.721) (-1256.303) [-1244.763] (-1247.423) -- 0:02:57
102000 -- [-1250.518] (-1251.969) (-1251.432) (-1256.376) * (-1251.007) [-1247.290] (-1248.451) (-1256.789) -- 0:02:56
102500 -- (-1245.938) [-1252.332] (-1251.923) (-1258.011) * [-1248.471] (-1244.128) (-1257.144) (-1244.685) -- 0:02:55
103000 -- [-1243.242] (-1246.136) (-1246.834) (-1258.700) * (-1247.779) (-1242.792) [-1248.420] (-1249.719) -- 0:02:54
103500 -- (-1247.139) [-1247.269] (-1249.874) (-1247.580) * [-1246.435] (-1249.416) (-1246.435) (-1254.495) -- 0:02:53
104000 -- (-1254.471) [-1247.890] (-1254.247) (-1244.259) * [-1248.902] (-1250.296) (-1244.628) (-1250.783) -- 0:02:52
104500 -- [-1244.713] (-1244.004) (-1248.691) (-1247.345) * (-1249.667) (-1247.644) (-1250.847) [-1249.651] -- 0:02:51
105000 -- (-1250.414) (-1246.183) (-1249.134) [-1250.996] * (-1253.528) [-1249.364] (-1243.631) (-1245.866) -- 0:02:50
Average standard deviation of split frequencies: 0.016010
105500 -- (-1247.997) (-1248.487) [-1249.503] (-1243.785) * (-1250.753) (-1255.048) [-1246.566] (-1246.354) -- 0:02:49
106000 -- (-1247.868) (-1253.387) (-1244.375) [-1243.450] * (-1255.965) (-1252.527) [-1253.022] (-1255.499) -- 0:02:48
106500 -- (-1249.380) (-1258.676) (-1248.605) [-1244.093] * [-1245.434] (-1251.355) (-1244.743) (-1246.067) -- 0:02:47
107000 -- (-1255.016) (-1248.001) [-1247.152] (-1247.084) * (-1253.525) [-1243.066] (-1249.191) (-1240.355) -- 0:02:55
107500 -- (-1248.899) (-1251.437) [-1242.008] (-1248.520) * (-1247.950) [-1242.000] (-1246.277) (-1246.345) -- 0:02:54
108000 -- (-1250.229) (-1254.008) [-1246.123] (-1248.054) * [-1246.774] (-1248.470) (-1256.998) (-1246.401) -- 0:02:53
108500 -- (-1246.407) [-1252.085] (-1248.144) (-1251.421) * (-1249.809) (-1249.060) [-1249.419] (-1244.363) -- 0:02:52
109000 -- [-1248.255] (-1259.419) (-1245.956) (-1246.185) * [-1242.459] (-1247.596) (-1250.796) (-1247.260) -- 0:02:51
109500 -- [-1246.928] (-1251.161) (-1248.170) (-1256.109) * (-1253.029) (-1249.230) [-1246.047] (-1251.286) -- 0:02:50
110000 -- [-1245.280] (-1252.170) (-1249.428) (-1251.961) * (-1248.759) [-1250.508] (-1245.501) (-1249.439) -- 0:02:49
Average standard deviation of split frequencies: 0.022150
110500 -- (-1249.578) (-1250.435) [-1242.861] (-1247.459) * (-1251.967) (-1250.539) (-1245.511) [-1246.657] -- 0:02:49
111000 -- (-1254.491) [-1248.360] (-1253.152) (-1247.442) * (-1254.332) (-1247.623) (-1245.841) [-1242.842] -- 0:02:48
111500 -- [-1248.365] (-1251.764) (-1259.720) (-1248.103) * (-1251.022) [-1246.036] (-1254.736) (-1240.451) -- 0:02:47
112000 -- (-1250.830) (-1250.033) (-1251.291) [-1253.504] * (-1247.420) [-1246.477] (-1244.603) (-1245.719) -- 0:02:54
112500 -- (-1246.882) (-1244.494) [-1246.187] (-1248.322) * (-1253.941) (-1252.308) (-1248.820) [-1246.952] -- 0:02:53
113000 -- (-1247.979) [-1247.493] (-1248.785) (-1247.823) * (-1249.729) (-1245.943) [-1253.944] (-1242.661) -- 0:02:52
113500 -- [-1245.671] (-1252.233) (-1243.717) (-1244.231) * [-1245.993] (-1248.507) (-1244.137) (-1244.837) -- 0:02:51
114000 -- (-1247.888) [-1247.017] (-1248.568) (-1251.259) * (-1247.832) [-1248.939] (-1252.916) (-1245.191) -- 0:02:50
114500 -- [-1252.715] (-1251.703) (-1253.246) (-1246.947) * (-1256.409) [-1253.395] (-1257.524) (-1258.620) -- 0:02:50
115000 -- (-1249.699) (-1257.738) [-1252.672] (-1247.249) * (-1253.223) (-1256.073) [-1245.192] (-1245.835) -- 0:02:49
Average standard deviation of split frequencies: 0.028447
115500 -- [-1247.683] (-1249.208) (-1248.259) (-1253.603) * (-1255.269) (-1244.947) (-1240.575) [-1242.450] -- 0:02:48
116000 -- [-1247.375] (-1246.110) (-1249.213) (-1252.501) * (-1251.870) (-1253.176) (-1243.508) [-1248.312] -- 0:02:47
116500 -- (-1250.888) (-1250.094) (-1245.154) [-1251.593] * [-1250.584] (-1255.080) (-1257.449) (-1245.625) -- 0:02:46
117000 -- (-1249.288) [-1246.237] (-1243.028) (-1248.231) * (-1247.919) (-1252.113) (-1254.526) [-1247.105] -- 0:02:53
117500 -- (-1250.998) [-1246.284] (-1250.170) (-1248.235) * [-1248.401] (-1249.338) (-1258.528) (-1249.593) -- 0:02:52
118000 -- (-1256.303) [-1245.823] (-1252.560) (-1248.870) * (-1247.132) (-1250.026) (-1250.557) [-1248.961] -- 0:02:51
118500 -- (-1259.477) (-1240.815) [-1249.133] (-1245.956) * (-1244.693) (-1247.148) [-1255.442] (-1258.236) -- 0:02:51
119000 -- (-1251.357) (-1246.594) [-1250.120] (-1250.828) * (-1250.776) (-1255.519) (-1254.169) [-1250.811] -- 0:02:50
119500 -- [-1251.272] (-1250.580) (-1246.973) (-1249.421) * (-1247.930) (-1255.065) [-1245.715] (-1253.238) -- 0:02:49
120000 -- (-1249.680) [-1247.005] (-1253.476) (-1242.062) * (-1254.636) (-1245.854) [-1243.943] (-1248.152) -- 0:02:48
Average standard deviation of split frequencies: 0.028128
120500 -- (-1257.399) (-1248.935) [-1242.816] (-1243.962) * (-1253.433) (-1252.453) (-1246.836) [-1240.347] -- 0:02:47
121000 -- [-1249.901] (-1246.459) (-1245.587) (-1247.653) * (-1247.858) (-1260.034) [-1247.709] (-1243.172) -- 0:02:47
121500 -- (-1251.325) [-1247.416] (-1242.802) (-1250.243) * (-1251.948) (-1250.161) (-1246.470) [-1243.839] -- 0:02:46
122000 -- (-1253.694) (-1248.806) [-1248.833] (-1245.363) * (-1244.697) (-1245.964) [-1243.381] (-1246.361) -- 0:02:45
122500 -- [-1247.145] (-1249.460) (-1249.618) (-1259.234) * (-1257.838) (-1247.273) (-1243.525) [-1246.018] -- 0:02:51
123000 -- (-1251.452) (-1245.069) [-1250.434] (-1249.486) * (-1246.833) (-1251.705) [-1243.162] (-1247.566) -- 0:02:51
123500 -- (-1251.442) [-1259.408] (-1245.475) (-1250.007) * (-1249.819) (-1255.807) (-1251.666) [-1242.950] -- 0:02:50
124000 -- (-1245.147) (-1257.912) (-1255.322) [-1247.285] * [-1256.420] (-1247.616) (-1250.679) (-1243.649) -- 0:02:49
124500 -- (-1244.811) (-1260.920) [-1244.151] (-1249.663) * (-1251.110) (-1248.529) [-1247.723] (-1241.877) -- 0:02:48
125000 -- (-1247.149) (-1248.158) (-1250.789) [-1244.337] * (-1246.817) (-1259.090) [-1246.056] (-1247.630) -- 0:02:48
Average standard deviation of split frequencies: 0.022448
125500 -- (-1248.022) (-1244.949) (-1247.663) [-1239.535] * (-1248.783) (-1252.962) (-1253.572) [-1244.111] -- 0:02:47
126000 -- (-1249.971) (-1252.292) (-1245.833) [-1244.398] * (-1249.716) (-1249.240) (-1243.464) [-1249.574] -- 0:02:46
126500 -- (-1248.944) (-1246.742) [-1248.833] (-1249.084) * (-1243.720) (-1245.605) [-1247.703] (-1247.483) -- 0:02:45
127000 -- (-1245.219) [-1247.415] (-1244.299) (-1249.355) * (-1246.737) (-1252.011) [-1248.067] (-1245.477) -- 0:02:44
127500 -- (-1244.000) (-1246.102) (-1254.738) [-1246.191] * (-1246.330) [-1243.660] (-1250.290) (-1246.545) -- 0:02:51
128000 -- (-1248.141) (-1251.414) (-1254.265) [-1249.293] * [-1246.389] (-1244.391) (-1251.834) (-1245.652) -- 0:02:50
128500 -- [-1248.108] (-1247.749) (-1248.373) (-1247.496) * (-1247.330) (-1247.819) (-1257.860) [-1242.144] -- 0:02:49
129000 -- (-1242.775) (-1246.013) (-1251.264) [-1246.385] * (-1246.104) [-1242.043] (-1253.546) (-1252.604) -- 0:02:48
129500 -- [-1247.248] (-1245.070) (-1244.874) (-1246.459) * (-1253.354) (-1244.963) (-1249.116) [-1248.440] -- 0:02:48
130000 -- (-1244.196) [-1246.849] (-1249.758) (-1249.142) * (-1249.546) (-1248.833) [-1243.269] (-1243.289) -- 0:02:47
Average standard deviation of split frequencies: 0.031026
130500 -- (-1250.208) (-1245.890) (-1251.005) [-1247.887] * [-1245.874] (-1251.799) (-1248.973) (-1240.844) -- 0:02:46
131000 -- [-1248.108] (-1249.725) (-1251.760) (-1256.298) * (-1254.574) (-1245.159) (-1250.182) [-1247.831] -- 0:02:45
131500 -- (-1246.411) (-1246.796) (-1244.745) [-1244.824] * [-1245.269] (-1250.395) (-1247.497) (-1242.421) -- 0:02:45
132000 -- (-1244.930) (-1250.045) [-1247.264] (-1245.110) * [-1245.671] (-1247.343) (-1251.605) (-1250.477) -- 0:02:44
132500 -- (-1247.554) (-1251.887) (-1247.247) [-1242.697] * (-1242.751) (-1248.207) [-1243.676] (-1252.012) -- 0:02:43
133000 -- (-1249.195) [-1245.602] (-1246.015) (-1243.474) * (-1250.599) [-1250.505] (-1254.471) (-1246.873) -- 0:02:49
133500 -- (-1252.716) [-1247.859] (-1253.230) (-1251.400) * (-1250.466) (-1247.522) [-1249.069] (-1245.918) -- 0:02:48
134000 -- (-1253.931) [-1243.824] (-1255.174) (-1249.159) * (-1249.944) [-1247.582] (-1246.719) (-1248.443) -- 0:02:48
134500 -- (-1252.908) (-1247.686) (-1255.650) [-1246.957] * [-1247.458] (-1246.132) (-1248.982) (-1250.334) -- 0:02:47
135000 -- (-1247.623) (-1248.474) (-1250.724) [-1242.242] * [-1242.915] (-1245.801) (-1247.560) (-1248.110) -- 0:02:46
Average standard deviation of split frequencies: 0.030503
135500 -- (-1250.796) (-1251.583) (-1249.511) [-1243.987] * (-1248.180) (-1244.461) [-1248.557] (-1251.184) -- 0:02:45
136000 -- [-1247.187] (-1244.618) (-1253.721) (-1251.505) * (-1251.736) (-1248.432) [-1247.110] (-1247.578) -- 0:02:45
136500 -- (-1250.372) (-1244.492) [-1249.164] (-1253.496) * (-1247.184) (-1244.263) (-1250.181) [-1245.855] -- 0:02:44
137000 -- [-1243.934] (-1246.610) (-1248.105) (-1244.635) * (-1247.629) (-1255.502) (-1253.719) [-1247.700] -- 0:02:43
137500 -- (-1259.076) [-1242.023] (-1246.285) (-1248.366) * (-1247.813) [-1242.900] (-1247.713) (-1250.361) -- 0:02:43
138000 -- [-1251.109] (-1249.578) (-1254.022) (-1251.788) * (-1250.353) (-1247.730) [-1247.057] (-1251.856) -- 0:02:48
138500 -- [-1250.289] (-1248.405) (-1247.607) (-1242.350) * (-1253.553) (-1248.573) [-1245.992] (-1250.630) -- 0:02:47
139000 -- (-1250.439) [-1247.784] (-1248.336) (-1249.966) * (-1253.714) (-1250.342) [-1244.755] (-1246.387) -- 0:02:47
139500 -- (-1255.725) [-1243.802] (-1246.018) (-1246.825) * (-1248.649) (-1244.899) [-1252.327] (-1247.474) -- 0:02:46
140000 -- (-1256.890) [-1242.634] (-1246.187) (-1249.659) * (-1247.728) (-1247.836) (-1246.095) [-1250.709] -- 0:02:45
Average standard deviation of split frequencies: 0.025469
140500 -- (-1258.550) [-1247.189] (-1247.665) (-1247.630) * (-1246.622) (-1253.145) [-1244.442] (-1249.276) -- 0:02:45
141000 -- (-1250.452) (-1255.698) (-1247.482) [-1250.869] * (-1252.246) [-1244.251] (-1251.612) (-1249.572) -- 0:02:44
141500 -- (-1254.146) (-1248.033) (-1248.926) [-1245.174] * (-1251.206) [-1249.504] (-1251.097) (-1256.643) -- 0:02:43
142000 -- (-1254.425) (-1248.655) [-1246.269] (-1243.688) * [-1245.020] (-1256.315) (-1246.781) (-1246.807) -- 0:02:43
142500 -- (-1251.707) [-1246.491] (-1245.807) (-1247.915) * [-1249.460] (-1250.952) (-1255.843) (-1246.763) -- 0:02:42
143000 -- (-1247.126) (-1244.545) [-1248.269] (-1249.236) * (-1246.146) (-1257.109) [-1249.371] (-1244.642) -- 0:02:41
143500 -- (-1247.984) [-1242.331] (-1252.683) (-1252.430) * (-1256.751) [-1242.848] (-1249.441) (-1247.499) -- 0:02:47
144000 -- (-1244.750) [-1243.451] (-1248.439) (-1254.718) * (-1245.101) (-1245.744) [-1246.173] (-1246.282) -- 0:02:46
144500 -- [-1248.950] (-1251.112) (-1245.515) (-1256.912) * (-1245.364) (-1247.965) (-1247.741) [-1245.273] -- 0:02:45
145000 -- (-1245.176) (-1254.349) [-1252.327] (-1262.751) * (-1251.276) (-1244.863) (-1246.810) [-1244.401] -- 0:02:45
Average standard deviation of split frequencies: 0.023247
145500 -- [-1246.211] (-1251.279) (-1253.794) (-1257.802) * (-1258.195) [-1247.668] (-1243.405) (-1242.718) -- 0:02:44
146000 -- [-1244.160] (-1246.632) (-1248.172) (-1252.498) * (-1249.919) (-1250.992) (-1246.878) [-1252.414] -- 0:02:43
146500 -- (-1253.493) [-1242.527] (-1243.922) (-1253.632) * (-1247.818) [-1249.725] (-1249.135) (-1243.915) -- 0:02:43
147000 -- (-1252.370) [-1245.046] (-1246.742) (-1258.049) * (-1253.736) (-1255.423) (-1248.803) [-1241.434] -- 0:02:42
147500 -- [-1242.892] (-1249.401) (-1250.569) (-1247.830) * (-1249.218) (-1246.415) [-1247.431] (-1248.744) -- 0:02:41
148000 -- (-1251.731) (-1243.682) [-1248.387] (-1254.956) * (-1248.182) (-1248.033) (-1247.621) [-1245.486] -- 0:02:41
148500 -- [-1248.491] (-1247.711) (-1247.870) (-1256.053) * (-1251.841) [-1251.206] (-1247.907) (-1250.974) -- 0:02:46
149000 -- (-1252.816) (-1248.564) (-1248.161) [-1247.806] * [-1244.050] (-1250.662) (-1246.156) (-1244.688) -- 0:02:45
149500 -- (-1251.944) [-1249.060] (-1253.803) (-1244.515) * [-1243.303] (-1252.970) (-1250.400) (-1249.165) -- 0:02:44
150000 -- (-1248.683) (-1243.156) [-1248.952] (-1247.355) * [-1247.414] (-1253.281) (-1251.864) (-1249.977) -- 0:02:44
Average standard deviation of split frequencies: 0.019399
150500 -- [-1246.729] (-1245.120) (-1243.554) (-1246.749) * (-1250.354) (-1248.578) (-1251.091) [-1248.869] -- 0:02:43
151000 -- (-1246.173) [-1245.322] (-1242.848) (-1253.018) * (-1251.679) (-1257.090) [-1248.126] (-1264.801) -- 0:02:43
151500 -- (-1242.614) (-1250.280) (-1255.008) [-1248.469] * (-1252.292) [-1246.227] (-1253.854) (-1251.454) -- 0:02:42
152000 -- (-1242.948) (-1260.405) (-1253.688) [-1243.447] * [-1252.536] (-1250.877) (-1248.075) (-1247.176) -- 0:02:41
152500 -- (-1245.796) [-1247.044] (-1246.697) (-1248.175) * [-1247.420] (-1253.935) (-1255.638) (-1245.282) -- 0:02:41
153000 -- (-1249.220) (-1253.611) [-1244.053] (-1246.672) * [-1250.397] (-1257.604) (-1252.924) (-1254.062) -- 0:02:40
153500 -- (-1248.409) (-1244.850) [-1250.527] (-1245.028) * (-1250.468) (-1257.733) [-1245.283] (-1243.962) -- 0:02:45
154000 -- (-1241.826) (-1253.881) (-1251.599) [-1252.281] * (-1252.252) (-1249.542) (-1243.148) [-1246.351] -- 0:02:44
154500 -- (-1247.814) [-1252.185] (-1250.415) (-1253.525) * (-1255.010) (-1244.290) [-1247.485] (-1241.667) -- 0:02:44
155000 -- [-1246.023] (-1254.567) (-1242.518) (-1246.256) * (-1263.975) (-1245.899) (-1253.208) [-1248.570] -- 0:02:43
Average standard deviation of split frequencies: 0.017527
155500 -- (-1245.420) (-1251.035) [-1242.400] (-1253.072) * (-1253.107) (-1243.944) [-1251.608] (-1245.866) -- 0:02:42
156000 -- (-1249.197) (-1251.069) (-1248.461) [-1252.737] * (-1249.028) [-1243.885] (-1246.861) (-1251.888) -- 0:02:42
156500 -- (-1246.850) [-1248.498] (-1242.632) (-1247.875) * (-1246.891) (-1247.318) (-1246.454) [-1243.823] -- 0:02:41
157000 -- [-1244.129] (-1260.177) (-1249.352) (-1247.230) * (-1253.207) (-1248.445) (-1245.081) [-1246.827] -- 0:02:41
157500 -- [-1248.020] (-1252.602) (-1247.288) (-1242.698) * (-1250.670) (-1250.787) (-1248.321) [-1241.289] -- 0:02:40
158000 -- [-1247.745] (-1263.346) (-1249.097) (-1243.668) * (-1254.936) [-1245.718] (-1247.134) (-1247.813) -- 0:02:39
158500 -- (-1248.174) (-1250.271) [-1248.912] (-1248.760) * (-1260.183) [-1243.363] (-1244.565) (-1250.007) -- 0:02:39
159000 -- (-1255.716) [-1248.490] (-1246.778) (-1246.025) * (-1255.395) [-1250.486] (-1245.271) (-1245.987) -- 0:02:43
159500 -- (-1250.141) [-1245.324] (-1249.289) (-1247.973) * (-1248.194) [-1250.050] (-1252.253) (-1246.978) -- 0:02:43
160000 -- (-1259.154) (-1248.675) [-1245.932] (-1243.022) * (-1250.633) [-1242.728] (-1258.370) (-1252.998) -- 0:02:42
Average standard deviation of split frequencies: 0.012910
160500 -- (-1253.486) (-1251.806) (-1246.910) [-1243.524] * (-1245.992) [-1240.719] (-1258.510) (-1241.735) -- 0:02:42
161000 -- (-1256.124) (-1250.029) [-1243.617] (-1244.268) * (-1247.748) (-1250.030) (-1245.168) [-1243.952] -- 0:02:41
161500 -- (-1251.495) (-1262.839) (-1246.220) [-1245.813] * [-1247.086] (-1245.787) (-1246.125) (-1243.445) -- 0:02:40
162000 -- (-1253.095) (-1247.029) (-1243.792) [-1244.826] * [-1246.624] (-1245.528) (-1242.719) (-1246.807) -- 0:02:40
162500 -- [-1249.930] (-1250.823) (-1246.381) (-1241.880) * (-1250.669) (-1254.119) (-1250.630) [-1248.324] -- 0:02:39
163000 -- [-1253.620] (-1243.340) (-1243.202) (-1244.711) * [-1250.242] (-1257.542) (-1250.757) (-1243.397) -- 0:02:39
163500 -- [-1245.352] (-1245.595) (-1247.289) (-1252.294) * (-1249.521) [-1250.966] (-1247.110) (-1246.887) -- 0:02:38
164000 -- (-1252.806) [-1253.960] (-1248.734) (-1247.801) * (-1251.384) (-1245.386) [-1247.091] (-1243.952) -- 0:02:43
164500 -- (-1247.407) (-1253.988) (-1247.147) [-1239.777] * [-1244.971] (-1257.883) (-1251.233) (-1246.662) -- 0:02:42
165000 -- (-1252.392) (-1247.441) [-1255.921] (-1247.464) * (-1246.303) [-1246.274] (-1251.701) (-1243.712) -- 0:02:41
Average standard deviation of split frequencies: 0.010223
165500 -- (-1256.615) [-1246.641] (-1243.891) (-1244.240) * [-1245.460] (-1248.850) (-1245.209) (-1255.766) -- 0:02:41
166000 -- (-1256.892) (-1248.929) [-1246.133] (-1244.906) * [-1252.098] (-1254.372) (-1242.550) (-1252.765) -- 0:02:40
166500 -- (-1267.129) (-1253.319) [-1250.484] (-1250.493) * (-1248.702) [-1245.527] (-1241.750) (-1246.594) -- 0:02:40
167000 -- [-1248.169] (-1248.896) (-1253.815) (-1253.981) * (-1250.844) (-1244.518) (-1251.719) [-1248.722] -- 0:02:39
167500 -- [-1246.356] (-1249.960) (-1248.724) (-1255.050) * [-1251.397] (-1248.420) (-1253.653) (-1252.519) -- 0:02:39
168000 -- [-1244.706] (-1246.471) (-1247.130) (-1252.694) * (-1247.997) (-1246.927) [-1255.006] (-1253.684) -- 0:02:38
168500 -- (-1246.836) (-1246.650) [-1247.930] (-1252.213) * [-1249.552] (-1257.762) (-1249.835) (-1246.539) -- 0:02:37
169000 -- (-1247.868) [-1244.277] (-1253.475) (-1250.800) * [-1247.932] (-1249.697) (-1252.746) (-1245.371) -- 0:02:37
169500 -- (-1249.565) [-1241.884] (-1250.231) (-1248.005) * (-1243.172) (-1248.909) (-1248.255) [-1242.629] -- 0:02:41
170000 -- (-1265.135) [-1249.929] (-1251.848) (-1248.169) * (-1245.231) (-1244.525) [-1257.578] (-1251.373) -- 0:02:41
Average standard deviation of split frequencies: 0.006629
170500 -- [-1248.902] (-1251.607) (-1242.514) (-1251.301) * (-1244.504) (-1245.546) (-1251.255) [-1249.206] -- 0:02:40
171000 -- [-1244.212] (-1245.237) (-1256.112) (-1248.939) * (-1251.115) (-1243.285) [-1245.201] (-1247.975) -- 0:02:39
171500 -- (-1242.827) [-1248.805] (-1244.636) (-1246.136) * [-1249.853] (-1249.417) (-1248.208) (-1248.948) -- 0:02:39
172000 -- (-1244.573) (-1249.030) [-1244.444] (-1248.579) * (-1244.382) (-1253.748) [-1246.118] (-1252.230) -- 0:02:38
172500 -- (-1253.195) [-1248.142] (-1245.472) (-1249.359) * (-1249.966) (-1250.771) (-1244.357) [-1248.519] -- 0:02:38
173000 -- (-1255.218) [-1248.962] (-1255.039) (-1246.631) * (-1248.930) [-1242.810] (-1249.936) (-1257.579) -- 0:02:37
173500 -- (-1247.941) [-1250.083] (-1243.450) (-1251.275) * (-1245.722) (-1250.586) [-1244.380] (-1257.222) -- 0:02:37
174000 -- (-1246.905) (-1251.877) (-1243.660) [-1245.646] * (-1251.351) [-1251.201] (-1245.938) (-1254.964) -- 0:02:36
174500 -- (-1253.528) (-1252.687) (-1249.888) [-1242.920] * (-1254.305) [-1254.361] (-1245.924) (-1259.171) -- 0:02:40
175000 -- (-1257.391) (-1254.911) (-1249.757) [-1249.772] * (-1255.135) (-1249.225) (-1245.838) [-1251.056] -- 0:02:40
Average standard deviation of split frequencies: 0.005357
175500 -- (-1248.294) [-1253.473] (-1252.175) (-1245.298) * (-1250.340) [-1242.094] (-1250.241) (-1255.653) -- 0:02:39
176000 -- (-1252.193) [-1247.257] (-1245.544) (-1250.489) * (-1250.944) (-1248.274) (-1245.482) [-1251.018] -- 0:02:39
176500 -- (-1247.077) (-1254.043) (-1250.173) [-1244.439] * (-1253.180) (-1244.483) (-1249.523) [-1248.327] -- 0:02:38
177000 -- (-1246.669) (-1256.657) [-1249.260] (-1250.238) * (-1253.064) [-1245.758] (-1253.044) (-1247.623) -- 0:02:38
177500 -- (-1251.212) [-1244.529] (-1256.857) (-1249.679) * (-1248.267) (-1247.353) (-1246.662) [-1245.886] -- 0:02:37
178000 -- (-1247.440) [-1244.589] (-1246.998) (-1255.023) * (-1252.566) (-1242.302) (-1257.826) [-1243.925] -- 0:02:37
178500 -- (-1251.728) [-1250.478] (-1252.079) (-1247.154) * (-1249.449) (-1248.149) [-1248.930] (-1251.386) -- 0:02:36
179000 -- (-1253.597) (-1249.537) (-1242.971) [-1252.737] * (-1248.603) [-1246.053] (-1248.503) (-1255.387) -- 0:02:35
179500 -- (-1245.884) (-1247.302) [-1245.725] (-1255.535) * [-1241.155] (-1252.316) (-1249.007) (-1251.650) -- 0:02:39
180000 -- (-1248.530) (-1249.308) (-1249.178) [-1242.799] * [-1248.054] (-1250.960) (-1254.118) (-1244.586) -- 0:02:39
Average standard deviation of split frequencies: 0.003653
180500 -- (-1243.900) (-1246.118) (-1245.183) [-1247.380] * (-1248.900) (-1253.288) (-1250.100) [-1249.505] -- 0:02:38
181000 -- (-1244.180) (-1246.423) (-1258.745) [-1248.181] * (-1252.184) (-1251.814) (-1255.475) [-1248.512] -- 0:02:38
181500 -- (-1248.376) [-1244.917] (-1250.783) (-1251.969) * [-1246.862] (-1247.488) (-1250.338) (-1243.543) -- 0:02:37
182000 -- (-1252.047) [-1241.453] (-1247.943) (-1248.507) * [-1249.980] (-1246.968) (-1246.338) (-1247.683) -- 0:02:37
182500 -- (-1248.253) [-1247.358] (-1249.211) (-1245.988) * [-1251.846] (-1250.153) (-1246.379) (-1248.080) -- 0:02:36
183000 -- (-1255.526) (-1247.760) (-1254.211) [-1250.789] * (-1252.910) (-1251.303) [-1243.463] (-1240.880) -- 0:02:36
183500 -- (-1247.602) (-1251.821) [-1251.915] (-1249.616) * (-1250.792) (-1249.856) (-1247.130) [-1246.553] -- 0:02:35
184000 -- (-1249.036) [-1248.107] (-1255.729) (-1253.111) * (-1250.384) (-1251.284) [-1245.669] (-1246.374) -- 0:02:35
184500 -- (-1250.015) (-1251.933) (-1256.236) [-1245.679] * (-1252.768) (-1248.546) (-1247.244) [-1246.296] -- 0:02:34
185000 -- (-1251.021) [-1242.492] (-1244.426) (-1242.922) * (-1252.181) (-1243.323) [-1248.818] (-1248.974) -- 0:02:38
Average standard deviation of split frequencies: 0.002028
185500 -- (-1258.346) [-1242.265] (-1246.957) (-1245.696) * (-1253.395) [-1242.584] (-1250.389) (-1241.284) -- 0:02:38
186000 -- (-1245.598) (-1246.805) (-1249.183) [-1242.639] * (-1251.582) (-1245.397) [-1249.354] (-1249.644) -- 0:02:37
186500 -- (-1250.903) (-1248.738) (-1244.378) [-1247.572] * [-1247.658] (-1242.579) (-1245.178) (-1251.025) -- 0:02:37
187000 -- (-1256.262) (-1248.319) (-1249.802) [-1241.691] * (-1245.796) (-1245.621) [-1251.834] (-1246.927) -- 0:02:36
187500 -- (-1248.538) [-1241.164] (-1244.643) (-1263.384) * (-1243.059) (-1242.452) [-1245.310] (-1242.426) -- 0:02:36
188000 -- (-1245.688) [-1245.376] (-1244.467) (-1245.074) * [-1243.313] (-1244.130) (-1258.990) (-1267.152) -- 0:02:35
188500 -- (-1244.204) (-1244.196) (-1242.069) [-1249.186] * (-1247.767) (-1246.716) [-1246.800] (-1252.599) -- 0:02:34
189000 -- (-1250.390) (-1251.952) [-1243.775] (-1245.487) * [-1245.531] (-1250.513) (-1254.635) (-1247.535) -- 0:02:34
189500 -- (-1255.175) [-1250.185] (-1243.607) (-1243.236) * (-1242.808) [-1241.292] (-1245.327) (-1247.830) -- 0:02:33
190000 -- [-1252.986] (-1249.900) (-1243.023) (-1252.191) * (-1250.432) (-1242.129) [-1248.414] (-1252.313) -- 0:02:37
Average standard deviation of split frequencies: 0.003956
190500 -- (-1255.537) [-1245.964] (-1246.478) (-1251.274) * (-1248.982) (-1248.045) [-1243.347] (-1244.425) -- 0:02:37
191000 -- (-1244.028) (-1251.585) [-1247.367] (-1249.230) * (-1245.813) [-1246.070] (-1248.438) (-1253.090) -- 0:02:36
191500 -- (-1256.784) (-1247.834) [-1244.381] (-1252.876) * (-1247.951) (-1251.742) (-1246.798) [-1246.510] -- 0:02:36
192000 -- (-1258.685) (-1251.460) [-1243.690] (-1245.555) * (-1247.278) (-1250.772) [-1252.221] (-1246.959) -- 0:02:35
192500 -- (-1246.858) [-1248.681] (-1250.491) (-1247.603) * [-1249.877] (-1245.331) (-1250.008) (-1253.156) -- 0:02:35
193000 -- [-1254.864] (-1249.515) (-1242.278) (-1251.773) * (-1245.073) [-1249.776] (-1250.067) (-1250.035) -- 0:02:34
193500 -- (-1254.481) (-1248.526) [-1241.964] (-1256.346) * (-1247.180) (-1244.407) (-1245.034) [-1248.579] -- 0:02:34
194000 -- (-1254.254) (-1242.666) (-1249.330) [-1253.571] * (-1245.256) (-1249.247) (-1251.295) [-1254.662] -- 0:02:33
194500 -- (-1244.108) (-1245.673) [-1248.112] (-1249.432) * (-1244.345) (-1250.479) (-1248.694) [-1249.144] -- 0:02:33
195000 -- (-1246.441) (-1245.638) [-1241.939] (-1244.954) * [-1250.058] (-1240.818) (-1247.376) (-1247.942) -- 0:02:32
Average standard deviation of split frequencies: 0.006253
195500 -- (-1247.731) (-1254.676) [-1248.389] (-1252.677) * (-1246.686) (-1246.797) (-1246.841) [-1244.171] -- 0:02:36
196000 -- (-1244.956) (-1247.316) (-1248.439) [-1250.219] * (-1243.670) (-1255.077) (-1246.867) [-1249.085] -- 0:02:35
196500 -- (-1256.214) [-1241.169] (-1244.384) (-1251.873) * (-1253.881) (-1251.916) [-1254.222] (-1251.424) -- 0:02:35
197000 -- (-1253.010) (-1247.610) (-1240.962) [-1247.486] * [-1242.629] (-1244.031) (-1250.865) (-1248.591) -- 0:02:34
197500 -- (-1255.934) (-1247.948) (-1244.874) [-1249.497] * (-1258.734) (-1253.404) [-1246.966] (-1242.653) -- 0:02:34
198000 -- (-1262.993) (-1249.440) (-1246.333) [-1246.857] * (-1249.581) [-1249.374] (-1248.105) (-1246.678) -- 0:02:33
198500 -- (-1258.709) (-1244.781) (-1257.674) [-1245.323] * (-1252.020) (-1252.103) (-1246.246) [-1245.314] -- 0:02:33
199000 -- (-1252.633) (-1245.744) [-1248.934] (-1250.587) * (-1249.693) [-1244.209] (-1246.649) (-1247.499) -- 0:02:32
199500 -- (-1250.332) (-1249.221) (-1250.100) [-1243.657] * [-1247.410] (-1247.275) (-1246.612) (-1249.088) -- 0:02:32
200000 -- (-1255.485) [-1250.421] (-1248.485) (-1244.959) * (-1247.181) (-1244.171) [-1245.840] (-1252.376) -- 0:02:32
Average standard deviation of split frequencies: 0.006108
200500 -- [-1248.256] (-1244.976) (-1249.814) (-1249.992) * (-1246.147) [-1251.743] (-1245.545) (-1254.775) -- 0:02:35
201000 -- (-1245.444) (-1245.774) (-1244.363) [-1244.570] * [-1244.415] (-1249.641) (-1254.420) (-1260.840) -- 0:02:35
201500 -- (-1246.277) (-1244.875) (-1247.772) [-1249.058] * [-1247.984] (-1247.591) (-1244.266) (-1253.219) -- 0:02:34
202000 -- (-1250.353) [-1249.837] (-1245.394) (-1248.056) * [-1248.439] (-1258.964) (-1246.169) (-1250.798) -- 0:02:34
202500 -- (-1251.581) (-1259.526) [-1239.908] (-1253.691) * (-1249.352) (-1248.122) (-1244.721) [-1248.455] -- 0:02:33
203000 -- (-1250.996) (-1244.458) [-1252.201] (-1250.879) * [-1243.595] (-1241.895) (-1247.866) (-1252.222) -- 0:02:33
203500 -- [-1243.703] (-1250.412) (-1248.514) (-1244.059) * (-1247.043) [-1246.855] (-1251.317) (-1250.188) -- 0:02:32
204000 -- (-1247.190) [-1248.888] (-1254.299) (-1244.451) * [-1250.816] (-1246.517) (-1255.016) (-1249.356) -- 0:02:32
204500 -- (-1246.211) (-1245.566) [-1254.521] (-1248.636) * [-1243.171] (-1251.191) (-1249.443) (-1247.112) -- 0:02:31
205000 -- (-1251.084) (-1252.965) [-1247.646] (-1250.846) * (-1249.436) [-1244.628] (-1246.594) (-1243.267) -- 0:02:31
Average standard deviation of split frequencies: 0.008238
205500 -- [-1246.202] (-1251.583) (-1253.481) (-1252.234) * (-1265.290) (-1244.866) (-1247.665) [-1250.057] -- 0:02:34
206000 -- (-1254.619) (-1243.417) (-1251.188) [-1243.156] * (-1256.965) (-1249.350) (-1247.235) [-1250.105] -- 0:02:34
206500 -- (-1250.943) (-1247.043) [-1243.270] (-1247.057) * (-1249.499) [-1249.463] (-1255.186) (-1246.046) -- 0:02:33
207000 -- (-1250.311) (-1248.542) [-1250.161] (-1246.590) * (-1251.891) (-1244.553) (-1246.361) [-1251.403] -- 0:02:33
207500 -- [-1250.129] (-1252.308) (-1249.627) (-1242.925) * (-1246.797) [-1248.620] (-1260.741) (-1251.588) -- 0:02:32
208000 -- (-1257.102) [-1244.720] (-1246.716) (-1256.557) * (-1245.568) [-1245.922] (-1252.709) (-1248.930) -- 0:02:32
208500 -- [-1246.838] (-1243.976) (-1251.254) (-1252.566) * [-1251.321] (-1254.886) (-1250.680) (-1249.981) -- 0:02:31
209000 -- (-1241.703) [-1247.667] (-1244.250) (-1250.538) * (-1246.612) [-1251.587] (-1246.475) (-1249.920) -- 0:02:31
209500 -- [-1249.856] (-1249.327) (-1242.899) (-1245.939) * (-1244.386) (-1245.904) [-1249.105] (-1245.260) -- 0:02:30
210000 -- [-1244.452] (-1249.999) (-1250.609) (-1253.067) * (-1244.851) (-1246.264) [-1248.648] (-1250.575) -- 0:02:30
Average standard deviation of split frequencies: 0.006713
210500 -- (-1253.156) (-1245.415) (-1255.054) [-1248.366] * [-1240.784] (-1246.958) (-1250.047) (-1247.578) -- 0:02:30
211000 -- [-1251.531] (-1244.265) (-1251.918) (-1243.902) * (-1247.341) [-1241.134] (-1243.867) (-1245.447) -- 0:02:33
211500 -- [-1250.802] (-1245.629) (-1252.120) (-1248.855) * [-1250.939] (-1251.928) (-1245.830) (-1249.413) -- 0:02:32
212000 -- (-1250.245) (-1244.895) [-1250.154] (-1243.773) * (-1263.189) [-1245.710] (-1253.665) (-1251.147) -- 0:02:32
212500 -- (-1250.975) (-1244.356) [-1254.119] (-1252.458) * [-1252.745] (-1252.937) (-1249.396) (-1248.247) -- 0:02:31
213000 -- (-1247.322) (-1246.460) (-1253.730) [-1248.844] * (-1246.575) (-1250.721) [-1243.082] (-1243.692) -- 0:02:31
213500 -- (-1252.522) (-1248.426) [-1253.306] (-1247.802) * [-1242.981] (-1250.030) (-1248.907) (-1244.762) -- 0:02:31
214000 -- (-1256.472) [-1247.817] (-1248.272) (-1243.271) * (-1251.753) (-1250.697) (-1249.057) [-1246.697] -- 0:02:30
214500 -- (-1247.202) (-1255.979) (-1249.995) [-1242.266] * (-1245.986) [-1247.254] (-1246.931) (-1248.949) -- 0:02:30
215000 -- (-1252.499) (-1246.339) (-1254.213) [-1243.700] * (-1247.476) (-1253.815) [-1242.210] (-1249.189) -- 0:02:29
Average standard deviation of split frequencies: 0.006111
215500 -- [-1246.034] (-1247.944) (-1250.848) (-1244.696) * (-1253.254) (-1246.274) (-1246.408) [-1248.797] -- 0:02:29
216000 -- (-1244.680) (-1248.280) (-1245.400) [-1244.791] * (-1248.802) (-1251.232) (-1246.812) [-1253.061] -- 0:02:28
216500 -- (-1249.779) (-1253.634) (-1249.835) [-1242.632] * (-1243.757) (-1248.254) [-1246.438] (-1248.293) -- 0:02:31
217000 -- (-1250.716) (-1251.825) (-1244.962) [-1243.646] * (-1246.473) [-1245.715] (-1253.772) (-1247.217) -- 0:02:31
217500 -- [-1247.589] (-1248.515) (-1256.926) (-1241.991) * (-1250.527) [-1245.844] (-1252.503) (-1243.529) -- 0:02:31
218000 -- (-1246.951) (-1246.120) [-1243.229] (-1247.556) * (-1245.303) (-1252.376) [-1253.680] (-1251.446) -- 0:02:30
218500 -- (-1248.354) (-1248.219) (-1245.906) [-1244.792] * (-1256.188) (-1245.209) (-1266.429) [-1258.007] -- 0:02:30
219000 -- [-1239.647] (-1256.546) (-1250.600) (-1252.420) * [-1249.766] (-1247.632) (-1254.256) (-1240.504) -- 0:02:29
219500 -- (-1249.144) (-1254.052) [-1247.003] (-1249.730) * (-1247.439) (-1252.233) (-1254.451) [-1240.576] -- 0:02:29
220000 -- (-1244.640) (-1263.211) (-1242.236) [-1246.105] * (-1248.918) [-1245.108] (-1253.562) (-1244.792) -- 0:02:28
Average standard deviation of split frequencies: 0.005554
220500 -- [-1243.230] (-1251.274) (-1242.250) (-1249.931) * [-1250.429] (-1250.387) (-1254.947) (-1246.015) -- 0:02:28
221000 -- (-1242.199) (-1258.159) [-1249.521] (-1250.742) * (-1255.095) [-1244.758] (-1252.258) (-1246.070) -- 0:02:28
221500 -- [-1246.236] (-1261.656) (-1248.552) (-1247.123) * (-1258.541) (-1242.568) (-1249.194) [-1244.298] -- 0:02:31
222000 -- (-1255.292) (-1265.310) [-1245.709] (-1249.667) * (-1251.888) (-1251.656) [-1248.467] (-1253.975) -- 0:02:30
222500 -- [-1242.526] (-1256.903) (-1246.356) (-1260.750) * (-1259.502) (-1255.079) [-1241.248] (-1251.319) -- 0:02:30
223000 -- (-1257.814) (-1249.883) [-1242.561] (-1255.265) * (-1250.917) (-1255.757) [-1241.984] (-1249.169) -- 0:02:29
223500 -- (-1263.476) [-1247.640] (-1249.595) (-1244.528) * (-1247.875) (-1257.796) (-1250.062) [-1246.428] -- 0:02:29
224000 -- (-1259.989) (-1249.101) [-1252.584] (-1251.987) * (-1249.346) (-1251.994) (-1253.199) [-1252.411] -- 0:02:28
224500 -- (-1251.504) [-1248.164] (-1248.573) (-1245.750) * (-1244.955) (-1259.843) [-1251.291] (-1250.656) -- 0:02:28
225000 -- (-1255.352) (-1244.214) [-1247.679] (-1247.523) * [-1246.332] (-1248.600) (-1251.041) (-1247.661) -- 0:02:28
Average standard deviation of split frequencies: 0.005006
225500 -- [-1253.435] (-1254.480) (-1248.568) (-1242.702) * (-1248.698) [-1258.494] (-1250.152) (-1252.839) -- 0:02:27
226000 -- [-1251.241] (-1252.865) (-1254.937) (-1245.401) * (-1252.850) (-1251.885) (-1250.639) [-1253.905] -- 0:02:27
226500 -- (-1258.039) (-1245.615) (-1248.064) [-1245.829] * [-1246.412] (-1253.452) (-1250.425) (-1245.866) -- 0:02:26
227000 -- [-1253.205] (-1246.378) (-1246.895) (-1252.236) * (-1249.470) (-1252.770) [-1248.688] (-1248.333) -- 0:02:29
227500 -- (-1253.954) (-1248.911) (-1253.971) [-1246.924] * [-1244.689] (-1253.631) (-1249.831) (-1244.226) -- 0:02:29
228000 -- (-1252.193) [-1243.304] (-1251.272) (-1252.009) * [-1248.421] (-1254.660) (-1251.090) (-1247.679) -- 0:02:28
228500 -- (-1244.170) (-1241.830) (-1249.778) [-1247.148] * (-1254.396) [-1250.229] (-1259.052) (-1243.399) -- 0:02:28
229000 -- [-1245.792] (-1246.520) (-1248.236) (-1246.146) * (-1249.821) (-1251.679) [-1250.159] (-1254.522) -- 0:02:28
229500 -- (-1246.357) [-1247.342] (-1244.883) (-1252.421) * (-1252.129) (-1252.131) (-1249.710) [-1243.828] -- 0:02:27
230000 -- (-1249.296) [-1246.539] (-1249.588) (-1250.547) * (-1245.754) (-1246.346) (-1247.109) [-1247.354] -- 0:02:27
Average standard deviation of split frequencies: 0.011853
230500 -- [-1250.548] (-1246.978) (-1248.100) (-1250.185) * (-1253.144) (-1244.823) [-1248.953] (-1245.511) -- 0:02:26
231000 -- (-1255.119) (-1247.606) (-1241.708) [-1250.737] * (-1247.320) [-1248.599] (-1247.348) (-1246.963) -- 0:02:26
231500 -- [-1252.928] (-1245.589) (-1246.927) (-1251.365) * [-1239.102] (-1251.920) (-1253.002) (-1253.638) -- 0:02:26
232000 -- [-1243.396] (-1249.856) (-1254.968) (-1247.879) * (-1252.362) [-1247.613] (-1251.914) (-1253.501) -- 0:02:28
232500 -- (-1249.957) (-1248.628) (-1251.998) [-1250.033] * [-1249.045] (-1254.570) (-1250.854) (-1249.791) -- 0:02:28
233000 -- (-1243.257) (-1259.071) (-1251.169) [-1252.186] * [-1250.423] (-1248.043) (-1261.210) (-1245.915) -- 0:02:28
233500 -- (-1250.776) (-1264.109) [-1249.979] (-1252.371) * [-1241.120] (-1246.065) (-1248.539) (-1255.197) -- 0:02:27
234000 -- (-1250.610) (-1250.298) (-1255.471) [-1250.459] * (-1243.331) [-1244.145] (-1246.145) (-1257.438) -- 0:02:27
234500 -- (-1244.639) (-1247.749) (-1245.216) [-1259.564] * (-1243.328) (-1244.516) (-1246.501) [-1248.197] -- 0:02:26
235000 -- [-1246.795] (-1254.902) (-1247.165) (-1242.989) * [-1248.433] (-1244.623) (-1242.933) (-1254.102) -- 0:02:26
Average standard deviation of split frequencies: 0.012784
235500 -- (-1247.547) [-1246.657] (-1249.933) (-1238.628) * (-1244.881) [-1244.974] (-1244.965) (-1247.947) -- 0:02:26
236000 -- (-1249.856) (-1252.431) [-1246.352] (-1248.200) * (-1250.716) [-1242.642] (-1255.703) (-1257.115) -- 0:02:25
236500 -- [-1245.445] (-1244.128) (-1246.202) (-1252.571) * (-1248.316) [-1246.003] (-1247.431) (-1245.829) -- 0:02:25
237000 -- (-1251.036) (-1241.199) [-1245.560] (-1252.705) * (-1258.266) (-1248.904) (-1242.957) [-1247.166] -- 0:02:24
237500 -- (-1246.681) (-1245.370) (-1250.249) [-1247.898] * (-1247.136) [-1240.706] (-1246.618) (-1248.577) -- 0:02:27
238000 -- [-1249.146] (-1247.729) (-1249.364) (-1243.025) * [-1242.904] (-1253.058) (-1254.002) (-1246.899) -- 0:02:27
238500 -- (-1250.377) [-1246.293] (-1258.653) (-1245.516) * (-1249.708) [-1246.250] (-1246.882) (-1245.989) -- 0:02:26
239000 -- (-1247.893) (-1245.338) (-1249.466) [-1243.647] * (-1260.255) [-1244.921] (-1246.429) (-1244.523) -- 0:02:26
239500 -- [-1244.159] (-1244.499) (-1250.261) (-1245.697) * (-1252.326) (-1244.752) [-1245.576] (-1250.660) -- 0:02:26
240000 -- (-1244.055) [-1244.889] (-1254.891) (-1252.160) * (-1249.702) (-1248.416) (-1244.158) [-1243.650] -- 0:02:25
Average standard deviation of split frequencies: 0.012536
240500 -- (-1253.188) [-1244.859] (-1251.907) (-1252.848) * [-1248.488] (-1254.772) (-1253.199) (-1247.977) -- 0:02:25
241000 -- [-1243.650] (-1253.576) (-1249.535) (-1244.359) * (-1253.259) (-1251.746) [-1249.142] (-1246.011) -- 0:02:24
241500 -- [-1251.280] (-1251.501) (-1253.534) (-1244.381) * [-1249.880] (-1245.304) (-1248.250) (-1245.115) -- 0:02:24
242000 -- (-1249.294) [-1245.323] (-1247.801) (-1242.346) * (-1255.035) (-1248.989) (-1242.995) [-1242.780] -- 0:02:24
242500 -- (-1249.652) [-1247.638] (-1247.298) (-1247.673) * (-1250.988) (-1244.730) [-1242.424] (-1248.683) -- 0:02:26
243000 -- (-1249.785) (-1250.545) (-1253.324) [-1246.692] * (-1249.330) [-1249.276] (-1249.209) (-1246.612) -- 0:02:26
243500 -- (-1248.201) [-1247.013] (-1253.625) (-1245.458) * (-1250.874) (-1249.166) [-1257.721] (-1247.693) -- 0:02:26
244000 -- (-1247.353) (-1244.033) (-1259.077) [-1244.484] * (-1246.605) (-1246.972) (-1251.283) [-1248.270] -- 0:02:25
244500 -- (-1247.130) (-1243.040) [-1243.642] (-1249.634) * (-1247.597) (-1245.769) [-1241.115] (-1248.930) -- 0:02:25
245000 -- (-1244.700) (-1242.645) [-1251.651] (-1251.179) * (-1250.057) (-1245.584) [-1241.077] (-1246.317) -- 0:02:24
Average standard deviation of split frequencies: 0.009581
245500 -- (-1243.657) [-1245.206] (-1259.045) (-1249.681) * (-1250.419) (-1248.009) [-1249.940] (-1253.517) -- 0:02:24
246000 -- (-1254.023) [-1245.549] (-1246.317) (-1250.032) * (-1245.488) (-1250.997) [-1241.274] (-1250.081) -- 0:02:24
246500 -- (-1249.992) [-1251.883] (-1247.538) (-1249.950) * [-1246.862] (-1245.161) (-1254.909) (-1244.794) -- 0:02:23
247000 -- (-1242.756) (-1248.017) (-1245.938) [-1245.747] * (-1246.681) (-1254.407) [-1248.715] (-1251.280) -- 0:02:23
247500 -- (-1244.721) (-1242.756) [-1246.015] (-1242.792) * [-1249.549] (-1248.868) (-1245.155) (-1250.653) -- 0:02:22
248000 -- [-1244.193] (-1242.988) (-1260.685) (-1246.213) * [-1248.619] (-1247.212) (-1244.884) (-1248.626) -- 0:02:25
248500 -- (-1244.520) (-1248.025) (-1253.338) [-1255.023] * [-1240.083] (-1243.798) (-1249.630) (-1245.298) -- 0:02:25
249000 -- (-1246.778) (-1248.136) [-1250.936] (-1247.799) * (-1252.851) (-1250.945) (-1250.395) [-1248.820] -- 0:02:24
249500 -- (-1242.992) [-1241.915] (-1246.171) (-1250.592) * (-1248.737) (-1243.561) (-1249.337) [-1246.911] -- 0:02:24
250000 -- (-1247.839) (-1252.213) (-1249.436) [-1248.090] * (-1249.198) (-1247.327) [-1251.458] (-1249.885) -- 0:02:24
Average standard deviation of split frequencies: 0.013164
250500 -- (-1258.317) [-1245.087] (-1247.144) (-1253.925) * (-1243.612) (-1254.761) [-1244.300] (-1246.743) -- 0:02:23
251000 -- (-1250.935) [-1244.769] (-1251.928) (-1247.102) * (-1243.968) (-1244.513) (-1254.903) [-1247.308] -- 0:02:23
251500 -- [-1245.359] (-1248.161) (-1250.816) (-1252.120) * [-1244.692] (-1242.843) (-1256.554) (-1246.070) -- 0:02:22
252000 -- (-1250.119) [-1245.899] (-1253.014) (-1245.147) * (-1248.184) [-1241.748] (-1247.198) (-1255.555) -- 0:02:22
252500 -- [-1243.730] (-1250.639) (-1255.965) (-1252.611) * [-1251.082] (-1251.948) (-1261.350) (-1247.211) -- 0:02:22
253000 -- (-1247.730) (-1247.931) (-1259.616) [-1243.435] * (-1249.069) [-1245.698] (-1249.008) (-1248.098) -- 0:02:24
253500 -- [-1248.041] (-1251.144) (-1258.296) (-1254.808) * [-1248.270] (-1247.830) (-1251.260) (-1252.074) -- 0:02:24
254000 -- (-1246.418) (-1247.421) [-1252.531] (-1249.703) * [-1246.777] (-1247.268) (-1251.604) (-1248.540) -- 0:02:23
254500 -- (-1247.337) (-1253.163) (-1261.915) [-1248.117] * (-1254.331) [-1244.965] (-1244.673) (-1248.794) -- 0:02:23
255000 -- (-1251.039) [-1252.673] (-1245.831) (-1249.358) * (-1249.389) [-1241.912] (-1250.346) (-1248.232) -- 0:02:23
Average standard deviation of split frequencies: 0.011785
255500 -- (-1247.439) [-1243.266] (-1250.227) (-1243.185) * (-1247.211) (-1244.774) [-1247.778] (-1254.098) -- 0:02:22
256000 -- (-1243.560) (-1246.918) (-1250.364) [-1240.586] * (-1255.919) (-1249.539) (-1250.382) [-1242.501] -- 0:02:22
256500 -- (-1246.996) (-1247.971) (-1247.235) [-1244.757] * (-1252.936) (-1248.436) (-1247.090) [-1245.410] -- 0:02:22
257000 -- (-1244.300) [-1243.896] (-1245.982) (-1253.349) * (-1247.291) (-1249.840) [-1255.078] (-1246.660) -- 0:02:21
257500 -- (-1247.463) (-1248.704) (-1251.861) [-1246.958] * (-1248.088) [-1245.485] (-1255.613) (-1248.999) -- 0:02:21
258000 -- [-1247.035] (-1249.611) (-1250.234) (-1247.273) * (-1245.802) (-1251.638) (-1246.093) [-1242.975] -- 0:02:23
258500 -- [-1244.183] (-1254.545) (-1244.864) (-1243.634) * [-1246.129] (-1248.530) (-1251.164) (-1248.568) -- 0:02:23
259000 -- (-1245.892) (-1246.929) [-1245.291] (-1252.568) * [-1247.839] (-1245.715) (-1254.078) (-1251.390) -- 0:02:23
259500 -- (-1253.602) (-1247.531) [-1247.733] (-1247.027) * (-1241.370) (-1255.243) (-1248.338) [-1241.972] -- 0:02:22
260000 -- [-1244.134] (-1242.740) (-1249.891) (-1250.303) * [-1247.094] (-1257.221) (-1244.715) (-1255.642) -- 0:02:22
Average standard deviation of split frequencies: 0.012659
260500 -- (-1255.391) [-1248.626] (-1246.719) (-1243.028) * (-1246.896) [-1243.162] (-1240.552) (-1252.340) -- 0:02:21
261000 -- (-1245.658) (-1246.596) [-1242.160] (-1248.609) * (-1244.996) (-1246.983) [-1245.672] (-1245.245) -- 0:02:21
261500 -- (-1248.935) (-1242.849) [-1242.985] (-1251.417) * [-1242.680] (-1243.501) (-1244.001) (-1247.711) -- 0:02:21
262000 -- (-1250.496) (-1248.660) (-1250.459) [-1245.137] * (-1243.130) (-1252.731) (-1250.174) [-1249.226] -- 0:02:20
262500 -- (-1252.248) [-1244.705] (-1247.398) (-1247.194) * (-1252.121) (-1248.461) (-1254.520) [-1248.183] -- 0:02:20
263000 -- [-1246.961] (-1254.013) (-1241.881) (-1252.806) * (-1252.737) (-1245.540) [-1253.909] (-1240.570) -- 0:02:22
263500 -- (-1248.253) [-1258.581] (-1246.316) (-1259.873) * (-1256.129) [-1263.882] (-1253.506) (-1241.804) -- 0:02:22
264000 -- (-1248.207) [-1242.945] (-1249.284) (-1242.023) * (-1250.746) (-1253.445) [-1252.071] (-1249.708) -- 0:02:22
264500 -- [-1242.491] (-1253.225) (-1246.733) (-1241.196) * (-1248.318) [-1251.418] (-1260.167) (-1244.839) -- 0:02:21
265000 -- (-1250.135) (-1252.387) [-1243.574] (-1244.402) * (-1255.715) (-1247.108) (-1253.534) [-1250.825] -- 0:02:21
Average standard deviation of split frequencies: 0.008152
265500 -- [-1248.047] (-1254.067) (-1255.992) (-1242.674) * (-1250.826) (-1243.380) (-1251.052) [-1242.871] -- 0:02:21
266000 -- (-1250.015) (-1260.574) [-1250.690] (-1247.400) * (-1247.365) [-1249.283] (-1253.553) (-1250.055) -- 0:02:20
266500 -- (-1253.354) (-1254.448) (-1248.128) [-1244.906] * (-1250.006) (-1246.219) [-1246.003] (-1254.835) -- 0:02:20
267000 -- (-1248.130) [-1251.293] (-1248.936) (-1256.773) * (-1251.726) [-1252.802] (-1243.766) (-1249.105) -- 0:02:20
267500 -- (-1249.319) (-1249.874) [-1248.015] (-1245.407) * (-1249.865) (-1244.390) [-1242.704] (-1241.985) -- 0:02:19
268000 -- [-1247.154] (-1261.714) (-1253.295) (-1251.531) * [-1249.156] (-1243.594) (-1250.822) (-1254.386) -- 0:02:19
268500 -- [-1251.451] (-1252.399) (-1247.591) (-1242.365) * (-1248.980) [-1249.663] (-1256.466) (-1244.364) -- 0:02:21
269000 -- [-1246.455] (-1244.807) (-1245.951) (-1245.143) * (-1249.103) (-1244.798) (-1248.858) [-1246.779] -- 0:02:21
269500 -- [-1251.270] (-1246.327) (-1246.281) (-1245.207) * (-1249.746) (-1250.912) [-1251.560] (-1246.675) -- 0:02:20
270000 -- [-1249.127] (-1253.435) (-1251.012) (-1244.841) * (-1248.705) (-1248.635) (-1249.461) [-1250.435] -- 0:02:20
Average standard deviation of split frequencies: 0.011843
270500 -- (-1243.655) [-1248.611] (-1255.628) (-1241.438) * [-1245.624] (-1247.208) (-1248.365) (-1245.875) -- 0:02:20
271000 -- (-1255.760) [-1244.202] (-1246.688) (-1249.154) * [-1247.985] (-1245.297) (-1248.846) (-1253.518) -- 0:02:19
271500 -- (-1249.408) [-1245.515] (-1255.546) (-1249.258) * (-1248.519) (-1246.836) (-1241.832) [-1246.390] -- 0:02:19
272000 -- [-1243.890] (-1253.754) (-1249.928) (-1246.961) * (-1252.605) (-1249.781) [-1245.704] (-1247.894) -- 0:02:19
272500 -- (-1243.842) (-1244.673) (-1248.936) [-1247.244] * (-1249.272) (-1247.489) (-1243.212) [-1250.427] -- 0:02:21
273000 -- (-1243.377) (-1248.576) (-1250.672) [-1250.528] * (-1257.708) (-1244.991) (-1246.796) [-1244.301] -- 0:02:21
273500 -- (-1257.516) (-1255.349) (-1252.876) [-1244.026] * (-1252.131) (-1253.328) (-1255.029) [-1242.588] -- 0:02:20
274000 -- [-1246.893] (-1243.781) (-1247.464) (-1256.514) * [-1247.434] (-1247.786) (-1251.417) (-1251.195) -- 0:02:20
274500 -- [-1244.351] (-1255.403) (-1246.140) (-1249.531) * (-1246.774) (-1251.607) (-1248.708) [-1246.351] -- 0:02:20
275000 -- (-1244.193) (-1240.505) (-1250.055) [-1246.294] * (-1251.847) [-1255.627] (-1252.375) (-1246.292) -- 0:02:19
Average standard deviation of split frequencies: 0.010248
275500 -- [-1248.083] (-1242.294) (-1245.305) (-1247.511) * (-1252.194) (-1254.211) (-1247.322) [-1242.399] -- 0:02:19
276000 -- [-1244.571] (-1248.465) (-1250.625) (-1254.601) * (-1244.040) [-1252.156] (-1242.022) (-1245.093) -- 0:02:19
276500 -- (-1245.118) (-1251.140) (-1243.575) [-1244.795] * (-1249.593) (-1248.515) (-1252.039) [-1246.954] -- 0:02:18
277000 -- (-1249.679) [-1241.777] (-1247.147) (-1250.034) * [-1241.017] (-1246.168) (-1245.076) (-1248.168) -- 0:02:20
277500 -- (-1246.208) (-1246.691) [-1245.330] (-1248.457) * [-1244.186] (-1251.673) (-1246.740) (-1243.621) -- 0:02:20
278000 -- (-1250.710) (-1240.061) [-1244.784] (-1255.831) * (-1251.190) (-1255.129) (-1246.960) [-1256.365] -- 0:02:20
278500 -- (-1250.392) (-1254.516) (-1248.892) [-1247.964] * [-1253.144] (-1248.646) (-1248.495) (-1245.741) -- 0:02:19
279000 -- [-1242.216] (-1256.246) (-1248.937) (-1245.899) * (-1253.095) (-1251.552) [-1242.888] (-1246.778) -- 0:02:19
279500 -- (-1246.837) (-1246.088) (-1245.981) [-1249.803] * (-1254.037) (-1249.311) [-1243.977] (-1246.254) -- 0:02:19
280000 -- [-1254.878] (-1251.024) (-1250.250) (-1248.861) * [-1248.380] (-1253.334) (-1244.870) (-1245.812) -- 0:02:18
Average standard deviation of split frequencies: 0.011421
280500 -- (-1252.394) [-1245.504] (-1248.594) (-1250.095) * (-1247.393) [-1250.865] (-1257.235) (-1246.485) -- 0:02:18
281000 -- (-1252.094) [-1242.918] (-1254.324) (-1252.634) * (-1245.022) [-1245.848] (-1249.054) (-1252.699) -- 0:02:18
281500 -- (-1249.799) (-1246.160) [-1253.222] (-1240.622) * (-1250.526) (-1249.918) [-1243.080] (-1250.349) -- 0:02:17
282000 -- [-1243.686] (-1258.196) (-1255.894) (-1248.947) * [-1247.576] (-1251.568) (-1245.348) (-1247.722) -- 0:02:20
282500 -- (-1249.835) (-1251.233) [-1248.834] (-1245.265) * (-1252.109) (-1257.675) (-1251.364) [-1251.062] -- 0:02:19
283000 -- (-1247.844) (-1251.304) [-1249.071] (-1245.736) * [-1255.211] (-1251.303) (-1246.205) (-1243.519) -- 0:02:19
283500 -- (-1245.623) (-1248.088) [-1252.906] (-1244.930) * (-1245.120) (-1245.345) [-1247.451] (-1252.037) -- 0:02:19
284000 -- [-1247.958] (-1246.470) (-1248.682) (-1244.056) * (-1244.062) (-1249.991) (-1246.125) [-1244.026] -- 0:02:18
284500 -- (-1256.281) (-1255.863) (-1257.267) [-1243.949] * (-1247.122) (-1251.474) (-1249.021) [-1246.491] -- 0:02:18
285000 -- (-1248.724) [-1247.754] (-1252.213) (-1247.498) * (-1252.421) (-1249.413) (-1248.983) [-1246.504] -- 0:02:17
Average standard deviation of split frequencies: 0.012856
285500 -- [-1249.954] (-1251.461) (-1244.451) (-1250.385) * (-1247.906) (-1246.286) (-1245.383) [-1248.409] -- 0:02:17
286000 -- (-1245.864) (-1270.301) [-1247.333] (-1248.553) * (-1247.905) [-1247.171] (-1248.833) (-1245.590) -- 0:02:17
286500 -- (-1250.992) (-1252.056) (-1246.453) [-1247.684] * (-1245.323) (-1251.562) [-1248.614] (-1242.837) -- 0:02:16
287000 -- (-1250.725) (-1254.866) [-1245.833] (-1244.604) * (-1243.333) (-1247.842) (-1244.160) [-1242.615] -- 0:02:19
287500 -- [-1247.863] (-1254.057) (-1245.146) (-1250.292) * (-1255.697) (-1250.548) (-1249.852) [-1243.145] -- 0:02:18
288000 -- (-1244.022) (-1248.879) (-1247.362) [-1244.677] * (-1242.688) (-1250.383) (-1246.596) [-1246.816] -- 0:02:18
288500 -- (-1249.326) [-1249.593] (-1246.485) (-1246.375) * (-1243.362) (-1252.496) [-1244.854] (-1264.904) -- 0:02:18
289000 -- [-1242.242] (-1247.111) (-1246.830) (-1249.546) * (-1248.809) (-1249.442) (-1250.623) [-1248.391] -- 0:02:17
289500 -- (-1248.852) [-1246.701] (-1252.651) (-1254.540) * [-1249.757] (-1261.061) (-1248.031) (-1250.299) -- 0:02:17
290000 -- (-1250.070) [-1243.030] (-1251.158) (-1256.462) * (-1260.270) [-1246.141] (-1243.847) (-1246.415) -- 0:02:17
Average standard deviation of split frequencies: 0.016218
290500 -- [-1242.591] (-1242.908) (-1241.721) (-1255.177) * [-1248.354] (-1246.510) (-1248.402) (-1258.435) -- 0:02:16
291000 -- (-1250.893) [-1243.337] (-1243.415) (-1255.287) * (-1248.639) [-1254.786] (-1242.371) (-1250.506) -- 0:02:16
291500 -- (-1249.277) [-1244.982] (-1254.495) (-1251.413) * (-1250.098) [-1250.880] (-1250.060) (-1248.023) -- 0:02:16
292000 -- (-1259.969) (-1248.530) [-1248.698] (-1246.373) * (-1245.702) (-1255.119) (-1258.697) [-1249.902] -- 0:02:15
292500 -- (-1246.286) (-1249.652) (-1244.730) [-1248.551] * (-1242.478) (-1251.115) [-1242.045] (-1253.697) -- 0:02:17
293000 -- (-1246.783) (-1247.012) (-1250.564) [-1247.517] * (-1243.950) [-1251.946] (-1246.991) (-1245.165) -- 0:02:17
293500 -- [-1246.361] (-1253.734) (-1248.808) (-1243.928) * (-1247.040) (-1246.835) (-1248.122) [-1244.768] -- 0:02:17
294000 -- (-1250.688) (-1247.268) [-1250.701] (-1246.710) * (-1248.112) (-1248.875) [-1247.528] (-1246.355) -- 0:02:16
294500 -- [-1251.142] (-1249.033) (-1254.793) (-1250.312) * [-1248.185] (-1244.684) (-1253.937) (-1247.950) -- 0:02:16
295000 -- [-1247.824] (-1249.416) (-1251.510) (-1245.817) * (-1246.807) [-1247.954] (-1247.593) (-1251.400) -- 0:02:16
Average standard deviation of split frequencies: 0.016881
295500 -- [-1248.556] (-1247.289) (-1259.608) (-1243.724) * (-1248.099) (-1251.115) (-1244.821) [-1250.743] -- 0:02:15
296000 -- (-1248.971) (-1243.434) (-1250.716) [-1247.840] * [-1249.389] (-1250.976) (-1246.627) (-1256.820) -- 0:02:15
296500 -- [-1245.541] (-1252.202) (-1245.104) (-1250.770) * (-1241.432) (-1246.195) (-1254.643) [-1243.801] -- 0:02:15
297000 -- [-1247.834] (-1246.997) (-1249.201) (-1260.053) * (-1249.147) (-1246.663) [-1247.878] (-1253.465) -- 0:02:17
297500 -- (-1249.290) [-1251.504] (-1244.763) (-1251.848) * (-1244.292) (-1246.875) [-1244.851] (-1252.177) -- 0:02:16
298000 -- (-1251.498) (-1250.451) [-1249.790] (-1244.485) * (-1246.327) (-1250.640) [-1249.137] (-1255.708) -- 0:02:16
298500 -- (-1245.048) [-1244.164] (-1248.043) (-1249.382) * (-1250.576) (-1248.939) (-1249.901) [-1250.232] -- 0:02:16
299000 -- (-1244.063) (-1251.822) [-1244.667] (-1248.178) * [-1245.759] (-1241.505) (-1246.438) (-1242.623) -- 0:02:15
299500 -- (-1244.995) (-1252.093) [-1251.417] (-1245.851) * (-1250.117) (-1248.969) [-1250.761] (-1254.878) -- 0:02:15
300000 -- (-1252.109) [-1251.581] (-1251.923) (-1253.717) * (-1244.507) (-1245.220) (-1251.274) [-1249.630] -- 0:02:15
Average standard deviation of split frequencies: 0.017560
300500 -- (-1248.563) [-1247.998] (-1251.378) (-1248.842) * (-1255.380) (-1251.438) [-1248.343] (-1244.280) -- 0:02:15
301000 -- (-1247.319) (-1252.009) [-1244.817] (-1247.513) * [-1246.327] (-1252.066) (-1245.401) (-1250.359) -- 0:02:17
301500 -- (-1252.250) [-1250.784] (-1251.811) (-1248.798) * [-1246.908] (-1252.555) (-1250.227) (-1253.253) -- 0:02:16
302000 -- (-1250.358) (-1248.074) [-1245.804] (-1249.266) * (-1249.043) [-1249.594] (-1249.691) (-1250.004) -- 0:02:16
302500 -- (-1252.016) (-1258.774) (-1243.901) [-1249.066] * [-1254.910] (-1248.432) (-1248.304) (-1254.513) -- 0:02:16
303000 -- (-1255.405) (-1254.152) (-1253.647) [-1250.648] * (-1258.368) (-1252.119) (-1253.879) [-1243.164] -- 0:02:15
303500 -- (-1249.065) [-1245.836] (-1246.041) (-1255.983) * [-1250.090] (-1251.073) (-1246.124) (-1247.068) -- 0:02:15
304000 -- (-1253.687) (-1241.640) [-1247.347] (-1249.380) * (-1248.385) (-1250.057) (-1246.006) [-1246.195] -- 0:02:15
304500 -- [-1257.680] (-1242.905) (-1247.921) (-1249.267) * (-1254.207) (-1251.335) (-1248.992) [-1246.510] -- 0:02:14
305000 -- (-1253.285) (-1245.795) (-1245.461) [-1245.455] * (-1247.485) (-1248.955) (-1256.593) [-1254.645] -- 0:02:14
Average standard deviation of split frequencies: 0.016330
305500 -- (-1253.641) (-1248.708) [-1243.377] (-1244.333) * (-1244.652) [-1246.307] (-1247.334) (-1261.545) -- 0:02:14
306000 -- [-1248.876] (-1259.592) (-1248.175) (-1250.245) * (-1251.111) [-1243.499] (-1247.317) (-1246.390) -- 0:02:16
306500 -- (-1254.294) [-1243.065] (-1247.394) (-1243.762) * (-1246.536) [-1244.684] (-1248.037) (-1244.187) -- 0:02:15
307000 -- [-1246.271] (-1250.468) (-1246.824) (-1245.973) * (-1250.751) (-1245.509) [-1246.552] (-1250.736) -- 0:02:15
307500 -- (-1245.990) [-1251.185] (-1250.471) (-1251.255) * [-1252.017] (-1254.350) (-1245.721) (-1250.155) -- 0:02:15
308000 -- [-1242.115] (-1258.035) (-1245.559) (-1255.044) * [-1248.638] (-1246.908) (-1249.354) (-1250.280) -- 0:02:14
308500 -- [-1244.335] (-1256.138) (-1254.292) (-1250.181) * [-1249.929] (-1250.491) (-1244.254) (-1245.976) -- 0:02:14
309000 -- (-1246.154) (-1249.159) (-1254.434) [-1246.038] * [-1247.791] (-1242.105) (-1252.922) (-1249.645) -- 0:02:14
309500 -- (-1241.209) (-1248.708) (-1246.726) [-1245.200] * (-1248.512) (-1246.419) (-1249.377) [-1248.863] -- 0:02:13
310000 -- (-1238.639) [-1253.041] (-1251.605) (-1245.504) * (-1241.587) [-1246.493] (-1249.359) (-1256.702) -- 0:02:13
Average standard deviation of split frequencies: 0.017298
310500 -- [-1244.030] (-1252.164) (-1246.859) (-1250.720) * (-1258.763) [-1247.796] (-1253.891) (-1247.682) -- 0:02:13
311000 -- [-1244.432] (-1244.652) (-1245.796) (-1246.667) * (-1252.947) [-1246.893] (-1248.496) (-1252.784) -- 0:02:15
311500 -- (-1246.366) (-1247.099) (-1258.290) [-1250.575] * (-1246.800) [-1245.964] (-1244.037) (-1244.875) -- 0:02:14
312000 -- (-1243.463) (-1252.650) (-1250.639) [-1256.194] * [-1249.062] (-1250.895) (-1244.142) (-1257.754) -- 0:02:14
312500 -- [-1254.023] (-1247.756) (-1253.132) (-1250.154) * (-1254.262) [-1252.237] (-1247.138) (-1246.827) -- 0:02:14
313000 -- (-1257.030) (-1247.945) [-1248.533] (-1247.644) * [-1242.081] (-1245.516) (-1259.912) (-1250.644) -- 0:02:13
313500 -- (-1248.544) (-1248.410) [-1246.371] (-1249.556) * [-1243.905] (-1250.485) (-1248.696) (-1245.809) -- 0:02:13
314000 -- (-1257.939) (-1252.343) (-1245.905) [-1250.101] * [-1251.135] (-1246.769) (-1245.585) (-1247.472) -- 0:02:13
314500 -- (-1246.367) (-1250.652) (-1244.781) [-1253.008] * (-1252.944) (-1247.469) [-1240.556] (-1254.058) -- 0:02:12
315000 -- (-1245.865) (-1246.177) [-1249.729] (-1245.398) * [-1246.782] (-1245.208) (-1251.430) (-1250.301) -- 0:02:12
Average standard deviation of split frequencies: 0.017603
315500 -- (-1242.330) (-1258.684) (-1249.791) [-1247.974] * [-1249.190] (-1249.450) (-1247.596) (-1251.481) -- 0:02:12
316000 -- (-1244.853) (-1249.048) (-1244.252) [-1249.264] * (-1255.239) (-1254.186) (-1243.510) [-1246.189] -- 0:02:12
316500 -- (-1243.600) [-1250.452] (-1250.394) (-1255.129) * (-1250.666) (-1249.201) (-1245.432) [-1244.040] -- 0:02:13
317000 -- [-1246.386] (-1248.684) (-1248.822) (-1255.286) * (-1251.481) (-1251.868) (-1243.731) [-1244.735] -- 0:02:13
317500 -- (-1250.210) (-1252.645) [-1241.203] (-1249.003) * (-1248.082) (-1245.783) [-1246.938] (-1246.120) -- 0:02:13
318000 -- (-1249.164) (-1248.082) (-1248.880) [-1246.170] * (-1260.117) [-1247.547] (-1240.963) (-1251.372) -- 0:02:12
318500 -- (-1250.385) (-1255.237) (-1245.357) [-1252.272] * (-1251.003) (-1246.095) [-1240.916] (-1246.070) -- 0:02:12
319000 -- (-1249.063) (-1251.691) (-1248.436) [-1250.768] * (-1251.805) [-1249.401] (-1250.216) (-1248.187) -- 0:02:12
319500 -- (-1250.215) (-1251.983) [-1243.243] (-1255.407) * (-1245.689) (-1249.115) (-1257.766) [-1250.784] -- 0:02:12
320000 -- [-1243.630] (-1246.065) (-1247.555) (-1246.147) * [-1249.331] (-1247.676) (-1248.570) (-1251.838) -- 0:02:11
Average standard deviation of split frequencies: 0.017347
320500 -- (-1249.699) (-1251.159) (-1242.288) [-1242.436] * (-1247.826) [-1250.158] (-1248.734) (-1253.033) -- 0:02:11
321000 -- [-1250.438] (-1253.499) (-1255.968) (-1248.843) * (-1245.574) (-1259.496) (-1245.933) [-1244.928] -- 0:02:11
321500 -- (-1250.751) (-1254.618) (-1249.126) [-1244.740] * [-1245.174] (-1251.622) (-1248.907) (-1243.372) -- 0:02:12
322000 -- (-1249.039) (-1246.519) [-1245.963] (-1243.184) * (-1245.644) (-1251.664) (-1248.151) [-1254.463] -- 0:02:12
322500 -- (-1259.329) (-1252.662) [-1249.888] (-1254.463) * (-1246.798) [-1252.435] (-1254.940) (-1242.304) -- 0:02:12
323000 -- [-1247.725] (-1254.572) (-1246.156) (-1250.852) * [-1253.150] (-1248.717) (-1249.276) (-1243.578) -- 0:02:12
323500 -- (-1242.933) [-1243.253] (-1248.709) (-1253.165) * (-1248.101) (-1254.144) (-1247.589) [-1240.829] -- 0:02:11
324000 -- (-1243.041) (-1247.173) [-1248.125] (-1252.713) * [-1254.490] (-1248.456) (-1246.434) (-1250.486) -- 0:02:11
324500 -- (-1252.377) [-1252.659] (-1249.112) (-1254.234) * (-1250.970) (-1250.027) (-1259.673) [-1252.525] -- 0:02:11
325000 -- (-1244.058) (-1250.459) (-1252.027) [-1247.968] * [-1245.225] (-1246.678) (-1251.716) (-1254.713) -- 0:02:10
Average standard deviation of split frequencies: 0.016485
325500 -- (-1250.894) (-1248.004) (-1252.825) [-1243.895] * [-1243.754] (-1248.628) (-1260.624) (-1252.052) -- 0:02:10
326000 -- (-1247.814) [-1255.257] (-1255.760) (-1252.500) * [-1254.049] (-1251.538) (-1249.632) (-1252.239) -- 0:02:10
326500 -- (-1249.358) [-1245.484] (-1254.219) (-1251.252) * (-1245.795) [-1244.007] (-1247.142) (-1248.034) -- 0:02:12
327000 -- (-1261.951) (-1253.039) (-1247.308) [-1249.159] * (-1242.829) [-1245.407] (-1252.602) (-1258.049) -- 0:02:11
327500 -- [-1249.757] (-1245.781) (-1243.058) (-1244.174) * (-1250.922) (-1256.142) (-1254.549) [-1247.150] -- 0:02:11
328000 -- [-1245.542] (-1252.573) (-1248.036) (-1241.981) * [-1241.245] (-1251.524) (-1246.581) (-1248.531) -- 0:02:11
328500 -- (-1247.216) (-1254.852) [-1250.482] (-1252.823) * (-1255.378) (-1248.283) [-1243.477] (-1254.600) -- 0:02:10
329000 -- [-1246.519] (-1249.569) (-1254.708) (-1251.021) * (-1252.764) [-1249.897] (-1246.053) (-1243.050) -- 0:02:10
329500 -- (-1250.401) (-1252.375) (-1243.834) [-1247.641] * (-1255.622) (-1252.172) (-1248.269) [-1244.354] -- 0:02:10
330000 -- (-1251.144) (-1259.717) [-1246.347] (-1250.957) * (-1247.090) [-1253.190] (-1247.062) (-1250.163) -- 0:02:09
Average standard deviation of split frequencies: 0.015682
330500 -- (-1255.766) [-1248.073] (-1247.740) (-1249.648) * (-1250.570) (-1248.613) [-1246.627] (-1249.074) -- 0:02:09
331000 -- [-1244.013] (-1255.007) (-1251.810) (-1245.344) * [-1247.775] (-1248.775) (-1242.476) (-1253.111) -- 0:02:09
331500 -- (-1253.845) [-1247.092] (-1251.670) (-1253.093) * (-1248.993) [-1243.989] (-1247.224) (-1245.224) -- 0:02:11
332000 -- (-1244.512) [-1243.863] (-1254.168) (-1245.998) * (-1255.409) (-1249.006) [-1245.200] (-1248.871) -- 0:02:10
332500 -- (-1247.782) (-1249.265) (-1251.806) [-1247.242] * (-1244.349) (-1246.510) [-1247.863] (-1253.809) -- 0:02:10
333000 -- [-1252.763] (-1246.633) (-1255.055) (-1246.049) * (-1241.815) (-1255.025) [-1246.067] (-1258.091) -- 0:02:10
333500 -- (-1245.795) (-1251.654) [-1248.373] (-1245.965) * (-1245.097) (-1244.357) [-1255.742] (-1254.599) -- 0:02:09
334000 -- (-1243.882) [-1243.613] (-1240.961) (-1255.518) * (-1251.699) (-1247.462) (-1253.550) [-1254.121] -- 0:02:09
334500 -- (-1247.445) (-1248.504) [-1249.330] (-1247.486) * [-1247.245] (-1253.303) (-1249.976) (-1247.199) -- 0:02:09
335000 -- [-1248.996] (-1252.193) (-1245.661) (-1253.896) * (-1246.733) (-1251.583) (-1244.597) [-1242.635] -- 0:02:09
Average standard deviation of split frequencies: 0.016555
335500 -- (-1250.901) (-1251.556) [-1242.824] (-1253.916) * (-1245.803) (-1250.998) [-1244.455] (-1251.113) -- 0:02:08
336000 -- (-1244.588) (-1252.246) [-1246.703] (-1248.211) * (-1247.480) (-1251.135) [-1242.547] (-1250.004) -- 0:02:10
336500 -- (-1243.938) (-1246.320) [-1245.967] (-1249.955) * (-1244.608) [-1249.341] (-1250.336) (-1253.404) -- 0:02:10
337000 -- (-1249.402) (-1259.302) (-1244.857) [-1247.391] * (-1251.999) (-1252.775) (-1252.956) [-1252.665] -- 0:02:09
337500 -- (-1245.546) (-1247.277) (-1246.779) [-1244.846] * (-1253.124) [-1246.228] (-1249.080) (-1247.552) -- 0:02:09
338000 -- [-1248.164] (-1251.871) (-1251.390) (-1248.402) * (-1248.154) (-1250.555) (-1254.829) [-1251.365] -- 0:02:09
338500 -- (-1248.699) [-1251.012] (-1251.646) (-1252.975) * (-1244.171) [-1248.019] (-1249.600) (-1250.203) -- 0:02:08
339000 -- (-1241.414) [-1244.023] (-1249.206) (-1248.511) * (-1250.373) (-1254.865) [-1245.970] (-1245.093) -- 0:02:08
339500 -- (-1249.104) (-1247.607) [-1241.597] (-1250.414) * (-1243.839) (-1258.481) (-1242.509) [-1242.287] -- 0:02:08
340000 -- (-1247.097) (-1250.576) [-1242.754] (-1250.242) * (-1249.998) [-1248.066] (-1248.871) (-1248.500) -- 0:02:08
Average standard deviation of split frequencies: 0.015221
340500 -- (-1246.970) (-1252.429) [-1240.312] (-1248.910) * (-1249.800) (-1249.594) [-1255.935] (-1243.829) -- 0:02:09
341000 -- [-1247.373] (-1241.644) (-1243.336) (-1244.881) * [-1245.119] (-1252.416) (-1260.194) (-1251.120) -- 0:02:09
341500 -- (-1246.617) (-1246.608) (-1246.782) [-1245.754] * [-1243.942] (-1251.074) (-1245.451) (-1260.053) -- 0:02:09
342000 -- (-1251.946) (-1259.187) [-1244.418] (-1257.235) * [-1247.885] (-1242.956) (-1250.128) (-1254.324) -- 0:02:08
342500 -- [-1241.866] (-1248.034) (-1249.221) (-1250.643) * (-1244.903) (-1253.684) [-1252.344] (-1248.431) -- 0:02:08
343000 -- (-1247.114) [-1241.992] (-1247.363) (-1251.843) * (-1251.493) (-1251.235) (-1246.922) [-1251.888] -- 0:02:08
343500 -- (-1248.845) [-1246.180] (-1246.699) (-1251.064) * [-1248.283] (-1246.101) (-1253.186) (-1252.764) -- 0:02:08
344000 -- (-1255.873) [-1242.991] (-1248.837) (-1258.697) * (-1252.948) (-1252.871) (-1242.183) [-1251.127] -- 0:02:07
344500 -- (-1251.687) (-1250.411) [-1246.376] (-1256.210) * [-1249.036] (-1245.889) (-1250.414) (-1247.520) -- 0:02:07
345000 -- [-1253.906] (-1250.568) (-1247.418) (-1253.133) * (-1247.778) (-1251.445) [-1246.463] (-1247.532) -- 0:02:07
Average standard deviation of split frequencies: 0.013352
345500 -- (-1247.409) (-1243.993) (-1250.946) [-1253.009] * (-1254.001) [-1246.006] (-1246.200) (-1255.795) -- 0:02:08
346000 -- (-1244.733) (-1243.380) [-1250.586] (-1253.826) * [-1247.317] (-1241.857) (-1257.330) (-1251.208) -- 0:02:08
346500 -- (-1243.494) (-1251.073) (-1254.676) [-1249.576] * (-1243.707) [-1244.337] (-1248.220) (-1247.910) -- 0:02:08
347000 -- (-1241.496) [-1247.205] (-1254.604) (-1247.927) * (-1246.756) [-1246.934] (-1251.095) (-1249.840) -- 0:02:07
347500 -- [-1244.140] (-1247.524) (-1245.913) (-1248.054) * [-1248.940] (-1245.300) (-1248.762) (-1249.285) -- 0:02:07
348000 -- (-1246.383) (-1255.236) (-1250.304) [-1252.351] * (-1250.175) (-1251.504) (-1248.738) [-1245.823] -- 0:02:07
348500 -- [-1249.323] (-1245.049) (-1245.730) (-1249.189) * (-1247.303) [-1246.991] (-1247.651) (-1246.108) -- 0:02:07
349000 -- [-1243.115] (-1252.045) (-1247.004) (-1253.755) * [-1248.237] (-1246.217) (-1245.712) (-1249.449) -- 0:02:06
349500 -- [-1243.899] (-1245.435) (-1244.431) (-1243.006) * (-1248.531) [-1252.476] (-1251.058) (-1255.997) -- 0:02:06
350000 -- (-1249.820) [-1250.829] (-1256.882) (-1244.711) * [-1249.793] (-1250.901) (-1248.923) (-1247.294) -- 0:02:06
Average standard deviation of split frequencies: 0.014519
350500 -- (-1252.834) [-1249.531] (-1252.050) (-1246.911) * [-1251.424] (-1247.892) (-1246.484) (-1245.793) -- 0:02:07
351000 -- (-1252.481) [-1245.355] (-1251.279) (-1248.679) * (-1247.866) (-1249.539) [-1242.265] (-1249.834) -- 0:02:07
351500 -- (-1250.273) [-1242.624] (-1245.598) (-1248.665) * [-1246.669] (-1259.339) (-1242.451) (-1244.417) -- 0:02:07
352000 -- (-1246.024) (-1243.688) [-1242.775] (-1249.784) * (-1253.358) (-1248.269) [-1245.075] (-1242.020) -- 0:02:07
352500 -- (-1249.894) (-1244.322) [-1243.464] (-1249.767) * (-1247.621) [-1248.821] (-1248.543) (-1242.713) -- 0:02:06
353000 -- (-1253.556) (-1242.945) [-1245.947] (-1250.633) * (-1248.015) (-1253.552) [-1248.581] (-1250.191) -- 0:02:06
353500 -- [-1250.552] (-1248.648) (-1252.333) (-1246.075) * [-1245.281] (-1248.430) (-1249.834) (-1246.842) -- 0:02:06
354000 -- [-1244.298] (-1250.229) (-1252.493) (-1244.624) * (-1252.431) [-1245.346] (-1248.714) (-1255.465) -- 0:02:05
354500 -- (-1253.148) [-1244.129] (-1240.541) (-1245.546) * (-1243.197) (-1248.970) (-1253.415) [-1242.363] -- 0:02:05
355000 -- (-1245.089) [-1246.674] (-1248.193) (-1249.380) * (-1241.784) [-1250.557] (-1250.052) (-1254.283) -- 0:02:05
Average standard deviation of split frequencies: 0.015890
355500 -- (-1249.341) [-1247.050] (-1247.177) (-1242.784) * (-1247.158) (-1245.809) (-1255.293) [-1246.832] -- 0:02:06
356000 -- (-1244.263) (-1251.040) (-1251.600) [-1249.221] * [-1250.795] (-1250.931) (-1251.473) (-1252.087) -- 0:02:06
356500 -- (-1249.586) (-1252.336) (-1252.451) [-1247.524] * [-1244.203] (-1246.838) (-1249.502) (-1248.053) -- 0:02:06
357000 -- (-1243.547) (-1245.478) (-1252.316) [-1246.925] * (-1244.915) [-1245.610] (-1255.074) (-1248.089) -- 0:02:06
357500 -- (-1246.376) (-1252.378) (-1253.431) [-1255.335] * (-1251.034) (-1250.172) (-1251.640) [-1249.055] -- 0:02:05
358000 -- (-1251.134) [-1249.680] (-1252.720) (-1250.367) * (-1250.786) (-1251.332) (-1246.715) [-1249.829] -- 0:02:05
358500 -- (-1246.101) (-1253.682) [-1252.220] (-1243.768) * (-1252.352) (-1246.988) [-1244.187] (-1248.224) -- 0:02:05
359000 -- (-1242.339) (-1248.549) (-1245.361) [-1247.392] * (-1242.715) (-1249.936) [-1244.481] (-1253.565) -- 0:02:04
359500 -- (-1247.288) (-1251.433) [-1246.338] (-1255.724) * (-1248.170) [-1250.693] (-1249.694) (-1252.832) -- 0:02:06
360000 -- (-1244.617) [-1248.170] (-1251.754) (-1257.749) * (-1249.214) [-1245.529] (-1252.352) (-1250.690) -- 0:02:06
Average standard deviation of split frequencies: 0.014116
360500 -- (-1245.033) [-1249.408] (-1253.304) (-1255.351) * (-1243.727) (-1243.760) (-1245.047) [-1250.591] -- 0:02:05
361000 -- (-1246.092) (-1268.460) (-1244.473) [-1247.733] * [-1245.375] (-1242.051) (-1242.838) (-1249.841) -- 0:02:05
361500 -- (-1254.904) (-1253.236) [-1244.927] (-1255.151) * (-1251.850) [-1249.801] (-1245.742) (-1251.562) -- 0:02:05
362000 -- (-1255.453) [-1247.136] (-1259.376) (-1255.189) * (-1248.484) (-1252.300) [-1250.061] (-1249.934) -- 0:02:05
362500 -- (-1260.843) [-1243.111] (-1246.190) (-1253.065) * [-1240.906] (-1251.435) (-1242.132) (-1244.673) -- 0:02:04
363000 -- (-1244.355) [-1249.497] (-1262.375) (-1246.951) * [-1248.117] (-1253.008) (-1245.979) (-1246.644) -- 0:02:04
363500 -- [-1249.727] (-1255.244) (-1249.781) (-1249.405) * (-1244.000) [-1249.436] (-1245.397) (-1249.373) -- 0:02:04
364000 -- (-1260.949) [-1245.416] (-1246.955) (-1249.899) * (-1241.639) (-1246.849) [-1248.077] (-1244.855) -- 0:02:05
364500 -- (-1250.861) (-1246.048) [-1250.369] (-1250.754) * (-1245.428) [-1241.678] (-1249.375) (-1251.861) -- 0:02:05
365000 -- (-1248.899) (-1252.169) (-1246.247) [-1245.675] * [-1247.487] (-1247.151) (-1246.242) (-1255.599) -- 0:02:05
Average standard deviation of split frequencies: 0.014425
365500 -- (-1252.185) (-1248.722) [-1244.583] (-1250.030) * [-1246.798] (-1250.362) (-1250.135) (-1252.125) -- 0:02:04
366000 -- (-1248.461) [-1247.699] (-1246.865) (-1250.396) * (-1241.844) (-1249.079) (-1248.436) [-1247.578] -- 0:02:04
366500 -- [-1243.564] (-1251.170) (-1249.213) (-1246.612) * (-1245.029) (-1251.224) (-1251.451) [-1245.000] -- 0:02:04
367000 -- [-1246.259] (-1242.676) (-1247.926) (-1257.313) * [-1248.048] (-1247.247) (-1253.184) (-1242.683) -- 0:02:04
367500 -- [-1251.357] (-1249.459) (-1250.749) (-1254.559) * (-1245.672) (-1247.061) (-1246.496) [-1253.182] -- 0:02:03
368000 -- (-1252.541) (-1243.714) (-1257.091) [-1248.243] * (-1250.086) [-1252.423] (-1248.795) (-1244.342) -- 0:02:03
368500 -- (-1249.521) [-1248.512] (-1247.226) (-1256.062) * [-1247.064] (-1252.357) (-1250.252) (-1250.904) -- 0:02:03
369000 -- (-1251.375) (-1252.849) [-1251.072] (-1250.998) * (-1254.132) [-1247.107] (-1249.176) (-1252.039) -- 0:02:04
369500 -- (-1262.250) [-1250.118] (-1249.170) (-1249.890) * [-1242.948] (-1249.934) (-1248.806) (-1253.704) -- 0:02:04
370000 -- (-1253.483) (-1247.530) (-1248.587) [-1246.678] * (-1246.963) [-1248.480] (-1244.481) (-1255.029) -- 0:02:04
Average standard deviation of split frequencies: 0.014498
370500 -- (-1244.439) (-1260.383) (-1248.608) [-1246.077] * (-1240.978) [-1257.642] (-1246.010) (-1245.089) -- 0:02:04
371000 -- (-1260.939) (-1265.199) (-1248.599) [-1248.719] * (-1249.297) (-1253.265) (-1248.983) [-1249.036] -- 0:02:03
371500 -- (-1261.007) [-1253.722] (-1242.876) (-1245.344) * (-1244.732) (-1248.906) (-1246.281) [-1251.572] -- 0:02:03
372000 -- [-1253.072] (-1250.552) (-1255.727) (-1253.029) * (-1247.481) (-1246.137) [-1248.565] (-1251.361) -- 0:02:03
372500 -- (-1249.871) (-1256.196) [-1244.016] (-1250.899) * (-1255.057) (-1250.743) (-1249.284) [-1249.229] -- 0:02:02
373000 -- (-1251.583) (-1252.078) (-1249.864) [-1245.675] * (-1247.172) (-1244.593) (-1245.013) [-1250.667] -- 0:02:02
373500 -- (-1250.303) (-1253.300) [-1249.908] (-1243.451) * (-1254.728) (-1245.808) [-1244.760] (-1247.640) -- 0:02:04
374000 -- [-1245.498] (-1255.076) (-1260.120) (-1246.960) * [-1256.548] (-1252.587) (-1258.176) (-1244.607) -- 0:02:03
374500 -- (-1253.013) (-1243.855) [-1243.986] (-1243.149) * (-1256.159) (-1247.909) (-1250.923) [-1244.757] -- 0:02:03
375000 -- [-1250.510] (-1256.610) (-1245.214) (-1249.051) * (-1255.378) [-1247.427] (-1247.526) (-1246.366) -- 0:02:03
Average standard deviation of split frequencies: 0.014042
375500 -- [-1249.211] (-1249.328) (-1246.964) (-1249.368) * (-1244.007) [-1247.506] (-1247.776) (-1252.119) -- 0:02:03
376000 -- (-1255.351) (-1253.972) (-1245.312) [-1246.572] * (-1241.498) [-1251.905] (-1250.472) (-1256.371) -- 0:02:02
376500 -- (-1248.761) (-1246.124) [-1249.271] (-1244.705) * (-1241.619) [-1245.907] (-1249.744) (-1247.237) -- 0:02:02
377000 -- [-1252.002] (-1245.113) (-1245.814) (-1245.433) * (-1248.236) [-1250.716] (-1246.831) (-1249.974) -- 0:02:02
377500 -- (-1257.756) [-1249.805] (-1249.379) (-1243.433) * [-1251.007] (-1254.307) (-1254.070) (-1246.001) -- 0:02:02
378000 -- (-1253.129) (-1242.504) [-1248.598] (-1247.949) * [-1252.459] (-1257.325) (-1251.777) (-1253.213) -- 0:02:03
378500 -- (-1245.458) [-1248.003] (-1242.012) (-1245.563) * (-1243.093) (-1245.382) [-1246.199] (-1244.620) -- 0:02:03
379000 -- (-1248.221) (-1247.494) [-1247.136] (-1241.255) * (-1246.413) [-1244.901] (-1256.206) (-1250.436) -- 0:02:02
379500 -- (-1245.961) [-1243.589] (-1254.573) (-1246.261) * (-1245.399) [-1243.686] (-1246.881) (-1251.125) -- 0:02:02
380000 -- [-1242.560] (-1248.195) (-1254.333) (-1249.147) * (-1248.781) [-1242.559] (-1250.743) (-1248.371) -- 0:02:02
Average standard deviation of split frequencies: 0.014117
380500 -- (-1252.712) (-1259.821) (-1254.745) [-1244.031] * (-1250.925) [-1247.009] (-1261.335) (-1248.535) -- 0:02:02
381000 -- (-1246.765) [-1241.328] (-1248.255) (-1244.616) * (-1246.957) (-1245.981) [-1250.309] (-1254.314) -- 0:02:01
381500 -- (-1250.487) (-1242.089) [-1243.361] (-1248.520) * (-1245.166) [-1246.944] (-1249.312) (-1243.562) -- 0:02:01
382000 -- (-1255.823) [-1243.383] (-1249.362) (-1259.112) * (-1252.532) [-1242.775] (-1247.781) (-1245.382) -- 0:02:01
382500 -- (-1242.571) [-1248.608] (-1252.176) (-1257.058) * (-1250.676) (-1246.648) (-1251.894) [-1247.987] -- 0:02:02
383000 -- (-1245.380) (-1248.273) [-1244.772] (-1249.843) * (-1246.702) [-1246.048] (-1245.845) (-1254.122) -- 0:02:02
383500 -- (-1244.740) (-1245.103) [-1246.006] (-1250.898) * [-1249.487] (-1245.532) (-1251.249) (-1247.480) -- 0:02:02
384000 -- (-1258.707) (-1248.941) (-1254.673) [-1246.197] * (-1247.618) (-1247.551) [-1251.135] (-1243.856) -- 0:02:01
384500 -- [-1250.709] (-1252.844) (-1253.664) (-1249.855) * (-1244.350) [-1242.822] (-1248.164) (-1245.792) -- 0:02:01
385000 -- (-1252.004) (-1252.087) [-1249.354] (-1246.849) * (-1255.934) [-1255.710] (-1252.437) (-1245.070) -- 0:02:01
Average standard deviation of split frequencies: 0.013678
385500 -- (-1247.077) [-1251.716] (-1251.626) (-1250.698) * [-1252.732] (-1251.570) (-1254.801) (-1248.041) -- 0:02:01
386000 -- (-1254.963) (-1249.862) (-1253.325) [-1245.455] * (-1253.346) (-1250.599) [-1251.108] (-1246.203) -- 0:02:00
386500 -- (-1254.368) (-1252.047) (-1258.902) [-1247.105] * (-1246.337) (-1250.368) [-1243.965] (-1255.444) -- 0:02:00
387000 -- (-1258.506) [-1248.164] (-1251.860) (-1248.484) * (-1246.760) (-1247.107) [-1241.941] (-1248.871) -- 0:02:00
387500 -- (-1248.129) (-1252.682) [-1252.439] (-1246.507) * (-1248.600) (-1253.540) [-1240.975] (-1244.977) -- 0:02:01
388000 -- (-1254.417) (-1254.835) [-1247.323] (-1244.902) * (-1252.085) (-1243.612) [-1243.800] (-1246.760) -- 0:02:01
388500 -- (-1256.219) (-1244.248) (-1244.532) [-1243.939] * [-1244.590] (-1243.921) (-1245.936) (-1250.718) -- 0:02:01
389000 -- (-1264.436) (-1257.117) (-1245.369) [-1244.408] * (-1245.322) (-1248.059) [-1246.813] (-1256.299) -- 0:02:00
389500 -- (-1248.511) (-1241.002) (-1247.077) [-1251.907] * [-1246.816] (-1248.310) (-1247.116) (-1248.237) -- 0:02:00
390000 -- (-1249.456) [-1247.621] (-1244.972) (-1249.741) * (-1253.627) [-1256.225] (-1250.797) (-1249.846) -- 0:02:00
Average standard deviation of split frequencies: 0.013032
390500 -- (-1249.599) (-1248.097) (-1247.466) [-1247.574] * (-1248.429) [-1244.555] (-1243.055) (-1245.715) -- 0:02:00
391000 -- (-1264.930) (-1250.690) [-1250.334] (-1246.544) * (-1246.445) [-1243.005] (-1247.683) (-1245.853) -- 0:01:59
391500 -- (-1251.527) (-1253.015) [-1251.944] (-1249.762) * (-1256.151) (-1250.932) (-1261.350) [-1248.439] -- 0:01:59
392000 -- [-1249.281] (-1248.898) (-1248.487) (-1249.799) * (-1256.738) [-1255.882] (-1255.808) (-1251.134) -- 0:01:59
392500 -- (-1249.472) (-1248.098) (-1251.385) [-1247.329] * [-1244.171] (-1249.911) (-1269.128) (-1248.567) -- 0:01:59
393000 -- (-1250.178) (-1250.327) (-1251.388) [-1248.299] * (-1253.366) (-1248.926) (-1248.830) [-1245.894] -- 0:02:00
393500 -- (-1254.762) (-1254.033) [-1246.247] (-1250.954) * [-1253.760] (-1248.128) (-1248.946) (-1246.004) -- 0:02:00
394000 -- (-1253.704) (-1246.071) [-1244.979] (-1247.378) * (-1253.990) [-1252.688] (-1249.028) (-1245.151) -- 0:01:59
394500 -- (-1253.576) (-1252.296) [-1244.472] (-1251.187) * [-1246.859] (-1243.031) (-1246.812) (-1247.680) -- 0:01:59
395000 -- [-1245.081] (-1250.427) (-1247.168) (-1242.821) * (-1244.754) (-1246.171) (-1250.839) [-1249.261] -- 0:01:59
Average standard deviation of split frequencies: 0.013809
395500 -- (-1258.012) (-1247.277) [-1243.125] (-1247.756) * (-1245.954) [-1253.081] (-1248.986) (-1248.999) -- 0:01:59
396000 -- (-1248.937) (-1259.063) (-1250.218) [-1247.270] * [-1243.472] (-1250.133) (-1243.965) (-1247.227) -- 0:01:58
396500 -- (-1252.842) (-1251.855) (-1248.436) [-1245.778] * (-1246.373) [-1250.774] (-1253.877) (-1248.239) -- 0:01:58
397000 -- [-1249.605] (-1250.504) (-1243.522) (-1244.625) * (-1253.166) [-1246.974] (-1251.456) (-1249.492) -- 0:01:58
397500 -- (-1252.777) (-1253.977) (-1249.358) [-1243.911] * (-1255.650) (-1249.493) (-1249.070) [-1249.142] -- 0:01:58
398000 -- [-1247.320] (-1251.467) (-1246.671) (-1255.777) * (-1253.435) [-1248.264] (-1250.477) (-1248.053) -- 0:01:59
398500 -- (-1253.281) [-1250.735] (-1264.917) (-1244.746) * (-1253.681) [-1243.239] (-1244.802) (-1246.444) -- 0:01:59
399000 -- (-1250.708) (-1245.281) [-1252.668] (-1242.409) * (-1251.451) [-1248.970] (-1256.007) (-1249.398) -- 0:01:58
399500 -- [-1248.369] (-1246.490) (-1254.907) (-1244.396) * (-1244.362) [-1245.847] (-1254.049) (-1244.880) -- 0:01:58
400000 -- (-1256.995) (-1250.543) [-1251.811] (-1246.589) * (-1244.017) (-1250.425) (-1251.301) [-1245.075] -- 0:01:58
Average standard deviation of split frequencies: 0.014119
400500 -- (-1254.965) [-1244.781] (-1255.801) (-1250.942) * (-1247.119) [-1253.752] (-1245.409) (-1254.202) -- 0:01:58
401000 -- (-1252.478) (-1249.133) (-1247.543) [-1249.694] * (-1250.141) (-1246.971) [-1249.379] (-1252.013) -- 0:01:58
401500 -- [-1253.666] (-1248.784) (-1247.992) (-1249.420) * (-1246.827) [-1246.281] (-1245.860) (-1250.168) -- 0:01:57
402000 -- (-1252.983) [-1247.343] (-1255.937) (-1243.815) * (-1246.239) [-1246.860] (-1242.335) (-1250.255) -- 0:01:57
402500 -- (-1252.049) [-1244.108] (-1246.084) (-1246.027) * (-1249.011) [-1248.697] (-1253.713) (-1247.540) -- 0:01:57
403000 -- (-1249.854) (-1246.916) [-1243.805] (-1252.211) * (-1252.686) (-1250.981) [-1246.846] (-1246.019) -- 0:01:58
403500 -- [-1248.053] (-1249.977) (-1244.715) (-1248.002) * (-1250.071) (-1249.966) [-1242.791] (-1245.944) -- 0:01:58
404000 -- (-1248.415) (-1248.317) [-1243.596] (-1247.632) * (-1252.365) (-1255.351) [-1245.557] (-1249.131) -- 0:01:58
404500 -- (-1244.487) (-1242.330) [-1244.735] (-1245.969) * (-1249.859) [-1242.855] (-1247.470) (-1250.897) -- 0:01:57
405000 -- (-1243.323) (-1245.428) (-1250.616) [-1250.521] * (-1246.539) (-1252.650) [-1244.406] (-1250.461) -- 0:01:57
Average standard deviation of split frequencies: 0.014398
405500 -- (-1244.615) (-1245.702) (-1252.369) [-1246.342] * (-1243.287) [-1249.325] (-1252.410) (-1247.767) -- 0:01:57
406000 -- (-1246.234) (-1245.190) [-1248.852] (-1246.458) * [-1246.194] (-1248.391) (-1261.746) (-1250.041) -- 0:01:57
406500 -- (-1247.410) (-1251.202) [-1248.549] (-1248.499) * [-1244.045] (-1251.819) (-1248.317) (-1257.195) -- 0:01:56
407000 -- (-1258.603) (-1243.795) (-1244.758) [-1256.477] * (-1246.157) [-1251.501] (-1246.538) (-1255.123) -- 0:01:56
407500 -- [-1247.466] (-1241.789) (-1254.213) (-1259.505) * (-1248.801) [-1246.742] (-1246.837) (-1251.889) -- 0:01:56
408000 -- (-1248.079) [-1249.005] (-1253.700) (-1254.527) * (-1248.796) (-1244.139) (-1247.087) [-1251.269] -- 0:01:57
408500 -- (-1250.037) (-1245.018) (-1254.149) [-1245.423] * (-1255.799) [-1244.337] (-1251.492) (-1246.698) -- 0:01:57
409000 -- (-1247.452) [-1248.741] (-1252.025) (-1251.876) * [-1254.526] (-1253.478) (-1248.566) (-1250.090) -- 0:01:57
409500 -- (-1245.762) (-1253.094) [-1249.490] (-1249.985) * (-1249.818) [-1241.775] (-1251.940) (-1251.120) -- 0:01:56
410000 -- (-1252.426) (-1241.519) [-1246.423] (-1249.983) * (-1246.294) [-1249.509] (-1249.082) (-1252.691) -- 0:01:56
Average standard deviation of split frequencies: 0.013086
410500 -- (-1248.941) [-1247.071] (-1242.415) (-1254.740) * (-1250.490) [-1248.527] (-1247.941) (-1250.321) -- 0:01:56
411000 -- (-1256.125) [-1245.407] (-1243.017) (-1250.698) * [-1246.839] (-1245.776) (-1249.761) (-1246.941) -- 0:01:56
411500 -- [-1244.992] (-1253.385) (-1248.347) (-1244.826) * (-1247.709) (-1253.806) [-1246.819] (-1249.495) -- 0:01:55
412000 -- (-1248.859) (-1247.948) [-1244.539] (-1250.627) * (-1251.543) (-1246.037) [-1248.692] (-1247.168) -- 0:01:55
412500 -- (-1244.365) [-1245.034] (-1250.061) (-1252.885) * [-1243.495] (-1247.346) (-1249.955) (-1249.877) -- 0:01:56
413000 -- (-1247.083) (-1255.671) (-1245.418) [-1246.401] * (-1245.030) (-1241.774) [-1250.449] (-1256.558) -- 0:01:56
413500 -- [-1249.434] (-1250.196) (-1247.038) (-1254.202) * (-1249.969) (-1253.088) (-1259.880) [-1251.734] -- 0:01:56
414000 -- (-1252.695) (-1245.493) [-1249.546] (-1248.682) * (-1245.555) (-1247.125) (-1249.239) [-1245.911] -- 0:01:56
414500 -- (-1246.930) (-1241.666) (-1245.114) [-1244.030] * (-1250.932) [-1249.757] (-1248.970) (-1244.757) -- 0:01:55
415000 -- [-1240.455] (-1247.398) (-1250.861) (-1243.586) * [-1248.067] (-1249.112) (-1254.484) (-1248.069) -- 0:01:55
Average standard deviation of split frequencies: 0.011332
415500 -- [-1247.531] (-1252.711) (-1242.891) (-1244.221) * (-1247.640) (-1251.040) [-1245.036] (-1243.901) -- 0:01:55
416000 -- (-1256.457) (-1258.066) (-1245.386) [-1245.902] * (-1253.125) (-1252.393) [-1248.927] (-1249.897) -- 0:01:55
416500 -- (-1252.574) (-1248.346) [-1245.086] (-1248.930) * [-1247.650] (-1252.517) (-1243.811) (-1254.216) -- 0:01:54
417000 -- [-1254.801] (-1249.910) (-1252.675) (-1253.749) * (-1251.285) (-1248.668) [-1249.596] (-1247.535) -- 0:01:56
417500 -- (-1245.761) [-1249.267] (-1256.242) (-1252.207) * (-1253.695) (-1248.893) [-1246.541] (-1254.269) -- 0:01:55
418000 -- (-1250.368) [-1251.395] (-1242.948) (-1248.599) * (-1257.202) (-1247.831) (-1248.608) [-1244.645] -- 0:01:55
418500 -- (-1249.524) (-1249.113) (-1245.647) [-1246.526] * (-1249.373) (-1244.784) (-1248.054) [-1251.029] -- 0:01:55
419000 -- (-1247.651) [-1239.589] (-1247.424) (-1248.188) * (-1248.734) (-1249.029) (-1251.921) [-1245.382] -- 0:01:55
419500 -- (-1244.970) (-1249.839) [-1242.576] (-1246.231) * (-1252.945) (-1254.528) (-1245.444) [-1240.365] -- 0:01:54
420000 -- (-1247.577) (-1252.769) (-1249.702) [-1249.264] * (-1253.848) (-1255.099) [-1244.132] (-1244.126) -- 0:01:54
Average standard deviation of split frequencies: 0.011206
420500 -- [-1258.705] (-1248.374) (-1249.424) (-1246.205) * (-1247.643) (-1262.536) [-1248.396] (-1245.606) -- 0:01:54
421000 -- (-1256.502) (-1248.185) (-1256.901) [-1248.137] * (-1246.850) (-1252.263) (-1248.845) [-1245.227] -- 0:01:54
421500 -- [-1251.304] (-1248.238) (-1246.145) (-1247.613) * (-1246.919) [-1246.029] (-1260.970) (-1245.875) -- 0:01:53
422000 -- (-1248.667) (-1244.851) (-1245.035) [-1249.799] * (-1251.969) [-1246.081] (-1248.153) (-1250.225) -- 0:01:55
422500 -- (-1251.769) [-1242.593] (-1250.203) (-1242.478) * (-1249.521) (-1246.386) [-1247.227] (-1245.374) -- 0:01:54
423000 -- (-1252.377) (-1245.384) [-1250.534] (-1246.667) * [-1245.478] (-1249.038) (-1243.033) (-1246.739) -- 0:01:54
423500 -- [-1248.600] (-1248.429) (-1250.352) (-1249.810) * [-1245.773] (-1255.132) (-1248.990) (-1251.087) -- 0:01:54
424000 -- (-1249.937) (-1247.303) (-1246.107) [-1252.389] * [-1245.161] (-1244.601) (-1252.699) (-1248.518) -- 0:01:54
424500 -- [-1250.995] (-1257.609) (-1253.710) (-1252.666) * (-1248.936) (-1258.531) [-1254.937] (-1245.124) -- 0:01:53
425000 -- (-1247.480) (-1248.264) [-1247.993] (-1255.337) * [-1250.751] (-1244.552) (-1248.949) (-1246.537) -- 0:01:53
Average standard deviation of split frequencies: 0.012394
425500 -- (-1247.154) (-1256.654) (-1250.894) [-1247.788] * (-1255.680) (-1248.482) [-1247.849] (-1244.023) -- 0:01:53
426000 -- (-1253.461) [-1248.235] (-1243.545) (-1246.997) * [-1249.539] (-1247.540) (-1243.157) (-1257.843) -- 0:01:53
426500 -- (-1248.048) (-1244.387) (-1248.715) [-1245.442] * (-1252.732) [-1244.949] (-1251.049) (-1250.360) -- 0:01:52
427000 -- (-1247.133) [-1243.895] (-1253.226) (-1243.850) * [-1247.688] (-1257.111) (-1244.659) (-1247.052) -- 0:01:54
427500 -- (-1245.664) (-1254.530) (-1245.742) [-1246.599] * (-1244.979) (-1253.316) [-1248.068] (-1243.782) -- 0:01:53
428000 -- [-1244.142] (-1252.194) (-1257.067) (-1250.486) * (-1258.227) (-1246.158) [-1249.283] (-1245.219) -- 0:01:53
428500 -- (-1255.149) (-1250.405) (-1259.614) [-1254.570] * (-1249.402) (-1242.108) (-1251.982) [-1244.638] -- 0:01:53
429000 -- (-1245.007) [-1244.744] (-1251.262) (-1252.597) * (-1248.114) [-1247.143] (-1247.848) (-1246.530) -- 0:01:53
429500 -- (-1251.167) (-1247.418) [-1252.959] (-1250.764) * (-1247.855) [-1247.753] (-1246.524) (-1252.959) -- 0:01:52
430000 -- (-1254.245) (-1246.022) [-1247.733] (-1250.906) * [-1250.779] (-1252.627) (-1259.165) (-1248.480) -- 0:01:52
Average standard deviation of split frequencies: 0.012697
430500 -- (-1252.836) (-1243.142) (-1250.592) [-1242.123] * (-1250.113) (-1248.702) (-1256.116) [-1244.847] -- 0:01:52
431000 -- (-1251.691) (-1250.286) [-1250.213] (-1249.300) * (-1252.051) [-1247.808] (-1252.231) (-1249.829) -- 0:01:52
431500 -- (-1251.054) [-1248.279] (-1252.225) (-1242.433) * [-1252.862] (-1244.793) (-1251.535) (-1250.721) -- 0:01:51
432000 -- (-1248.468) (-1245.025) (-1256.507) [-1251.654] * (-1247.362) (-1250.324) (-1253.955) [-1245.855] -- 0:01:53
432500 -- (-1251.307) (-1245.302) [-1251.801] (-1250.605) * (-1245.310) [-1246.223] (-1248.116) (-1243.017) -- 0:01:52
433000 -- (-1248.777) (-1245.793) (-1252.034) [-1242.058] * (-1250.083) [-1250.509] (-1247.962) (-1245.686) -- 0:01:52
433500 -- (-1261.577) (-1244.707) [-1247.543] (-1249.317) * (-1251.198) (-1243.489) [-1243.310] (-1252.853) -- 0:01:52
434000 -- (-1253.516) [-1244.257] (-1245.378) (-1250.969) * (-1243.372) (-1244.894) [-1247.439] (-1252.661) -- 0:01:52
434500 -- (-1255.705) (-1246.807) [-1245.628] (-1246.355) * [-1248.686] (-1245.916) (-1244.817) (-1250.986) -- 0:01:51
435000 -- [-1246.317] (-1244.497) (-1252.507) (-1255.568) * (-1252.703) (-1249.863) (-1249.496) [-1250.199] -- 0:01:51
Average standard deviation of split frequencies: 0.012758
435500 -- (-1246.475) [-1244.580] (-1244.698) (-1250.631) * (-1251.437) (-1249.500) (-1245.855) [-1254.115] -- 0:01:51
436000 -- [-1255.323] (-1246.612) (-1247.573) (-1247.488) * (-1250.615) (-1244.978) [-1245.636] (-1255.349) -- 0:01:51
436500 -- (-1256.164) (-1242.442) (-1250.799) [-1250.441] * (-1251.586) [-1243.467] (-1252.140) (-1246.255) -- 0:01:51
437000 -- [-1243.314] (-1243.675) (-1247.970) (-1248.015) * (-1255.316) [-1249.835] (-1251.360) (-1246.010) -- 0:01:52
437500 -- (-1247.207) [-1244.906] (-1249.370) (-1259.745) * (-1249.364) (-1254.133) (-1249.571) [-1249.788] -- 0:01:51
438000 -- [-1246.325] (-1246.232) (-1252.902) (-1252.928) * (-1249.443) [-1249.607] (-1248.993) (-1260.552) -- 0:01:51
438500 -- (-1251.557) [-1247.583] (-1248.335) (-1254.762) * (-1251.705) (-1253.608) [-1245.757] (-1244.709) -- 0:01:51
439000 -- [-1244.022] (-1246.053) (-1246.146) (-1248.466) * (-1257.522) (-1250.435) [-1251.140] (-1245.413) -- 0:01:51
439500 -- [-1242.526] (-1248.239) (-1244.528) (-1248.481) * (-1256.961) (-1242.895) (-1247.264) [-1246.238] -- 0:01:50
440000 -- [-1248.119] (-1253.329) (-1243.234) (-1244.162) * [-1248.963] (-1247.616) (-1250.169) (-1254.082) -- 0:01:50
Average standard deviation of split frequencies: 0.012195
440500 -- (-1248.602) [-1250.295] (-1244.975) (-1246.500) * (-1246.824) (-1246.995) (-1250.799) [-1244.309] -- 0:01:50
441000 -- [-1248.637] (-1244.978) (-1246.259) (-1247.022) * [-1248.448] (-1248.803) (-1248.978) (-1252.146) -- 0:01:50
441500 -- (-1255.500) [-1243.373] (-1250.661) (-1246.693) * [-1243.763] (-1255.106) (-1253.173) (-1254.638) -- 0:01:50
442000 -- (-1256.376) (-1252.048) [-1246.266] (-1253.689) * [-1248.533] (-1258.105) (-1250.966) (-1250.353) -- 0:01:51
442500 -- (-1256.083) (-1251.177) [-1243.340] (-1248.614) * (-1251.993) [-1249.078] (-1252.404) (-1251.107) -- 0:01:50
443000 -- (-1247.732) [-1251.017] (-1256.911) (-1252.848) * (-1248.368) (-1249.354) (-1247.951) [-1249.388] -- 0:01:50
443500 -- (-1246.741) (-1247.183) (-1243.492) [-1252.399] * (-1259.473) (-1253.320) (-1247.127) [-1248.335] -- 0:01:50
444000 -- [-1242.754] (-1246.169) (-1255.208) (-1261.583) * [-1245.983] (-1244.906) (-1249.013) (-1251.059) -- 0:01:50
444500 -- (-1250.647) (-1244.697) [-1247.116] (-1265.075) * (-1243.989) (-1247.355) [-1251.392] (-1250.667) -- 0:01:49
445000 -- (-1246.634) [-1247.866] (-1253.000) (-1254.882) * [-1247.719] (-1246.294) (-1245.256) (-1251.129) -- 0:01:49
Average standard deviation of split frequencies: 0.012049
445500 -- (-1246.363) (-1250.641) [-1245.157] (-1251.163) * (-1248.883) (-1248.914) [-1248.042] (-1253.370) -- 0:01:49
446000 -- (-1249.334) [-1247.978] (-1247.569) (-1245.479) * (-1251.752) (-1253.850) [-1248.464] (-1254.594) -- 0:01:49
446500 -- (-1250.515) (-1250.680) [-1247.800] (-1246.885) * (-1248.401) (-1249.956) [-1247.731] (-1250.755) -- 0:01:49
447000 -- (-1251.250) (-1249.803) [-1251.196] (-1248.938) * (-1249.978) (-1249.001) [-1248.620] (-1260.849) -- 0:01:50
447500 -- (-1248.610) (-1250.195) (-1246.278) [-1244.140] * (-1258.791) (-1247.512) (-1248.152) [-1257.065] -- 0:01:49
448000 -- (-1245.394) [-1248.367] (-1248.229) (-1244.260) * (-1251.782) [-1246.467] (-1251.239) (-1251.910) -- 0:01:49
448500 -- (-1250.526) [-1247.466] (-1246.203) (-1245.829) * (-1255.149) (-1241.502) (-1247.753) [-1254.291] -- 0:01:49
449000 -- (-1253.946) [-1248.189] (-1248.992) (-1249.222) * (-1249.465) (-1248.022) (-1247.827) [-1252.166] -- 0:01:49
449500 -- (-1246.665) [-1246.631] (-1255.986) (-1243.511) * (-1247.839) (-1252.095) [-1247.722] (-1253.011) -- 0:01:48
450000 -- (-1252.136) [-1247.171] (-1245.564) (-1254.092) * [-1244.003] (-1248.698) (-1248.758) (-1245.819) -- 0:01:48
Average standard deviation of split frequencies: 0.012761
450500 -- (-1247.661) (-1242.501) (-1256.605) [-1245.073] * (-1246.367) (-1249.052) (-1249.036) [-1249.469] -- 0:01:48
451000 -- (-1248.389) (-1250.344) (-1243.347) [-1245.072] * [-1247.448] (-1250.599) (-1250.018) (-1256.913) -- 0:01:48
451500 -- (-1253.758) (-1250.268) (-1245.380) [-1242.938] * [-1248.071] (-1242.497) (-1249.640) (-1250.702) -- 0:01:48
452000 -- (-1251.588) [-1246.141] (-1245.983) (-1245.250) * (-1251.937) [-1246.300] (-1251.828) (-1252.628) -- 0:01:47
452500 -- (-1248.006) [-1246.030] (-1250.563) (-1247.639) * (-1246.942) [-1252.523] (-1251.161) (-1247.001) -- 0:01:48
453000 -- [-1253.290] (-1243.578) (-1251.328) (-1243.287) * (-1247.595) (-1257.200) (-1245.914) [-1251.767] -- 0:01:48
453500 -- (-1242.230) (-1243.488) [-1246.959] (-1249.700) * (-1251.132) (-1253.024) [-1255.554] (-1255.040) -- 0:01:48
454000 -- (-1247.184) (-1252.781) (-1252.258) [-1246.799] * [-1249.224] (-1251.142) (-1246.456) (-1246.654) -- 0:01:48
454500 -- (-1252.834) (-1249.874) (-1246.092) [-1244.930] * (-1246.548) (-1240.983) [-1251.602] (-1256.166) -- 0:01:48
455000 -- (-1252.318) (-1258.227) (-1250.923) [-1243.731] * (-1248.425) (-1255.091) (-1247.419) [-1249.461] -- 0:01:47
Average standard deviation of split frequencies: 0.012199
455500 -- (-1247.478) (-1247.614) [-1246.622] (-1247.467) * (-1245.718) (-1248.658) [-1246.922] (-1250.601) -- 0:01:47
456000 -- (-1251.386) (-1246.016) (-1243.016) [-1244.899] * (-1255.196) [-1248.200] (-1260.347) (-1253.436) -- 0:01:47
456500 -- (-1254.652) [-1241.720] (-1249.377) (-1248.335) * [-1244.117] (-1248.205) (-1242.562) (-1242.382) -- 0:01:47
457000 -- (-1245.530) (-1246.162) (-1257.557) [-1252.718] * (-1249.759) [-1248.316] (-1256.086) (-1245.175) -- 0:01:46
457500 -- [-1248.338] (-1253.658) (-1253.286) (-1244.855) * (-1257.524) [-1241.497] (-1243.832) (-1246.556) -- 0:01:47
458000 -- [-1247.480] (-1246.619) (-1243.800) (-1247.044) * (-1252.574) (-1248.009) (-1248.142) [-1245.413] -- 0:01:47
458500 -- [-1250.366] (-1253.687) (-1248.508) (-1244.413) * [-1247.592] (-1244.730) (-1248.471) (-1248.703) -- 0:01:47
459000 -- [-1244.930] (-1246.709) (-1255.103) (-1257.687) * [-1244.298] (-1247.887) (-1250.986) (-1247.069) -- 0:01:47
459500 -- (-1254.818) (-1247.820) [-1247.174] (-1251.816) * (-1244.889) (-1248.049) (-1247.672) [-1240.809] -- 0:01:47
460000 -- (-1249.635) [-1246.412] (-1248.006) (-1251.791) * (-1251.015) (-1260.551) (-1247.832) [-1247.979] -- 0:01:46
Average standard deviation of split frequencies: 0.012484
460500 -- [-1243.389] (-1252.221) (-1249.152) (-1243.902) * (-1243.858) (-1250.618) (-1249.647) [-1246.165] -- 0:01:46
461000 -- (-1246.413) (-1262.921) (-1249.996) [-1251.587] * [-1247.701] (-1251.353) (-1253.288) (-1248.897) -- 0:01:46
461500 -- (-1247.928) (-1249.416) [-1242.167] (-1253.949) * (-1254.283) (-1250.071) (-1246.691) [-1246.300] -- 0:01:46
462000 -- (-1254.853) [-1251.917] (-1245.335) (-1249.510) * (-1246.958) (-1252.607) (-1251.968) [-1250.914] -- 0:01:45
462500 -- (-1247.571) [-1245.694] (-1246.953) (-1247.053) * [-1252.228] (-1246.216) (-1255.066) (-1250.265) -- 0:01:46
463000 -- (-1244.980) (-1249.143) [-1244.748] (-1247.950) * (-1249.554) (-1248.559) [-1249.647] (-1252.299) -- 0:01:46
463500 -- (-1251.935) (-1252.215) (-1251.552) [-1245.618] * [-1250.003] (-1240.263) (-1249.574) (-1254.024) -- 0:01:46
464000 -- (-1254.331) (-1249.764) (-1252.547) [-1249.547] * (-1246.766) (-1246.132) [-1245.839] (-1245.020) -- 0:01:46
464500 -- (-1249.345) (-1248.567) [-1249.659] (-1248.052) * (-1251.364) (-1247.807) [-1250.294] (-1242.536) -- 0:01:46
465000 -- [-1246.166] (-1258.428) (-1254.760) (-1246.573) * (-1254.612) [-1243.372] (-1248.720) (-1248.541) -- 0:01:45
Average standard deviation of split frequencies: 0.010925
465500 -- (-1247.640) [-1247.100] (-1249.557) (-1249.325) * (-1255.569) (-1248.001) (-1252.441) [-1246.173] -- 0:01:45
466000 -- (-1246.105) (-1243.347) [-1249.078] (-1245.059) * (-1251.447) (-1239.890) (-1243.670) [-1246.000] -- 0:01:45
466500 -- (-1249.198) (-1248.819) (-1248.641) [-1247.336] * (-1251.703) [-1247.029] (-1251.103) (-1246.747) -- 0:01:45
467000 -- (-1247.314) (-1244.967) (-1248.130) [-1246.160] * (-1249.970) (-1247.316) [-1249.542] (-1247.990) -- 0:01:45
467500 -- [-1248.066] (-1247.128) (-1248.783) (-1245.937) * (-1245.700) [-1246.071] (-1240.140) (-1245.421) -- 0:01:44
468000 -- (-1252.696) (-1248.418) (-1247.265) [-1245.794] * (-1252.718) [-1245.215] (-1246.934) (-1244.019) -- 0:01:45
468500 -- (-1251.086) (-1244.387) [-1249.218] (-1253.158) * [-1250.360] (-1247.018) (-1246.140) (-1249.772) -- 0:01:45
469000 -- [-1252.217] (-1246.281) (-1247.306) (-1243.411) * (-1251.255) (-1247.406) [-1246.532] (-1244.315) -- 0:01:45
469500 -- (-1247.273) (-1254.671) [-1247.116] (-1241.150) * (-1245.789) (-1250.798) [-1249.399] (-1254.994) -- 0:01:45
470000 -- [-1254.256] (-1244.024) (-1249.044) (-1247.666) * (-1245.417) (-1251.937) (-1251.790) [-1244.281] -- 0:01:44
Average standard deviation of split frequencies: 0.009014
470500 -- (-1248.813) [-1243.768] (-1245.450) (-1253.191) * (-1247.833) (-1247.988) (-1251.732) [-1244.469] -- 0:01:44
471000 -- [-1245.020] (-1246.453) (-1248.703) (-1244.070) * (-1245.651) [-1253.902] (-1248.424) (-1243.901) -- 0:01:44
471500 -- [-1248.381] (-1243.787) (-1247.591) (-1253.582) * (-1252.461) (-1247.693) (-1258.459) [-1250.711] -- 0:01:44
472000 -- [-1243.656] (-1244.551) (-1245.136) (-1256.166) * (-1242.642) (-1243.807) [-1246.986] (-1248.551) -- 0:01:44
472500 -- (-1244.220) [-1248.470] (-1249.835) (-1240.960) * [-1246.578] (-1251.275) (-1245.012) (-1245.288) -- 0:01:43
473000 -- (-1251.580) (-1255.980) (-1245.200) [-1244.789] * (-1252.235) [-1245.609] (-1248.367) (-1248.764) -- 0:01:44
473500 -- (-1251.670) (-1250.391) (-1253.941) [-1243.315] * (-1256.881) (-1252.606) [-1249.133] (-1247.005) -- 0:01:44
474000 -- (-1252.602) (-1254.478) (-1248.992) [-1249.442] * (-1246.630) [-1241.923] (-1249.140) (-1247.668) -- 0:01:44
474500 -- (-1250.800) [-1240.908] (-1244.407) (-1253.151) * (-1262.159) [-1247.118] (-1251.779) (-1245.005) -- 0:01:44
475000 -- (-1248.176) [-1250.869] (-1245.303) (-1244.426) * (-1253.714) (-1246.642) (-1251.097) [-1248.611] -- 0:01:43
Average standard deviation of split frequencies: 0.008913
475500 -- (-1253.537) (-1242.437) (-1248.330) [-1247.712] * (-1252.345) (-1248.581) (-1242.220) [-1244.066] -- 0:01:43
476000 -- (-1251.560) (-1246.628) (-1246.667) [-1243.334] * (-1262.028) [-1244.577] (-1253.408) (-1251.973) -- 0:01:43
476500 -- (-1246.865) [-1248.521] (-1246.013) (-1245.740) * (-1251.139) (-1249.967) [-1247.496] (-1248.971) -- 0:01:43
477000 -- (-1243.462) (-1243.168) [-1246.981] (-1251.121) * (-1253.405) (-1248.021) (-1247.614) [-1246.536] -- 0:01:43
477500 -- (-1252.203) [-1248.497] (-1243.296) (-1253.306) * (-1248.700) (-1245.360) [-1246.677] (-1252.282) -- 0:01:42
478000 -- [-1250.480] (-1245.664) (-1246.510) (-1247.694) * (-1249.537) (-1249.428) (-1242.027) [-1247.733] -- 0:01:42
478500 -- (-1247.600) (-1252.663) [-1241.644] (-1251.131) * (-1248.720) (-1247.067) (-1247.011) [-1241.235] -- 0:01:43
479000 -- (-1246.918) [-1249.846] (-1246.630) (-1244.011) * [-1250.131] (-1249.781) (-1247.995) (-1254.591) -- 0:01:43
479500 -- (-1253.699) (-1250.427) (-1241.198) [-1242.723] * (-1244.446) (-1253.414) (-1245.558) [-1249.655] -- 0:01:43
480000 -- (-1249.480) (-1253.294) [-1248.170] (-1242.728) * (-1246.973) [-1256.835] (-1242.384) (-1254.488) -- 0:01:42
Average standard deviation of split frequencies: 0.008827
480500 -- (-1244.305) [-1246.338] (-1249.367) (-1253.556) * (-1255.732) [-1251.875] (-1249.395) (-1248.442) -- 0:01:42
481000 -- [-1246.334] (-1246.280) (-1245.990) (-1253.467) * (-1246.344) (-1262.461) (-1249.103) [-1243.886] -- 0:01:42
481500 -- (-1247.142) (-1253.160) (-1243.922) [-1250.640] * (-1250.933) (-1256.412) [-1254.043] (-1258.139) -- 0:01:42
482000 -- (-1248.982) (-1248.489) (-1243.817) [-1244.205] * (-1251.648) (-1253.039) [-1252.026] (-1242.783) -- 0:01:42
482500 -- (-1256.329) (-1247.127) [-1246.122] (-1244.307) * [-1246.780] (-1245.234) (-1253.709) (-1248.422) -- 0:01:41
483000 -- (-1249.726) (-1243.235) [-1243.138] (-1247.854) * [-1246.763] (-1248.097) (-1244.030) (-1246.747) -- 0:01:41
483500 -- (-1245.675) (-1251.659) [-1245.507] (-1244.855) * (-1250.341) (-1248.902) (-1244.243) [-1240.944] -- 0:01:42
484000 -- (-1249.508) (-1248.484) [-1246.219] (-1244.873) * (-1251.908) [-1253.591] (-1243.978) (-1252.124) -- 0:01:42
484500 -- [-1247.274] (-1250.184) (-1250.761) (-1250.045) * (-1248.790) (-1254.168) (-1247.384) [-1245.387] -- 0:01:42
485000 -- (-1252.946) [-1244.940] (-1251.884) (-1251.621) * [-1245.148] (-1243.307) (-1250.270) (-1248.692) -- 0:01:41
Average standard deviation of split frequencies: 0.010088
485500 -- (-1250.702) [-1247.651] (-1251.820) (-1246.597) * (-1249.530) (-1261.432) [-1244.487] (-1246.461) -- 0:01:41
486000 -- [-1249.801] (-1249.323) (-1254.004) (-1250.095) * (-1256.690) [-1254.910] (-1249.501) (-1245.153) -- 0:01:41
486500 -- (-1254.556) (-1247.350) [-1253.138] (-1245.622) * (-1246.154) (-1253.590) [-1248.946] (-1256.716) -- 0:01:41
487000 -- [-1253.046] (-1251.585) (-1251.592) (-1248.842) * (-1247.719) (-1250.779) [-1245.684] (-1254.960) -- 0:01:41
487500 -- (-1251.100) (-1246.533) [-1245.588] (-1246.948) * [-1258.837] (-1254.178) (-1245.385) (-1245.796) -- 0:01:40
488000 -- (-1246.331) (-1252.760) (-1255.334) [-1246.058] * (-1251.705) (-1248.919) [-1246.258] (-1249.416) -- 0:01:40
488500 -- [-1245.299] (-1246.369) (-1251.131) (-1251.620) * (-1245.529) [-1247.961] (-1250.855) (-1244.951) -- 0:01:41
489000 -- (-1256.465) (-1243.606) (-1253.221) [-1245.982] * (-1248.482) (-1245.757) [-1248.976] (-1246.621) -- 0:01:41
489500 -- (-1248.083) (-1250.793) (-1250.212) [-1248.683] * (-1254.628) (-1251.087) (-1252.897) [-1246.809] -- 0:01:41
490000 -- (-1249.072) (-1249.349) [-1246.568] (-1247.483) * [-1245.257] (-1245.862) (-1254.154) (-1245.817) -- 0:01:40
Average standard deviation of split frequencies: 0.011337
490500 -- [-1245.848] (-1248.609) (-1244.401) (-1244.856) * (-1247.604) (-1248.763) [-1245.295] (-1254.276) -- 0:01:40
491000 -- (-1249.709) [-1255.638] (-1255.263) (-1250.050) * (-1247.870) [-1250.596] (-1246.741) (-1253.001) -- 0:01:40
491500 -- (-1245.509) (-1250.755) [-1251.208] (-1251.311) * (-1256.019) [-1253.766] (-1246.897) (-1246.866) -- 0:01:40
492000 -- (-1245.655) (-1247.965) (-1246.779) [-1250.165] * (-1253.406) (-1251.532) (-1246.239) [-1241.073] -- 0:01:40
492500 -- [-1249.008] (-1259.387) (-1255.214) (-1257.300) * (-1252.024) (-1248.391) [-1245.017] (-1244.250) -- 0:01:39
493000 -- (-1249.759) (-1248.879) [-1244.183] (-1244.477) * (-1249.367) (-1246.570) [-1246.160] (-1246.479) -- 0:01:39
493500 -- (-1248.671) [-1250.605] (-1243.833) (-1244.311) * (-1251.793) (-1247.574) (-1250.201) [-1253.106] -- 0:01:39
494000 -- (-1245.291) [-1242.999] (-1248.386) (-1244.092) * (-1265.780) (-1247.871) (-1244.065) [-1243.131] -- 0:01:40
494500 -- [-1247.354] (-1248.102) (-1249.658) (-1249.862) * [-1251.527] (-1254.399) (-1250.960) (-1244.190) -- 0:01:40
495000 -- (-1244.255) (-1245.705) (-1245.244) [-1245.244] * (-1260.253) (-1247.877) (-1249.333) [-1241.752] -- 0:01:39
Average standard deviation of split frequencies: 0.011785
495500 -- (-1250.516) (-1255.136) (-1248.036) [-1247.699] * (-1260.636) (-1250.106) (-1247.229) [-1247.544] -- 0:01:39
496000 -- [-1248.898] (-1248.709) (-1247.884) (-1253.119) * (-1251.028) (-1245.903) [-1245.593] (-1244.490) -- 0:01:39
496500 -- [-1246.652] (-1246.296) (-1250.922) (-1248.008) * [-1255.007] (-1251.613) (-1247.193) (-1248.282) -- 0:01:39
497000 -- (-1244.684) (-1249.188) [-1247.871] (-1251.624) * (-1251.960) [-1248.951] (-1243.659) (-1247.787) -- 0:01:39
497500 -- (-1252.351) (-1246.516) [-1242.337] (-1250.814) * [-1250.930] (-1246.511) (-1249.521) (-1250.020) -- 0:01:38
498000 -- (-1247.689) (-1253.363) (-1248.268) [-1252.337] * [-1250.677] (-1256.023) (-1251.543) (-1246.843) -- 0:01:38
498500 -- (-1251.823) (-1247.810) [-1242.600] (-1246.940) * (-1248.514) [-1248.229] (-1246.792) (-1250.889) -- 0:01:38
499000 -- (-1249.739) (-1247.164) (-1243.409) [-1243.138] * (-1248.838) (-1252.182) [-1247.608] (-1247.319) -- 0:01:39
499500 -- (-1249.929) [-1246.297] (-1241.968) (-1249.773) * (-1252.321) [-1245.386] (-1249.573) (-1253.027) -- 0:01:39
500000 -- [-1247.541] (-1247.457) (-1249.757) (-1250.741) * (-1246.283) (-1247.115) [-1248.495] (-1249.623) -- 0:01:39
Average standard deviation of split frequencies: 0.012805
500500 -- (-1252.794) (-1247.363) [-1244.265] (-1254.626) * (-1250.415) [-1251.939] (-1247.367) (-1247.840) -- 0:01:38
501000 -- (-1246.230) [-1250.588] (-1247.686) (-1252.566) * [-1248.191] (-1242.876) (-1244.299) (-1248.251) -- 0:01:38
501500 -- (-1250.541) (-1252.976) [-1245.019] (-1249.415) * [-1243.812] (-1243.823) (-1251.683) (-1248.525) -- 0:01:38
502000 -- (-1248.474) [-1247.315] (-1246.344) (-1246.651) * [-1245.174] (-1246.324) (-1256.237) (-1254.950) -- 0:01:38
502500 -- (-1252.824) (-1248.299) [-1247.469] (-1251.563) * [-1247.709] (-1250.169) (-1253.731) (-1244.297) -- 0:01:38
503000 -- (-1249.400) (-1251.315) (-1249.629) [-1241.477] * [-1244.956] (-1251.534) (-1247.748) (-1245.362) -- 0:01:37
503500 -- (-1251.204) (-1249.749) [-1239.106] (-1245.778) * (-1248.289) (-1248.774) (-1248.601) [-1246.160] -- 0:01:37
504000 -- [-1248.136] (-1242.767) (-1251.138) (-1244.028) * [-1247.304] (-1246.530) (-1242.363) (-1246.721) -- 0:01:38
504500 -- [-1248.284] (-1250.111) (-1254.793) (-1251.601) * [-1252.892] (-1249.200) (-1240.447) (-1256.494) -- 0:01:38
505000 -- [-1251.311] (-1247.083) (-1250.138) (-1252.008) * [-1248.643] (-1244.148) (-1249.209) (-1249.049) -- 0:01:38
Average standard deviation of split frequencies: 0.013415
505500 -- (-1257.145) [-1242.914] (-1245.697) (-1251.874) * [-1242.289] (-1248.653) (-1254.507) (-1253.600) -- 0:01:37
506000 -- (-1247.478) [-1249.178] (-1244.605) (-1253.583) * (-1245.642) (-1248.399) [-1248.665] (-1255.433) -- 0:01:37
506500 -- (-1254.865) (-1252.450) (-1251.142) [-1246.932] * [-1249.781] (-1248.515) (-1245.781) (-1249.335) -- 0:01:37
507000 -- (-1255.722) (-1254.493) [-1249.207] (-1244.087) * (-1244.908) (-1253.479) (-1252.399) [-1252.769] -- 0:01:37
507500 -- (-1257.278) (-1254.826) (-1246.321) [-1244.038] * (-1246.937) [-1246.775] (-1250.409) (-1245.999) -- 0:01:37
508000 -- (-1252.012) (-1252.419) (-1251.740) [-1246.028] * (-1245.877) [-1244.602] (-1259.331) (-1258.045) -- 0:01:36
508500 -- (-1257.567) (-1249.095) [-1245.311] (-1249.882) * (-1247.587) [-1244.569] (-1252.327) (-1258.639) -- 0:01:36
509000 -- (-1254.870) [-1252.114] (-1245.742) (-1244.441) * [-1245.146] (-1246.588) (-1246.285) (-1248.490) -- 0:01:37
509500 -- (-1250.063) (-1255.665) [-1243.265] (-1243.902) * [-1246.283] (-1252.660) (-1247.627) (-1245.398) -- 0:01:37
510000 -- (-1253.561) (-1247.768) (-1250.835) [-1246.085] * (-1259.934) (-1253.458) [-1247.550] (-1243.620) -- 0:01:37
Average standard deviation of split frequencies: 0.013293
510500 -- (-1251.879) (-1251.483) (-1245.656) [-1253.004] * (-1246.155) (-1248.467) (-1252.188) [-1251.117] -- 0:01:36
511000 -- (-1250.007) (-1245.588) [-1246.372] (-1255.414) * (-1250.649) (-1244.365) [-1241.740] (-1243.939) -- 0:01:36
511500 -- [-1242.044] (-1249.376) (-1251.101) (-1251.269) * (-1250.442) (-1247.052) (-1243.961) [-1243.163] -- 0:01:36
512000 -- (-1244.217) (-1249.462) [-1244.410] (-1249.620) * [-1246.783] (-1244.073) (-1244.563) (-1250.934) -- 0:01:36
512500 -- (-1248.775) [-1248.830] (-1256.715) (-1244.308) * (-1247.303) [-1244.227] (-1248.186) (-1251.135) -- 0:01:36
513000 -- (-1247.261) (-1245.030) [-1246.537] (-1244.407) * (-1246.189) [-1243.641] (-1247.961) (-1252.912) -- 0:01:35
513500 -- (-1245.874) (-1247.475) (-1245.586) [-1242.264] * (-1249.851) (-1247.236) [-1243.440] (-1250.021) -- 0:01:35
514000 -- (-1244.490) (-1253.790) [-1247.393] (-1255.623) * [-1250.488] (-1257.537) (-1247.397) (-1257.600) -- 0:01:36
514500 -- (-1244.026) (-1244.833) (-1241.795) [-1243.138] * (-1250.928) [-1242.050] (-1245.797) (-1253.525) -- 0:01:36
515000 -- (-1248.509) (-1251.664) (-1249.472) [-1248.299] * (-1245.250) (-1250.133) (-1244.665) [-1247.762] -- 0:01:36
Average standard deviation of split frequencies: 0.012973
515500 -- [-1249.405] (-1255.388) (-1250.546) (-1255.581) * (-1247.100) (-1251.597) [-1246.776] (-1245.436) -- 0:01:35
516000 -- (-1249.027) (-1250.469) [-1247.264] (-1245.766) * (-1246.526) (-1250.276) [-1244.012] (-1250.030) -- 0:01:35
516500 -- (-1247.382) (-1254.394) [-1248.105] (-1241.993) * [-1246.224] (-1249.104) (-1251.267) (-1245.132) -- 0:01:35
517000 -- (-1252.221) (-1249.819) (-1247.713) [-1246.957] * (-1247.028) [-1248.766] (-1246.230) (-1248.878) -- 0:01:35
517500 -- (-1248.439) (-1246.712) [-1251.340] (-1243.746) * (-1247.353) (-1249.336) (-1250.483) [-1245.249] -- 0:01:35
518000 -- (-1249.282) [-1248.363] (-1245.699) (-1247.821) * (-1253.249) (-1247.290) (-1251.632) [-1243.616] -- 0:01:34
518500 -- (-1248.809) (-1242.699) (-1253.889) [-1245.460] * (-1246.915) (-1255.666) (-1248.577) [-1245.172] -- 0:01:34
519000 -- (-1254.761) (-1251.325) [-1249.644] (-1250.559) * (-1247.584) (-1249.742) (-1250.157) [-1249.323] -- 0:01:35
519500 -- (-1251.091) [-1246.117] (-1248.727) (-1248.629) * (-1255.800) (-1246.583) [-1245.259] (-1247.889) -- 0:01:35
520000 -- (-1252.736) [-1249.231] (-1248.557) (-1244.926) * [-1246.536] (-1249.054) (-1247.828) (-1246.802) -- 0:01:35
Average standard deviation of split frequencies: 0.013400
520500 -- (-1252.972) [-1249.855] (-1256.795) (-1245.221) * [-1244.043] (-1250.327) (-1248.003) (-1252.670) -- 0:01:34
521000 -- (-1253.043) [-1254.878] (-1249.596) (-1243.538) * [-1250.952] (-1247.357) (-1247.776) (-1246.598) -- 0:01:34
521500 -- (-1252.574) (-1247.037) (-1249.434) [-1246.977] * [-1243.246] (-1245.432) (-1242.223) (-1253.524) -- 0:01:34
522000 -- (-1245.690) (-1244.112) (-1255.693) [-1250.793] * (-1242.191) (-1250.396) [-1243.304] (-1244.607) -- 0:01:34
522500 -- (-1247.069) (-1251.843) (-1255.453) [-1248.380] * (-1245.160) [-1249.708] (-1248.964) (-1250.720) -- 0:01:34
523000 -- (-1252.616) [-1246.890] (-1253.009) (-1244.886) * (-1255.462) [-1248.073] (-1246.092) (-1244.849) -- 0:01:33
523500 -- (-1246.198) (-1243.597) (-1258.505) [-1245.659] * (-1254.723) (-1243.601) [-1246.878] (-1244.507) -- 0:01:33
524000 -- (-1245.298) (-1250.991) (-1252.598) [-1244.684] * (-1248.917) (-1247.192) [-1245.095] (-1250.907) -- 0:01:34
524500 -- (-1254.032) (-1249.288) (-1260.521) [-1251.694] * (-1250.940) [-1257.096] (-1255.112) (-1247.839) -- 0:01:34
525000 -- (-1248.215) [-1251.220] (-1251.821) (-1250.508) * (-1244.161) (-1250.092) [-1248.852] (-1255.435) -- 0:01:34
Average standard deviation of split frequencies: 0.013802
525500 -- (-1243.110) [-1247.571] (-1249.600) (-1250.707) * [-1249.254] (-1252.990) (-1246.938) (-1251.685) -- 0:01:33
526000 -- (-1243.859) (-1249.420) (-1255.618) [-1247.277] * (-1251.724) [-1250.629] (-1245.551) (-1252.066) -- 0:01:33
526500 -- (-1247.315) [-1244.251] (-1247.207) (-1249.199) * (-1254.965) (-1250.316) [-1247.927] (-1250.403) -- 0:01:33
527000 -- (-1254.158) [-1251.498] (-1244.927) (-1250.757) * (-1247.849) [-1245.337] (-1243.977) (-1248.636) -- 0:01:33
527500 -- (-1246.121) (-1247.085) [-1247.920] (-1246.711) * [-1245.252] (-1252.643) (-1244.942) (-1250.982) -- 0:01:33
528000 -- (-1246.778) [-1242.016] (-1245.553) (-1248.408) * (-1247.509) [-1246.894] (-1247.251) (-1250.594) -- 0:01:32
528500 -- [-1249.572] (-1253.093) (-1246.325) (-1243.500) * [-1246.718] (-1248.098) (-1242.682) (-1246.111) -- 0:01:32
529000 -- [-1243.155] (-1243.896) (-1249.055) (-1246.601) * (-1252.655) (-1251.718) (-1251.305) [-1245.970] -- 0:01:33
529500 -- (-1250.120) [-1246.182] (-1247.542) (-1253.549) * (-1250.367) [-1242.201] (-1255.812) (-1249.693) -- 0:01:33
530000 -- (-1246.585) [-1247.352] (-1249.348) (-1254.385) * (-1252.541) (-1249.747) (-1245.821) [-1248.375] -- 0:01:33
Average standard deviation of split frequencies: 0.013325
530500 -- (-1252.524) [-1247.136] (-1246.634) (-1251.552) * (-1246.131) (-1246.175) [-1249.289] (-1248.407) -- 0:01:32
531000 -- (-1245.132) [-1246.592] (-1249.761) (-1251.426) * (-1251.856) (-1256.505) (-1252.553) [-1246.272] -- 0:01:32
531500 -- (-1244.378) (-1249.737) (-1251.330) [-1254.522] * [-1246.520] (-1259.431) (-1244.264) (-1242.551) -- 0:01:32
532000 -- (-1251.161) (-1255.439) (-1249.255) [-1245.019] * [-1247.463] (-1245.910) (-1249.567) (-1251.905) -- 0:01:32
532500 -- (-1250.832) [-1244.229] (-1244.960) (-1250.210) * (-1254.510) (-1260.069) [-1249.927] (-1246.601) -- 0:01:32
533000 -- [-1249.250] (-1242.730) (-1243.036) (-1246.258) * (-1245.877) (-1249.767) (-1246.358) [-1252.394] -- 0:01:31
533500 -- (-1251.832) [-1244.607] (-1253.522) (-1249.647) * (-1247.181) (-1255.854) [-1251.834] (-1246.747) -- 0:01:31
534000 -- [-1244.126] (-1250.462) (-1248.072) (-1249.570) * [-1248.543] (-1245.005) (-1246.220) (-1251.169) -- 0:01:31
534500 -- (-1251.970) (-1246.740) (-1248.683) [-1242.655] * [-1245.998] (-1253.258) (-1247.169) (-1241.631) -- 0:01:32
535000 -- (-1246.531) (-1244.561) (-1250.211) [-1245.378] * (-1252.649) (-1247.538) [-1248.397] (-1248.591) -- 0:01:32
Average standard deviation of split frequencies: 0.012489
535500 -- (-1253.823) (-1244.222) (-1246.043) [-1245.677] * [-1245.165] (-1249.749) (-1249.068) (-1244.780) -- 0:01:31
536000 -- (-1251.204) (-1257.341) [-1247.640] (-1249.318) * (-1244.313) [-1250.593] (-1247.751) (-1248.938) -- 0:01:31
536500 -- [-1249.063] (-1250.940) (-1253.927) (-1257.316) * (-1244.984) (-1254.798) [-1250.323] (-1242.437) -- 0:01:31
537000 -- (-1249.445) [-1242.978] (-1251.691) (-1242.247) * (-1247.049) (-1250.064) (-1244.297) [-1242.440] -- 0:01:31
537500 -- [-1245.104] (-1251.227) (-1257.091) (-1249.841) * (-1254.924) (-1244.877) [-1245.446] (-1243.159) -- 0:01:31
538000 -- (-1249.374) (-1246.361) (-1250.687) [-1250.634] * (-1246.710) (-1253.747) (-1251.645) [-1242.183] -- 0:01:31
538500 -- (-1246.941) (-1244.150) (-1249.260) [-1241.375] * (-1252.478) (-1248.499) [-1246.178] (-1248.861) -- 0:01:30
539000 -- (-1248.159) (-1248.106) [-1249.000] (-1247.004) * (-1252.216) (-1247.294) (-1249.537) [-1246.993] -- 0:01:30
539500 -- (-1253.102) [-1244.376] (-1248.207) (-1258.273) * (-1256.808) (-1246.671) (-1247.023) [-1247.220] -- 0:01:31
540000 -- (-1255.822) (-1253.576) (-1246.772) [-1245.972] * (-1252.556) (-1244.153) (-1251.051) [-1245.166] -- 0:01:31
Average standard deviation of split frequencies: 0.012730
540500 -- (-1252.207) [-1255.943] (-1247.965) (-1246.754) * (-1252.833) (-1249.250) [-1251.273] (-1245.819) -- 0:01:30
541000 -- (-1244.415) [-1250.255] (-1250.111) (-1244.649) * (-1242.240) (-1244.681) [-1242.882] (-1251.652) -- 0:01:30
541500 -- (-1244.412) (-1251.672) [-1245.984] (-1256.181) * [-1245.053] (-1244.163) (-1241.901) (-1250.898) -- 0:01:30
542000 -- [-1246.108] (-1251.197) (-1253.024) (-1249.402) * (-1248.284) (-1252.733) [-1248.514] (-1250.421) -- 0:01:30
542500 -- (-1248.122) (-1252.789) [-1244.818] (-1253.552) * (-1249.532) (-1246.721) (-1256.245) [-1246.077] -- 0:01:30
543000 -- (-1248.119) (-1254.219) [-1246.262] (-1252.918) * (-1253.384) [-1249.360] (-1259.679) (-1251.847) -- 0:01:30
543500 -- [-1244.019] (-1255.008) (-1249.768) (-1243.799) * (-1243.416) (-1251.022) [-1246.173] (-1249.654) -- 0:01:29
544000 -- (-1246.450) [-1254.166] (-1249.992) (-1253.352) * [-1245.592] (-1248.731) (-1245.792) (-1242.024) -- 0:01:29
544500 -- (-1251.071) (-1242.053) [-1252.648] (-1252.102) * (-1251.079) (-1246.672) [-1247.704] (-1249.086) -- 0:01:30
545000 -- (-1251.897) (-1258.033) [-1247.787] (-1248.007) * (-1247.055) (-1245.246) (-1248.318) [-1244.649] -- 0:01:30
Average standard deviation of split frequencies: 0.012087
545500 -- (-1246.776) [-1247.904] (-1248.264) (-1250.725) * [-1247.744] (-1263.110) (-1246.714) (-1247.863) -- 0:01:29
546000 -- (-1249.766) (-1253.136) (-1245.304) [-1246.928] * (-1247.346) (-1254.749) (-1241.516) [-1246.142] -- 0:01:29
546500 -- (-1262.299) (-1246.725) [-1255.380] (-1239.256) * (-1245.256) (-1243.813) (-1254.156) [-1256.645] -- 0:01:29
547000 -- (-1244.226) (-1252.384) [-1247.911] (-1251.691) * (-1253.454) (-1245.580) (-1249.454) [-1248.747] -- 0:01:29
547500 -- [-1243.080] (-1252.239) (-1251.642) (-1240.396) * [-1249.097] (-1244.053) (-1248.093) (-1246.384) -- 0:01:29
548000 -- (-1246.871) [-1248.220] (-1245.404) (-1252.059) * (-1254.849) [-1248.550] (-1251.104) (-1257.609) -- 0:01:29
548500 -- [-1243.986] (-1249.265) (-1248.563) (-1251.937) * (-1242.583) (-1246.595) [-1246.592] (-1254.243) -- 0:01:28
549000 -- (-1249.022) [-1249.425] (-1248.840) (-1248.205) * (-1246.281) [-1240.486] (-1258.438) (-1250.843) -- 0:01:28
549500 -- (-1245.619) (-1247.711) (-1249.880) [-1247.589] * (-1248.627) [-1242.613] (-1250.547) (-1247.247) -- 0:01:29
550000 -- (-1249.731) (-1244.544) [-1244.929] (-1254.292) * (-1251.843) [-1249.163] (-1251.443) (-1251.823) -- 0:01:29
Average standard deviation of split frequencies: 0.011814
550500 -- [-1251.815] (-1245.892) (-1247.274) (-1250.409) * (-1249.060) (-1245.276) [-1247.160] (-1248.545) -- 0:01:29
551000 -- (-1247.845) [-1246.810] (-1249.614) (-1252.441) * (-1250.045) (-1251.291) [-1243.696] (-1244.325) -- 0:01:28
551500 -- [-1255.364] (-1248.974) (-1252.674) (-1246.084) * (-1250.720) (-1252.606) (-1252.553) [-1245.566] -- 0:01:28
552000 -- (-1252.574) (-1250.225) (-1247.062) [-1242.135] * (-1249.378) [-1251.024] (-1246.085) (-1246.357) -- 0:01:28
552500 -- (-1252.386) (-1242.340) [-1244.460] (-1245.901) * [-1246.168] (-1247.701) (-1245.569) (-1244.918) -- 0:01:28
553000 -- (-1250.608) [-1246.404] (-1243.702) (-1246.660) * (-1252.923) [-1249.076] (-1244.674) (-1247.200) -- 0:01:28
553500 -- [-1246.375] (-1245.178) (-1253.930) (-1252.878) * (-1253.940) (-1248.637) (-1245.170) [-1247.251] -- 0:01:27
554000 -- (-1249.444) (-1250.649) (-1248.566) [-1256.313] * (-1249.728) (-1246.905) (-1258.580) [-1248.345] -- 0:01:27
554500 -- (-1250.043) (-1248.616) [-1242.006] (-1250.369) * (-1250.039) [-1247.862] (-1249.772) (-1252.143) -- 0:01:27
555000 -- (-1252.033) [-1241.908] (-1248.355) (-1250.016) * (-1248.140) [-1244.108] (-1256.663) (-1249.576) -- 0:01:28
Average standard deviation of split frequencies: 0.011361
555500 -- (-1246.367) (-1247.223) [-1242.966] (-1245.689) * (-1252.578) (-1251.721) (-1257.382) [-1250.143] -- 0:01:28
556000 -- (-1247.797) (-1250.329) [-1251.790] (-1254.227) * (-1241.919) (-1243.252) (-1256.716) [-1250.394] -- 0:01:27
556500 -- (-1249.615) (-1246.199) [-1249.340] (-1256.592) * (-1245.522) (-1247.230) (-1258.984) [-1251.159] -- 0:01:27
557000 -- (-1256.020) [-1248.626] (-1247.936) (-1246.565) * [-1249.943] (-1253.384) (-1253.128) (-1246.777) -- 0:01:27
557500 -- (-1249.084) (-1249.109) (-1250.892) [-1246.225] * [-1247.523] (-1243.950) (-1250.191) (-1248.850) -- 0:01:27
558000 -- (-1249.819) (-1251.216) [-1242.828] (-1245.283) * (-1246.718) (-1245.028) [-1244.997] (-1242.874) -- 0:01:27
558500 -- [-1252.034] (-1245.342) (-1242.504) (-1248.756) * (-1247.755) (-1246.873) [-1244.601] (-1244.128) -- 0:01:26
559000 -- (-1256.238) (-1251.283) (-1244.245) [-1241.895] * (-1244.311) (-1262.826) (-1248.365) [-1251.817] -- 0:01:26
559500 -- [-1246.320] (-1251.313) (-1247.541) (-1254.923) * [-1243.374] (-1246.896) (-1251.693) (-1249.684) -- 0:01:26
560000 -- (-1254.823) (-1257.101) [-1254.032] (-1250.243) * (-1247.691) (-1249.685) [-1246.477] (-1243.474) -- 0:01:27
Average standard deviation of split frequencies: 0.011603
560500 -- [-1245.396] (-1246.984) (-1250.807) (-1244.819) * (-1251.969) (-1245.340) [-1245.892] (-1242.164) -- 0:01:27
561000 -- (-1256.657) (-1250.101) [-1246.475] (-1249.191) * [-1249.059] (-1245.155) (-1239.163) (-1246.254) -- 0:01:26
561500 -- [-1251.996] (-1245.209) (-1256.000) (-1245.094) * (-1249.130) [-1249.533] (-1258.424) (-1240.402) -- 0:01:26
562000 -- (-1246.600) (-1251.619) [-1249.109] (-1246.059) * [-1250.618] (-1247.165) (-1250.197) (-1248.736) -- 0:01:26
562500 -- (-1254.564) (-1247.381) (-1249.098) [-1245.949] * (-1244.114) (-1244.891) (-1254.163) [-1246.465] -- 0:01:26
563000 -- (-1254.928) (-1249.160) [-1247.363] (-1243.154) * (-1247.637) [-1249.818] (-1248.693) (-1248.495) -- 0:01:26
563500 -- (-1253.003) (-1244.785) [-1245.189] (-1251.556) * (-1246.257) (-1245.708) (-1243.421) [-1249.900] -- 0:01:25
564000 -- (-1246.351) (-1246.049) (-1247.265) [-1243.361] * (-1244.157) (-1249.045) (-1242.801) [-1249.234] -- 0:01:25
564500 -- (-1244.590) (-1247.915) (-1248.434) [-1252.141] * (-1246.012) (-1267.647) [-1249.907] (-1245.153) -- 0:01:25
565000 -- [-1248.102] (-1249.412) (-1253.396) (-1244.178) * (-1251.954) [-1246.806] (-1255.902) (-1252.513) -- 0:01:26
Average standard deviation of split frequencies: 0.013492
565500 -- (-1243.281) (-1251.251) [-1257.529] (-1247.500) * [-1250.070] (-1255.405) (-1247.614) (-1255.700) -- 0:01:26
566000 -- (-1248.937) [-1250.190] (-1254.117) (-1246.226) * (-1255.892) (-1248.918) [-1241.721] (-1247.497) -- 0:01:25
566500 -- (-1246.667) (-1247.289) (-1252.348) [-1241.906] * [-1242.780] (-1246.116) (-1248.486) (-1247.741) -- 0:01:25
567000 -- (-1248.270) (-1248.506) (-1255.701) [-1250.009] * (-1244.019) (-1251.435) (-1248.003) [-1244.582] -- 0:01:25
567500 -- [-1247.265] (-1252.887) (-1254.184) (-1248.800) * (-1248.389) [-1245.489] (-1242.804) (-1252.406) -- 0:01:25
568000 -- (-1247.718) (-1248.768) [-1250.270] (-1250.759) * (-1251.507) (-1245.820) [-1252.690] (-1246.938) -- 0:01:25
568500 -- (-1247.828) (-1245.481) [-1247.425] (-1248.596) * (-1247.175) [-1246.198] (-1253.613) (-1244.795) -- 0:01:25
569000 -- (-1246.251) (-1244.462) [-1251.951] (-1248.477) * (-1244.047) (-1244.962) (-1247.066) [-1247.846] -- 0:01:24
569500 -- (-1251.082) (-1248.956) (-1249.849) [-1245.189] * (-1248.330) (-1249.398) (-1245.941) [-1243.776] -- 0:01:24
570000 -- (-1251.599) (-1246.434) (-1246.668) [-1247.724] * (-1247.235) [-1246.219] (-1248.669) (-1249.199) -- 0:01:24
Average standard deviation of split frequencies: 0.012556
570500 -- [-1251.659] (-1251.919) (-1252.353) (-1250.372) * (-1243.570) (-1245.763) [-1243.921] (-1241.990) -- 0:01:25
571000 -- (-1247.357) [-1246.009] (-1250.592) (-1250.207) * [-1246.662] (-1246.031) (-1248.857) (-1246.735) -- 0:01:24
571500 -- [-1249.895] (-1249.505) (-1255.403) (-1246.577) * (-1246.739) (-1248.176) [-1243.353] (-1248.638) -- 0:01:24
572000 -- (-1244.732) [-1244.219] (-1256.395) (-1246.664) * (-1258.807) (-1252.922) (-1242.142) [-1248.977] -- 0:01:24
572500 -- (-1253.851) (-1252.839) (-1248.853) [-1252.633] * (-1249.084) [-1247.791] (-1248.063) (-1245.209) -- 0:01:24
573000 -- [-1252.024] (-1242.660) (-1250.490) (-1251.037) * (-1241.844) (-1243.857) [-1246.322] (-1248.885) -- 0:01:24
573500 -- (-1248.095) (-1245.012) (-1252.355) [-1248.677] * [-1244.714] (-1248.061) (-1248.845) (-1243.451) -- 0:01:24
574000 -- (-1252.369) (-1249.782) (-1251.608) [-1252.685] * (-1243.481) [-1246.014] (-1248.300) (-1243.130) -- 0:01:23
574500 -- (-1245.855) [-1239.724] (-1255.082) (-1251.339) * [-1243.357] (-1249.016) (-1242.967) (-1244.453) -- 0:01:23
575000 -- (-1252.189) (-1251.261) [-1248.058] (-1246.378) * [-1247.472] (-1246.954) (-1243.424) (-1244.076) -- 0:01:23
Average standard deviation of split frequencies: 0.012276
575500 -- (-1254.713) (-1241.989) [-1241.227] (-1254.432) * [-1249.514] (-1252.550) (-1251.753) (-1249.628) -- 0:01:24
576000 -- (-1253.736) (-1249.525) [-1255.286] (-1251.410) * (-1246.893) (-1247.169) [-1245.867] (-1251.950) -- 0:01:23
576500 -- (-1251.934) [-1243.530] (-1250.156) (-1242.731) * (-1253.168) (-1258.673) (-1257.537) [-1242.666] -- 0:01:23
577000 -- (-1258.993) [-1241.858] (-1248.256) (-1247.911) * (-1248.814) [-1243.106] (-1248.566) (-1244.907) -- 0:01:23
577500 -- (-1260.270) (-1243.294) [-1248.490] (-1252.307) * [-1245.375] (-1255.138) (-1257.155) (-1255.548) -- 0:01:23
578000 -- (-1251.147) (-1256.100) [-1249.157] (-1249.575) * (-1244.430) (-1249.213) [-1252.366] (-1246.071) -- 0:01:23
578500 -- (-1264.121) (-1244.934) (-1253.398) [-1244.623] * (-1248.811) (-1247.441) [-1248.530] (-1251.018) -- 0:01:23
579000 -- (-1260.166) (-1250.012) [-1247.846] (-1245.550) * (-1244.853) [-1248.113] (-1245.717) (-1255.433) -- 0:01:22
579500 -- (-1256.509) [-1251.492] (-1246.624) (-1250.232) * [-1253.010] (-1254.837) (-1247.111) (-1256.512) -- 0:01:22
580000 -- (-1247.133) [-1245.834] (-1252.067) (-1248.078) * (-1249.360) (-1259.551) [-1255.709] (-1257.155) -- 0:01:22
Average standard deviation of split frequencies: 0.013152
580500 -- [-1251.946] (-1245.932) (-1247.871) (-1249.494) * (-1247.410) [-1250.994] (-1253.277) (-1254.960) -- 0:01:22
581000 -- (-1246.220) (-1247.992) [-1253.509] (-1248.029) * [-1242.845] (-1260.383) (-1241.962) (-1245.807) -- 0:01:22
581500 -- (-1245.276) (-1245.273) [-1248.595] (-1248.478) * (-1248.675) (-1245.763) [-1241.395] (-1246.340) -- 0:01:22
582000 -- (-1245.894) (-1253.227) (-1256.157) [-1253.228] * (-1247.863) [-1246.202] (-1244.974) (-1251.399) -- 0:01:22
582500 -- [-1249.010] (-1244.835) (-1242.606) (-1254.145) * (-1247.124) [-1255.441] (-1244.857) (-1249.469) -- 0:01:22
583000 -- (-1262.694) (-1250.494) [-1244.521] (-1252.693) * (-1258.660) [-1253.403] (-1252.187) (-1250.156) -- 0:01:22
583500 -- [-1244.065] (-1249.195) (-1242.829) (-1244.056) * (-1256.611) [-1238.691] (-1245.349) (-1250.558) -- 0:01:22
584000 -- [-1240.176] (-1246.194) (-1248.898) (-1246.871) * (-1254.340) (-1256.131) [-1243.552] (-1252.335) -- 0:01:21
584500 -- [-1242.651] (-1245.247) (-1255.413) (-1246.710) * (-1252.386) [-1243.580] (-1243.873) (-1259.336) -- 0:01:21
585000 -- (-1246.217) [-1242.707] (-1246.325) (-1249.421) * [-1244.944] (-1251.544) (-1242.534) (-1252.896) -- 0:01:21
Average standard deviation of split frequencies: 0.012871
585500 -- (-1246.503) [-1245.713] (-1249.960) (-1245.008) * (-1245.553) (-1247.917) [-1249.889] (-1248.039) -- 0:01:21
586000 -- (-1242.405) (-1249.818) (-1245.367) [-1248.107] * (-1246.252) [-1243.661] (-1252.356) (-1247.959) -- 0:01:21
586500 -- [-1247.366] (-1244.440) (-1254.147) (-1250.163) * [-1250.145] (-1247.795) (-1253.878) (-1245.456) -- 0:01:21
587000 -- (-1246.011) [-1245.079] (-1248.678) (-1246.018) * (-1241.880) [-1243.100] (-1253.802) (-1247.914) -- 0:01:21
587500 -- (-1252.649) (-1252.437) [-1246.675] (-1246.555) * (-1247.599) (-1249.254) [-1258.782] (-1246.324) -- 0:01:21
588000 -- (-1247.277) [-1245.092] (-1245.569) (-1249.646) * [-1246.115] (-1244.874) (-1260.612) (-1251.635) -- 0:01:21
588500 -- (-1255.674) (-1244.264) [-1248.006] (-1245.315) * (-1246.736) (-1251.920) [-1254.615] (-1247.030) -- 0:01:21
589000 -- (-1246.470) (-1249.159) (-1245.220) [-1245.805] * (-1245.837) (-1252.147) (-1246.588) [-1257.793] -- 0:01:20
589500 -- (-1254.779) (-1252.013) [-1247.954] (-1251.144) * [-1242.252] (-1252.641) (-1251.249) (-1246.620) -- 0:01:20
590000 -- (-1252.526) [-1251.503] (-1246.096) (-1245.457) * (-1249.316) (-1255.000) (-1250.491) [-1244.454] -- 0:01:20
Average standard deviation of split frequencies: 0.012929
590500 -- (-1254.929) (-1245.105) (-1255.888) [-1246.062] * (-1252.230) [-1257.676] (-1248.630) (-1249.263) -- 0:01:20
591000 -- [-1242.608] (-1249.978) (-1249.952) (-1242.887) * (-1260.505) [-1253.572] (-1244.144) (-1245.369) -- 0:01:20
591500 -- (-1251.040) (-1253.082) (-1251.392) [-1247.659] * [-1248.325] (-1252.564) (-1250.889) (-1256.790) -- 0:01:20
592000 -- (-1240.372) (-1249.053) (-1251.466) [-1244.892] * [-1243.213] (-1249.450) (-1242.146) (-1246.516) -- 0:01:20
592500 -- (-1249.686) (-1253.114) [-1249.356] (-1245.780) * (-1243.998) [-1248.567] (-1243.305) (-1249.881) -- 0:01:20
593000 -- (-1252.730) (-1248.949) [-1247.282] (-1253.571) * [-1245.010] (-1252.889) (-1247.866) (-1251.350) -- 0:01:20
593500 -- (-1247.378) (-1248.214) (-1253.329) [-1249.368] * (-1244.239) (-1246.908) [-1250.682] (-1251.600) -- 0:01:20
594000 -- (-1249.915) (-1251.099) [-1252.313] (-1245.138) * (-1244.973) [-1252.949] (-1248.364) (-1246.014) -- 0:01:19
594500 -- (-1248.395) [-1249.267] (-1252.832) (-1243.878) * (-1256.099) (-1249.577) (-1251.737) [-1242.494] -- 0:01:19
595000 -- (-1252.033) [-1250.918] (-1250.446) (-1246.752) * (-1249.838) [-1244.185] (-1248.499) (-1248.865) -- 0:01:19
Average standard deviation of split frequencies: 0.012813
595500 -- [-1250.057] (-1251.723) (-1254.824) (-1249.615) * (-1246.318) (-1244.139) (-1245.453) [-1252.897] -- 0:01:19
596000 -- (-1246.010) (-1248.176) [-1243.898] (-1247.267) * (-1251.890) [-1242.985] (-1252.837) (-1251.603) -- 0:01:19
596500 -- (-1244.216) [-1248.478] (-1249.664) (-1245.427) * (-1248.608) (-1248.222) [-1246.431] (-1253.207) -- 0:01:19
597000 -- (-1254.775) (-1252.282) (-1243.495) [-1249.062] * (-1254.582) (-1248.370) (-1248.292) [-1253.192] -- 0:01:19
597500 -- (-1246.215) [-1247.442] (-1250.789) (-1245.018) * (-1251.669) (-1247.327) (-1257.007) [-1255.154] -- 0:01:19
598000 -- (-1244.157) [-1241.132] (-1246.525) (-1255.480) * (-1250.248) (-1250.427) [-1250.034] (-1248.518) -- 0:01:19
598500 -- (-1249.150) (-1244.909) (-1247.271) [-1241.645] * (-1245.433) (-1251.589) [-1246.282] (-1255.655) -- 0:01:19
599000 -- (-1250.694) (-1258.207) [-1252.432] (-1247.594) * [-1249.406] (-1248.932) (-1250.889) (-1252.133) -- 0:01:18
599500 -- [-1240.111] (-1252.352) (-1251.574) (-1257.410) * (-1252.044) (-1246.941) (-1247.365) [-1248.263] -- 0:01:18
600000 -- (-1246.935) (-1251.026) (-1251.734) [-1245.465] * (-1249.138) [-1246.145] (-1249.166) (-1248.411) -- 0:01:18
Average standard deviation of split frequencies: 0.012557
600500 -- (-1246.692) (-1247.867) (-1249.195) [-1242.208] * (-1250.436) (-1249.210) [-1247.309] (-1256.366) -- 0:01:18
601000 -- (-1255.388) (-1247.090) [-1246.531] (-1250.123) * (-1249.683) (-1248.340) [-1251.254] (-1254.130) -- 0:01:18
601500 -- (-1250.953) (-1243.445) (-1247.312) [-1248.373] * [-1249.298] (-1245.580) (-1250.563) (-1254.024) -- 0:01:18
602000 -- (-1246.403) (-1252.504) (-1241.893) [-1246.233] * (-1245.699) (-1254.443) [-1251.316] (-1247.651) -- 0:01:18
602500 -- [-1253.543] (-1252.851) (-1242.570) (-1250.099) * (-1249.254) (-1253.274) [-1250.339] (-1245.736) -- 0:01:18
603000 -- (-1254.319) [-1249.151] (-1257.951) (-1247.820) * (-1248.403) [-1247.352] (-1249.182) (-1242.712) -- 0:01:18
603500 -- (-1243.184) [-1243.219] (-1243.688) (-1248.938) * (-1249.957) (-1250.339) (-1245.115) [-1245.300] -- 0:01:18
604000 -- (-1253.638) (-1247.539) [-1249.896] (-1251.034) * (-1244.747) [-1248.775] (-1250.187) (-1243.830) -- 0:01:18
604500 -- (-1257.684) [-1242.578] (-1246.446) (-1252.142) * [-1252.955] (-1250.794) (-1249.740) (-1243.072) -- 0:01:17
605000 -- (-1251.309) (-1248.254) [-1256.603] (-1244.701) * (-1250.275) (-1243.709) (-1246.594) [-1249.741] -- 0:01:17
Average standard deviation of split frequencies: 0.013847
605500 -- (-1252.169) (-1259.233) [-1250.179] (-1250.969) * (-1251.654) [-1250.290] (-1246.546) (-1247.865) -- 0:01:17
606000 -- (-1254.017) (-1250.988) (-1249.509) [-1246.103] * (-1255.233) (-1242.088) (-1247.760) [-1248.267] -- 0:01:17
606500 -- (-1246.607) (-1247.745) [-1247.198] (-1254.134) * (-1250.284) [-1242.390] (-1243.503) (-1249.801) -- 0:01:17
607000 -- (-1253.828) (-1246.217) [-1250.276] (-1245.782) * (-1249.544) (-1250.695) [-1245.437] (-1251.787) -- 0:01:17
607500 -- (-1243.590) (-1247.905) [-1247.670] (-1262.443) * [-1245.060] (-1248.489) (-1251.351) (-1244.151) -- 0:01:17
608000 -- (-1248.165) (-1252.514) [-1247.501] (-1249.583) * [-1249.372] (-1251.470) (-1247.917) (-1255.619) -- 0:01:17
608500 -- (-1253.030) (-1241.816) [-1245.849] (-1252.725) * (-1247.352) (-1252.151) [-1251.477] (-1254.583) -- 0:01:17
609000 -- (-1253.970) (-1251.217) (-1244.344) [-1245.394] * (-1248.450) [-1244.869] (-1257.542) (-1251.121) -- 0:01:17
609500 -- (-1247.947) (-1242.907) (-1246.725) [-1244.694] * (-1248.345) [-1242.616] (-1247.664) (-1258.903) -- 0:01:16
610000 -- (-1244.891) (-1245.174) [-1244.568] (-1246.015) * [-1249.300] (-1244.878) (-1244.524) (-1251.465) -- 0:01:16
Average standard deviation of split frequencies: 0.014976
610500 -- [-1242.232] (-1244.584) (-1251.159) (-1247.440) * [-1244.719] (-1252.980) (-1245.702) (-1250.425) -- 0:01:16
611000 -- (-1249.307) (-1248.425) [-1245.925] (-1253.737) * [-1245.537] (-1250.957) (-1243.204) (-1246.463) -- 0:01:16
611500 -- [-1249.455] (-1245.061) (-1244.201) (-1250.680) * (-1256.263) [-1248.326] (-1249.767) (-1255.389) -- 0:01:16
612000 -- [-1248.643] (-1246.913) (-1246.024) (-1245.684) * [-1249.231] (-1251.159) (-1249.938) (-1245.911) -- 0:01:16
612500 -- (-1248.003) (-1245.775) (-1249.128) [-1247.438] * (-1248.572) [-1246.626] (-1249.070) (-1254.649) -- 0:01:16
613000 -- (-1251.944) [-1248.212] (-1247.805) (-1246.571) * (-1247.709) (-1250.175) (-1243.929) [-1250.367] -- 0:01:16
613500 -- (-1251.207) [-1245.418] (-1246.419) (-1256.533) * (-1246.701) (-1252.268) (-1253.228) [-1248.355] -- 0:01:16
614000 -- (-1243.210) (-1251.030) [-1252.471] (-1257.585) * (-1252.510) [-1250.522] (-1249.092) (-1244.355) -- 0:01:16
614500 -- (-1242.435) (-1249.488) [-1254.829] (-1253.387) * [-1243.891] (-1246.779) (-1249.542) (-1247.037) -- 0:01:15
615000 -- (-1248.465) (-1256.695) (-1249.228) [-1247.175] * (-1246.881) [-1240.056] (-1246.637) (-1257.436) -- 0:01:15
Average standard deviation of split frequencies: 0.015152
615500 -- (-1242.787) (-1249.815) [-1246.213] (-1251.448) * (-1260.622) (-1247.342) [-1251.036] (-1243.447) -- 0:01:15
616000 -- (-1254.834) (-1249.735) [-1249.033] (-1247.395) * (-1243.124) (-1260.396) (-1245.166) [-1240.101] -- 0:01:15
616500 -- (-1245.491) [-1249.999] (-1244.393) (-1249.950) * [-1240.467] (-1248.082) (-1243.952) (-1247.202) -- 0:01:15
617000 -- (-1246.685) (-1248.275) (-1249.067) [-1250.078] * (-1248.046) (-1250.977) [-1248.681] (-1250.208) -- 0:01:15
617500 -- [-1249.306] (-1246.909) (-1250.437) (-1252.497) * (-1244.965) (-1251.783) [-1248.815] (-1248.223) -- 0:01:15
618000 -- [-1252.865] (-1254.819) (-1247.989) (-1243.524) * [-1248.375] (-1248.103) (-1254.686) (-1244.714) -- 0:01:15
618500 -- (-1245.024) (-1248.626) [-1245.228] (-1246.282) * (-1248.361) (-1250.277) (-1244.767) [-1244.481] -- 0:01:15
619000 -- [-1242.230] (-1249.852) (-1249.081) (-1255.326) * (-1247.826) (-1245.976) (-1246.169) [-1245.750] -- 0:01:15
619500 -- (-1257.265) (-1250.418) (-1244.050) [-1247.401] * [-1247.715] (-1251.940) (-1249.571) (-1246.845) -- 0:01:14
620000 -- [-1250.416] (-1253.305) (-1255.927) (-1251.641) * (-1248.970) [-1242.984] (-1250.415) (-1250.913) -- 0:01:14
Average standard deviation of split frequencies: 0.014127
620500 -- (-1242.497) (-1249.506) [-1252.926] (-1255.132) * (-1248.403) [-1244.351] (-1251.798) (-1254.548) -- 0:01:14
621000 -- (-1251.047) [-1246.453] (-1252.282) (-1249.401) * (-1249.024) (-1252.484) [-1247.233] (-1245.836) -- 0:01:14
621500 -- (-1242.802) (-1245.974) [-1252.457] (-1250.417) * (-1248.390) (-1245.389) [-1244.931] (-1252.012) -- 0:01:14
622000 -- (-1246.365) (-1249.031) [-1248.391] (-1252.008) * [-1246.545] (-1248.144) (-1243.543) (-1253.152) -- 0:01:14
622500 -- (-1249.751) (-1249.262) (-1249.911) [-1246.755] * (-1242.994) (-1249.805) (-1243.303) [-1247.575] -- 0:01:14
623000 -- [-1245.271] (-1248.442) (-1256.406) (-1242.633) * (-1247.163) (-1245.387) (-1245.334) [-1242.640] -- 0:01:14
623500 -- [-1256.536] (-1246.817) (-1249.613) (-1250.126) * [-1247.022] (-1254.025) (-1246.991) (-1251.807) -- 0:01:14
624000 -- (-1248.015) (-1248.319) (-1249.615) [-1243.556] * (-1253.204) (-1256.663) (-1241.043) [-1250.643] -- 0:01:14
624500 -- (-1245.942) (-1253.280) (-1244.829) [-1252.497] * (-1248.054) [-1247.527] (-1255.520) (-1247.454) -- 0:01:13
625000 -- (-1250.268) (-1249.626) (-1252.654) [-1244.467] * [-1246.625] (-1244.373) (-1254.112) (-1251.156) -- 0:01:13
Average standard deviation of split frequencies: 0.015211
625500 -- (-1246.056) (-1248.135) [-1248.403] (-1249.496) * [-1248.538] (-1242.710) (-1254.943) (-1256.834) -- 0:01:13
626000 -- (-1252.887) (-1249.908) (-1249.035) [-1248.299] * (-1247.524) (-1248.661) (-1249.428) [-1243.972] -- 0:01:13
626500 -- [-1246.145] (-1247.189) (-1245.608) (-1251.812) * (-1246.999) [-1245.707] (-1249.761) (-1250.897) -- 0:01:13
627000 -- [-1245.316] (-1244.684) (-1249.277) (-1245.902) * (-1248.333) (-1249.873) (-1248.309) [-1245.727] -- 0:01:13
627500 -- [-1247.784] (-1251.452) (-1252.875) (-1249.831) * (-1250.203) [-1243.380] (-1250.557) (-1250.493) -- 0:01:13
628000 -- (-1245.740) (-1245.042) [-1243.161] (-1252.016) * [-1243.235] (-1239.346) (-1249.822) (-1246.907) -- 0:01:13
628500 -- (-1245.822) (-1252.291) (-1242.913) [-1245.307] * (-1256.862) (-1249.911) (-1253.212) [-1244.661] -- 0:01:13
629000 -- (-1246.905) [-1243.566] (-1249.763) (-1251.082) * (-1246.072) (-1243.345) [-1251.643] (-1256.773) -- 0:01:13
629500 -- (-1245.412) (-1241.058) (-1254.574) [-1246.418] * [-1245.730] (-1255.804) (-1249.357) (-1248.082) -- 0:01:12
630000 -- (-1251.410) (-1247.549) (-1248.792) [-1244.634] * (-1242.659) (-1242.249) [-1254.004] (-1247.449) -- 0:01:12
Average standard deviation of split frequencies: 0.015996
630500 -- (-1247.443) [-1243.985] (-1245.726) (-1247.357) * (-1252.046) [-1242.413] (-1256.086) (-1244.907) -- 0:01:12
631000 -- (-1253.285) [-1243.223] (-1247.958) (-1249.086) * [-1249.600] (-1244.976) (-1251.086) (-1244.385) -- 0:01:12
631500 -- (-1249.144) [-1245.368] (-1249.554) (-1250.253) * [-1248.131] (-1253.757) (-1252.641) (-1248.490) -- 0:01:12
632000 -- [-1246.229] (-1249.571) (-1249.484) (-1247.246) * (-1247.252) (-1242.746) [-1253.229] (-1242.378) -- 0:01:12
632500 -- (-1250.564) [-1252.670] (-1246.855) (-1257.516) * (-1246.370) [-1242.532] (-1244.651) (-1249.509) -- 0:01:12
633000 -- [-1247.753] (-1253.448) (-1247.017) (-1245.727) * (-1254.275) (-1248.071) [-1252.114] (-1262.110) -- 0:01:12
633500 -- (-1252.672) (-1252.887) [-1251.748] (-1246.376) * [-1245.169] (-1247.558) (-1251.176) (-1243.951) -- 0:01:12
634000 -- (-1253.351) [-1243.535] (-1256.107) (-1251.722) * (-1259.664) (-1245.848) [-1247.940] (-1248.403) -- 0:01:12
634500 -- (-1255.318) [-1244.753] (-1248.785) (-1248.762) * (-1251.546) [-1246.455] (-1247.365) (-1250.766) -- 0:01:12
635000 -- [-1256.018] (-1251.476) (-1247.384) (-1247.793) * [-1252.595] (-1246.308) (-1252.819) (-1242.508) -- 0:01:11
Average standard deviation of split frequencies: 0.016158
635500 -- [-1248.832] (-1255.269) (-1244.963) (-1244.199) * (-1255.534) [-1246.150] (-1250.501) (-1252.096) -- 0:01:11
636000 -- (-1250.517) [-1250.896] (-1248.726) (-1254.567) * (-1248.977) [-1250.157] (-1249.286) (-1260.239) -- 0:01:11
636500 -- (-1244.669) (-1249.824) [-1243.274] (-1246.915) * (-1248.023) (-1247.459) [-1244.427] (-1249.243) -- 0:01:11
637000 -- (-1247.721) (-1255.503) [-1249.963] (-1248.587) * [-1246.796] (-1249.125) (-1243.339) (-1252.780) -- 0:01:11
637500 -- (-1260.576) (-1251.560) (-1249.590) [-1246.427] * [-1247.559] (-1255.545) (-1248.001) (-1245.897) -- 0:01:11
638000 -- (-1248.150) [-1250.668] (-1244.772) (-1246.223) * [-1250.086] (-1249.046) (-1245.409) (-1246.175) -- 0:01:11
638500 -- (-1250.150) [-1247.163] (-1247.230) (-1247.742) * [-1246.753] (-1253.460) (-1249.533) (-1249.691) -- 0:01:11
639000 -- [-1248.629] (-1250.968) (-1256.652) (-1246.524) * (-1252.687) (-1248.084) [-1251.665] (-1244.469) -- 0:01:11
639500 -- (-1252.485) [-1244.650] (-1249.967) (-1250.776) * (-1247.873) [-1244.423] (-1247.748) (-1257.831) -- 0:01:11
640000 -- (-1261.016) (-1249.715) (-1252.520) [-1247.746] * [-1246.923] (-1242.737) (-1249.030) (-1248.737) -- 0:01:10
Average standard deviation of split frequencies: 0.017071
640500 -- (-1245.888) (-1247.474) (-1244.941) [-1243.151] * (-1251.599) (-1246.476) [-1246.445] (-1249.820) -- 0:01:10
641000 -- [-1250.427] (-1244.798) (-1244.234) (-1246.322) * (-1248.543) (-1244.203) [-1243.036] (-1247.336) -- 0:01:10
641500 -- (-1259.076) (-1252.074) [-1244.871] (-1257.068) * [-1254.582] (-1245.723) (-1250.151) (-1249.736) -- 0:01:10
642000 -- (-1246.232) (-1248.461) (-1244.977) [-1249.493] * (-1247.613) (-1247.806) (-1249.813) [-1247.504] -- 0:01:10
642500 -- [-1244.936] (-1249.215) (-1257.487) (-1243.811) * [-1251.456] (-1248.326) (-1247.384) (-1254.664) -- 0:01:10
643000 -- (-1253.418) [-1244.066] (-1253.152) (-1252.848) * [-1247.566] (-1247.050) (-1244.383) (-1251.124) -- 0:01:10
643500 -- (-1254.342) [-1247.871] (-1255.647) (-1255.483) * (-1248.816) [-1253.906] (-1245.476) (-1254.810) -- 0:01:10
644000 -- (-1247.875) (-1245.700) [-1246.187] (-1248.682) * (-1248.410) (-1254.999) [-1242.413] (-1259.915) -- 0:01:10
644500 -- (-1247.277) [-1244.105] (-1248.898) (-1256.672) * (-1258.291) (-1250.973) [-1252.811] (-1251.632) -- 0:01:10
645000 -- (-1251.045) [-1245.113] (-1256.216) (-1253.356) * (-1249.702) (-1251.509) (-1250.377) [-1253.740] -- 0:01:09
Average standard deviation of split frequencies: 0.016200
645500 -- (-1249.847) [-1247.474] (-1248.153) (-1247.875) * (-1253.693) (-1251.601) (-1243.871) [-1248.896] -- 0:01:09
646000 -- (-1252.338) (-1250.979) (-1261.214) [-1246.719] * (-1253.588) (-1248.290) [-1249.246] (-1246.655) -- 0:01:09
646500 -- (-1249.108) (-1252.268) (-1245.861) [-1248.871] * (-1253.200) [-1253.642] (-1251.904) (-1253.530) -- 0:01:09
647000 -- (-1253.289) [-1242.831] (-1250.602) (-1251.983) * (-1246.537) [-1249.346] (-1249.842) (-1247.269) -- 0:01:09
647500 -- [-1247.272] (-1244.920) (-1248.281) (-1249.274) * (-1249.858) (-1241.919) [-1242.823] (-1249.380) -- 0:01:09
648000 -- (-1247.539) (-1248.067) [-1247.499] (-1251.501) * (-1247.434) (-1249.329) (-1248.966) [-1248.970] -- 0:01:09
648500 -- [-1243.977] (-1250.032) (-1249.879) (-1245.574) * (-1248.174) [-1249.633] (-1250.652) (-1253.055) -- 0:01:09
649000 -- [-1246.505] (-1246.193) (-1249.521) (-1249.183) * (-1248.980) [-1243.426] (-1246.758) (-1250.627) -- 0:01:09
649500 -- [-1248.199] (-1252.080) (-1251.153) (-1245.199) * (-1252.711) (-1248.615) (-1250.986) [-1244.807] -- 0:01:09
650000 -- (-1255.373) [-1251.339] (-1249.795) (-1248.705) * (-1246.427) (-1246.038) (-1254.540) [-1246.652] -- 0:01:08
Average standard deviation of split frequencies: 0.015359
650500 -- [-1246.481] (-1249.060) (-1257.684) (-1252.849) * (-1246.872) (-1244.104) [-1246.322] (-1248.486) -- 0:01:08
651000 -- [-1248.302] (-1251.196) (-1256.214) (-1244.968) * [-1252.065] (-1243.724) (-1249.033) (-1246.020) -- 0:01:08
651500 -- [-1242.334] (-1247.686) (-1260.155) (-1247.419) * (-1248.869) [-1246.088] (-1250.610) (-1246.280) -- 0:01:08
652000 -- (-1250.374) (-1249.899) [-1246.670] (-1253.543) * [-1253.058] (-1244.411) (-1250.636) (-1243.508) -- 0:01:08
652500 -- (-1258.463) [-1240.951] (-1252.523) (-1251.806) * [-1244.769] (-1249.819) (-1249.718) (-1255.672) -- 0:01:08
653000 -- (-1257.374) (-1245.307) [-1250.042] (-1246.681) * (-1250.225) (-1252.311) [-1250.835] (-1255.471) -- 0:01:08
653500 -- [-1254.957] (-1245.460) (-1247.177) (-1251.034) * (-1241.985) [-1247.254] (-1249.047) (-1251.604) -- 0:01:08
654000 -- (-1256.400) (-1245.611) (-1254.769) [-1245.395] * (-1254.869) (-1248.393) [-1246.138] (-1255.698) -- 0:01:08
654500 -- (-1251.924) (-1252.091) (-1248.679) [-1245.153] * (-1252.461) (-1253.075) [-1248.112] (-1248.898) -- 0:01:08
655000 -- [-1246.431] (-1248.084) (-1252.899) (-1248.662) * (-1251.068) [-1251.669] (-1250.928) (-1252.124) -- 0:01:07
Average standard deviation of split frequencies: 0.015234
655500 -- [-1246.091] (-1246.129) (-1241.388) (-1248.579) * [-1253.967] (-1257.113) (-1246.767) (-1248.482) -- 0:01:07
656000 -- (-1251.514) [-1249.133] (-1249.692) (-1253.053) * (-1243.919) [-1254.594] (-1254.336) (-1250.949) -- 0:01:07
656500 -- (-1244.582) (-1244.507) (-1254.308) [-1248.421] * (-1251.043) (-1259.934) [-1248.543] (-1253.900) -- 0:01:07
657000 -- (-1251.067) [-1255.606] (-1247.381) (-1247.844) * [-1247.327] (-1253.517) (-1247.695) (-1250.601) -- 0:01:07
657500 -- (-1258.308) (-1250.116) [-1247.171] (-1248.810) * [-1253.949] (-1250.513) (-1248.804) (-1248.182) -- 0:01:07
658000 -- [-1255.587] (-1255.335) (-1252.416) (-1247.655) * (-1248.511) (-1254.576) [-1248.024] (-1254.550) -- 0:01:07
658500 -- (-1251.312) [-1251.244] (-1246.403) (-1252.462) * (-1246.300) (-1256.155) [-1246.600] (-1253.169) -- 0:01:07
659000 -- (-1249.980) [-1251.819] (-1246.201) (-1246.588) * (-1250.667) (-1250.206) [-1249.809] (-1251.118) -- 0:01:07
659500 -- (-1250.291) (-1255.731) [-1247.511] (-1242.297) * (-1248.651) (-1248.756) (-1250.196) [-1245.343] -- 0:01:07
660000 -- (-1251.014) (-1246.876) (-1246.290) [-1245.200] * [-1249.602] (-1244.829) (-1249.883) (-1250.508) -- 0:01:06
Average standard deviation of split frequencies: 0.016268
660500 -- [-1248.474] (-1245.031) (-1254.627) (-1245.919) * [-1243.424] (-1254.801) (-1245.227) (-1247.234) -- 0:01:06
661000 -- (-1252.356) (-1245.373) [-1252.008] (-1248.657) * (-1248.419) (-1257.410) (-1251.055) [-1250.000] -- 0:01:06
661500 -- (-1254.610) (-1252.147) (-1255.996) [-1243.224] * [-1244.187] (-1258.137) (-1246.923) (-1254.868) -- 0:01:06
662000 -- (-1253.893) (-1253.147) (-1249.706) [-1247.964] * (-1246.037) (-1243.166) [-1250.522] (-1243.466) -- 0:01:06
662500 -- [-1257.714] (-1256.017) (-1247.336) (-1249.164) * (-1247.805) (-1249.915) (-1257.933) [-1247.769] -- 0:01:06
663000 -- [-1246.980] (-1248.459) (-1258.248) (-1246.100) * [-1250.943] (-1245.997) (-1243.633) (-1247.447) -- 0:01:06
663500 -- (-1251.112) (-1241.955) [-1243.436] (-1252.081) * (-1252.476) [-1245.048] (-1250.888) (-1243.870) -- 0:01:05
664000 -- (-1251.064) (-1241.816) (-1257.663) [-1242.538] * (-1250.424) [-1244.475] (-1247.815) (-1246.554) -- 0:01:06
664500 -- (-1249.199) (-1247.897) (-1243.880) [-1244.557] * [-1245.910] (-1244.148) (-1251.154) (-1247.993) -- 0:01:06
665000 -- (-1245.083) (-1247.178) (-1249.224) [-1248.231] * (-1245.468) (-1252.484) (-1255.950) [-1242.811] -- 0:01:05
Average standard deviation of split frequencies: 0.016421
665500 -- (-1247.125) (-1243.225) [-1248.421] (-1261.609) * [-1241.546] (-1246.558) (-1248.274) (-1243.567) -- 0:01:05
666000 -- (-1249.094) (-1246.444) (-1247.312) [-1253.270] * (-1248.404) (-1256.578) (-1246.329) [-1246.303] -- 0:01:05
666500 -- (-1248.615) (-1257.538) [-1250.113] (-1245.906) * (-1244.010) (-1255.644) (-1242.883) [-1240.916] -- 0:01:05
667000 -- [-1245.951] (-1250.021) (-1246.776) (-1248.580) * (-1252.368) (-1251.783) [-1246.796] (-1246.967) -- 0:01:05
667500 -- (-1244.261) (-1249.373) [-1246.142] (-1249.979) * (-1246.166) [-1249.896] (-1245.470) (-1258.357) -- 0:01:05
668000 -- (-1249.413) (-1251.364) (-1240.185) [-1250.475] * (-1246.054) [-1247.243] (-1247.089) (-1250.041) -- 0:01:05
668500 -- (-1246.151) (-1258.568) (-1248.930) [-1252.287] * [-1246.113] (-1247.701) (-1253.282) (-1248.450) -- 0:01:04
669000 -- (-1247.603) (-1251.994) (-1248.926) [-1248.846] * [-1246.169] (-1248.396) (-1242.648) (-1250.011) -- 0:01:05
669500 -- (-1254.467) (-1249.618) (-1249.948) [-1246.071] * (-1255.209) [-1252.214] (-1247.879) (-1251.144) -- 0:01:05
670000 -- (-1243.003) (-1258.836) (-1253.397) [-1255.463] * [-1249.345] (-1249.958) (-1252.080) (-1251.058) -- 0:01:05
Average standard deviation of split frequencies: 0.016729
670500 -- [-1249.501] (-1254.457) (-1253.387) (-1247.189) * [-1245.193] (-1245.541) (-1247.200) (-1250.094) -- 0:01:04
671000 -- [-1244.194] (-1246.328) (-1247.763) (-1246.380) * (-1248.328) (-1252.892) (-1250.146) [-1246.691] -- 0:01:04
671500 -- (-1241.787) [-1247.587] (-1247.653) (-1250.116) * (-1248.510) [-1248.548] (-1248.280) (-1251.271) -- 0:01:04
672000 -- (-1245.962) [-1245.573] (-1245.143) (-1252.392) * (-1250.378) (-1246.209) (-1252.132) [-1251.409] -- 0:01:04
672500 -- (-1247.041) (-1250.904) [-1243.319] (-1245.933) * (-1243.477) (-1252.105) (-1247.815) [-1247.743] -- 0:01:04
673000 -- (-1246.577) [-1246.412] (-1245.020) (-1247.214) * (-1251.724) [-1251.064] (-1252.488) (-1245.763) -- 0:01:04
673500 -- (-1242.618) [-1249.134] (-1249.969) (-1250.365) * [-1246.364] (-1249.976) (-1243.690) (-1249.223) -- 0:01:03
674000 -- [-1252.786] (-1260.823) (-1247.601) (-1246.232) * (-1247.315) [-1248.685] (-1245.217) (-1255.813) -- 0:01:03
674500 -- (-1243.231) (-1249.799) (-1247.456) [-1249.646] * (-1253.352) [-1245.523] (-1248.506) (-1248.140) -- 0:01:04
675000 -- (-1254.222) (-1246.259) [-1250.016] (-1250.196) * (-1251.516) (-1247.376) (-1249.309) [-1253.367] -- 0:01:04
Average standard deviation of split frequencies: 0.015899
675500 -- (-1244.699) (-1248.915) [-1243.991] (-1257.790) * (-1251.267) [-1246.232] (-1246.263) (-1256.937) -- 0:01:03
676000 -- (-1244.660) (-1250.883) [-1248.465] (-1248.365) * (-1259.710) [-1246.420] (-1244.407) (-1252.043) -- 0:01:03
676500 -- [-1243.932] (-1249.247) (-1247.839) (-1250.404) * (-1247.604) (-1243.650) [-1248.115] (-1246.672) -- 0:01:03
677000 -- (-1252.914) (-1245.806) (-1252.972) [-1251.094] * (-1242.719) [-1247.955] (-1247.943) (-1255.013) -- 0:01:03
677500 -- (-1246.441) [-1246.580] (-1247.422) (-1250.487) * [-1252.805] (-1245.103) (-1245.056) (-1245.579) -- 0:01:03
678000 -- (-1246.717) [-1246.944] (-1245.215) (-1246.948) * [-1245.481] (-1249.803) (-1251.322) (-1250.741) -- 0:01:03
678500 -- [-1247.984] (-1244.693) (-1247.662) (-1252.047) * (-1252.306) [-1241.360] (-1245.037) (-1248.481) -- 0:01:03
679000 -- (-1248.114) (-1246.986) [-1244.182] (-1248.367) * [-1245.782] (-1248.207) (-1258.643) (-1250.439) -- 0:01:02
679500 -- (-1247.962) [-1245.990] (-1256.619) (-1249.022) * (-1249.043) [-1254.703] (-1245.283) (-1250.841) -- 0:01:03
680000 -- (-1252.458) [-1244.699] (-1249.377) (-1251.277) * (-1247.856) (-1252.450) [-1250.833] (-1251.698) -- 0:01:03
Average standard deviation of split frequencies: 0.016206
680500 -- (-1248.053) (-1258.894) (-1247.086) [-1243.611] * (-1246.010) (-1249.051) (-1256.644) [-1244.865] -- 0:01:02
681000 -- [-1245.946] (-1258.169) (-1248.852) (-1246.452) * (-1249.186) (-1258.664) [-1244.357] (-1244.751) -- 0:01:02
681500 -- (-1251.938) [-1250.730] (-1248.814) (-1247.739) * (-1244.412) (-1254.576) (-1253.196) [-1249.127] -- 0:01:02
682000 -- (-1250.561) (-1244.968) (-1255.453) [-1246.250] * (-1247.627) [-1251.421] (-1251.585) (-1248.760) -- 0:01:02
682500 -- (-1252.612) (-1244.461) (-1247.957) [-1243.676] * (-1262.778) (-1248.481) [-1249.228] (-1245.101) -- 0:01:02
683000 -- (-1257.374) [-1241.983] (-1253.447) (-1247.239) * (-1251.778) [-1247.682] (-1252.513) (-1248.600) -- 0:01:02
683500 -- (-1252.015) [-1246.213] (-1248.443) (-1249.644) * (-1248.320) (-1250.473) (-1252.002) [-1250.373] -- 0:01:02
684000 -- [-1254.721] (-1246.866) (-1252.195) (-1248.795) * [-1252.401] (-1245.100) (-1257.307) (-1251.061) -- 0:01:01
684500 -- [-1245.476] (-1246.512) (-1245.056) (-1251.611) * (-1252.029) (-1256.332) [-1245.780] (-1248.266) -- 0:01:02
685000 -- (-1249.674) [-1250.499] (-1248.129) (-1244.386) * [-1245.504] (-1243.333) (-1250.945) (-1248.525) -- 0:01:02
Average standard deviation of split frequencies: 0.015393
685500 -- (-1255.210) [-1247.902] (-1250.027) (-1245.562) * (-1245.620) (-1247.348) (-1252.635) [-1246.241] -- 0:01:01
686000 -- (-1252.382) (-1254.290) (-1251.505) [-1250.646] * (-1248.785) (-1251.560) [-1246.619] (-1248.189) -- 0:01:01
686500 -- (-1254.327) (-1245.986) [-1242.654] (-1244.387) * (-1255.421) (-1255.580) (-1249.818) [-1251.077] -- 0:01:01
687000 -- (-1252.029) (-1250.756) (-1248.341) [-1241.489] * (-1248.082) (-1249.727) [-1243.395] (-1247.801) -- 0:01:01
687500 -- (-1245.563) (-1254.483) [-1252.352] (-1247.364) * (-1249.452) (-1247.381) [-1248.318] (-1250.729) -- 0:01:01
688000 -- (-1249.889) (-1247.974) (-1253.031) [-1245.105] * (-1249.374) (-1250.331) [-1247.706] (-1250.917) -- 0:01:01
688500 -- (-1243.480) (-1252.927) [-1243.615] (-1243.627) * (-1249.240) [-1244.275] (-1245.332) (-1248.700) -- 0:01:01
689000 -- [-1251.594] (-1244.842) (-1246.636) (-1247.877) * [-1246.868] (-1251.754) (-1256.700) (-1250.642) -- 0:01:00
689500 -- (-1245.017) [-1241.053] (-1250.616) (-1248.617) * (-1253.416) (-1242.538) [-1244.487] (-1245.440) -- 0:01:00
690000 -- [-1247.433] (-1246.799) (-1245.967) (-1244.637) * [-1241.733] (-1244.445) (-1252.371) (-1251.309) -- 0:01:01
Average standard deviation of split frequencies: 0.015152
690500 -- (-1243.685) (-1247.372) [-1247.244] (-1247.658) * (-1247.014) [-1245.842] (-1249.323) (-1255.098) -- 0:01:00
691000 -- [-1245.490] (-1246.195) (-1245.555) (-1245.553) * [-1247.281] (-1253.418) (-1251.923) (-1252.169) -- 0:01:00
691500 -- [-1249.783] (-1243.813) (-1243.928) (-1244.208) * [-1252.429] (-1246.993) (-1253.138) (-1243.741) -- 0:01:00
692000 -- [-1245.048] (-1255.884) (-1251.043) (-1245.107) * (-1255.887) (-1246.500) [-1248.898] (-1247.003) -- 0:01:00
692500 -- [-1248.768] (-1251.893) (-1253.030) (-1251.644) * [-1248.106] (-1245.581) (-1246.980) (-1243.101) -- 0:01:00
693000 -- (-1251.225) (-1251.276) (-1246.786) [-1247.047] * (-1241.942) [-1245.068] (-1255.405) (-1251.430) -- 0:01:00
693500 -- [-1250.537] (-1244.711) (-1254.040) (-1246.920) * [-1243.614] (-1242.129) (-1250.478) (-1252.347) -- 0:01:00
694000 -- [-1246.773] (-1247.482) (-1250.540) (-1256.472) * [-1248.803] (-1252.560) (-1255.062) (-1247.740) -- 0:00:59
694500 -- (-1256.182) (-1251.622) [-1249.483] (-1256.541) * (-1249.587) (-1252.217) [-1246.756] (-1249.831) -- 0:00:59
695000 -- (-1252.571) [-1249.196] (-1250.736) (-1243.553) * (-1243.463) (-1247.633) [-1243.210] (-1248.702) -- 0:01:00
Average standard deviation of split frequencies: 0.015849
695500 -- (-1248.346) (-1250.036) (-1250.275) [-1245.513] * (-1251.323) (-1251.855) (-1244.844) [-1248.497] -- 0:00:59
696000 -- (-1249.480) (-1258.657) [-1250.531] (-1254.579) * [-1246.752] (-1255.992) (-1253.501) (-1251.315) -- 0:00:59
696500 -- (-1253.203) [-1252.618] (-1245.835) (-1245.665) * (-1252.156) (-1249.361) [-1248.046] (-1247.139) -- 0:00:59
697000 -- (-1246.726) (-1252.404) [-1251.560] (-1251.585) * (-1250.103) [-1247.509] (-1249.703) (-1246.006) -- 0:00:59
697500 -- [-1250.474] (-1248.773) (-1251.411) (-1247.810) * (-1246.104) (-1246.154) (-1251.638) [-1251.252] -- 0:00:59
698000 -- (-1251.384) (-1249.259) (-1246.465) [-1246.428] * (-1250.331) (-1244.630) (-1250.988) [-1242.729] -- 0:00:59
698500 -- (-1244.617) (-1246.055) [-1241.981] (-1245.076) * (-1248.027) [-1249.512] (-1246.316) (-1253.626) -- 0:00:59
699000 -- (-1246.508) [-1249.463] (-1249.390) (-1263.103) * (-1239.921) [-1246.230] (-1247.628) (-1244.036) -- 0:00:58
699500 -- (-1243.424) (-1257.101) [-1245.889] (-1248.730) * (-1244.707) (-1251.097) [-1241.584] (-1244.706) -- 0:00:58
700000 -- (-1248.712) (-1246.664) [-1250.503] (-1253.435) * (-1249.040) (-1252.395) (-1252.710) [-1249.377] -- 0:00:58
Average standard deviation of split frequencies: 0.016551
700500 -- (-1247.458) (-1254.260) (-1250.723) [-1252.487] * [-1248.157] (-1247.552) (-1245.264) (-1247.587) -- 0:00:59
701000 -- (-1248.929) [-1245.307] (-1252.613) (-1244.728) * (-1247.190) [-1249.931] (-1247.865) (-1251.780) -- 0:00:58
701500 -- (-1256.840) (-1250.174) [-1247.669] (-1246.419) * (-1248.846) [-1245.755] (-1249.785) (-1245.937) -- 0:00:58
702000 -- [-1254.613] (-1245.863) (-1249.813) (-1249.540) * (-1244.685) [-1247.031] (-1254.203) (-1248.271) -- 0:00:58
702500 -- (-1256.767) [-1251.639] (-1248.817) (-1247.706) * [-1244.585] (-1249.527) (-1244.392) (-1249.354) -- 0:00:58
703000 -- (-1250.247) (-1250.196) [-1244.173] (-1253.373) * (-1245.004) [-1243.427] (-1242.421) (-1256.452) -- 0:00:58
703500 -- [-1248.183] (-1249.923) (-1248.831) (-1249.433) * [-1243.832] (-1254.422) (-1240.740) (-1246.647) -- 0:00:58
704000 -- (-1254.577) [-1246.561] (-1246.867) (-1257.542) * (-1245.141) [-1244.490] (-1247.282) (-1250.691) -- 0:00:58
704500 -- (-1250.653) (-1245.978) [-1249.495] (-1244.633) * (-1244.653) (-1248.749) [-1245.441] (-1247.764) -- 0:00:57
705000 -- [-1247.147] (-1247.054) (-1256.455) (-1254.742) * (-1250.916) (-1246.602) (-1245.361) [-1245.413] -- 0:00:57
Average standard deviation of split frequencies: 0.016693
705500 -- (-1247.724) (-1251.766) [-1250.279] (-1250.084) * (-1250.350) (-1255.488) [-1244.305] (-1248.340) -- 0:00:58
706000 -- (-1243.793) [-1245.120] (-1245.864) (-1255.785) * (-1242.747) (-1245.878) (-1244.757) [-1246.077] -- 0:00:57
706500 -- (-1248.526) (-1243.283) [-1250.539] (-1254.940) * [-1244.542] (-1246.068) (-1247.509) (-1244.764) -- 0:00:57
707000 -- (-1254.906) (-1255.743) (-1256.043) [-1249.332] * (-1249.120) (-1245.744) (-1250.056) [-1246.243] -- 0:00:57
707500 -- [-1254.543] (-1250.860) (-1253.057) (-1245.450) * (-1248.738) [-1245.877] (-1247.385) (-1247.697) -- 0:00:57
708000 -- (-1249.965) [-1244.238] (-1247.369) (-1248.461) * (-1251.418) (-1251.844) [-1248.397] (-1247.640) -- 0:00:57
708500 -- (-1253.852) (-1243.403) (-1252.850) [-1249.849] * (-1259.754) (-1250.982) (-1249.046) [-1254.079] -- 0:00:57
709000 -- (-1244.639) [-1243.597] (-1247.567) (-1243.346) * (-1251.220) [-1249.662] (-1251.735) (-1248.103) -- 0:00:57
709500 -- (-1247.315) [-1247.748] (-1253.889) (-1243.112) * (-1262.152) (-1252.138) (-1246.960) [-1246.070] -- 0:00:56
710000 -- (-1247.477) [-1247.421] (-1251.212) (-1252.669) * (-1251.516) [-1245.141] (-1248.285) (-1250.755) -- 0:00:56
Average standard deviation of split frequencies: 0.017114
710500 -- [-1249.978] (-1249.025) (-1243.191) (-1249.876) * (-1254.331) (-1245.720) [-1246.042] (-1244.765) -- 0:00:57
711000 -- (-1246.579) (-1251.622) [-1245.903] (-1251.095) * (-1249.490) (-1251.829) [-1244.552] (-1246.785) -- 0:00:56
711500 -- (-1250.845) [-1244.751] (-1246.273) (-1248.496) * (-1255.845) (-1242.583) [-1242.743] (-1244.278) -- 0:00:56
712000 -- (-1251.834) (-1250.235) (-1256.253) [-1242.536] * (-1247.603) (-1248.615) [-1245.399] (-1242.044) -- 0:00:56
712500 -- (-1249.106) (-1248.100) (-1244.923) [-1243.637] * (-1262.120) (-1253.882) [-1243.320] (-1241.242) -- 0:00:56
713000 -- (-1250.582) (-1252.025) (-1248.135) [-1247.536] * (-1256.664) (-1251.754) (-1249.121) [-1242.567] -- 0:00:56
713500 -- (-1244.686) (-1254.951) [-1247.763] (-1242.961) * (-1252.908) (-1251.968) (-1243.076) [-1245.859] -- 0:00:56
714000 -- (-1246.297) (-1245.089) (-1243.913) [-1242.180] * (-1249.351) (-1248.201) (-1248.868) [-1245.256] -- 0:00:56
714500 -- (-1254.876) [-1245.030] (-1246.366) (-1250.246) * (-1251.350) [-1248.108] (-1242.934) (-1249.883) -- 0:00:55
715000 -- (-1261.090) (-1244.190) (-1250.044) [-1243.311] * (-1245.245) (-1246.227) (-1247.097) [-1245.636] -- 0:00:55
Average standard deviation of split frequencies: 0.017645
715500 -- (-1245.124) (-1247.813) (-1249.751) [-1246.349] * (-1247.111) [-1249.341] (-1247.773) (-1255.590) -- 0:00:55
716000 -- (-1246.941) [-1244.206] (-1246.014) (-1249.961) * (-1246.506) (-1251.757) [-1242.725] (-1253.384) -- 0:00:55
716500 -- [-1246.272] (-1246.905) (-1242.411) (-1246.443) * [-1248.256] (-1250.883) (-1243.180) (-1258.824) -- 0:00:55
717000 -- (-1250.101) (-1251.419) [-1248.531] (-1253.694) * (-1249.850) (-1244.409) [-1247.034] (-1255.233) -- 0:00:55
717500 -- (-1251.680) (-1247.792) (-1247.134) [-1248.693] * [-1247.508] (-1244.538) (-1246.630) (-1249.108) -- 0:00:55
718000 -- (-1251.669) (-1252.859) (-1242.445) [-1245.211] * (-1245.264) [-1247.673] (-1254.685) (-1253.386) -- 0:00:55
718500 -- [-1250.918] (-1245.004) (-1250.647) (-1245.697) * (-1245.071) (-1244.976) (-1254.572) [-1249.480] -- 0:00:55
719000 -- [-1252.381] (-1250.541) (-1250.339) (-1243.930) * (-1252.691) (-1246.321) (-1258.255) [-1244.206] -- 0:00:55
719500 -- (-1259.877) (-1250.069) (-1246.664) [-1242.250] * [-1249.394] (-1252.396) (-1252.282) (-1250.841) -- 0:00:54
720000 -- (-1245.908) [-1250.128] (-1248.158) (-1250.536) * (-1249.807) (-1246.233) [-1245.800] (-1250.265) -- 0:00:54
Average standard deviation of split frequencies: 0.018446
720500 -- (-1246.312) [-1242.913] (-1254.660) (-1247.191) * (-1250.827) [-1248.639] (-1247.472) (-1249.018) -- 0:00:54
721000 -- (-1249.851) (-1244.825) [-1246.887] (-1248.527) * (-1248.500) [-1255.597] (-1248.869) (-1248.688) -- 0:00:54
721500 -- (-1247.506) [-1245.784] (-1254.154) (-1245.518) * (-1250.523) (-1248.793) (-1249.047) [-1248.681] -- 0:00:54
722000 -- (-1250.339) (-1248.991) [-1247.696] (-1244.358) * (-1256.810) (-1244.095) (-1250.233) [-1255.789] -- 0:00:54
722500 -- [-1240.974] (-1245.678) (-1246.954) (-1242.538) * (-1245.370) [-1249.335] (-1254.111) (-1251.126) -- 0:00:54
723000 -- (-1253.859) (-1262.125) (-1246.480) [-1240.881] * (-1251.441) (-1251.596) [-1251.891] (-1248.198) -- 0:00:54
723500 -- [-1255.313] (-1250.972) (-1248.090) (-1246.599) * (-1243.631) (-1260.567) (-1246.066) [-1253.644] -- 0:00:54
724000 -- (-1252.118) (-1244.180) [-1247.799] (-1250.952) * (-1248.667) (-1252.012) (-1250.704) [-1246.235] -- 0:00:54
724500 -- [-1243.819] (-1263.994) (-1251.864) (-1255.808) * (-1245.324) (-1247.221) [-1245.620] (-1252.380) -- 0:00:53
725000 -- (-1249.616) (-1247.235) (-1253.512) [-1252.325] * (-1244.111) (-1251.382) [-1247.391] (-1248.522) -- 0:00:53
Average standard deviation of split frequencies: 0.018960
725500 -- [-1246.410] (-1251.983) (-1257.485) (-1246.335) * [-1245.481] (-1246.417) (-1245.361) (-1243.803) -- 0:00:53
726000 -- (-1243.687) (-1252.074) [-1245.850] (-1247.563) * (-1245.521) (-1250.562) (-1243.832) [-1243.530] -- 0:00:53
726500 -- (-1244.926) [-1248.709] (-1246.805) (-1252.528) * (-1249.182) [-1246.813] (-1254.326) (-1247.765) -- 0:00:53
727000 -- (-1246.746) [-1247.476] (-1244.860) (-1249.633) * (-1249.967) (-1243.484) [-1248.131] (-1247.598) -- 0:00:53
727500 -- (-1244.602) (-1257.623) (-1245.821) [-1246.077] * [-1245.828] (-1244.393) (-1250.694) (-1252.013) -- 0:00:53
728000 -- (-1243.760) (-1246.789) (-1252.279) [-1248.100] * [-1251.009] (-1245.000) (-1251.987) (-1245.618) -- 0:00:53
728500 -- (-1249.795) (-1243.090) (-1255.604) [-1250.519] * (-1245.379) (-1251.320) (-1248.336) [-1243.180] -- 0:00:53
729000 -- (-1251.472) [-1248.991] (-1250.471) (-1253.350) * [-1244.585] (-1247.465) (-1255.164) (-1246.904) -- 0:00:53
729500 -- [-1245.313] (-1250.357) (-1254.378) (-1246.737) * (-1242.058) (-1248.302) [-1249.480] (-1259.610) -- 0:00:53
730000 -- [-1242.598] (-1246.710) (-1254.463) (-1247.482) * (-1249.265) (-1249.094) (-1264.180) [-1247.823] -- 0:00:52
Average standard deviation of split frequencies: 0.019355
730500 -- (-1246.965) (-1249.494) [-1249.281] (-1248.804) * (-1252.473) (-1251.108) (-1251.923) [-1244.740] -- 0:00:52
731000 -- [-1252.010] (-1255.757) (-1244.221) (-1246.849) * (-1251.235) (-1245.190) (-1252.839) [-1248.587] -- 0:00:52
731500 -- [-1241.299] (-1243.347) (-1248.663) (-1246.609) * (-1251.198) [-1249.384] (-1249.671) (-1243.579) -- 0:00:52
732000 -- (-1244.447) (-1248.048) [-1245.587] (-1248.810) * (-1250.275) (-1249.386) (-1250.469) [-1243.210] -- 0:00:52
732500 -- (-1246.498) (-1249.775) [-1245.162] (-1258.444) * [-1245.342] (-1249.194) (-1252.773) (-1247.968) -- 0:00:52
733000 -- (-1250.476) (-1239.654) (-1247.532) [-1250.419] * (-1249.663) (-1248.422) [-1247.583] (-1251.888) -- 0:00:52
733500 -- (-1252.515) [-1247.762] (-1245.991) (-1245.778) * (-1247.937) (-1246.313) (-1245.426) [-1258.688] -- 0:00:52
734000 -- (-1243.822) (-1256.397) [-1246.712] (-1250.497) * (-1251.845) [-1252.860] (-1250.670) (-1246.269) -- 0:00:52
734500 -- (-1247.064) (-1246.693) (-1252.311) [-1245.344] * (-1251.870) (-1250.355) [-1255.550] (-1251.134) -- 0:00:52
735000 -- [-1248.684] (-1248.043) (-1248.718) (-1251.295) * (-1250.925) (-1248.306) (-1250.881) [-1247.898] -- 0:00:51
Average standard deviation of split frequencies: 0.019599
735500 -- (-1244.778) (-1248.222) [-1245.692] (-1246.961) * (-1252.360) (-1248.351) [-1244.768] (-1248.534) -- 0:00:51
736000 -- (-1252.267) [-1245.458] (-1241.581) (-1258.537) * (-1254.642) (-1244.294) [-1247.361] (-1244.582) -- 0:00:51
736500 -- (-1254.012) (-1250.446) [-1251.111] (-1246.219) * (-1254.154) (-1251.010) [-1243.778] (-1246.907) -- 0:00:51
737000 -- (-1250.416) [-1245.481] (-1251.231) (-1246.656) * (-1248.088) (-1245.358) [-1244.126] (-1249.472) -- 0:00:51
737500 -- (-1253.222) (-1247.186) [-1247.247] (-1246.891) * (-1244.779) [-1244.879] (-1252.153) (-1247.063) -- 0:00:51
738000 -- (-1249.364) (-1253.951) [-1247.517] (-1246.163) * (-1244.618) (-1242.791) [-1241.502] (-1246.653) -- 0:00:51
738500 -- [-1251.162] (-1252.392) (-1247.433) (-1254.120) * (-1243.490) (-1250.519) [-1249.580] (-1242.675) -- 0:00:51
739000 -- (-1253.174) (-1254.075) [-1245.444] (-1253.860) * (-1244.499) (-1244.420) [-1250.214] (-1253.207) -- 0:00:51
739500 -- (-1254.316) (-1254.771) (-1250.830) [-1245.292] * (-1243.648) (-1245.066) (-1243.860) [-1243.995] -- 0:00:51
740000 -- (-1257.338) (-1254.897) (-1245.272) [-1245.298] * (-1245.945) [-1245.928] (-1246.703) (-1253.297) -- 0:00:50
Average standard deviation of split frequencies: 0.019730
740500 -- (-1248.922) [-1247.087] (-1245.543) (-1245.388) * [-1245.920] (-1248.866) (-1251.846) (-1259.370) -- 0:00:50
741000 -- (-1254.421) (-1247.903) (-1247.433) [-1246.297] * (-1254.669) [-1248.771] (-1246.461) (-1254.542) -- 0:00:50
741500 -- (-1246.935) (-1250.413) [-1242.582] (-1253.633) * [-1242.396] (-1248.173) (-1248.822) (-1258.035) -- 0:00:50
742000 -- (-1254.451) (-1254.787) [-1258.124] (-1247.472) * (-1249.559) (-1251.575) (-1257.981) [-1250.807] -- 0:00:50
742500 -- (-1251.242) (-1252.386) (-1250.183) [-1248.189] * (-1244.774) [-1245.878] (-1244.094) (-1247.065) -- 0:00:50
743000 -- (-1256.473) (-1253.256) (-1246.957) [-1243.811] * (-1250.161) (-1253.444) (-1245.501) [-1245.899] -- 0:00:50
743500 -- (-1248.709) (-1246.037) (-1244.365) [-1245.200] * [-1245.644] (-1246.398) (-1248.390) (-1249.277) -- 0:00:50
744000 -- (-1247.914) (-1255.724) (-1246.505) [-1253.863] * [-1246.294] (-1241.596) (-1253.681) (-1254.916) -- 0:00:50
744500 -- (-1251.910) [-1246.518] (-1249.588) (-1259.723) * (-1250.914) (-1248.928) [-1248.580] (-1253.258) -- 0:00:50
745000 -- (-1247.505) (-1244.902) (-1254.489) [-1243.516] * (-1246.365) (-1244.112) (-1250.125) [-1247.134] -- 0:00:49
Average standard deviation of split frequencies: 0.017820
745500 -- (-1251.591) [-1243.433] (-1249.897) (-1249.036) * (-1248.489) (-1245.664) (-1247.538) [-1250.764] -- 0:00:49
746000 -- (-1250.183) (-1249.519) (-1246.911) [-1244.876] * (-1249.288) [-1243.216] (-1249.069) (-1244.312) -- 0:00:49
746500 -- (-1257.249) (-1252.664) (-1249.034) [-1244.391] * (-1249.832) [-1256.078] (-1247.548) (-1247.273) -- 0:00:49
747000 -- (-1250.478) [-1249.716] (-1247.859) (-1249.611) * (-1248.976) (-1247.481) (-1260.692) [-1247.839] -- 0:00:49
747500 -- (-1247.981) (-1253.403) [-1246.009] (-1252.043) * [-1248.624] (-1249.731) (-1257.328) (-1243.886) -- 0:00:49
748000 -- [-1251.188] (-1255.717) (-1248.786) (-1247.682) * (-1247.201) (-1248.534) (-1253.974) [-1251.989] -- 0:00:49
748500 -- [-1246.139] (-1253.013) (-1253.542) (-1252.243) * (-1240.199) (-1253.521) [-1243.873] (-1242.348) -- 0:00:49
749000 -- [-1241.637] (-1252.158) (-1251.142) (-1251.230) * (-1242.456) (-1244.007) [-1249.579] (-1241.931) -- 0:00:49
749500 -- (-1241.569) (-1243.549) (-1250.521) [-1242.052] * [-1245.440] (-1244.578) (-1245.335) (-1245.957) -- 0:00:49
750000 -- (-1250.347) [-1248.259] (-1246.668) (-1254.045) * [-1252.106] (-1250.265) (-1250.943) (-1243.544) -- 0:00:49
Average standard deviation of split frequencies: 0.017207
750500 -- [-1247.960] (-1242.208) (-1247.080) (-1251.806) * (-1251.793) [-1244.470] (-1246.981) (-1252.123) -- 0:00:48
751000 -- (-1247.477) [-1250.051] (-1244.990) (-1247.195) * [-1250.515] (-1251.149) (-1247.701) (-1245.896) -- 0:00:48
751500 -- (-1243.348) (-1242.356) [-1253.960] (-1250.920) * (-1249.460) [-1249.712] (-1246.867) (-1245.349) -- 0:00:48
752000 -- (-1250.324) (-1243.263) (-1249.921) [-1242.620] * (-1243.217) (-1244.540) [-1244.554] (-1249.217) -- 0:00:48
752500 -- (-1242.525) (-1245.084) [-1247.251] (-1244.302) * [-1257.308] (-1248.354) (-1247.241) (-1257.032) -- 0:00:48
753000 -- [-1241.579] (-1253.512) (-1251.133) (-1244.494) * (-1246.558) [-1245.368] (-1249.302) (-1258.240) -- 0:00:48
753500 -- (-1248.881) (-1252.735) (-1253.964) [-1244.754] * (-1243.729) (-1246.218) [-1246.508] (-1246.855) -- 0:00:48
754000 -- (-1250.659) (-1247.410) [-1252.568] (-1250.746) * (-1244.614) (-1253.985) (-1248.772) [-1251.839] -- 0:00:48
754500 -- [-1246.115] (-1245.098) (-1247.396) (-1250.459) * (-1253.519) (-1247.672) [-1247.150] (-1251.923) -- 0:00:48
755000 -- [-1241.656] (-1246.007) (-1250.867) (-1249.803) * (-1253.350) (-1245.413) [-1251.631] (-1255.457) -- 0:00:48
Average standard deviation of split frequencies: 0.016836
755500 -- (-1242.545) (-1248.542) [-1243.678] (-1252.922) * [-1248.620] (-1252.113) (-1250.208) (-1247.406) -- 0:00:47
756000 -- [-1250.950] (-1249.346) (-1244.023) (-1248.312) * (-1257.249) (-1246.654) [-1247.646] (-1247.999) -- 0:00:47
756500 -- (-1249.569) [-1250.545] (-1257.337) (-1249.993) * (-1256.952) [-1247.830] (-1245.521) (-1247.221) -- 0:00:47
757000 -- (-1254.976) [-1246.402] (-1252.293) (-1256.425) * (-1257.354) (-1246.906) (-1250.349) [-1242.739] -- 0:00:47
757500 -- (-1246.442) [-1245.234] (-1253.642) (-1252.001) * (-1251.536) (-1248.732) (-1251.852) [-1245.713] -- 0:00:47
758000 -- [-1248.694] (-1249.350) (-1249.890) (-1257.562) * (-1248.792) [-1245.976] (-1248.921) (-1244.866) -- 0:00:47
758500 -- (-1245.103) (-1247.537) [-1247.949] (-1254.720) * (-1251.240) (-1250.294) (-1254.057) [-1245.426] -- 0:00:47
759000 -- [-1241.246] (-1242.106) (-1245.826) (-1254.071) * [-1244.555] (-1255.898) (-1250.463) (-1252.105) -- 0:00:47
759500 -- (-1250.307) (-1260.343) (-1254.453) [-1253.243] * (-1253.604) (-1251.432) [-1246.039] (-1248.680) -- 0:00:47
760000 -- [-1244.560] (-1249.605) (-1247.924) (-1249.070) * [-1246.485] (-1261.879) (-1246.926) (-1250.923) -- 0:00:47
Average standard deviation of split frequencies: 0.015617
760500 -- (-1244.196) (-1251.801) [-1248.419] (-1247.089) * (-1245.807) (-1260.150) [-1247.724] (-1257.319) -- 0:00:46
761000 -- (-1251.972) [-1244.662] (-1248.584) (-1254.201) * (-1254.742) (-1256.450) (-1251.740) [-1249.920] -- 0:00:46
761500 -- (-1246.760) (-1251.470) [-1246.758] (-1253.535) * (-1251.478) (-1249.651) [-1245.671] (-1252.973) -- 0:00:46
762000 -- (-1251.044) (-1244.328) (-1248.824) [-1251.389] * (-1248.785) (-1246.201) (-1247.482) [-1248.049] -- 0:00:46
762500 -- (-1247.919) [-1251.481] (-1243.114) (-1248.136) * (-1255.157) (-1250.028) (-1252.670) [-1249.641] -- 0:00:46
763000 -- [-1246.864] (-1249.309) (-1246.609) (-1246.996) * (-1241.980) (-1252.511) [-1250.336] (-1251.985) -- 0:00:46
763500 -- (-1252.483) [-1247.193] (-1246.141) (-1254.587) * (-1247.391) (-1247.906) [-1245.670] (-1249.675) -- 0:00:46
764000 -- (-1249.595) (-1249.034) (-1260.557) [-1248.513] * (-1244.243) (-1243.986) [-1250.779] (-1254.485) -- 0:00:46
764500 -- (-1244.827) [-1249.870] (-1256.871) (-1247.081) * [-1247.899] (-1248.613) (-1245.062) (-1251.999) -- 0:00:46
765000 -- (-1244.460) (-1247.398) [-1244.042] (-1247.527) * (-1251.640) [-1246.984] (-1254.272) (-1245.480) -- 0:00:46
Average standard deviation of split frequencies: 0.016124
765500 -- (-1243.904) [-1247.214] (-1251.405) (-1245.121) * (-1243.054) (-1248.788) (-1254.852) [-1249.072] -- 0:00:45
766000 -- (-1255.847) [-1248.238] (-1256.245) (-1244.580) * [-1246.912] (-1249.118) (-1241.958) (-1249.655) -- 0:00:45
766500 -- (-1254.271) (-1249.687) (-1245.346) [-1251.806] * (-1248.738) [-1242.388] (-1246.392) (-1248.339) -- 0:00:45
767000 -- [-1255.315] (-1245.552) (-1252.454) (-1250.659) * (-1246.540) [-1242.197] (-1244.782) (-1246.609) -- 0:00:45
767500 -- (-1251.449) (-1250.255) [-1249.091] (-1253.054) * (-1251.257) (-1247.238) (-1245.234) [-1240.722] -- 0:00:45
768000 -- (-1246.621) (-1243.234) [-1245.157] (-1250.071) * (-1243.950) [-1243.986] (-1246.055) (-1252.304) -- 0:00:45
768500 -- [-1245.906] (-1245.573) (-1248.120) (-1249.715) * (-1243.207) (-1244.961) (-1259.566) [-1248.934] -- 0:00:45
769000 -- (-1249.407) (-1244.389) (-1246.299) [-1248.872] * (-1243.940) (-1245.957) [-1249.257] (-1250.026) -- 0:00:45
769500 -- (-1254.143) [-1246.309] (-1255.320) (-1244.311) * (-1244.744) (-1248.702) [-1248.967] (-1248.478) -- 0:00:45
770000 -- (-1251.055) (-1243.745) [-1249.382] (-1251.454) * (-1252.711) (-1251.606) (-1246.205) [-1246.304] -- 0:00:45
Average standard deviation of split frequencies: 0.017005
770500 -- (-1247.910) [-1248.203] (-1242.247) (-1251.996) * (-1243.127) (-1255.859) [-1246.179] (-1247.268) -- 0:00:44
771000 -- (-1241.823) (-1246.009) [-1244.630] (-1251.174) * (-1250.588) (-1263.227) (-1244.747) [-1249.204] -- 0:00:44
771500 -- (-1245.686) (-1253.705) [-1247.628] (-1251.788) * (-1249.305) (-1255.423) (-1249.603) [-1249.572] -- 0:00:44
772000 -- [-1241.494] (-1244.502) (-1249.782) (-1243.288) * (-1252.228) (-1240.439) [-1249.946] (-1251.490) -- 0:00:44
772500 -- (-1249.231) [-1245.264] (-1251.707) (-1251.451) * (-1249.136) [-1244.233] (-1240.540) (-1247.052) -- 0:00:44
773000 -- (-1248.193) (-1248.362) [-1251.330] (-1249.163) * (-1246.646) [-1249.622] (-1250.662) (-1247.041) -- 0:00:44
773500 -- (-1249.979) [-1247.967] (-1249.702) (-1246.711) * [-1247.254] (-1251.239) (-1248.237) (-1251.200) -- 0:00:44
774000 -- [-1245.913] (-1248.090) (-1248.993) (-1252.366) * (-1252.532) [-1250.201] (-1249.706) (-1252.765) -- 0:00:44
774500 -- [-1250.203] (-1259.078) (-1246.338) (-1248.249) * (-1254.005) [-1247.967] (-1245.410) (-1246.374) -- 0:00:44
775000 -- (-1245.118) (-1257.077) (-1248.915) [-1242.959] * (-1248.715) (-1249.208) [-1244.707] (-1250.283) -- 0:00:44
Average standard deviation of split frequencies: 0.017374
775500 -- (-1246.776) (-1248.783) (-1246.417) [-1245.460] * (-1263.747) [-1245.979] (-1245.684) (-1257.081) -- 0:00:44
776000 -- [-1240.539] (-1254.302) (-1246.072) (-1241.696) * (-1253.313) [-1248.186] (-1247.299) (-1254.891) -- 0:00:43
776500 -- (-1250.197) [-1248.150] (-1246.989) (-1257.566) * (-1251.076) (-1247.952) (-1248.527) [-1244.009] -- 0:00:43
777000 -- (-1250.685) (-1250.346) [-1247.733] (-1249.526) * (-1252.488) (-1247.477) (-1247.099) [-1243.018] -- 0:00:43
777500 -- (-1246.127) [-1243.232] (-1253.622) (-1250.541) * (-1247.716) (-1255.206) (-1252.579) [-1246.993] -- 0:00:43
778000 -- (-1242.608) (-1249.003) (-1248.210) [-1244.629] * (-1249.089) [-1248.052] (-1244.615) (-1246.238) -- 0:00:43
778500 -- (-1247.654) [-1243.449] (-1255.541) (-1251.887) * (-1245.209) (-1244.177) (-1247.459) [-1249.808] -- 0:00:43
779000 -- [-1248.081] (-1249.187) (-1253.150) (-1241.020) * [-1247.885] (-1246.700) (-1251.443) (-1248.218) -- 0:00:43
779500 -- (-1246.445) (-1252.168) (-1249.661) [-1245.909] * (-1247.231) (-1251.324) [-1249.107] (-1248.747) -- 0:00:43
780000 -- (-1246.213) (-1248.465) (-1253.543) [-1248.324] * (-1252.746) (-1247.794) [-1244.639] (-1251.190) -- 0:00:43
Average standard deviation of split frequencies: 0.017149
780500 -- (-1241.610) [-1240.833] (-1253.690) (-1249.787) * (-1250.132) [-1248.684] (-1257.506) (-1253.729) -- 0:00:43
781000 -- (-1240.618) (-1240.769) (-1248.659) [-1246.125] * (-1251.368) (-1249.962) (-1252.805) [-1247.277] -- 0:00:42
781500 -- (-1245.362) (-1250.112) (-1251.525) [-1252.670] * [-1245.762] (-1251.143) (-1245.924) (-1247.225) -- 0:00:42
782000 -- [-1241.463] (-1247.679) (-1247.274) (-1246.533) * (-1252.676) (-1251.811) [-1252.260] (-1250.909) -- 0:00:42
782500 -- (-1243.911) (-1251.336) (-1244.095) [-1243.432] * (-1251.473) (-1250.294) [-1251.744] (-1247.734) -- 0:00:42
783000 -- (-1252.009) (-1244.875) [-1244.666] (-1243.642) * (-1249.979) (-1250.385) (-1254.158) [-1244.354] -- 0:00:42
783500 -- (-1243.758) [-1245.426] (-1247.038) (-1253.150) * (-1248.463) (-1246.569) (-1254.107) [-1246.866] -- 0:00:42
784000 -- [-1241.319] (-1252.920) (-1250.496) (-1244.507) * [-1244.368] (-1248.001) (-1245.125) (-1249.907) -- 0:00:42
784500 -- (-1248.662) [-1246.752] (-1250.343) (-1247.232) * (-1255.026) (-1248.189) [-1246.088] (-1248.373) -- 0:00:42
785000 -- (-1254.745) (-1253.377) [-1246.032] (-1247.689) * [-1248.677] (-1244.449) (-1249.569) (-1244.237) -- 0:00:42
Average standard deviation of split frequencies: 0.016313
785500 -- [-1241.587] (-1252.769) (-1249.856) (-1252.629) * (-1249.211) [-1248.576] (-1251.306) (-1247.387) -- 0:00:42
786000 -- (-1243.888) (-1245.302) (-1259.139) [-1249.530] * [-1244.291] (-1247.075) (-1245.248) (-1249.640) -- 0:00:41
786500 -- (-1248.630) (-1254.019) (-1251.908) [-1248.119] * (-1242.330) [-1249.804] (-1246.900) (-1257.426) -- 0:00:41
787000 -- [-1251.254] (-1251.237) (-1244.022) (-1244.264) * (-1255.152) (-1248.319) (-1253.142) [-1244.840] -- 0:00:41
787500 -- (-1248.851) [-1247.785] (-1244.095) (-1250.988) * (-1247.271) [-1244.549] (-1245.104) (-1244.936) -- 0:00:41
788000 -- [-1248.556] (-1248.119) (-1252.205) (-1249.586) * (-1249.326) (-1245.749) [-1246.431] (-1247.766) -- 0:00:41
788500 -- (-1246.412) (-1247.018) (-1256.010) [-1245.806] * (-1253.948) (-1245.951) (-1242.799) [-1245.947] -- 0:00:41
789000 -- (-1248.724) (-1248.371) [-1249.383] (-1250.622) * (-1253.429) (-1246.278) [-1248.098] (-1250.980) -- 0:00:41
789500 -- [-1243.615] (-1252.681) (-1249.102) (-1248.863) * (-1248.394) [-1247.085] (-1243.499) (-1247.259) -- 0:00:41
790000 -- [-1248.389] (-1257.615) (-1251.954) (-1244.113) * (-1243.250) [-1245.755] (-1249.608) (-1246.967) -- 0:00:41
Average standard deviation of split frequencies: 0.015621
790500 -- [-1249.608] (-1247.237) (-1254.031) (-1251.223) * [-1253.597] (-1245.368) (-1243.345) (-1244.741) -- 0:00:41
791000 -- (-1250.717) (-1248.410) (-1250.395) [-1246.611] * (-1252.800) (-1246.026) (-1251.125) [-1246.569] -- 0:00:40
791500 -- (-1247.639) (-1252.384) (-1245.217) [-1239.623] * (-1254.163) (-1245.638) [-1249.415] (-1244.117) -- 0:00:40
792000 -- [-1251.615] (-1242.596) (-1247.975) (-1250.242) * (-1250.880) [-1243.468] (-1243.948) (-1261.998) -- 0:00:40
792500 -- (-1246.248) [-1250.279] (-1251.233) (-1251.337) * (-1249.285) (-1249.480) [-1247.404] (-1262.300) -- 0:00:40
793000 -- (-1245.884) [-1253.244] (-1243.643) (-1249.900) * [-1242.075] (-1241.291) (-1254.046) (-1256.860) -- 0:00:40
793500 -- (-1246.496) (-1247.842) [-1239.920] (-1246.870) * [-1240.352] (-1243.505) (-1251.946) (-1247.002) -- 0:00:40
794000 -- (-1243.455) (-1255.839) [-1243.510] (-1246.910) * [-1248.812] (-1252.173) (-1261.136) (-1250.083) -- 0:00:40
794500 -- (-1251.426) [-1250.454] (-1244.342) (-1254.662) * (-1246.811) (-1256.985) (-1253.387) [-1248.907] -- 0:00:40
795000 -- [-1245.533] (-1255.281) (-1245.068) (-1249.442) * (-1248.070) [-1245.703] (-1254.350) (-1246.813) -- 0:00:40
Average standard deviation of split frequencies: 0.014687
795500 -- (-1245.856) (-1251.561) (-1248.600) [-1243.466] * (-1245.651) (-1242.480) (-1243.852) [-1251.047] -- 0:00:40
796000 -- (-1256.366) (-1247.550) [-1248.641] (-1245.409) * [-1249.974] (-1247.660) (-1246.505) (-1257.712) -- 0:00:39
796500 -- [-1248.041] (-1250.808) (-1249.516) (-1257.084) * (-1250.704) (-1244.716) (-1252.216) [-1244.746] -- 0:00:39
797000 -- (-1246.698) [-1246.541] (-1253.318) (-1253.157) * (-1251.612) (-1244.519) (-1249.572) [-1245.749] -- 0:00:39
797500 -- (-1242.840) (-1246.728) [-1245.843] (-1257.337) * [-1247.208] (-1250.047) (-1244.840) (-1249.632) -- 0:00:39
798000 -- (-1243.876) [-1249.225] (-1251.413) (-1246.051) * (-1247.603) (-1249.965) (-1246.750) [-1245.984] -- 0:00:39
798500 -- (-1252.113) [-1246.702] (-1247.010) (-1248.015) * (-1249.788) (-1252.598) [-1248.553] (-1249.369) -- 0:00:39
799000 -- (-1249.765) [-1241.330] (-1243.006) (-1250.416) * (-1250.245) [-1240.924] (-1257.099) (-1250.569) -- 0:00:39
799500 -- (-1253.224) (-1246.295) [-1242.348] (-1249.220) * [-1251.784] (-1248.860) (-1257.737) (-1244.452) -- 0:00:39
800000 -- (-1249.125) (-1250.780) [-1247.408] (-1250.502) * (-1254.514) (-1249.906) (-1250.583) [-1242.278] -- 0:00:39
Average standard deviation of split frequencies: 0.013542
800500 -- (-1247.841) [-1247.070] (-1243.508) (-1243.773) * (-1243.628) (-1250.241) [-1250.939] (-1251.589) -- 0:00:39
801000 -- (-1249.512) [-1247.520] (-1244.423) (-1251.435) * [-1245.814] (-1252.789) (-1248.677) (-1251.169) -- 0:00:39
801500 -- [-1244.998] (-1243.485) (-1247.258) (-1248.571) * [-1241.081] (-1249.617) (-1263.099) (-1239.978) -- 0:00:38
802000 -- (-1247.293) (-1252.616) (-1249.943) [-1255.170] * (-1243.329) (-1249.841) (-1253.441) [-1249.950] -- 0:00:38
802500 -- (-1246.922) [-1242.434] (-1251.005) (-1260.300) * (-1249.069) (-1248.373) [-1250.032] (-1244.297) -- 0:00:38
803000 -- (-1245.043) [-1244.856] (-1260.085) (-1250.011) * [-1246.744] (-1250.707) (-1247.717) (-1246.254) -- 0:00:38
803500 -- [-1243.187] (-1252.223) (-1250.905) (-1253.965) * (-1245.956) (-1249.131) [-1248.176] (-1245.688) -- 0:00:38
804000 -- (-1252.115) (-1250.105) (-1254.492) [-1247.030] * (-1244.701) (-1248.364) [-1244.786] (-1243.059) -- 0:00:38
804500 -- (-1245.985) [-1244.920] (-1252.072) (-1246.765) * (-1252.597) (-1247.999) (-1246.864) [-1250.959] -- 0:00:38
805000 -- (-1249.062) [-1247.681] (-1252.711) (-1247.523) * (-1246.646) (-1250.416) (-1245.150) [-1249.270] -- 0:00:38
Average standard deviation of split frequencies: 0.012516
805500 -- (-1245.105) (-1245.436) [-1242.722] (-1245.221) * [-1249.497] (-1249.118) (-1246.977) (-1249.492) -- 0:00:38
806000 -- (-1251.879) (-1249.596) [-1246.247] (-1256.828) * (-1252.094) (-1246.672) [-1241.203] (-1249.267) -- 0:00:38
806500 -- (-1256.849) (-1249.820) [-1242.943] (-1248.930) * (-1245.708) (-1244.585) (-1251.515) [-1248.661] -- 0:00:37
807000 -- (-1242.415) [-1257.145] (-1244.637) (-1241.790) * (-1246.194) (-1243.534) [-1254.313] (-1250.860) -- 0:00:37
807500 -- (-1246.756) (-1246.659) (-1243.842) [-1248.501] * (-1252.580) (-1244.763) (-1257.346) [-1251.510] -- 0:00:37
808000 -- [-1249.311] (-1248.032) (-1249.328) (-1241.237) * (-1249.274) [-1248.617] (-1250.014) (-1249.217) -- 0:00:37
808500 -- (-1250.272) (-1257.845) (-1242.347) [-1244.798] * (-1246.037) (-1257.219) [-1249.072] (-1247.189) -- 0:00:37
809000 -- [-1243.446] (-1256.989) (-1248.970) (-1247.854) * [-1242.243] (-1255.145) (-1251.861) (-1258.202) -- 0:00:37
809500 -- (-1245.252) (-1258.641) [-1253.895] (-1251.409) * (-1251.871) (-1250.698) [-1247.025] (-1244.012) -- 0:00:37
810000 -- (-1251.448) [-1252.331] (-1252.775) (-1264.137) * (-1259.668) (-1244.780) (-1249.953) [-1248.655] -- 0:00:37
Average standard deviation of split frequencies: 0.012328
810500 -- (-1246.928) (-1254.620) [-1244.345] (-1252.247) * (-1257.142) (-1245.806) (-1250.982) [-1254.642] -- 0:00:37
811000 -- [-1246.135] (-1252.226) (-1265.855) (-1252.460) * (-1257.142) (-1260.061) [-1254.560] (-1247.500) -- 0:00:37
811500 -- (-1242.655) (-1258.347) (-1249.640) [-1250.842] * [-1250.010] (-1250.059) (-1246.467) (-1246.526) -- 0:00:36
812000 -- (-1245.943) (-1254.863) (-1254.738) [-1246.486] * (-1250.628) [-1249.587] (-1246.411) (-1253.291) -- 0:00:36
812500 -- (-1247.703) (-1251.463) (-1251.897) [-1248.129] * (-1250.744) (-1260.857) [-1245.037] (-1251.479) -- 0:00:36
813000 -- (-1244.116) (-1253.099) (-1246.907) [-1255.401] * (-1246.957) (-1246.802) (-1243.938) [-1247.881] -- 0:00:36
813500 -- (-1246.153) [-1248.204] (-1253.070) (-1251.024) * (-1250.384) [-1249.622] (-1244.365) (-1244.278) -- 0:00:36
814000 -- (-1256.040) [-1246.248] (-1253.459) (-1244.540) * (-1245.928) [-1247.589] (-1246.519) (-1248.317) -- 0:00:36
814500 -- (-1250.613) [-1240.341] (-1259.885) (-1247.568) * [-1245.003] (-1249.669) (-1245.757) (-1248.568) -- 0:00:36
815000 -- (-1246.506) [-1243.681] (-1255.217) (-1249.153) * [-1241.443] (-1242.630) (-1246.453) (-1246.803) -- 0:00:36
Average standard deviation of split frequencies: 0.011323
815500 -- (-1246.012) (-1251.702) (-1245.149) [-1256.795] * (-1246.902) (-1257.902) (-1258.522) [-1245.305] -- 0:00:36
816000 -- (-1243.059) (-1252.255) [-1243.633] (-1249.202) * (-1247.144) [-1247.041] (-1252.143) (-1246.016) -- 0:00:36
816500 -- (-1244.709) [-1253.242] (-1253.318) (-1253.801) * (-1256.256) [-1246.574] (-1246.970) (-1246.517) -- 0:00:35
817000 -- [-1240.543] (-1253.711) (-1247.231) (-1253.376) * (-1248.678) (-1253.077) [-1242.144] (-1243.611) -- 0:00:35
817500 -- (-1248.393) (-1259.722) [-1244.640] (-1246.228) * [-1253.689] (-1245.073) (-1252.057) (-1251.748) -- 0:00:35
818000 -- [-1243.538] (-1249.081) (-1252.171) (-1251.187) * (-1249.687) (-1246.762) (-1244.162) [-1249.516] -- 0:00:35
818500 -- (-1246.728) (-1255.364) (-1246.856) [-1248.048] * (-1250.023) [-1251.640] (-1248.083) (-1244.344) -- 0:00:35
819000 -- (-1246.188) [-1248.872] (-1253.798) (-1251.383) * (-1246.639) [-1246.586] (-1248.585) (-1243.394) -- 0:00:35
819500 -- (-1248.133) (-1245.768) [-1253.425] (-1246.092) * (-1253.850) (-1255.441) [-1252.360] (-1253.139) -- 0:00:35
820000 -- (-1247.159) [-1246.426] (-1252.496) (-1248.709) * (-1254.316) [-1245.257] (-1246.526) (-1247.244) -- 0:00:35
Average standard deviation of split frequencies: 0.011373
820500 -- (-1249.512) (-1252.248) (-1249.898) [-1243.630] * (-1244.577) [-1253.935] (-1255.009) (-1246.125) -- 0:00:35
821000 -- (-1245.338) (-1254.038) [-1246.438] (-1248.175) * (-1248.038) (-1250.574) (-1246.747) [-1246.921] -- 0:00:35
821500 -- [-1244.359] (-1251.708) (-1248.478) (-1245.501) * (-1245.725) [-1245.221] (-1251.791) (-1245.639) -- 0:00:34
822000 -- (-1242.558) [-1244.458] (-1252.468) (-1252.393) * [-1248.939] (-1248.778) (-1251.372) (-1256.349) -- 0:00:34
822500 -- (-1251.286) (-1251.723) [-1247.022] (-1255.741) * (-1255.755) [-1245.764] (-1249.374) (-1247.658) -- 0:00:34
823000 -- (-1252.833) [-1245.583] (-1251.714) (-1246.903) * (-1249.355) [-1255.528] (-1246.801) (-1242.649) -- 0:00:34
823500 -- (-1255.077) [-1248.662] (-1252.299) (-1242.002) * (-1255.847) (-1247.581) [-1247.536] (-1253.109) -- 0:00:34
824000 -- [-1246.722] (-1248.396) (-1252.594) (-1245.493) * (-1245.345) (-1248.152) (-1250.189) [-1250.500] -- 0:00:34
824500 -- (-1255.684) [-1240.723] (-1249.151) (-1251.969) * (-1248.390) [-1247.421] (-1256.207) (-1248.295) -- 0:00:34
825000 -- (-1250.402) [-1248.071] (-1245.070) (-1255.964) * (-1252.936) (-1251.122) (-1248.269) [-1253.389] -- 0:00:34
Average standard deviation of split frequencies: 0.011757
825500 -- (-1246.720) [-1248.857] (-1250.510) (-1250.403) * (-1246.860) (-1246.377) [-1253.116] (-1250.186) -- 0:00:34
826000 -- (-1252.563) (-1251.893) (-1247.632) [-1246.286] * (-1257.041) [-1244.576] (-1255.326) (-1251.510) -- 0:00:34
826500 -- (-1254.831) (-1250.196) (-1250.760) [-1245.185] * [-1248.729] (-1257.768) (-1263.025) (-1245.531) -- 0:00:34
827000 -- (-1264.702) (-1254.792) [-1250.626] (-1247.523) * (-1254.929) [-1248.546] (-1248.131) (-1247.470) -- 0:00:33
827500 -- (-1260.208) (-1251.837) [-1248.734] (-1255.171) * (-1257.199) [-1253.734] (-1247.670) (-1252.771) -- 0:00:33
828000 -- [-1248.849] (-1248.298) (-1251.547) (-1247.763) * [-1253.702] (-1249.205) (-1247.738) (-1251.874) -- 0:00:33
828500 -- (-1249.916) (-1249.405) [-1249.440] (-1261.475) * (-1255.490) (-1248.379) [-1245.287] (-1248.161) -- 0:00:33
829000 -- (-1254.870) (-1249.349) (-1247.615) [-1250.958] * [-1249.210] (-1248.197) (-1251.808) (-1248.807) -- 0:00:33
829500 -- [-1250.351] (-1248.791) (-1246.604) (-1254.954) * (-1251.943) (-1252.367) [-1247.609] (-1248.912) -- 0:00:33
830000 -- (-1247.685) [-1247.604] (-1248.720) (-1253.712) * [-1249.642] (-1247.298) (-1244.653) (-1248.331) -- 0:00:33
Average standard deviation of split frequencies: 0.011918
830500 -- (-1253.980) [-1253.977] (-1255.105) (-1249.946) * (-1247.507) [-1251.160] (-1253.187) (-1245.659) -- 0:00:33
831000 -- (-1245.813) (-1242.592) [-1251.741] (-1253.924) * (-1254.325) (-1245.866) [-1250.590] (-1245.321) -- 0:00:33
831500 -- (-1250.468) (-1254.541) [-1247.501] (-1247.052) * (-1246.177) [-1243.442] (-1249.389) (-1247.500) -- 0:00:33
832000 -- (-1256.110) (-1249.635) [-1248.287] (-1248.687) * (-1252.133) [-1243.344] (-1245.872) (-1248.195) -- 0:00:32
832500 -- [-1247.040] (-1245.226) (-1250.210) (-1247.291) * (-1247.651) [-1243.214] (-1247.383) (-1247.116) -- 0:00:32
833000 -- (-1246.145) (-1254.513) (-1248.161) [-1249.320] * [-1243.930] (-1250.429) (-1243.213) (-1245.987) -- 0:00:32
833500 -- (-1241.563) (-1242.294) (-1249.458) [-1251.858] * [-1248.330] (-1249.116) (-1252.115) (-1258.688) -- 0:00:32
834000 -- (-1251.652) [-1246.718] (-1243.115) (-1252.774) * (-1249.545) [-1249.262] (-1256.273) (-1252.549) -- 0:00:32
834500 -- (-1253.136) (-1248.669) (-1246.518) [-1246.304] * [-1246.861] (-1254.582) (-1253.440) (-1248.379) -- 0:00:32
835000 -- (-1248.103) (-1255.904) [-1240.502] (-1247.226) * [-1245.490] (-1242.806) (-1253.322) (-1248.575) -- 0:00:32
Average standard deviation of split frequencies: 0.011954
835500 -- (-1246.868) (-1246.224) [-1247.589] (-1260.137) * [-1246.344] (-1247.883) (-1249.605) (-1255.670) -- 0:00:32
836000 -- (-1251.632) [-1249.833] (-1244.507) (-1255.317) * [-1247.054] (-1251.336) (-1246.260) (-1257.223) -- 0:00:32
836500 -- [-1247.239] (-1249.970) (-1250.867) (-1246.947) * [-1248.537] (-1247.543) (-1256.516) (-1261.798) -- 0:00:32
837000 -- (-1246.657) (-1252.784) [-1246.698] (-1248.294) * (-1244.705) (-1251.875) [-1251.876] (-1246.889) -- 0:00:31
837500 -- (-1246.710) (-1250.483) [-1243.362] (-1251.751) * [-1247.054] (-1249.592) (-1252.996) (-1254.464) -- 0:00:31
838000 -- (-1256.548) (-1254.181) (-1246.075) [-1247.061] * [-1247.260] (-1254.619) (-1248.861) (-1251.397) -- 0:00:31
838500 -- (-1248.682) (-1252.845) (-1256.603) [-1249.427] * (-1241.822) (-1247.957) [-1250.286] (-1252.424) -- 0:00:31
839000 -- [-1247.258] (-1254.651) (-1246.830) (-1250.812) * (-1246.351) (-1248.096) [-1244.781] (-1250.774) -- 0:00:31
839500 -- (-1245.040) (-1250.233) [-1245.902] (-1247.408) * (-1245.149) (-1250.414) (-1251.817) [-1247.496] -- 0:00:31
840000 -- (-1248.186) [-1248.381] (-1245.675) (-1252.568) * (-1251.904) (-1244.927) [-1251.494] (-1252.030) -- 0:00:31
Average standard deviation of split frequencies: 0.012224
840500 -- (-1250.859) (-1253.216) [-1246.281] (-1246.510) * (-1244.702) (-1258.738) (-1254.158) [-1251.785] -- 0:00:31
841000 -- (-1251.638) (-1252.686) (-1251.105) [-1253.261] * (-1245.148) [-1248.402] (-1248.054) (-1256.554) -- 0:00:31
841500 -- (-1251.406) (-1247.812) [-1247.036] (-1244.370) * [-1239.993] (-1248.149) (-1250.370) (-1248.606) -- 0:00:31
842000 -- (-1257.247) (-1243.098) (-1245.066) [-1249.976] * (-1252.750) [-1242.585] (-1247.626) (-1249.800) -- 0:00:30
842500 -- [-1246.297] (-1245.377) (-1243.626) (-1244.536) * [-1245.587] (-1251.667) (-1246.643) (-1249.590) -- 0:00:30
843000 -- (-1252.079) [-1248.326] (-1242.366) (-1242.965) * [-1242.951] (-1246.972) (-1260.355) (-1241.914) -- 0:00:30
843500 -- (-1256.660) [-1245.980] (-1255.525) (-1246.160) * [-1248.151] (-1250.451) (-1244.573) (-1247.446) -- 0:00:30
844000 -- (-1250.471) (-1248.843) [-1253.362] (-1259.523) * (-1248.825) (-1248.285) (-1249.155) [-1242.800] -- 0:00:30
844500 -- (-1242.659) (-1246.655) [-1242.522] (-1249.462) * (-1251.685) (-1259.713) (-1243.741) [-1244.153] -- 0:00:30
845000 -- (-1250.167) [-1254.123] (-1248.689) (-1248.958) * (-1252.329) [-1250.066] (-1253.660) (-1247.312) -- 0:00:30
Average standard deviation of split frequencies: 0.012259
845500 -- [-1243.823] (-1248.634) (-1248.979) (-1256.532) * (-1255.881) [-1250.974] (-1251.789) (-1249.712) -- 0:00:30
846000 -- (-1243.631) (-1250.575) [-1245.890] (-1246.550) * (-1247.049) (-1253.449) (-1253.036) [-1245.494] -- 0:00:30
846500 -- (-1253.436) [-1248.792] (-1252.556) (-1249.381) * [-1240.915] (-1252.150) (-1250.216) (-1254.014) -- 0:00:30
847000 -- [-1248.830] (-1246.635) (-1246.343) (-1249.100) * [-1246.993] (-1249.766) (-1246.199) (-1248.953) -- 0:00:29
847500 -- (-1245.375) [-1240.163] (-1251.424) (-1247.515) * (-1245.621) [-1245.301] (-1258.030) (-1249.672) -- 0:00:29
848000 -- (-1245.632) (-1254.560) (-1249.493) [-1242.910] * (-1254.500) [-1244.833] (-1248.025) (-1243.298) -- 0:00:29
848500 -- (-1250.335) (-1249.633) (-1248.459) [-1253.532] * (-1249.955) (-1250.311) (-1242.520) [-1244.339] -- 0:00:29
849000 -- [-1245.881] (-1255.343) (-1251.464) (-1250.769) * (-1245.854) (-1248.997) [-1241.101] (-1250.912) -- 0:00:29
849500 -- (-1250.740) [-1244.755] (-1253.601) (-1248.871) * (-1251.397) (-1241.821) (-1246.969) [-1243.222] -- 0:00:29
850000 -- (-1246.855) (-1249.871) (-1249.616) [-1249.115] * (-1253.703) [-1245.571] (-1249.922) (-1255.330) -- 0:00:29
Average standard deviation of split frequencies: 0.012746
850500 -- (-1259.245) [-1251.664] (-1249.626) (-1247.296) * (-1251.855) (-1246.145) (-1248.943) [-1248.602] -- 0:00:29
851000 -- [-1242.259] (-1258.514) (-1249.763) (-1250.477) * (-1252.013) [-1243.940] (-1247.687) (-1245.649) -- 0:00:29
851500 -- (-1248.205) (-1253.517) (-1248.648) [-1254.412] * (-1252.334) [-1245.082] (-1250.258) (-1250.097) -- 0:00:29
852000 -- (-1247.979) (-1249.793) [-1247.861] (-1240.392) * (-1250.899) (-1255.437) [-1246.637] (-1251.608) -- 0:00:29
852500 -- [-1244.557] (-1241.363) (-1247.599) (-1247.997) * (-1247.328) (-1248.464) [-1248.959] (-1247.252) -- 0:00:28
853000 -- (-1249.785) (-1244.190) [-1244.971] (-1250.746) * (-1250.095) (-1253.263) (-1248.234) [-1250.443] -- 0:00:28
853500 -- [-1249.141] (-1251.322) (-1249.706) (-1257.985) * (-1249.114) (-1246.755) (-1242.603) [-1243.771] -- 0:00:28
854000 -- (-1250.174) [-1255.235] (-1254.398) (-1254.631) * (-1247.988) [-1242.165] (-1248.368) (-1256.734) -- 0:00:28
854500 -- [-1250.673] (-1249.081) (-1240.714) (-1246.536) * [-1250.232] (-1250.829) (-1248.262) (-1250.338) -- 0:00:28
855000 -- [-1247.542] (-1254.324) (-1257.122) (-1242.689) * [-1251.806] (-1248.403) (-1253.027) (-1264.181) -- 0:00:28
Average standard deviation of split frequencies: 0.012005
855500 -- (-1250.600) (-1247.270) (-1245.647) [-1244.108] * (-1249.081) (-1246.966) (-1252.855) [-1250.016] -- 0:00:28
856000 -- (-1248.372) (-1254.609) (-1245.414) [-1243.828] * [-1258.348] (-1253.011) (-1250.012) (-1255.396) -- 0:00:28
856500 -- [-1248.349] (-1256.210) (-1247.150) (-1247.193) * [-1245.715] (-1246.362) (-1252.203) (-1250.058) -- 0:00:28
857000 -- (-1243.360) (-1257.720) [-1239.184] (-1246.082) * (-1251.940) [-1241.029] (-1243.470) (-1256.652) -- 0:00:28
857500 -- (-1244.792) (-1243.996) (-1250.909) [-1247.671] * (-1251.363) (-1241.905) [-1243.154] (-1252.172) -- 0:00:27
858000 -- [-1239.724] (-1255.977) (-1250.175) (-1255.806) * (-1250.582) (-1241.852) [-1246.013] (-1259.013) -- 0:00:27
858500 -- (-1251.359) (-1247.019) [-1247.406] (-1252.174) * [-1246.019] (-1245.093) (-1254.948) (-1256.945) -- 0:00:27
859000 -- (-1245.854) [-1246.256] (-1246.113) (-1253.901) * (-1255.765) [-1245.989] (-1242.264) (-1248.758) -- 0:00:27
859500 -- (-1247.325) [-1249.946] (-1259.837) (-1246.253) * (-1248.361) [-1242.007] (-1242.754) (-1249.008) -- 0:00:27
860000 -- (-1244.955) (-1247.652) (-1246.799) [-1246.596] * (-1247.680) (-1255.670) (-1248.510) [-1242.848] -- 0:00:27
Average standard deviation of split frequencies: 0.012159
860500 -- (-1250.564) (-1257.604) (-1249.213) [-1245.545] * [-1248.887] (-1250.399) (-1252.594) (-1249.313) -- 0:00:27
861000 -- (-1251.404) (-1248.797) [-1247.551] (-1242.589) * (-1256.394) (-1243.923) (-1246.900) [-1247.290] -- 0:00:27
861500 -- (-1257.264) (-1256.156) (-1251.089) [-1244.800] * (-1247.761) (-1255.515) (-1250.522) [-1252.549] -- 0:00:27
862000 -- [-1247.379] (-1255.227) (-1254.492) (-1248.656) * [-1253.440] (-1255.015) (-1248.545) (-1257.360) -- 0:00:27
862500 -- (-1246.774) (-1256.836) [-1243.679] (-1254.041) * (-1245.919) [-1251.248] (-1244.233) (-1244.513) -- 0:00:26
863000 -- (-1246.862) (-1259.834) (-1245.714) [-1252.904] * [-1246.985] (-1254.992) (-1251.298) (-1251.072) -- 0:00:26
863500 -- (-1246.968) (-1248.034) (-1255.112) [-1250.063] * [-1247.552] (-1242.989) (-1246.328) (-1258.046) -- 0:00:26
864000 -- (-1247.092) (-1252.109) (-1245.799) [-1245.021] * (-1250.281) [-1244.235] (-1247.290) (-1261.073) -- 0:00:26
864500 -- (-1249.877) (-1253.329) (-1251.523) [-1244.155] * (-1250.523) (-1255.140) (-1242.878) [-1244.356] -- 0:00:26
865000 -- [-1254.645] (-1248.779) (-1250.814) (-1257.569) * (-1253.141) (-1248.788) [-1246.228] (-1252.723) -- 0:00:26
Average standard deviation of split frequencies: 0.012302
865500 -- [-1241.803] (-1249.990) (-1254.035) (-1251.808) * (-1251.224) (-1245.135) (-1243.859) [-1244.789] -- 0:00:26
866000 -- (-1248.707) [-1245.720] (-1263.115) (-1249.090) * (-1251.632) (-1248.380) [-1246.672] (-1248.733) -- 0:00:26
866500 -- (-1248.263) (-1251.358) (-1254.057) [-1250.516] * (-1249.171) [-1249.559] (-1252.957) (-1250.872) -- 0:00:26
867000 -- (-1247.156) (-1246.375) (-1251.768) [-1244.280] * (-1250.592) [-1243.273] (-1254.980) (-1251.645) -- 0:00:26
867500 -- [-1251.102] (-1262.081) (-1247.030) (-1249.741) * (-1245.786) [-1242.824] (-1249.426) (-1248.769) -- 0:00:25
868000 -- (-1246.083) (-1249.653) [-1251.570] (-1248.076) * (-1252.261) [-1252.089] (-1246.133) (-1245.272) -- 0:00:25
868500 -- [-1245.346] (-1255.778) (-1246.225) (-1251.365) * (-1255.252) (-1247.078) (-1246.548) [-1243.061] -- 0:00:25
869000 -- (-1248.536) [-1254.019] (-1248.116) (-1242.105) * (-1258.628) (-1251.944) [-1241.994] (-1244.198) -- 0:00:25
869500 -- (-1247.702) (-1253.118) (-1247.031) [-1248.292] * (-1261.722) (-1261.047) [-1245.147] (-1243.360) -- 0:00:25
870000 -- [-1243.757] (-1247.620) (-1245.823) (-1249.201) * (-1249.669) (-1252.711) (-1246.630) [-1248.265] -- 0:00:25
Average standard deviation of split frequencies: 0.012345
870500 -- [-1248.632] (-1252.522) (-1252.186) (-1244.989) * (-1251.493) [-1249.623] (-1247.475) (-1251.104) -- 0:00:25
871000 -- [-1244.488] (-1249.505) (-1250.450) (-1249.327) * (-1245.403) [-1244.505] (-1244.857) (-1247.416) -- 0:00:25
871500 -- (-1250.375) (-1247.352) (-1249.982) [-1249.525] * (-1250.676) (-1242.268) [-1248.141] (-1255.759) -- 0:00:25
872000 -- (-1254.569) [-1242.861] (-1247.951) (-1244.651) * (-1250.044) (-1245.467) (-1245.546) [-1247.424] -- 0:00:25
872500 -- (-1247.009) (-1253.449) (-1254.508) [-1247.608] * (-1245.789) (-1247.384) [-1243.052] (-1256.671) -- 0:00:24
873000 -- (-1250.940) (-1251.140) (-1247.918) [-1245.438] * (-1256.925) (-1252.118) [-1254.800] (-1250.199) -- 0:00:24
873500 -- (-1250.169) (-1244.357) (-1247.349) [-1247.064] * (-1243.768) (-1250.117) [-1245.030] (-1251.813) -- 0:00:24
874000 -- (-1259.339) [-1251.906] (-1247.203) (-1246.497) * (-1243.737) (-1249.548) [-1242.156] (-1250.750) -- 0:00:24
874500 -- (-1254.874) (-1252.844) (-1254.954) [-1247.707] * (-1247.348) (-1253.182) (-1258.239) [-1243.399] -- 0:00:24
875000 -- [-1246.929] (-1256.074) (-1246.796) (-1246.194) * (-1246.558) (-1243.746) [-1249.121] (-1251.099) -- 0:00:24
Average standard deviation of split frequencies: 0.012377
875500 -- (-1246.497) [-1246.474] (-1248.090) (-1247.868) * (-1241.595) [-1245.804] (-1261.393) (-1243.152) -- 0:00:24
876000 -- (-1248.461) (-1252.010) (-1248.207) [-1247.457] * (-1251.352) (-1253.857) (-1246.603) [-1240.254] -- 0:00:24
876500 -- (-1242.518) (-1249.499) [-1249.115] (-1249.190) * (-1254.152) [-1254.308] (-1242.295) (-1254.758) -- 0:00:24
877000 -- (-1255.502) (-1245.521) (-1246.369) [-1250.600] * (-1251.315) (-1251.862) (-1247.285) [-1251.429] -- 0:00:24
877500 -- (-1253.058) [-1245.204] (-1243.792) (-1243.619) * (-1255.461) [-1243.369] (-1256.498) (-1252.244) -- 0:00:24
878000 -- (-1254.978) (-1249.927) (-1245.019) [-1243.741] * (-1257.247) (-1247.411) [-1244.815] (-1249.347) -- 0:00:23
878500 -- [-1250.807] (-1254.036) (-1241.541) (-1248.722) * (-1252.791) [-1244.668] (-1242.948) (-1244.296) -- 0:00:23
879000 -- (-1254.293) (-1251.111) (-1247.236) [-1247.909] * (-1248.830) (-1261.436) (-1249.380) [-1247.105] -- 0:00:23
879500 -- (-1252.401) (-1250.188) (-1249.682) [-1249.979] * (-1248.082) (-1250.228) [-1245.343] (-1242.574) -- 0:00:23
880000 -- [-1245.860] (-1264.507) (-1248.439) (-1250.854) * [-1243.984] (-1251.924) (-1248.666) (-1255.848) -- 0:00:23
Average standard deviation of split frequencies: 0.012526
880500 -- (-1246.036) [-1246.588] (-1245.550) (-1261.593) * (-1241.910) (-1249.164) (-1255.375) [-1250.683] -- 0:00:23
881000 -- (-1252.384) [-1251.129] (-1249.610) (-1249.695) * (-1244.756) (-1249.212) (-1254.181) [-1245.265] -- 0:00:23
881500 -- (-1245.248) (-1248.955) [-1242.831] (-1259.538) * [-1242.934] (-1244.498) (-1244.597) (-1245.195) -- 0:00:23
882000 -- (-1259.363) (-1252.567) [-1243.826] (-1249.770) * (-1245.521) [-1252.655] (-1249.740) (-1245.965) -- 0:00:23
882500 -- (-1253.026) [-1244.929] (-1244.654) (-1247.855) * (-1245.544) (-1250.752) (-1248.830) [-1248.407] -- 0:00:23
883000 -- (-1248.954) (-1250.043) (-1248.685) [-1250.909] * (-1247.438) (-1246.051) (-1248.254) [-1250.895] -- 0:00:22
883500 -- (-1246.778) (-1246.290) (-1249.446) [-1252.894] * (-1251.404) (-1253.733) (-1245.625) [-1245.045] -- 0:00:22
884000 -- (-1252.181) [-1243.434] (-1250.011) (-1249.083) * (-1252.181) (-1253.299) (-1251.709) [-1245.637] -- 0:00:22
884500 -- (-1261.140) (-1245.814) (-1247.756) [-1251.897] * [-1248.657] (-1252.933) (-1257.685) (-1248.576) -- 0:00:22
885000 -- (-1252.385) (-1246.568) (-1253.465) [-1247.146] * [-1242.650] (-1249.379) (-1251.291) (-1251.960) -- 0:00:22
Average standard deviation of split frequencies: 0.012663
885500 -- (-1254.811) (-1254.951) [-1249.945] (-1255.015) * [-1240.466] (-1247.701) (-1246.960) (-1242.052) -- 0:00:22
886000 -- [-1245.113] (-1253.540) (-1245.173) (-1245.092) * (-1246.698) (-1252.124) (-1251.387) [-1244.701] -- 0:00:22
886500 -- (-1245.164) (-1251.770) [-1244.997] (-1245.073) * (-1247.609) [-1253.462] (-1256.614) (-1253.643) -- 0:00:22
887000 -- (-1247.443) (-1250.888) [-1247.206] (-1242.794) * (-1250.535) (-1245.407) (-1255.550) [-1252.394] -- 0:00:22
887500 -- (-1250.685) (-1250.191) [-1248.117] (-1245.863) * (-1248.779) (-1250.622) (-1251.372) [-1249.858] -- 0:00:22
888000 -- (-1243.773) (-1250.765) (-1252.880) [-1250.494] * (-1245.008) (-1244.089) (-1249.526) [-1254.202] -- 0:00:21
888500 -- (-1255.697) [-1254.158] (-1254.713) (-1250.035) * (-1243.768) (-1247.584) [-1251.869] (-1249.360) -- 0:00:21
889000 -- (-1248.551) (-1250.526) (-1245.707) [-1245.459] * (-1247.133) [-1247.126] (-1245.204) (-1258.148) -- 0:00:21
889500 -- (-1243.782) [-1251.179] (-1246.621) (-1249.499) * (-1245.465) [-1246.800] (-1248.216) (-1253.592) -- 0:00:21
890000 -- (-1248.372) (-1252.161) [-1247.700] (-1249.496) * (-1252.639) [-1252.583] (-1246.707) (-1245.930) -- 0:00:21
Average standard deviation of split frequencies: 0.012385
890500 -- [-1252.436] (-1247.653) (-1257.240) (-1247.117) * (-1246.603) (-1253.381) [-1243.722] (-1249.870) -- 0:00:21
891000 -- (-1249.281) (-1243.098) (-1253.456) [-1244.519] * (-1246.244) (-1247.665) [-1247.444] (-1242.432) -- 0:00:21
891500 -- (-1264.007) [-1253.097] (-1241.048) (-1251.271) * (-1256.507) [-1249.301] (-1247.397) (-1246.033) -- 0:00:21
892000 -- (-1251.711) (-1245.811) (-1247.745) [-1246.485] * (-1251.984) [-1249.006] (-1246.655) (-1242.271) -- 0:00:21
892500 -- (-1246.363) (-1250.356) [-1245.851] (-1252.349) * [-1243.114] (-1247.037) (-1246.507) (-1246.496) -- 0:00:21
893000 -- (-1252.604) [-1247.956] (-1248.592) (-1250.180) * [-1247.057] (-1242.514) (-1245.733) (-1245.037) -- 0:00:20
893500 -- [-1244.746] (-1250.917) (-1249.651) (-1257.456) * [-1250.813] (-1250.696) (-1246.882) (-1248.695) -- 0:00:20
894000 -- (-1249.860) (-1243.954) (-1248.840) [-1253.489] * (-1251.318) (-1253.769) [-1242.881] (-1251.951) -- 0:00:20
894500 -- [-1244.429] (-1247.887) (-1246.783) (-1258.691) * (-1255.037) (-1254.112) (-1250.423) [-1244.565] -- 0:00:20
895000 -- (-1249.536) [-1249.146] (-1255.702) (-1254.512) * (-1249.224) [-1242.016] (-1248.765) (-1245.841) -- 0:00:20
Average standard deviation of split frequencies: 0.011469
895500 -- (-1246.452) [-1241.633] (-1256.635) (-1247.230) * [-1249.709] (-1247.523) (-1241.655) (-1244.597) -- 0:00:20
896000 -- [-1242.678] (-1243.148) (-1254.338) (-1258.265) * (-1252.295) (-1249.868) (-1245.474) [-1244.033] -- 0:00:20
896500 -- (-1245.012) (-1249.089) [-1250.720] (-1252.373) * [-1244.591] (-1246.213) (-1249.107) (-1247.395) -- 0:00:20
897000 -- (-1247.207) [-1248.748] (-1246.931) (-1247.430) * (-1246.978) (-1253.429) (-1251.024) [-1252.640] -- 0:00:20
897500 -- [-1249.083] (-1249.340) (-1249.024) (-1246.224) * (-1259.989) (-1245.487) (-1254.831) [-1247.491] -- 0:00:20
898000 -- [-1246.431] (-1248.569) (-1248.193) (-1249.269) * (-1250.718) [-1248.338] (-1244.600) (-1245.740) -- 0:00:19
898500 -- (-1248.992) [-1252.328] (-1247.253) (-1248.653) * (-1256.848) (-1249.478) (-1254.369) [-1250.601] -- 0:00:19
899000 -- [-1245.382] (-1247.222) (-1240.184) (-1246.983) * [-1251.475] (-1258.788) (-1245.974) (-1249.845) -- 0:00:19
899500 -- (-1244.282) (-1247.364) (-1242.422) [-1247.439] * (-1245.557) [-1247.681] (-1250.597) (-1248.419) -- 0:00:19
900000 -- [-1241.688] (-1243.129) (-1246.893) (-1249.981) * [-1247.927] (-1250.433) (-1245.585) (-1246.929) -- 0:00:19
Average standard deviation of split frequencies: 0.011515
900500 -- (-1247.311) [-1242.055] (-1245.075) (-1256.152) * (-1247.983) (-1250.642) [-1250.036] (-1260.058) -- 0:00:19
901000 -- (-1244.555) (-1245.354) [-1247.419] (-1257.950) * (-1248.430) (-1248.919) (-1244.258) [-1258.673] -- 0:00:19
901500 -- (-1258.665) [-1245.879] (-1254.593) (-1256.256) * (-1248.560) [-1256.536] (-1249.603) (-1251.786) -- 0:00:19
902000 -- (-1251.033) (-1256.748) [-1248.010] (-1248.696) * (-1249.218) [-1247.754] (-1249.353) (-1250.113) -- 0:00:19
902500 -- (-1254.581) [-1248.573] (-1245.855) (-1248.158) * (-1245.380) [-1247.513] (-1243.578) (-1249.711) -- 0:00:19
903000 -- (-1257.192) (-1249.024) [-1246.747] (-1249.057) * (-1250.556) [-1248.382] (-1245.321) (-1249.497) -- 0:00:19
903500 -- (-1249.950) [-1248.833] (-1249.331) (-1247.584) * (-1254.926) [-1247.903] (-1251.508) (-1245.763) -- 0:00:18
904000 -- (-1251.716) (-1244.752) [-1249.793] (-1248.083) * (-1251.979) [-1246.321] (-1248.404) (-1260.350) -- 0:00:18
904500 -- (-1247.200) (-1251.208) (-1252.122) [-1253.624] * (-1251.769) (-1245.082) (-1251.867) [-1253.808] -- 0:00:18
905000 -- (-1252.710) [-1246.940] (-1256.401) (-1248.056) * (-1265.290) (-1243.327) [-1251.684] (-1246.307) -- 0:00:18
Average standard deviation of split frequencies: 0.011031
905500 -- (-1246.230) (-1251.408) (-1254.083) [-1246.453] * (-1254.509) (-1244.270) (-1251.420) [-1250.006] -- 0:00:18
906000 -- (-1249.534) [-1247.265] (-1251.716) (-1253.444) * [-1249.456] (-1247.805) (-1247.137) (-1248.206) -- 0:00:18
906500 -- (-1257.953) [-1249.130] (-1249.369) (-1248.406) * [-1244.016] (-1246.388) (-1252.254) (-1255.491) -- 0:00:18
907000 -- (-1250.734) (-1245.207) [-1246.994] (-1246.056) * (-1244.196) (-1251.143) [-1249.273] (-1252.059) -- 0:00:18
907500 -- (-1245.763) (-1246.166) (-1252.174) [-1247.811] * [-1253.813] (-1250.033) (-1252.693) (-1247.276) -- 0:00:18
908000 -- (-1246.319) (-1251.610) (-1252.175) [-1248.001] * (-1251.775) [-1248.439] (-1256.520) (-1256.258) -- 0:00:18
908500 -- (-1247.265) (-1247.232) (-1245.423) [-1247.661] * (-1251.681) (-1250.826) (-1250.459) [-1251.260] -- 0:00:17
909000 -- (-1245.401) (-1247.469) (-1246.181) [-1241.647] * (-1247.756) (-1255.267) [-1249.004] (-1252.426) -- 0:00:17
909500 -- [-1242.926] (-1248.700) (-1250.787) (-1244.497) * [-1243.234] (-1245.089) (-1252.025) (-1254.241) -- 0:00:17
910000 -- [-1247.202] (-1254.342) (-1253.666) (-1240.949) * (-1246.526) (-1245.704) (-1249.458) [-1248.505] -- 0:00:17
Average standard deviation of split frequencies: 0.011181
910500 -- (-1247.997) (-1253.917) (-1246.611) [-1247.257] * (-1242.755) (-1245.244) [-1247.853] (-1256.628) -- 0:00:17
911000 -- (-1246.247) [-1253.954] (-1251.007) (-1247.703) * (-1243.488) (-1254.203) [-1247.163] (-1251.324) -- 0:00:17
911500 -- (-1246.622) (-1243.580) (-1245.330) [-1254.167] * (-1250.092) (-1250.120) (-1255.950) [-1249.628] -- 0:00:17
912000 -- (-1246.785) [-1245.591] (-1247.882) (-1257.287) * [-1251.792] (-1251.283) (-1247.945) (-1250.318) -- 0:00:17
912500 -- [-1247.967] (-1247.807) (-1251.971) (-1245.909) * (-1245.326) [-1242.687] (-1257.289) (-1246.188) -- 0:00:17
913000 -- (-1250.314) [-1244.456] (-1244.217) (-1254.410) * (-1241.949) (-1248.852) (-1247.494) [-1244.311] -- 0:00:17
913500 -- (-1251.852) (-1256.359) (-1250.746) [-1248.186] * (-1242.020) (-1261.845) (-1243.728) [-1247.186] -- 0:00:16
914000 -- (-1250.507) (-1247.766) (-1246.588) [-1245.271] * (-1249.995) (-1253.631) [-1245.597] (-1252.366) -- 0:00:16
914500 -- (-1246.928) [-1249.260] (-1244.197) (-1247.060) * (-1256.653) [-1248.624] (-1248.748) (-1256.333) -- 0:00:16
915000 -- (-1248.893) (-1251.008) [-1250.783] (-1258.003) * [-1253.409] (-1251.415) (-1242.703) (-1249.591) -- 0:00:16
Average standard deviation of split frequencies: 0.011940
915500 -- (-1246.054) (-1246.207) [-1243.653] (-1252.344) * (-1252.160) [-1242.916] (-1239.433) (-1253.840) -- 0:00:16
916000 -- (-1247.130) (-1243.594) [-1247.118] (-1247.487) * (-1247.830) (-1250.316) (-1245.265) [-1246.558] -- 0:00:16
916500 -- [-1247.359] (-1256.047) (-1254.026) (-1245.947) * (-1247.889) (-1255.948) [-1246.838] (-1247.908) -- 0:00:16
917000 -- (-1249.202) (-1246.653) [-1253.393] (-1244.559) * (-1247.729) (-1252.037) [-1251.710] (-1244.925) -- 0:00:16
917500 -- [-1244.001] (-1246.495) (-1252.184) (-1250.362) * (-1249.266) (-1249.807) [-1251.905] (-1257.528) -- 0:00:16
918000 -- (-1255.116) [-1253.778] (-1248.340) (-1245.179) * [-1246.143] (-1255.891) (-1247.764) (-1253.293) -- 0:00:16
918500 -- (-1244.013) (-1257.981) [-1249.784] (-1247.801) * (-1248.634) (-1244.558) (-1253.217) [-1246.736] -- 0:00:15
919000 -- (-1246.111) (-1244.388) [-1246.357] (-1251.677) * (-1249.790) (-1249.075) (-1249.367) [-1252.621] -- 0:00:15
919500 -- (-1259.344) [-1247.888] (-1245.871) (-1244.533) * (-1249.500) (-1249.800) [-1248.957] (-1247.681) -- 0:00:15
920000 -- [-1254.552] (-1249.837) (-1247.218) (-1247.262) * (-1244.750) (-1245.951) [-1248.362] (-1250.563) -- 0:00:15
Average standard deviation of split frequencies: 0.011674
920500 -- (-1254.152) [-1245.786] (-1244.946) (-1250.073) * (-1248.714) (-1253.723) (-1251.412) [-1247.207] -- 0:00:15
921000 -- (-1251.609) (-1243.954) [-1253.575] (-1249.389) * (-1245.172) [-1245.939] (-1248.639) (-1249.720) -- 0:00:15
921500 -- [-1244.764] (-1246.753) (-1244.875) (-1243.696) * (-1243.793) [-1243.455] (-1247.518) (-1251.095) -- 0:00:15
922000 -- [-1242.983] (-1248.935) (-1248.513) (-1255.402) * (-1244.436) [-1244.755] (-1247.040) (-1250.141) -- 0:00:15
922500 -- (-1249.574) (-1246.726) (-1248.388) [-1247.439] * [-1246.906] (-1253.867) (-1250.273) (-1259.717) -- 0:00:15
923000 -- (-1256.478) [-1244.155] (-1247.632) (-1260.157) * (-1249.647) [-1243.026] (-1245.450) (-1251.784) -- 0:00:15
923500 -- (-1248.135) (-1246.065) (-1241.792) [-1247.724] * [-1247.482] (-1247.990) (-1252.164) (-1248.608) -- 0:00:14
924000 -- (-1245.732) (-1245.452) [-1247.475] (-1245.867) * (-1245.052) [-1241.702] (-1243.711) (-1257.359) -- 0:00:14
924500 -- [-1246.708] (-1244.549) (-1251.439) (-1247.714) * (-1256.334) (-1248.956) (-1248.207) [-1246.682] -- 0:00:14
925000 -- [-1245.979] (-1244.254) (-1251.010) (-1251.549) * [-1254.512] (-1245.876) (-1253.257) (-1247.564) -- 0:00:14
Average standard deviation of split frequencies: 0.010996
925500 -- (-1255.967) (-1248.191) [-1247.569] (-1249.780) * (-1257.492) (-1251.474) [-1249.458] (-1245.513) -- 0:00:14
926000 -- (-1257.559) (-1253.445) [-1241.153] (-1250.820) * (-1247.850) [-1245.046] (-1244.034) (-1250.149) -- 0:00:14
926500 -- (-1253.310) (-1252.669) (-1245.465) [-1245.380] * (-1249.748) [-1245.514] (-1255.400) (-1243.678) -- 0:00:14
927000 -- [-1246.590] (-1249.922) (-1247.575) (-1247.556) * (-1251.366) (-1256.160) (-1251.770) [-1247.123] -- 0:00:14
927500 -- (-1249.991) (-1246.312) (-1245.409) [-1248.998] * (-1252.200) [-1245.265] (-1247.976) (-1244.219) -- 0:00:14
928000 -- (-1251.153) [-1247.525] (-1243.856) (-1251.509) * (-1254.836) (-1251.843) [-1248.344] (-1244.660) -- 0:00:14
928500 -- (-1244.260) (-1244.771) (-1247.739) [-1249.520] * (-1248.908) (-1252.168) (-1256.008) [-1245.232] -- 0:00:14
929000 -- (-1253.907) (-1244.455) (-1250.675) [-1246.911] * (-1243.007) (-1259.691) (-1250.670) [-1249.496] -- 0:00:13
929500 -- (-1248.467) (-1247.016) [-1245.849] (-1245.804) * (-1253.205) [-1242.561] (-1248.468) (-1251.989) -- 0:00:13
930000 -- (-1249.588) [-1253.937] (-1254.742) (-1249.520) * (-1247.738) (-1246.105) (-1258.990) [-1246.825] -- 0:00:13
Average standard deviation of split frequencies: 0.010637
930500 -- (-1256.422) [-1240.159] (-1248.320) (-1251.421) * (-1250.890) [-1248.024] (-1242.535) (-1241.497) -- 0:00:13
931000 -- (-1263.627) (-1246.583) [-1255.483] (-1254.322) * (-1244.865) (-1249.481) (-1254.105) [-1242.825] -- 0:00:13
931500 -- (-1250.582) (-1244.497) [-1248.274] (-1247.369) * [-1242.122] (-1256.434) (-1249.516) (-1246.950) -- 0:00:13
932000 -- (-1254.959) [-1248.300] (-1257.459) (-1251.812) * (-1246.098) (-1248.905) [-1252.779] (-1249.506) -- 0:00:13
932500 -- (-1255.121) [-1247.542] (-1255.823) (-1247.301) * (-1248.991) (-1246.635) [-1244.806] (-1246.480) -- 0:00:13
933000 -- [-1242.981] (-1257.095) (-1250.608) (-1248.356) * (-1249.952) (-1252.307) [-1254.813] (-1247.088) -- 0:00:13
933500 -- [-1247.213] (-1251.062) (-1245.778) (-1250.068) * (-1257.833) (-1251.038) (-1249.754) [-1248.804] -- 0:00:13
934000 -- (-1251.127) (-1246.219) [-1248.356] (-1249.214) * [-1245.981] (-1245.832) (-1250.837) (-1245.009) -- 0:00:12
934500 -- (-1254.876) (-1248.583) (-1246.737) [-1246.589] * (-1246.333) (-1244.463) (-1252.755) [-1249.616] -- 0:00:12
935000 -- (-1246.073) (-1255.813) (-1250.666) [-1249.103] * (-1244.682) (-1254.408) [-1246.506] (-1251.462) -- 0:00:12
Average standard deviation of split frequencies: 0.011281
935500 -- (-1246.096) (-1244.382) [-1250.779] (-1248.087) * [-1244.044] (-1255.833) (-1249.520) (-1247.746) -- 0:00:12
936000 -- (-1252.157) (-1249.912) (-1248.470) [-1244.800] * (-1249.481) (-1257.843) (-1242.790) [-1249.349] -- 0:00:12
936500 -- (-1258.690) (-1245.552) [-1246.916] (-1249.970) * [-1246.385] (-1254.140) (-1252.104) (-1243.856) -- 0:00:12
937000 -- (-1253.046) (-1249.785) [-1245.045] (-1243.065) * (-1249.691) (-1262.322) (-1245.910) [-1243.741] -- 0:00:12
937500 -- (-1248.348) [-1243.831] (-1245.921) (-1250.790) * (-1256.581) (-1256.872) [-1248.220] (-1248.282) -- 0:00:12
938000 -- (-1246.971) [-1243.892] (-1244.937) (-1254.228) * [-1251.562] (-1257.804) (-1255.311) (-1247.516) -- 0:00:12
938500 -- (-1248.797) [-1244.131] (-1250.564) (-1257.276) * (-1242.547) [-1249.922] (-1251.040) (-1251.291) -- 0:00:12
939000 -- (-1250.534) [-1245.484] (-1250.065) (-1257.849) * [-1250.748] (-1247.841) (-1257.518) (-1245.534) -- 0:00:11
939500 -- [-1242.847] (-1250.330) (-1252.230) (-1244.375) * (-1256.697) [-1244.485] (-1247.830) (-1247.398) -- 0:00:11
940000 -- (-1245.061) (-1258.197) [-1243.812] (-1252.534) * (-1247.867) (-1248.688) [-1247.158] (-1258.766) -- 0:00:11
Average standard deviation of split frequencies: 0.010925
940500 -- [-1248.043] (-1252.240) (-1245.123) (-1249.192) * [-1243.099] (-1245.412) (-1248.729) (-1247.388) -- 0:00:11
941000 -- (-1253.436) (-1249.173) [-1243.480] (-1246.733) * (-1253.486) (-1250.174) (-1247.815) [-1245.048] -- 0:00:11
941500 -- (-1244.480) (-1246.746) [-1242.095] (-1246.128) * (-1245.882) (-1245.636) (-1256.588) [-1251.460] -- 0:00:11
942000 -- (-1251.468) (-1249.026) (-1250.427) [-1243.243] * (-1247.647) (-1255.684) [-1251.827] (-1245.340) -- 0:00:11
942500 -- [-1247.966] (-1250.333) (-1255.938) (-1252.419) * (-1244.988) (-1246.660) [-1245.359] (-1245.814) -- 0:00:11
943000 -- (-1247.660) [-1246.749] (-1246.208) (-1249.404) * [-1244.969] (-1249.422) (-1245.382) (-1251.111) -- 0:00:11
943500 -- (-1254.974) [-1243.024] (-1245.907) (-1250.456) * (-1246.178) (-1248.434) (-1260.220) [-1243.067] -- 0:00:11
944000 -- [-1244.966] (-1247.442) (-1244.852) (-1247.371) * (-1250.771) (-1247.366) (-1248.490) [-1247.201] -- 0:00:10
944500 -- [-1246.616] (-1251.083) (-1250.248) (-1249.259) * (-1247.355) (-1246.719) (-1247.613) [-1245.131] -- 0:00:10
945000 -- (-1249.243) (-1251.288) [-1245.403] (-1245.909) * [-1244.935] (-1249.199) (-1245.251) (-1251.129) -- 0:00:10
Average standard deviation of split frequencies: 0.011063
945500 -- (-1248.466) (-1252.167) (-1246.607) [-1245.866] * (-1248.303) (-1252.523) (-1244.785) [-1252.489] -- 0:00:10
946000 -- (-1250.408) (-1244.650) [-1244.350] (-1249.056) * (-1247.591) [-1242.503] (-1251.478) (-1251.725) -- 0:00:10
946500 -- (-1247.746) (-1257.216) [-1242.499] (-1245.042) * (-1252.057) (-1249.712) [-1245.994] (-1252.652) -- 0:00:10
947000 -- (-1248.010) (-1245.260) (-1254.972) [-1254.732] * [-1250.803] (-1256.772) (-1250.430) (-1248.870) -- 0:00:10
947500 -- (-1247.413) [-1247.972] (-1244.938) (-1242.506) * (-1246.224) [-1250.509] (-1256.379) (-1244.781) -- 0:00:10
948000 -- [-1246.102] (-1247.680) (-1245.929) (-1241.296) * (-1247.197) [-1241.440] (-1246.748) (-1244.529) -- 0:00:10
948500 -- (-1248.977) [-1248.818] (-1248.436) (-1240.943) * (-1242.640) (-1247.220) (-1255.416) [-1243.848] -- 0:00:10
949000 -- (-1251.964) (-1244.476) (-1250.154) [-1247.013] * [-1247.262] (-1252.058) (-1244.988) (-1248.995) -- 0:00:09
949500 -- (-1249.605) (-1249.948) (-1252.866) [-1245.513] * (-1245.457) (-1253.787) (-1249.560) [-1250.308] -- 0:00:09
950000 -- [-1240.163] (-1241.652) (-1247.006) (-1247.429) * (-1251.877) [-1248.794] (-1250.969) (-1248.058) -- 0:00:09
Average standard deviation of split frequencies: 0.011306
950500 -- (-1259.259) (-1244.357) [-1249.162] (-1250.274) * (-1252.184) (-1260.159) (-1246.929) [-1244.918] -- 0:00:09
951000 -- (-1246.239) (-1245.953) [-1243.990] (-1253.791) * (-1252.176) [-1247.275] (-1254.222) (-1252.208) -- 0:00:09
951500 -- (-1255.514) (-1245.705) (-1244.863) [-1243.445] * (-1253.181) [-1251.506] (-1249.520) (-1248.916) -- 0:00:09
952000 -- (-1248.575) (-1255.962) (-1254.740) [-1248.685] * (-1246.830) (-1246.027) (-1252.653) [-1245.480] -- 0:00:09
952500 -- (-1252.964) [-1245.904] (-1257.285) (-1249.404) * [-1246.736] (-1247.693) (-1251.274) (-1245.722) -- 0:00:09
953000 -- (-1243.770) (-1245.407) (-1254.474) [-1247.621] * (-1247.597) (-1247.254) [-1244.640] (-1253.661) -- 0:00:09
953500 -- (-1246.513) (-1247.252) (-1245.603) [-1253.680] * [-1247.121] (-1247.823) (-1249.003) (-1247.005) -- 0:00:09
954000 -- [-1248.003] (-1255.111) (-1246.529) (-1246.318) * [-1246.816] (-1248.585) (-1249.493) (-1242.275) -- 0:00:09
954500 -- (-1245.425) (-1243.037) (-1254.396) [-1252.742] * (-1249.247) [-1254.538] (-1249.210) (-1251.768) -- 0:00:08
955000 -- (-1245.609) [-1244.002] (-1243.087) (-1250.748) * [-1247.632] (-1253.092) (-1249.841) (-1250.970) -- 0:00:08
Average standard deviation of split frequencies: 0.011341
955500 -- (-1245.914) [-1242.201] (-1248.347) (-1252.427) * (-1249.476) (-1244.449) [-1248.729] (-1251.062) -- 0:00:08
956000 -- (-1253.265) (-1246.335) [-1250.646] (-1259.080) * [-1249.546] (-1252.807) (-1249.103) (-1245.727) -- 0:00:08
956500 -- [-1242.763] (-1252.754) (-1246.000) (-1249.525) * (-1246.312) (-1250.579) [-1248.742] (-1250.536) -- 0:00:08
957000 -- (-1246.598) [-1243.978] (-1247.176) (-1251.000) * (-1249.869) (-1250.986) (-1246.430) [-1249.637] -- 0:00:08
957500 -- [-1245.076] (-1247.879) (-1251.329) (-1250.978) * (-1248.059) (-1248.612) [-1248.576] (-1250.843) -- 0:00:08
958000 -- [-1246.228] (-1249.530) (-1248.728) (-1255.062) * [-1250.753] (-1247.253) (-1248.368) (-1244.011) -- 0:00:08
958500 -- [-1244.851] (-1248.968) (-1252.591) (-1253.890) * [-1243.078] (-1254.795) (-1246.932) (-1250.285) -- 0:00:08
959000 -- [-1245.090] (-1251.556) (-1249.358) (-1250.299) * (-1247.508) (-1251.197) [-1249.178] (-1245.651) -- 0:00:08
959500 -- (-1248.588) [-1248.203] (-1258.196) (-1243.752) * (-1245.532) [-1249.224] (-1250.662) (-1245.786) -- 0:00:07
960000 -- (-1243.438) [-1245.256] (-1250.095) (-1249.696) * (-1246.642) (-1246.924) (-1248.218) [-1242.921] -- 0:00:07
Average standard deviation of split frequencies: 0.011875
960500 -- [-1250.234] (-1250.131) (-1244.900) (-1244.840) * (-1252.926) (-1254.614) (-1244.799) [-1247.948] -- 0:00:07
961000 -- (-1243.690) [-1249.968] (-1244.613) (-1243.595) * (-1247.767) (-1261.124) (-1250.719) [-1251.720] -- 0:00:07
961500 -- [-1248.918] (-1250.133) (-1251.973) (-1250.144) * (-1247.314) (-1251.235) (-1250.747) [-1250.870] -- 0:00:07
962000 -- [-1244.212] (-1249.503) (-1246.250) (-1249.858) * [-1250.420] (-1251.460) (-1255.131) (-1248.769) -- 0:00:07
962500 -- (-1244.134) (-1243.791) (-1247.751) [-1247.041] * (-1253.436) (-1252.816) [-1249.029] (-1246.124) -- 0:00:07
963000 -- [-1247.965] (-1254.727) (-1244.142) (-1247.800) * (-1251.859) [-1253.736] (-1246.646) (-1252.446) -- 0:00:07
963500 -- [-1242.995] (-1242.475) (-1251.972) (-1248.036) * [-1250.276] (-1251.037) (-1249.748) (-1245.365) -- 0:00:07
964000 -- (-1242.180) (-1244.118) [-1245.344] (-1252.618) * (-1247.868) (-1246.052) (-1246.582) [-1240.363] -- 0:00:07
964500 -- [-1246.237] (-1245.291) (-1247.990) (-1240.153) * (-1255.053) [-1245.719] (-1250.133) (-1245.398) -- 0:00:06
965000 -- (-1250.048) (-1246.110) [-1250.421] (-1247.376) * (-1248.632) (-1245.533) (-1244.883) [-1242.521] -- 0:00:06
Average standard deviation of split frequencies: 0.012200
965500 -- (-1251.059) (-1256.960) (-1260.009) [-1249.153] * [-1248.637] (-1250.534) (-1249.186) (-1248.015) -- 0:00:06
966000 -- (-1245.857) [-1243.464] (-1256.329) (-1246.033) * (-1248.743) (-1255.736) [-1244.877] (-1252.360) -- 0:00:06
966500 -- [-1246.504] (-1246.125) (-1248.845) (-1262.536) * (-1246.315) (-1260.791) (-1254.067) [-1246.745] -- 0:00:06
967000 -- (-1248.674) [-1247.490] (-1249.391) (-1260.685) * (-1250.007) [-1253.681] (-1259.909) (-1248.227) -- 0:00:06
967500 -- (-1245.769) (-1250.081) (-1244.968) [-1253.881] * (-1244.280) [-1245.586] (-1249.447) (-1251.614) -- 0:00:06
968000 -- (-1244.710) (-1258.685) [-1251.942] (-1249.767) * (-1254.909) [-1245.394] (-1247.581) (-1251.133) -- 0:00:06
968500 -- [-1247.902] (-1245.717) (-1248.036) (-1253.073) * (-1253.330) (-1244.370) [-1248.399] (-1244.446) -- 0:00:06
969000 -- (-1244.300) (-1249.876) (-1252.018) [-1249.935] * (-1250.033) (-1245.974) (-1244.723) [-1245.205] -- 0:00:06
969500 -- (-1246.221) (-1244.299) (-1247.109) [-1244.388] * [-1265.822] (-1256.922) (-1246.217) (-1250.207) -- 0:00:05
970000 -- (-1255.423) (-1247.761) (-1248.462) [-1246.522] * (-1253.137) [-1244.052] (-1247.825) (-1249.781) -- 0:00:05
Average standard deviation of split frequencies: 0.012044
970500 -- (-1253.212) [-1249.187] (-1247.308) (-1248.796) * (-1247.326) [-1250.486] (-1248.734) (-1248.468) -- 0:00:05
971000 -- (-1251.690) (-1249.040) [-1253.749] (-1248.304) * (-1249.803) (-1247.917) [-1243.497] (-1242.426) -- 0:00:05
971500 -- (-1250.985) [-1246.490] (-1259.890) (-1248.472) * (-1253.777) (-1252.672) [-1246.010] (-1246.628) -- 0:00:05
972000 -- (-1250.178) (-1249.733) (-1248.957) [-1249.133] * (-1249.762) (-1247.020) [-1243.617] (-1242.162) -- 0:00:05
972500 -- (-1252.108) [-1243.990] (-1249.064) (-1246.113) * (-1251.723) (-1244.424) (-1246.904) [-1246.237] -- 0:00:05
973000 -- (-1261.564) (-1249.099) [-1251.959] (-1250.528) * (-1255.431) [-1246.905] (-1254.353) (-1247.905) -- 0:00:05
973500 -- (-1247.981) (-1256.321) [-1240.872] (-1251.559) * (-1251.572) (-1254.936) (-1246.810) [-1249.548] -- 0:00:05
974000 -- [-1251.547] (-1254.769) (-1245.713) (-1255.504) * (-1248.903) (-1248.953) (-1245.789) [-1248.221] -- 0:00:05
974500 -- (-1253.232) (-1254.266) [-1249.051] (-1250.629) * (-1250.349) (-1247.785) [-1244.478] (-1254.368) -- 0:00:04
975000 -- (-1241.434) [-1253.493] (-1244.429) (-1248.626) * (-1246.816) [-1246.081] (-1241.442) (-1246.242) -- 0:00:04
Average standard deviation of split frequencies: 0.011882
975500 -- (-1254.799) (-1246.278) (-1250.611) [-1245.822] * [-1244.572] (-1250.756) (-1253.197) (-1241.916) -- 0:00:04
976000 -- [-1252.418] (-1250.466) (-1248.811) (-1245.863) * [-1244.529] (-1244.897) (-1249.559) (-1245.412) -- 0:00:04
976500 -- (-1259.264) [-1248.846] (-1247.187) (-1250.506) * (-1259.212) (-1248.447) [-1251.452] (-1242.766) -- 0:00:04
977000 -- (-1253.239) [-1241.796] (-1245.243) (-1247.359) * (-1251.628) (-1253.646) (-1252.469) [-1242.015] -- 0:00:04
977500 -- (-1250.642) [-1240.757] (-1246.579) (-1250.000) * (-1249.827) (-1253.976) (-1255.071) [-1247.222] -- 0:00:04
978000 -- (-1255.391) (-1245.390) [-1250.977] (-1242.759) * (-1250.986) (-1243.819) [-1243.140] (-1243.997) -- 0:00:04
978500 -- [-1252.241] (-1244.236) (-1245.009) (-1252.182) * (-1256.068) (-1254.954) [-1248.935] (-1241.775) -- 0:00:04
979000 -- [-1248.460] (-1246.304) (-1252.032) (-1251.766) * (-1252.842) (-1248.260) (-1245.888) [-1249.759] -- 0:00:04
979500 -- (-1251.731) (-1248.587) [-1246.293] (-1250.303) * (-1255.966) (-1247.173) [-1240.909] (-1251.064) -- 0:00:04
980000 -- [-1244.348] (-1255.178) (-1246.968) (-1245.396) * (-1251.669) [-1247.197] (-1254.818) (-1249.859) -- 0:00:03
Average standard deviation of split frequencies: 0.012787
980500 -- (-1250.192) (-1248.576) [-1244.635] (-1247.273) * (-1241.598) (-1244.473) [-1247.757] (-1253.030) -- 0:00:03
981000 -- [-1242.231] (-1251.640) (-1246.707) (-1252.109) * (-1250.135) [-1248.015] (-1246.665) (-1259.098) -- 0:00:03
981500 -- (-1245.780) (-1257.260) [-1245.243] (-1247.353) * (-1246.320) (-1244.709) (-1247.032) [-1243.209] -- 0:00:03
982000 -- (-1253.018) (-1248.592) (-1243.223) [-1251.252] * (-1254.322) (-1246.236) [-1242.392] (-1248.920) -- 0:00:03
982500 -- [-1248.955] (-1250.269) (-1248.025) (-1249.699) * [-1241.535] (-1246.464) (-1243.676) (-1254.344) -- 0:00:03
983000 -- (-1250.940) (-1253.365) [-1251.628] (-1243.618) * (-1246.320) [-1246.256] (-1251.656) (-1246.111) -- 0:00:03
983500 -- [-1248.697] (-1253.560) (-1242.182) (-1241.756) * (-1247.030) [-1251.312] (-1260.359) (-1248.702) -- 0:00:03
984000 -- (-1262.058) (-1254.174) (-1247.831) [-1247.598] * [-1250.049] (-1248.813) (-1250.117) (-1244.795) -- 0:00:03
984500 -- [-1248.963] (-1259.687) (-1249.877) (-1255.579) * (-1258.608) (-1250.774) (-1254.268) [-1243.837] -- 0:00:03
985000 -- (-1247.828) (-1253.253) (-1261.251) [-1252.774] * (-1249.177) (-1246.946) [-1254.456] (-1245.873) -- 0:00:02
Average standard deviation of split frequencies: 0.013291
985500 -- (-1249.445) [-1250.889] (-1251.147) (-1256.639) * (-1255.623) [-1250.501] (-1247.851) (-1248.850) -- 0:00:02
986000 -- (-1251.605) (-1255.930) (-1246.727) [-1256.518] * (-1251.933) [-1253.888] (-1252.270) (-1251.588) -- 0:00:02
986500 -- (-1250.007) (-1242.169) [-1251.845] (-1257.894) * (-1255.650) (-1247.398) [-1249.214] (-1248.178) -- 0:00:02
987000 -- [-1247.000] (-1242.695) (-1245.964) (-1249.085) * (-1250.812) (-1247.413) (-1255.529) [-1243.095] -- 0:00:02
987500 -- [-1247.431] (-1252.366) (-1243.807) (-1254.539) * (-1261.794) (-1246.409) [-1250.684] (-1249.548) -- 0:00:02
988000 -- [-1244.635] (-1248.667) (-1250.900) (-1247.432) * (-1254.794) (-1247.126) (-1250.264) [-1242.732] -- 0:00:02
988500 -- [-1249.612] (-1251.249) (-1250.238) (-1249.177) * [-1258.769] (-1246.306) (-1243.640) (-1253.066) -- 0:00:02
989000 -- (-1246.584) (-1240.914) [-1251.989] (-1252.130) * (-1248.987) [-1247.527] (-1245.930) (-1252.083) -- 0:00:02
989500 -- (-1247.677) (-1247.486) [-1247.472] (-1249.573) * (-1246.875) (-1255.973) [-1246.174] (-1245.974) -- 0:00:02
990000 -- [-1244.554] (-1252.628) (-1246.846) (-1248.262) * [-1242.805] (-1255.424) (-1248.991) (-1249.167) -- 0:00:01
Average standard deviation of split frequencies: 0.013324
990500 -- (-1246.804) [-1245.839] (-1250.031) (-1249.819) * [-1249.679] (-1246.153) (-1245.707) (-1254.451) -- 0:00:01
991000 -- (-1244.551) [-1244.868] (-1249.748) (-1246.269) * (-1255.307) (-1254.101) (-1249.615) [-1246.104] -- 0:00:01
991500 -- (-1251.379) [-1249.712] (-1253.089) (-1240.947) * (-1246.709) (-1244.934) (-1250.248) [-1249.098] -- 0:00:01
992000 -- [-1254.653] (-1255.383) (-1245.297) (-1241.072) * (-1247.582) (-1246.863) [-1246.237] (-1249.965) -- 0:00:01
992500 -- (-1252.525) (-1247.112) (-1252.137) [-1254.641] * [-1247.595] (-1252.770) (-1249.440) (-1257.788) -- 0:00:01
993000 -- (-1245.379) (-1252.947) (-1247.044) [-1245.832] * (-1242.586) [-1251.367] (-1251.095) (-1245.730) -- 0:00:01
993500 -- (-1246.003) (-1255.447) [-1249.201] (-1247.107) * (-1246.216) (-1245.850) (-1245.918) [-1246.798] -- 0:00:01
994000 -- (-1249.644) (-1256.124) (-1244.172) [-1243.463] * (-1246.498) [-1247.188] (-1244.898) (-1242.974) -- 0:00:01
994500 -- (-1256.799) [-1251.878] (-1247.389) (-1251.859) * (-1248.528) (-1250.478) (-1247.816) [-1251.990] -- 0:00:01
995000 -- (-1250.973) [-1247.884] (-1245.626) (-1248.131) * (-1251.934) [-1248.161] (-1245.806) (-1245.015) -- 0:00:00
Average standard deviation of split frequencies: 0.012779
995500 -- [-1238.769] (-1245.550) (-1246.525) (-1254.304) * (-1254.299) (-1252.152) [-1246.139] (-1248.836) -- 0:00:00
996000 -- (-1246.036) [-1248.259] (-1245.725) (-1242.736) * [-1246.173] (-1253.020) (-1249.609) (-1249.571) -- 0:00:00
996500 -- [-1243.605] (-1243.384) (-1251.130) (-1245.186) * (-1258.307) (-1250.205) [-1244.763] (-1246.176) -- 0:00:00
997000 -- [-1242.011] (-1249.060) (-1252.524) (-1248.870) * [-1247.453] (-1244.579) (-1246.860) (-1248.030) -- 0:00:00
997500 -- (-1251.306) [-1246.075] (-1249.682) (-1243.856) * (-1248.314) (-1254.305) (-1248.222) [-1244.018] -- 0:00:00
998000 -- (-1247.694) [-1247.196] (-1244.709) (-1244.232) * (-1247.772) (-1247.539) (-1258.974) [-1243.483] -- 0:00:00
998500 -- (-1245.974) (-1252.599) [-1248.058] (-1241.253) * (-1247.504) (-1249.076) [-1246.603] (-1253.283) -- 0:00:00
999000 -- (-1246.691) [-1253.172] (-1242.012) (-1255.945) * (-1247.902) (-1251.058) [-1243.378] (-1248.343) -- 0:00:00
999500 -- [-1242.902] (-1256.673) (-1244.209) (-1247.873) * (-1247.542) (-1252.720) [-1246.286] (-1248.538) -- 0:00:00
1000000 -- (-1248.741) (-1251.881) [-1247.737] (-1248.001) * (-1246.119) (-1254.516) [-1249.915] (-1247.037) -- 0:00:00
Average standard deviation of split frequencies: 0.013473
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1248.741486 -- 14.707841
Chain 1 -- -1248.741486 -- 14.707841
Chain 2 -- -1251.881287 -- 12.455705
Chain 2 -- -1251.881289 -- 12.455705
Chain 3 -- -1247.737250 -- 14.244048
Chain 3 -- -1247.737254 -- 14.244048
Chain 4 -- -1248.001023 -- 11.191185
Chain 4 -- -1248.001020 -- 11.191185
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1246.118766 -- 12.243383
Chain 1 -- -1246.118767 -- 12.243383
Chain 2 -- -1254.516437 -- 13.268665
Chain 2 -- -1254.516435 -- 13.268665
Chain 3 -- -1249.915271 -- 14.257686
Chain 3 -- -1249.915271 -- 14.257686
Chain 4 -- -1247.036527 -- 12.175487
Chain 4 -- -1247.036521 -- 12.175487
Analysis completed in 3 mins 16 seconds
Analysis used 196.06 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1237.47
Likelihood of best state for "cold" chain of run 2 was -1237.47
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
56.5 % ( 47 %) Dirichlet(Revmat{all})
71.6 % ( 61 %) Slider(Revmat{all})
28.4 % ( 23 %) Dirichlet(Pi{all})
30.5 % ( 35 %) Slider(Pi{all})
58.9 % ( 34 %) Multiplier(Alpha{1,2})
48.1 % ( 25 %) Multiplier(Alpha{3})
59.6 % ( 36 %) Slider(Pinvar{all})
12.3 % ( 12 %) ExtSPR(Tau{all},V{all})
6.9 % ( 7 %) ExtTBR(Tau{all},V{all})
22.2 % ( 19 %) NNI(Tau{all},V{all})
21.5 % ( 22 %) ParsSPR(Tau{all},V{all})
26.6 % ( 20 %) Multiplier(V{all})
40.9 % ( 41 %) Nodeslider(V{all})
25.9 % ( 28 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
56.1 % ( 48 %) Dirichlet(Revmat{all})
71.8 % ( 68 %) Slider(Revmat{all})
28.7 % ( 23 %) Dirichlet(Pi{all})
30.1 % ( 19 %) Slider(Pi{all})
59.4 % ( 33 %) Multiplier(Alpha{1,2})
47.8 % ( 24 %) Multiplier(Alpha{3})
59.5 % ( 31 %) Slider(Pinvar{all})
12.4 % ( 9 %) ExtSPR(Tau{all},V{all})
7.0 % ( 9 %) ExtTBR(Tau{all},V{all})
22.4 % ( 22 %) NNI(Tau{all},V{all})
21.7 % ( 28 %) ParsSPR(Tau{all},V{all})
26.6 % ( 31 %) Multiplier(V{all})
41.1 % ( 40 %) Nodeslider(V{all})
25.9 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.65 0.52
2 | 166636 0.83 0.68
3 | 166306 166705 0.84
4 | 167312 166485 166556
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.82 0.66 0.53
2 | 166148 0.83 0.68
3 | 166874 166648 0.84
4 | 166701 166716 166913
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/7/Alg-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/7/Alg-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/7/Alg-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1245.51
|1 1 1 |
|2 2 |
| 1 2 21 2 |
| 12 2 1 |
| 1 12 1 12 1 * 1 2 1 2 |
| 11 2 1 2 1 1 12 1 2 2 1 2 |
| 1 1 * 2 1 211 2 1212 1 12 *2 *|
| 2 11 1 22 1 2 11 1 2 |
| 21* 122 2 1212 2 1 2 21 2 2 1 1 |
| 2 2 12 2 2 1 1 |
| 2 1 211 2 * 2 |
| 2 2 2 1 |
| 1 |
| |
| 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1249.60
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/7/Alg-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/7/Alg-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/7/Alg-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1243.45 -1253.18
2 -1243.74 -1258.65
--------------------------------------
TOTAL -1243.59 -1257.96
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/7/Alg-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/7/Alg-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/7/Alg-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.615231 0.012892 0.408317 0.841728 0.604583 1356.39 1384.61 1.000
r(A<->C){all} 0.043336 0.000627 0.000310 0.091831 0.039286 830.48 845.41 1.000
r(A<->G){all} 0.270607 0.004223 0.148932 0.398514 0.266191 467.13 746.26 1.001
r(A<->T){all} 0.043400 0.000347 0.012888 0.082716 0.040954 722.99 870.52 1.001
r(C<->G){all} 0.084503 0.001450 0.015533 0.157855 0.080820 800.06 810.26 1.000
r(C<->T){all} 0.520530 0.005577 0.377215 0.664500 0.520673 452.96 708.14 1.000
r(G<->T){all} 0.037624 0.000495 0.000064 0.077993 0.034095 784.56 895.16 1.000
pi(A){all} 0.288147 0.000334 0.252354 0.324943 0.287981 1365.12 1377.64 1.000
pi(C){all} 0.181552 0.000236 0.151278 0.211208 0.181175 1248.24 1316.58 1.000
pi(G){all} 0.213868 0.000275 0.184128 0.247905 0.213722 1115.31 1258.33 1.000
pi(T){all} 0.316434 0.000355 0.278722 0.352112 0.316362 1127.60 1227.03 1.000
alpha{1,2} 0.059305 0.001297 0.000123 0.119659 0.058981 1054.12 1107.56 1.000
alpha{3} 2.134053 0.623356 0.895858 3.731421 2.008896 1219.85 1360.42 1.000
pinvar{all} 0.383823 0.006769 0.219542 0.536139 0.390131 1230.08 1339.94 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/7/Alg-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/7/Alg-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/7/Alg-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/7/Alg-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/opt/ADOPS/7/Alg-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...***
8 -- .**...
9 -- ...**.
10 -- ....**
11 -- ...*.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/7/Alg-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 2833 0.943704 0.008951 0.937375 0.950033 2
8 2804 0.934044 0.004711 0.930713 0.937375 2
9 1822 0.606929 0.016017 0.595603 0.618254 2
10 629 0.209527 0.010835 0.201865 0.217189 2
11 551 0.183544 0.026852 0.164557 0.202532 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/7/Alg-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.036442 0.000174 0.012683 0.062575 0.034732 1.000 2
length{all}[2] 0.010798 0.000034 0.001387 0.021980 0.009799 1.000 2
length{all}[3] 0.002897 0.000009 0.000000 0.008728 0.002010 1.001 2
length{all}[4] 0.065441 0.000419 0.028444 0.105833 0.062857 1.001 2
length{all}[5] 0.039222 0.000250 0.012091 0.071949 0.037273 1.000 2
length{all}[6] 0.394996 0.009225 0.221757 0.580266 0.383944 1.000 2
length{all}[7] 0.037053 0.000322 0.004502 0.070165 0.034807 1.000 2
length{all}[8] 0.012157 0.000058 0.000020 0.026806 0.010781 1.001 2
length{all}[9] 0.021810 0.000287 0.000133 0.053732 0.017901 1.000 2
length{all}[10] 0.013852 0.000149 0.000021 0.038758 0.010661 0.998 2
length{all}[11] 0.011251 0.000108 0.000023 0.030534 0.008060 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.013473
Maximum standard deviation of split frequencies = 0.026852
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.001
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------------ C4 (4)
| /-----------61----------+
| | \------------------------ C5 (5)
+-----------94----------+
| \------------------------------------------------ C6 (6)
|
| /------------------------ C2 (2)
\-----------------------93----------------------+
\------------------------ C3 (3)
Phylogram (based on average branch lengths):
/------ C1 (1)
|
| /----------- C4 (4)
| /--+
| | \------ C5 (5)
+-----+
| \------------------------------------------------------------------ C6 (6)
|
| /-- C2 (2)
\-+
\ C3 (3)
|-------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (17 trees sampled):
90 % credible set contains 4 trees
95 % credible set contains 6 trees
99 % credible set contains 10 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 6 ls = 534
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
119 patterns at 178 / 178 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
116144 bytes for conP
16184 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, ((4, 5), 6), (2, 3)); MP score: 110
232288 bytes for conP, adjusted
0.056657 0.071100 0.000000 0.099339 0.072535 0.439808 0.026889 0.019814 0.006107 0.300000 1.300000
ntime & nrate & np: 9 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 11
lnL0 = -1397.290857
Iterating by ming2
Initial: fx= 1397.290857
x= 0.05666 0.07110 0.00000 0.09934 0.07254 0.43981 0.02689 0.01981 0.00611 0.30000 1.30000
1 h-m-p 0.0000 0.0000 1572.0394 +CYCCC 1390.898500 4 0.0000 24 | 0/11
2 h-m-p 0.0000 0.0000 282.9944 ++ 1389.941919 m 0.0000 38 | 1/11
3 h-m-p 0.0000 0.0011 423.4679 +++CCCCC 1373.485007 4 0.0007 63 | 1/11
4 h-m-p 0.0009 0.0045 200.6606 YYCCC 1364.366968 4 0.0015 83 | 1/11
5 h-m-p 0.0006 0.0031 134.2268 ++ 1343.076309 m 0.0031 97 | 1/11
6 h-m-p -0.0000 -0.0000 3086.1222
h-m-p: -1.86757710e-20 -9.33788550e-20 3.08612216e+03 1343.076309
.. | 1/11
7 h-m-p 0.0000 0.0005 1576.4145 YYCCCC 1336.903636 5 0.0000 130 | 1/11
8 h-m-p 0.0001 0.0005 258.1642 ++ 1308.292849 m 0.0005 144 | 1/11
9 h-m-p 0.0000 0.0001 2709.4508 +YYYYYCCCCC 1274.855163 9 0.0001 172 | 1/11
10 h-m-p 0.0000 0.0000 1123.6289 +YYYYCCC 1268.679826 6 0.0000 195 | 1/11
11 h-m-p 0.0001 0.0004 237.7443 +YYYCCC 1261.090398 5 0.0003 217 | 1/11
12 h-m-p 0.0001 0.0003 1210.4914 ++ 1208.763782 m 0.0003 231 | 1/11
13 h-m-p 0.0001 0.0003 310.9915 CYCCCC 1206.858827 5 0.0001 254 | 1/11
14 h-m-p 0.0005 0.0040 70.9733 YCCC 1205.379527 3 0.0008 273 | 1/11
15 h-m-p 0.0007 0.0033 55.0875 CYCCC 1204.340480 4 0.0010 294 | 1/11
16 h-m-p 0.0015 0.0254 35.6974 +YYC 1201.545798 2 0.0049 311 | 1/11
17 h-m-p 0.0133 1.4739 13.0619 YYCCC 1196.294698 4 0.0196 331 | 1/11
18 h-m-p 0.0989 0.4945 1.2668 +CCC 1188.838163 2 0.4072 350 | 1/11
19 h-m-p 0.9343 4.6713 0.2302 YCCC 1185.683122 3 2.1334 369 | 1/11
20 h-m-p 1.6000 8.0000 0.1560 CCCC 1184.480003 3 1.9894 399 | 1/11
21 h-m-p 1.6000 8.0000 0.0765 CCCC 1184.130188 3 2.5327 429 | 1/11
22 h-m-p 1.6000 8.0000 0.0279 +YCCC 1183.609463 3 4.4799 459 | 1/11
23 h-m-p 1.6000 8.0000 0.0213 +CCC 1182.133856 2 6.5351 488 | 1/11
24 h-m-p 1.6000 8.0000 0.0245 YCCC 1181.060708 3 2.6067 517 | 1/11
25 h-m-p 0.5566 8.0000 0.1147 +YCCC 1179.665771 3 3.9128 547 | 1/11
26 h-m-p 0.8378 4.1890 0.0581 YCCC 1179.023556 3 2.0796 576 | 1/11
27 h-m-p 1.6000 8.0000 0.0145 YCCC 1178.693179 3 2.8641 605 | 1/11
28 h-m-p 0.5447 5.7296 0.0761 +YC 1178.367018 1 3.5369 631 | 1/11
29 h-m-p 1.6000 8.0000 0.0817 CYC 1178.247680 2 1.8941 658 | 1/11
30 h-m-p 1.6000 8.0000 0.0162 CC 1178.208480 1 2.1049 684 | 1/11
31 h-m-p 1.6000 8.0000 0.0167 CC 1178.202329 1 1.9852 710 | 1/11
32 h-m-p 1.6000 8.0000 0.0013 CC 1178.199995 1 2.1905 736 | 1/11
33 h-m-p 0.5209 8.0000 0.0054 +YC 1178.199652 1 1.6813 762 | 1/11
34 h-m-p 1.6000 8.0000 0.0013 Y 1178.199609 0 2.8964 786 | 1/11
35 h-m-p 1.6000 8.0000 0.0005 YC 1178.199551 1 3.8127 811 | 1/11
36 h-m-p 1.6000 8.0000 0.0006 Y 1178.199548 0 1.1567 835 | 1/11
37 h-m-p 1.6000 8.0000 0.0000 Y 1178.199548 0 1.2411 859 | 1/11
38 h-m-p 1.6000 8.0000 0.0000 Y 1178.199548 0 1.1888 883 | 1/11
39 h-m-p 1.6000 8.0000 0.0000 C 1178.199548 0 1.6000 907 | 1/11
40 h-m-p 1.6000 8.0000 0.0000 ----------C 1178.199548 0 0.0000 941
Out..
lnL = -1178.199548
942 lfun, 942 eigenQcodon, 8478 P(t)
Time used: 0:03
Model 1: NearlyNeutral
TREE # 1
(1, ((4, 5), 6), (2, 3)); MP score: 110
0.055556 0.074501 0.000000 0.094638 0.064108 0.403323 0.034082 0.026077 0.004997 2.864413 0.747245 0.296991
ntime & nrate & np: 9 2 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 6.358678
np = 12
lnL0 = -1230.080961
Iterating by ming2
Initial: fx= 1230.080961
x= 0.05556 0.07450 0.00000 0.09464 0.06411 0.40332 0.03408 0.02608 0.00500 2.86441 0.74724 0.29699
1 h-m-p 0.0000 0.0000 273.8019 ++ 1227.972250 m 0.0000 17 | 1/12
2 h-m-p 0.0000 0.0005 249.1754 ++YCCYCC 1218.203718 5 0.0004 43 | 1/12
3 h-m-p 0.0000 0.0001 2140.5610 +YYCYCCC 1208.487443 6 0.0000 68 | 1/12
4 h-m-p 0.0000 0.0000 6756.4744 +YYCYCCC 1195.796925 6 0.0000 93 | 1/12
5 h-m-p 0.0000 0.0000 2621.8297 +YYCCCC 1192.008164 5 0.0000 117 | 1/12
6 h-m-p 0.0001 0.0006 65.9921 ++ 1190.916931 m 0.0006 132 | 1/12
7 h-m-p 0.0000 0.0000 18.6022
h-m-p: 1.09639044e-19 5.48195222e-19 1.86021716e+01 1190.916931
.. | 1/12
8 h-m-p 0.0000 0.0008 1317.5370 +CCYCC 1179.738648 4 0.0000 167 | 1/12
9 h-m-p 0.0002 0.0009 127.5841 YCCC 1176.504977 3 0.0004 187 | 1/12
10 h-m-p 0.0001 0.0007 113.9361 YCYCCC 1174.954464 5 0.0003 210 | 1/12
11 h-m-p 0.0001 0.0004 104.7125 YC 1174.397408 1 0.0002 226 | 1/12
12 h-m-p 0.0001 0.0006 75.8347 CCC 1174.142309 2 0.0002 245 | 1/12
13 h-m-p 0.0003 0.0049 40.7816 CC 1173.915836 1 0.0005 262 | 1/12
14 h-m-p 0.0011 0.0150 16.7389 CC 1173.797978 1 0.0011 279 | 1/12
15 h-m-p 0.0012 0.0074 15.6455 YCCC 1173.653498 3 0.0023 299 | 1/12
16 h-m-p 0.0059 0.0296 5.3372 YC 1173.644722 1 0.0008 315 | 1/12
17 h-m-p 0.0082 0.1650 0.5211 +CC 1173.639015 1 0.0298 333 | 1/12
18 h-m-p 0.0009 0.2110 17.7208 ++CYC 1173.547632 2 0.0148 364 | 1/12
19 h-m-p 1.6000 8.0000 0.0502 YCC 1173.524646 2 1.0885 382 | 1/12
20 h-m-p 1.6000 8.0000 0.0050 +YC 1173.499668 1 5.3284 410 | 1/12
21 h-m-p 1.2583 8.0000 0.0213 YC 1173.497240 1 0.9380 437 | 1/12
22 h-m-p 1.6000 8.0000 0.0054 YC 1173.497186 1 0.9254 464 | 1/12
23 h-m-p 1.6000 8.0000 0.0003 Y 1173.497185 0 0.9383 490 | 1/12
24 h-m-p 1.6000 8.0000 0.0000 Y 1173.497185 0 1.0281 516 | 1/12
25 h-m-p 1.6000 8.0000 0.0000 C 1173.497185 0 0.4000 542 | 1/12
26 h-m-p 0.7029 8.0000 0.0000 Y 1173.497185 0 0.1757 568
Out..
lnL = -1173.497185
569 lfun, 1707 eigenQcodon, 10242 P(t)
Time used: 0:06
Model 2: PositiveSelection
TREE # 1
(1, ((4, 5), 6), (2, 3)); MP score: 110
initial w for M2:NSpselection reset.
0.070634 0.069375 0.000000 0.085964 0.056782 0.375674 0.033780 0.025353 0.026372 3.102432 0.896732 0.199894 0.157918 2.073080
ntime & nrate & np: 9 3 14
Bounds (np=14):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 4.345620
np = 14
lnL0 = -1252.365175
Iterating by ming2
Initial: fx= 1252.365175
x= 0.07063 0.06937 0.00000 0.08596 0.05678 0.37567 0.03378 0.02535 0.02637 3.10243 0.89673 0.19989 0.15792 2.07308
1 h-m-p 0.0000 0.0002 380.7145 +++ 1243.956191 m 0.0002 20 | 1/14
2 h-m-p 0.0003 0.0016 123.1516 ++ 1225.279504 m 0.0016 37 | 2/14
3 h-m-p 0.0010 0.0048 145.2583 +YCCC 1216.453653 3 0.0027 60 | 2/14
4 h-m-p 0.0006 0.0030 129.2055 +YYYCCC 1207.914878 5 0.0023 85 | 2/14
5 h-m-p 0.0003 0.0017 167.4925 +YYYCCC 1202.135902 5 0.0013 110 | 2/14
6 h-m-p 0.0002 0.0011 281.3312 YCCC 1199.827252 3 0.0005 132 | 2/14
7 h-m-p 0.0021 0.0106 31.7249 CC 1199.161259 1 0.0021 151 | 1/14
8 h-m-p 0.0004 0.0022 173.9303 YCCC 1199.061644 3 0.0000 173 | 1/14
9 h-m-p 0.0002 0.0244 38.1011 ++YCCC 1197.074332 3 0.0070 197 | 1/14
10 h-m-p 0.0122 0.0608 14.0518 CYC 1196.287157 2 0.0113 217 | 1/14
11 h-m-p 0.0359 0.3456 4.4457 ++ 1188.465644 m 0.3456 234 | 2/14
12 h-m-p 0.1619 0.8095 0.8117 +YYCCCC 1182.536492 5 0.5723 260 | 2/14
13 h-m-p 0.0450 0.2252 1.4428 ++ 1177.790830 m 0.2252 289 | 2/14
14 h-m-p 0.3001 2.1413 1.0827 YCCCC 1175.301345 4 0.7327 313 | 2/14
15 h-m-p 0.2760 1.3801 2.3183 CYC 1174.442195 2 0.2455 333 | 2/14
16 h-m-p 0.2311 1.1556 1.6260 CC 1174.094762 1 0.2184 352 | 2/14
17 h-m-p 0.2636 1.3180 0.3499 YCCC 1173.795364 3 0.5905 374 | 2/14
18 h-m-p 0.6366 8.0000 0.3246 CC 1173.632821 1 0.6365 405 | 2/14
19 h-m-p 0.9969 8.0000 0.2072 YC 1173.547528 1 0.7615 435 | 2/14
20 h-m-p 0.9039 8.0000 0.1746 CC 1173.501618 1 0.9733 466 | 2/14
21 h-m-p 1.6000 8.0000 0.0217 YC 1173.497896 1 0.8709 496 | 2/14
22 h-m-p 1.6000 8.0000 0.0109 CC 1173.497255 1 0.4984 527 | 2/14
23 h-m-p 1.6000 8.0000 0.0029 YC 1173.497192 1 1.0838 557 | 2/14
24 h-m-p 1.6000 8.0000 0.0012 Y 1173.497186 0 0.7072 586 | 2/14
25 h-m-p 1.6000 8.0000 0.0002 Y 1173.497185 0 1.1996 615 | 2/14
26 h-m-p 1.6000 8.0000 0.0001 C 1173.497185 0 1.5495 644 | 2/14
27 h-m-p 1.6000 8.0000 0.0000 C 1173.497185 0 1.7434 673 | 2/14
28 h-m-p 1.6000 8.0000 0.0000 C 1173.497185 0 1.3365 702 | 2/14
29 h-m-p 1.6000 8.0000 0.0000 C 1173.497185 0 1.9209 731 | 2/14
30 h-m-p 1.6000 8.0000 0.0000 Y 1173.497185 0 1.6000 760 | 2/14
31 h-m-p 1.6000 8.0000 0.0000 -----C 1173.497185 0 0.0004 794
Out..
lnL = -1173.497185
795 lfun, 3180 eigenQcodon, 21465 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1186.837816 S = -1142.341107 -35.680885
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 119 patterns 0:14
did 20 / 119 patterns 0:14
did 30 / 119 patterns 0:14
did 40 / 119 patterns 0:14
did 50 / 119 patterns 0:14
did 60 / 119 patterns 0:14
did 70 / 119 patterns 0:14
did 80 / 119 patterns 0:14
did 90 / 119 patterns 0:14
did 100 / 119 patterns 0:14
did 110 / 119 patterns 0:14
did 119 / 119 patterns 0:15
Time used: 0:15
Model 3: discrete
TREE # 1
(1, ((4, 5), 6), (2, 3)); MP score: 110
0.060395 0.071117 0.000000 0.102664 0.072827 0.424186 0.023707 0.017286 0.004491 3.102432 0.215184 0.509770 0.024857 0.062265 0.090233
ntime & nrate & np: 9 4 15
Bounds (np=15):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 12.631395
np = 15
lnL0 = -1179.085222
Iterating by ming2
Initial: fx= 1179.085222
x= 0.06040 0.07112 0.00000 0.10266 0.07283 0.42419 0.02371 0.01729 0.00449 3.10243 0.21518 0.50977 0.02486 0.06227 0.09023
1 h-m-p 0.0000 0.0000 179.3667 ++ 1178.223343 m 0.0000 20 | 1/15
2 h-m-p 0.0000 0.0002 129.4415 +++ 1176.749622 m 0.0002 39 | 2/15
3 h-m-p 0.0001 0.0010 144.9071 YC 1176.305841 1 0.0002 58 | 2/15
4 h-m-p 0.0002 0.0012 107.9176 ++ 1174.105519 m 0.0012 76 | 3/15
5 h-m-p 0.0010 0.0050 17.4191 YCCC 1174.029907 3 0.0007 99 | 3/15
6 h-m-p 0.0016 0.0178 7.5222 YCC 1174.011985 2 0.0007 120 | 3/15
7 h-m-p 0.0003 0.0132 16.4046 +YC 1173.969981 1 0.0008 140 | 3/15
8 h-m-p 0.0009 0.0340 15.8347 CC 1173.923329 1 0.0011 160 | 3/15
9 h-m-p 0.0061 0.1172 2.9602 CC 1173.911717 1 0.0020 180 | 3/15
10 h-m-p 0.0036 0.3312 1.6409 +CCC 1173.856844 2 0.0132 203 | 3/15
11 h-m-p 0.0022 0.0779 9.9298 YCC 1173.758709 2 0.0043 224 | 3/15
12 h-m-p 0.0490 1.1947 0.8756 ++CCC 1172.919561 2 0.6985 248 | 3/15
13 h-m-p 0.6654 3.3272 0.5949 YYYCC 1172.258074 4 0.6536 283 | 3/15
14 h-m-p 0.5502 8.0000 0.7067 CCCC 1172.010204 3 0.5849 319 | 3/15
15 h-m-p 0.9757 4.8785 0.1084 CCC 1171.852180 2 0.9178 353 | 3/15
16 h-m-p 0.5835 8.0000 0.1705 YCCC 1171.809320 3 0.9880 388 | 3/15
17 h-m-p 1.6000 8.0000 0.0904 YC 1171.797880 1 0.6846 419 | 3/15
18 h-m-p 1.6000 8.0000 0.0133 CY 1171.793560 1 1.7016 451 | 3/15
19 h-m-p 1.6000 8.0000 0.0063 CC 1171.792588 1 1.4349 483 | 3/15
20 h-m-p 1.6000 8.0000 0.0014 Y 1171.792543 0 1.0999 513 | 3/15
21 h-m-p 1.6000 8.0000 0.0003 Y 1171.792542 0 0.9571 543 | 3/15
22 h-m-p 1.6000 8.0000 0.0000 Y 1171.792542 0 0.8714 573 | 3/15
23 h-m-p 1.6000 8.0000 0.0000 Y 1171.792542 0 0.8358 603 | 3/15
24 h-m-p 1.6000 8.0000 0.0000 --C 1171.792542 0 0.0250 635
Out..
lnL = -1171.792542
636 lfun, 2544 eigenQcodon, 17172 P(t)
Time used: 0:20
Model 7: beta
TREE # 1
(1, ((4, 5), 6), (2, 3)); MP score: 110
0.060532 0.076668 0.000000 0.104515 0.074449 0.415146 0.035830 0.020769 0.003695 2.912070 0.603915 1.022819
ntime & nrate & np: 9 1 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 7.241338
np = 12
lnL0 = -1214.196430
Iterating by ming2
Initial: fx= 1214.196430
x= 0.06053 0.07667 0.00000 0.10452 0.07445 0.41515 0.03583 0.02077 0.00370 2.91207 0.60392 1.02282
1 h-m-p 0.0000 0.0000 207.5293 ++ 1213.210128 m 0.0000 17 | 1/12
2 h-m-p 0.0000 0.0010 108.5885 ++YCYCCCC 1210.226971 6 0.0006 44 | 1/12
3 h-m-p 0.0001 0.0005 345.0122 +YYCCCC 1205.392879 5 0.0003 68 | 1/12
4 h-m-p 0.0001 0.0005 598.3136 ++ 1185.928031 m 0.0005 83 | 1/12
5 h-m-p -0.0000 -0.0000 1196893.5434
h-m-p: -2.28112157e-24 -1.14056079e-23 1.19689354e+06 1185.928031
.. | 1/12
6 h-m-p 0.0000 0.0009 312.9820 ++CCYC 1180.978881 3 0.0002 117 | 1/12
7 h-m-p 0.0004 0.0020 107.1408 +YCYCCC 1173.666661 5 0.0011 141 | 1/12
8 h-m-p 0.0001 0.0006 169.9886 CCCCC 1172.721650 4 0.0002 164 | 1/12
9 h-m-p 0.0004 0.0018 42.2107 YYC 1172.519198 2 0.0003 181 | 1/12
10 h-m-p 0.0008 0.0042 12.6037 YCCC 1172.487336 3 0.0004 201 | 1/12
11 h-m-p 0.0002 0.0061 27.2202 CC 1172.458443 1 0.0002 218 | 1/12
12 h-m-p 0.0011 0.1485 5.7950 +CCC 1172.405233 2 0.0041 238 | 1/12
13 h-m-p 0.0013 0.0063 4.1092 CC 1172.397104 1 0.0014 255 | 1/12
14 h-m-p 0.0026 0.0130 1.9620 YC 1172.395262 1 0.0011 271 | 1/12
15 h-m-p 0.0021 1.0327 1.7457 +++YCC 1172.280711 2 0.0893 292 | 1/12
16 h-m-p 1.4810 8.0000 0.1052 CCCC 1172.107135 3 2.1979 313 | 1/12
17 h-m-p 0.7447 7.0613 0.3106 CC 1172.064049 1 0.6342 341 | 1/12
18 h-m-p 1.6000 8.0000 0.0849 YYC 1172.043408 2 1.3893 369 | 1/12
19 h-m-p 1.6000 8.0000 0.0077 CC 1172.041433 1 1.4770 397 | 1/12
20 h-m-p 1.6000 8.0000 0.0057 YC 1172.041344 1 1.0025 424 | 1/12
21 h-m-p 1.6000 8.0000 0.0016 Y 1172.041339 0 0.8735 450 | 1/12
22 h-m-p 1.6000 8.0000 0.0002 Y 1172.041339 0 0.8806 476 | 1/12
23 h-m-p 1.6000 8.0000 0.0000 Y 1172.041339 0 0.8639 502 | 1/12
24 h-m-p 1.6000 8.0000 0.0000 C 1172.041339 0 1.3670 528 | 1/12
25 h-m-p 1.6000 8.0000 0.0000 --C 1172.041339 0 0.0312 556 | 1/12
26 h-m-p 0.0264 8.0000 0.0000 -------------.. | 1/12
27 h-m-p 0.0160 8.0000 0.0001 ------------- | 1/12
28 h-m-p 0.0160 8.0000 0.0001 -------------
Out..
lnL = -1172.041339
668 lfun, 7348 eigenQcodon, 60120 P(t)
Time used: 0:41
Model 8: beta&w>1
TREE # 1
(1, ((4, 5), 6), (2, 3)); MP score: 110
initial w for M8:NSbetaw>1 reset.
0.056419 0.069553 0.000000 0.100777 0.072305 0.433705 0.027669 0.017475 0.002894 2.925828 0.900000 0.523761 1.873198 2.941449
ntime & nrate & np: 9 2 14
Bounds (np=14):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 6.169027
np = 14
lnL0 = -1213.109413
Iterating by ming2
Initial: fx= 1213.109413
x= 0.05642 0.06955 0.00000 0.10078 0.07231 0.43371 0.02767 0.01747 0.00289 2.92583 0.90000 0.52376 1.87320 2.94145
1 h-m-p 0.0000 0.0000 289.3413 ++ 1211.120940 m 0.0000 33 | 1/14
2 h-m-p 0.0000 0.0000 5871.9927 ++ 1193.833912 m 0.0000 64 | 2/14
3 h-m-p 0.0003 0.0017 79.8851 +YYCCCC 1190.507520 5 0.0011 103 | 2/14
4 h-m-p 0.0004 0.0020 182.1089 +YYCCCC 1181.220834 5 0.0015 141 | 2/14
5 h-m-p 0.0001 0.0003 754.1879 CYCCC 1179.264445 4 0.0001 177 | 2/14
6 h-m-p 0.0001 0.0007 201.2898 YCCCC 1178.540411 4 0.0002 213 | 2/14
7 h-m-p 0.0023 0.0405 13.3769 YCCC 1178.189807 3 0.0039 247 | 1/14
8 h-m-p 0.0011 0.0174 48.6868 CYC 1178.037347 2 0.0003 279 | 1/14
9 h-m-p 0.0003 0.0053 47.7740 +CCCC 1177.569880 3 0.0018 316 | 1/14
10 h-m-p 0.0070 0.0349 8.6824 YYCC 1177.406518 3 0.0050 350 | 1/14
11 h-m-p 0.0018 0.0102 23.7668 ++ 1176.056567 m 0.0102 380 | 2/14
12 h-m-p 0.0865 0.6782 2.8068 +YCCC 1174.606145 3 0.2492 416 | 2/14
13 h-m-p 0.0453 0.2267 5.1159 +YCCC 1173.152895 3 0.1455 451 | 2/14
14 h-m-p 0.3457 1.7285 0.4925 YCCC 1172.748059 3 0.8552 485 | 2/14
15 h-m-p 1.6000 8.0000 0.1486 YC 1172.690620 1 0.7915 515 | 2/14
16 h-m-p 0.4862 7.6941 0.2419 +YYYC 1172.562433 3 1.7109 548 | 1/14
17 h-m-p 0.0027 0.0134 108.5189 CYC 1172.554541 2 0.0007 580 | 1/14
18 h-m-p 0.1789 0.8944 0.4261 ++ 1172.416213 m 0.8944 610 | 2/14
19 h-m-p 0.3202 1.6010 0.2821 ++ 1172.164997 m 1.6010 640 | 3/14
20 h-m-p 0.2687 1.3435 0.9925 YYYCCCC 1172.113703 6 0.2776 678 | 3/14
21 h-m-p 0.4115 2.0573 0.2669 YYCC 1172.048167 3 0.3289 710 | 3/14
22 h-m-p 1.6000 8.0000 0.0461 YC 1172.042812 1 0.7520 739 | 3/14
23 h-m-p 1.6000 8.0000 0.0133 YC 1172.041880 1 1.0272 768 | 3/14
24 h-m-p 1.6000 8.0000 0.0036 YC 1172.041571 1 1.0695 797 | 3/14
25 h-m-p 0.6751 8.0000 0.0056 C 1172.041484 0 0.9028 825 | 3/14
26 h-m-p 1.6000 8.0000 0.0027 Y 1172.041470 0 0.9287 853 | 3/14
27 h-m-p 1.6000 8.0000 0.0007 Y 1172.041468 0 1.0278 881 | 3/14
28 h-m-p 1.6000 8.0000 0.0002 Y 1172.041468 0 0.7553 909 | 3/14
29 h-m-p 1.6000 8.0000 0.0000 Y 1172.041468 0 0.8440 937 | 3/14
30 h-m-p 1.6000 8.0000 0.0000 Y 1172.041468 0 0.7436 965 | 3/14
31 h-m-p 1.6000 8.0000 0.0000 C 1172.041468 0 0.5548 993 | 3/14
32 h-m-p 1.1524 8.0000 0.0000 ---------Y 1172.041468 0 0.0000 1030
Out..
lnL = -1172.041468
1031 lfun, 12372 eigenQcodon, 102069 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1190.349208 S = -1143.192848 -38.887274
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 119 patterns 1:15
did 20 / 119 patterns 1:16
did 30 / 119 patterns 1:16
did 40 / 119 patterns 1:16
did 50 / 119 patterns 1:16
did 60 / 119 patterns 1:16
did 70 / 119 patterns 1:16
did 80 / 119 patterns 1:17
did 90 / 119 patterns 1:17
did 100 / 119 patterns 1:17
did 110 / 119 patterns 1:17
did 119 / 119 patterns 1:17
Time used: 1:17
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=178
D_melanogaster_Alg-2-PC MAYNHDGMPDQQFLWDVFQRVDKDRSGHISADELQVALSNGTWSAFNPET
D_sechellia_Alg-2-PC MAYNHDGMPDQQFLWDVFQRVDKDKSGHISADELQVALSNGTWSAFNPET
D_simulans_Alg-2-PC MAYNHDGMPDQQFLWDVFQRVDKDRSGHISADELQVALSNGTWSAFNPET
D_yakuba_Alg-2-PC MAYNYSGMPDQQFLWDVFQRVDKDSSGHISADELQVALSNGTWSAFNPET
D_erecta_Alg-2-PC MAYNHDGMPDQQFLWDVFQRVDKDRSGHISADELQVALSNGTWSAFNPET
D_takahashii_Alg-2-PC MTFQNDGMPDQQFLWDVFQRVDKDRSGHISADELQVALSNGTWSAFNPET
*::: .****************** *************************
D_melanogaster_Alg-2-PC IRLMIGMFDRENKGTVSFKDFGALWKYVTDWQNCFRSFDRDNSGNIDKTE
D_sechellia_Alg-2-PC IRLMIGMFDRENKGTVSFKDFGALWKYVTDWQNCFRSFDCDNSGNIDKTE
D_simulans_Alg-2-PC IRLMIGMFDRENKGTVSFKDFGALWKYVTDWQNCFRSFDRDNSGNIDKTE
D_yakuba_Alg-2-PC IRLMIGMFDRENRGTVSFQDFGALWKYVTDWQNCFRSFDRDNSGNIDKTE
D_erecta_Alg-2-PC IRLMIGMFDRENRGTVSFQDFGALWKYVTDWQNCFRSFDRDNSGNIDKAE
D_takahashii_Alg-2-PC IRLMIGMFDRENTGTVSFQDFGALWKYVTDWQNCFRSFDRDSSGNIDKTE
************ *****:******************** *.******:*
D_melanogaster_Alg-2-PC LKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
D_sechellia_Alg-2-PC LKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
D_simulans_Alg-2-PC LKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
D_yakuba_Alg-2-PC LKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
D_erecta_Alg-2-PC LKTALTSFGYRLSDHLIDILLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
D_takahashii_Alg-2-PC LKTALTSFGYRLSDHLINVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA
*****************::*******************************
D_melanogaster_Alg-2-PC FRQHDTDLDGIITIHYEQFLSMVFSLKI
D_sechellia_Alg-2-PC FRQHDTDMDGIITIHYEQFLSMVFSLKI
D_simulans_Alg-2-PC FRQHDTDMDGIITIHYEQFLSMVFSLKI
D_yakuba_Alg-2-PC FRQHDTDMDGIITIHYEQFLSMVFSLKI
D_erecta_Alg-2-PC FRQHDTDMDGVITIHYEQFLSMVFSLKI
D_takahashii_Alg-2-PC FRQHDTDMDGIITIHYEQFLSMVFSLKI
*******:**:*****************
>D_melanogaster_Alg-2-PC ATGGCCTACAATCATGATGGTATGCCAGACCAGCAATTTCTTTGGGATGT TTTTCAAAGAGTGGATAAAGATAGGAGTGGTCATATATCCGCAGATGAGC TACAAGTGGCCCTTTCGAATGGTACCTGGTCTGCATTTAATCCGGAGACT ATCCGTTTGATGATTGGAATGTTTGATCGTGAAAATAAAGGGACTGTGTC CTTTAAAGATTTTGGAGCGTTGTGGAAGTATGTGACGGATTGGCAAAATT GTTTTCGATCCTTTGATCGTGACAATTCTGGAAATATTGACAAAACTGAG CTGAAAACAGCACTGACATCATTTGGTTATCGTTTATCTGACCACCTAAT CGACGTCTTACTACGAAAATTTGACCGCTTTGGGCGTGGTACAATTCTTT TCGATGATTTTATTCAATGTTGTATTGTGCTGTATACATTAACAACTGCA TTCCGCCAGCACGACACTGACTTGGATGGGATCATAACCATACATTACGA ACAGTTCTTAAGTATGGTATTTTCGTTAAAAATA >D_sechellia_Alg-2-PC ATGGCCTACAACCATGATGGTATGCCAGATCAGCAATTTCTTTGGGACGT TTTTCAAAGAGTGGATAAAGATAAGAGTGGTCATATATCCGCAGATGAGC TACAAGTGGCCCTTTCGAATGGTACCTGGTCTGCATTTAATCCGGAAACT ATCCGTTTGATGATTGGAATGTTTGATCGTGAAAATAAAGGGACTGTGTC CTTTAAAGATTTTGGAGCGTTGTGGAAGTATGTGACGGATTGGCAAAATT GTTTTCGATCCTTTGATTGTGACAATTCTGGAAACATTGACAAAACTGAG CTGAAAACAGCATTGACATCATTTGGTTATCGCTTATCTGACCACCTAAT CGACGTTTTACTTCGGAAATTTGACCGCTTTGGACGTGGTACAATTCTTT TCGATGATTTTATTCAATGTTGTATTGTGCTATATACGTTAACAACTGCA TTCCGGCAGCACGACACTGACATGGATGGGATCATAACCATACATTACGA ACAGTTCTTAAGTATGGTATTTTCGTTAAAAATA >D_simulans_Alg-2-PC ATGGCCTACAACCATGATGGTATGCCAGATCAGCAATTTCTTTGGGACGT TTTTCAAAGAGTGGATAAAGATAGGAGTGGTCATATATCCGCAGATGAGC TACAAGTGGCCCTTTCGAATGGTACCTGGTCTGCATTTAATCCGGAAACT ATCCGTTTGATGATTGGAATGTTTGATCGTGAAAATAAAGGGACTGTGTC CTTTAAAGATTTTGGAGCGTTGTGGAAGTATGTGACGGATTGGCAAAATT GTTTTCGATCCTTTGATCGTGACAATTCTGGAAACATTGACAAAACTGAG CTGAAAACAGCATTGACATCATTTGGTTATCGCTTATCTGACCACCTAAT CGACGTTTTACTTCGAAAATTTGACCGCTTTGGACGTGGTACAATTCTTT TCGATGATTTTATTCAATGTTGTATTGTGCTATATACGTTAACAACTGCA TTCCGGCAGCACGACACTGACATGGATGGGATCATAACCATACATTACGA ACAGTTCTTAAGTATGGTATTTTCGTTAAAAATA >D_yakuba_Alg-2-PC ATGGCGTACAATTATAGTGGAATGCCAGATCAACAATTTCTTTGGGATGT TTTTCAAAGAGTGGACAAAGATAGCAGTGGTCATATATCGGCAGATGAGC TACAAGTGGCCCTTTCGAATGGTACATGGTCTGCATTTAATCCGGAAACT ATCCGTTTGATGATTGGAATGTTTGATCGTGAAAATAGAGGGACTGTGTC CTTTCAAGATTTTGGAGCTTTGTGGAAGTATGTGACGGATTGGCAAAACT GTTTTCGTTCCTTTGATCGAGACAACTCTGGAAACATTGACAAAACTGAA CTGAAAACAGCACTGACATCATTTGGTTATCGTTTATCTGACCATCTAAT CGACGTTTTACTTCGAAAATTTGATCGCTTTGGACGTGGTACAATCCTTT TTGATGATTTTATTCAATGTTGTATTGTACTATACACGTTAACAACTGCG TTCCGCCAGCACGACACTGACATGGATGGGATCATAACCATACATTACGA ACAGTTTTTAAGTATGGTATTTTCGTTAAAAATA >D_erecta_Alg-2-PC ATGGCCTACAACCATGATGGAATGCCAGATCAGCAATTTCTTTGGGATGT TTTTCAAAGAGTGGACAAAGATAGGAGTGGTCATATATCTGCAGATGAGC TACAAGTGGCCCTTTCAAATGGTACATGGTCTGCATTTAATCCGGAAACT ATCCGTTTGATGATTGGAATGTTTGATCGTGAAAATAGAGGGACCGTGTC CTTTCAAGATTTTGGAGCTTTGTGGAAGTATGTGACGGATTGGCAAAATT GTTTTCGATCCTTTGATCGTGACAACTCTGGAAACATTGACAAAGCTGAG TTGAAAACAGCACTTACATCATTTGGTTATCGTTTATCTGACCACCTAAT CGACATTTTACTTCGAAAGTTTGACCGCTTTGGACGTGGTACAATTCTTT TTGATGATTTTATTCAGTGTTGTATTGTACTCTATACGTTAACAACTGCA TTCCGCCAGCACGACACTGACATGGATGGGGTCATAACCATACATTATGA ACAGTTTTTAAGTATGGTATTTTCGTTAAAAATA >D_takahashii_Alg-2-PC ATGACCTTTCAGAATGACGGAATGCCAGATCAACAATTTTTGTGGGATGT TTTTCAAAGAGTGGACAAAGACAGGAGTGGTCATATTTCCGCTGATGAGC TACAAGTGGCCCTTTCGAATGGTACATGGTCTGCATTTAATCCCGAAACG ATCCGTTTGATGATTGGAATGTTTGATCGCGAAAATACAGGCACCGTATC CTTCCAAGACTTCGGAGCATTATGGAAATACGTGACGGATTGGCAAAATT GCTTTCGATCATTCGATCGCGATAGTTCTGGAAACATTGACAAAACTGAG TTGAAGACAGCGCTGACATCATTTGGGTATCGTTTATCCGACCATTTAAT TAACGTTTTGCTACGCAAGTTTGATCGTTTTGGACGTGGTACAATCCTGT TCGATGATTTTATTCAATGTTGCATTGTGCTATATACTTTAACAACTGCA TTCCGACAGCACGACACTGATATGGATGGGATCATAACCATACATTATGA ACAATTTTTAAGTATGGTTTTTTCATTAAAAATA
>D_melanogaster_Alg-2-PC MAYNHDGMPDQQFLWDVFQRVDKDRSGHISADELQVALSNGTWSAFNPET IRLMIGMFDRENKGTVSFKDFGALWKYVTDWQNCFRSFDRDNSGNIDKTE LKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA FRQHDTDLDGIITIHYEQFLSMVFSLKI >D_sechellia_Alg-2-PC MAYNHDGMPDQQFLWDVFQRVDKDKSGHISADELQVALSNGTWSAFNPET IRLMIGMFDRENKGTVSFKDFGALWKYVTDWQNCFRSFDCDNSGNIDKTE LKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA FRQHDTDMDGIITIHYEQFLSMVFSLKI >D_simulans_Alg-2-PC MAYNHDGMPDQQFLWDVFQRVDKDRSGHISADELQVALSNGTWSAFNPET IRLMIGMFDRENKGTVSFKDFGALWKYVTDWQNCFRSFDRDNSGNIDKTE LKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA FRQHDTDMDGIITIHYEQFLSMVFSLKI >D_yakuba_Alg-2-PC MAYNYSGMPDQQFLWDVFQRVDKDSSGHISADELQVALSNGTWSAFNPET IRLMIGMFDRENRGTVSFQDFGALWKYVTDWQNCFRSFDRDNSGNIDKTE LKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA FRQHDTDMDGIITIHYEQFLSMVFSLKI >D_erecta_Alg-2-PC MAYNHDGMPDQQFLWDVFQRVDKDRSGHISADELQVALSNGTWSAFNPET IRLMIGMFDRENRGTVSFQDFGALWKYVTDWQNCFRSFDRDNSGNIDKAE LKTALTSFGYRLSDHLIDILLRKFDRFGRGTILFDDFIQCCIVLYTLTTA FRQHDTDMDGVITIHYEQFLSMVFSLKI >D_takahashii_Alg-2-PC MTFQNDGMPDQQFLWDVFQRVDKDRSGHISADELQVALSNGTWSAFNPET IRLMIGMFDRENTGTVSFQDFGALWKYVTDWQNCFRSFDRDSSGNIDKTE LKTALTSFGYRLSDHLINVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTA FRQHDTDMDGIITIHYEQFLSMVFSLKI
#NEXUS
[ID: 9304711243]
begin taxa;
dimensions ntax=6;
taxlabels
D_melanogaster_Alg-2-PC
D_sechellia_Alg-2-PC
D_simulans_Alg-2-PC
D_yakuba_Alg-2-PC
D_erecta_Alg-2-PC
D_takahashii_Alg-2-PC
;
end;
begin trees;
translate
1 D_melanogaster_Alg-2-PC,
2 D_sechellia_Alg-2-PC,
3 D_simulans_Alg-2-PC,
4 D_yakuba_Alg-2-PC,
5 D_erecta_Alg-2-PC,
6 D_takahashii_Alg-2-PC
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.03473178,((4:0.06285739,5:0.03727264)0.607:0.01790067,6:0.3839438)0.944:0.03480702,(2:0.009799224,3:0.002009602)0.934:0.01078082);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.03473178,((4:0.06285739,5:0.03727264):0.01790067,6:0.3839438):0.03480702,(2:0.009799224,3:0.002009602):0.01078082);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/7/Alg-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/7/Alg-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/7/Alg-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1243.45 -1253.18
2 -1243.74 -1258.65
--------------------------------------
TOTAL -1243.59 -1257.96
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/7/Alg-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/7/Alg-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/7/Alg-2-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.615231 0.012892 0.408317 0.841728 0.604583 1356.39 1384.61 1.000
r(A<->C){all} 0.043336 0.000627 0.000310 0.091831 0.039286 830.48 845.41 1.000
r(A<->G){all} 0.270607 0.004223 0.148932 0.398514 0.266191 467.13 746.26 1.001
r(A<->T){all} 0.043400 0.000347 0.012888 0.082716 0.040954 722.99 870.52 1.001
r(C<->G){all} 0.084503 0.001450 0.015533 0.157855 0.080820 800.06 810.26 1.000
r(C<->T){all} 0.520530 0.005577 0.377215 0.664500 0.520673 452.96 708.14 1.000
r(G<->T){all} 0.037624 0.000495 0.000064 0.077993 0.034095 784.56 895.16 1.000
pi(A){all} 0.288147 0.000334 0.252354 0.324943 0.287981 1365.12 1377.64 1.000
pi(C){all} 0.181552 0.000236 0.151278 0.211208 0.181175 1248.24 1316.58 1.000
pi(G){all} 0.213868 0.000275 0.184128 0.247905 0.213722 1115.31 1258.33 1.000
pi(T){all} 0.316434 0.000355 0.278722 0.352112 0.316362 1127.60 1227.03 1.000
alpha{1,2} 0.059305 0.001297 0.000123 0.119659 0.058981 1054.12 1107.56 1.000
alpha{3} 2.134053 0.623356 0.895858 3.731421 2.008896 1219.85 1360.42 1.000
pinvar{all} 0.383823 0.006769 0.219542 0.536139 0.390131 1230.08 1339.94 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/7/Alg-2-PC/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 178
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 13 13 13 15 15 12 | Ser TCT 3 3 3 3 4 2 | Tyr TAT 3 3 3 3 4 3 | Cys TGT 3 4 3 3 3 1
TTC 3 3 3 1 1 5 | TCC 3 3 3 2 2 3 | TAC 2 2 2 3 1 1 | TGC 0 0 0 0 0 2
Leu TTA 5 5 5 5 5 6 | TCA 1 1 1 1 2 3 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 2 3 4 | TCG 2 2 2 3 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 3 4 4 4 5 1 | Pro CCT 0 0 0 0 0 0 | His CAT 3 3 3 3 3 3 | Arg CGT 5 3 4 5 5 4
CTC 0 0 0 0 1 0 | CCC 0 0 0 0 0 1 | CAC 2 2 2 1 2 1 | CGC 2 2 2 2 2 3
CTA 3 3 3 3 2 3 | CCA 1 1 1 1 1 1 | Gln CAA 5 5 5 7 5 8 | CGA 2 1 2 2 2 2
CTG 3 1 1 2 0 2 | CCG 1 1 1 1 1 0 | CAG 3 3 3 2 4 2 | CGG 0 2 1 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 5 5 5 4 6 6 | Thr ACT 5 5 5 5 3 4 | Asn AAT 7 5 5 4 4 5 | Ser AGT 2 2 2 3 2 3
ATC 3 3 3 4 2 3 | ACC 2 2 2 1 2 3 | AAC 0 2 2 3 3 2 | AGC 0 0 0 1 0 0
ATA 4 4 4 4 4 3 | ACA 5 4 4 5 5 6 | Lys AAA 7 7 7 5 4 4 | Arg AGA 1 1 1 2 2 1
Met ATG 5 6 6 6 6 6 | ACG 1 2 2 2 2 2 | AAG 1 2 1 1 2 2 | AGG 1 0 1 0 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 2 2 2 1 3 | Ala GCT 0 0 0 1 2 1 | Asp GAT 12 12 12 12 12 12 | Gly GGT 5 5 5 4 4 3
GTC 1 0 0 0 1 0 | GCC 2 2 2 1 2 1 | GAC 8 8 8 7 8 7 | GGC 0 0 0 0 0 1
GTA 1 1 1 2 2 1 | GCA 4 4 4 3 4 3 | Glu GAA 2 3 3 4 3 3 | GGA 3 4 4 5 5 5
GTG 5 5 5 4 4 4 | GCG 1 1 1 2 0 1 | GAG 3 2 2 1 2 2 | GGG 3 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_Alg-2-PC
position 1: T:0.25281 C:0.18539 A:0.27528 G:0.28652
position 2: T:0.32584 C:0.17416 A:0.32584 G:0.17416
position 3: T:0.39326 C:0.15730 A:0.24719 G:0.20225
Average T:0.32397 C:0.17228 A:0.28277 G:0.22097
#2: D_sechellia_Alg-2-PC
position 1: T:0.25843 C:0.17416 A:0.28090 G:0.28652
position 2: T:0.32584 C:0.17416 A:0.33146 G:0.16854
position 3: T:0.38764 C:0.16292 A:0.24719 G:0.20225
Average T:0.32397 C:0.17041 A:0.28652 G:0.21910
#3: D_simulans_Alg-2-PC
position 1: T:0.25281 C:0.17978 A:0.28090 G:0.28652
position 2: T:0.32584 C:0.17416 A:0.32584 G:0.17416
position 3: T:0.38764 C:0.16292 A:0.25281 G:0.19663
Average T:0.32210 C:0.17228 A:0.28652 G:0.21910
#4: D_yakuba_Alg-2-PC
position 1: T:0.25281 C:0.18539 A:0.28090 G:0.28090
position 2: T:0.32584 C:0.17416 A:0.31461 G:0.18539
position 3: T:0.39888 C:0.14607 A:0.27528 G:0.17978
Average T:0.32584 C:0.16854 A:0.29026 G:0.21536
#5: D_erecta_Alg-2-PC
position 1: T:0.25281 C:0.18539 A:0.26966 G:0.29213
position 2: T:0.32584 C:0.17416 A:0.32022 G:0.17978
position 3: T:0.41011 C:0.15169 A:0.25843 G:0.17978
Average T:0.32959 C:0.17041 A:0.28277 G:0.21723
#6: D_takahashii_Alg-2-PC
position 1: T:0.26404 C:0.17416 A:0.28652 G:0.27528
position 2: T:0.33146 C:0.17978 A:0.30899 G:0.17978
position 3: T:0.35393 C:0.18539 A:0.27528 G:0.18539
Average T:0.31648 C:0.17978 A:0.29026 G:0.21348
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 81 | Ser S TCT 18 | Tyr Y TAT 19 | Cys C TGT 17
TTC 16 | TCC 16 | TAC 11 | TGC 2
Leu L TTA 31 | TCA 9 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 11 | TAG 0 | Trp W TGG 24
------------------------------------------------------------------------------
Leu L CTT 21 | Pro P CCT 0 | His H CAT 18 | Arg R CGT 26
CTC 1 | CCC 1 | CAC 10 | CGC 13
CTA 17 | CCA 6 | Gln Q CAA 35 | CGA 11
CTG 9 | CCG 5 | CAG 17 | CGG 3
------------------------------------------------------------------------------
Ile I ATT 31 | Thr T ACT 27 | Asn N AAT 30 | Ser S AGT 14
ATC 18 | ACC 12 | AAC 12 | AGC 1
ATA 23 | ACA 29 | Lys K AAA 34 | Arg R AGA 8
Met M ATG 35 | ACG 11 | AAG 9 | AGG 4
------------------------------------------------------------------------------
Val V GTT 11 | Ala A GCT 4 | Asp D GAT 72 | Gly G GGT 26
GTC 2 | GCC 10 | GAC 46 | GGC 1
GTA 8 | GCA 22 | Glu E GAA 18 | GGA 26
GTG 27 | GCG 6 | GAG 12 | GGG 13
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.25562 C:0.18071 A:0.27903 G:0.28464
position 2: T:0.32678 C:0.17509 A:0.32116 G:0.17697
position 3: T:0.38858 C:0.16105 A:0.25936 G:0.19101
Average T:0.32366 C:0.17228 A:0.28652 G:0.21754
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_Alg-2-PC
D_sechellia_Alg-2-PC 0.0543 (0.0072 0.1325)
D_simulans_Alg-2-PC 0.0197 (0.0024 0.1217) 0.5450 (0.0048 0.0088)
D_yakuba_Alg-2-PC 0.0582 (0.0169 0.2912) 0.0718 (0.0193 0.2694) 0.0566 (0.0145 0.2558)
D_erecta_Alg-2-PC 0.0567 (0.0145 0.2555) 0.0916 (0.0193 0.2107) 0.0729 (0.0145 0.1983) 0.0808 (0.0169 0.2091)
D_takahashii_Alg-2-PC 0.0325 (0.0268 0.8250) 0.0370 (0.0292 0.7885) 0.0310 (0.0243 0.7827) 0.0387 (0.0292 0.7552) 0.0408 (0.0292 0.7150)
Model 0: one-ratio
TREE # 1: (1, ((4, 5), 6), (2, 3)); MP score: 110
lnL(ntime: 9 np: 11): -1178.199548 +0.000000
7..1 7..8 8..9 9..4 9..5 8..6 7..10 10..2 10..3
0.062403 0.057996 0.011376 0.117794 0.079850 0.475837 0.024828 0.017941 0.000004 2.864413 0.049714
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.84803
(1: 0.062403, ((4: 0.117794, 5: 0.079850): 0.011376, 6: 0.475837): 0.057996, (2: 0.017941, 3: 0.000004): 0.024828);
(D_melanogaster_Alg-2-PC: 0.062403, ((D_yakuba_Alg-2-PC: 0.117794, D_erecta_Alg-2-PC: 0.079850): 0.011376, D_takahashii_Alg-2-PC: 0.475837): 0.057996, (D_sechellia_Alg-2-PC: 0.017941, D_simulans_Alg-2-PC: 0.000004): 0.024828);
Detailed output identifying parameters
kappa (ts/tv) = 2.86441
omega (dN/dS) = 0.04971
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.062 404.5 129.5 0.0497 0.0037 0.0743 1.5 9.6
7..8 0.058 404.5 129.5 0.0497 0.0034 0.0690 1.4 8.9
8..9 0.011 404.5 129.5 0.0497 0.0007 0.0135 0.3 1.8
9..4 0.118 404.5 129.5 0.0497 0.0070 0.1402 2.8 18.1
9..5 0.080 404.5 129.5 0.0497 0.0047 0.0950 1.9 12.3
8..6 0.476 404.5 129.5 0.0497 0.0282 0.5663 11.4 73.3
7..10 0.025 404.5 129.5 0.0497 0.0015 0.0295 0.6 3.8
10..2 0.018 404.5 129.5 0.0497 0.0011 0.0214 0.4 2.8
10..3 0.000 404.5 129.5 0.0497 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0502
tree length for dS: 1.0092
Time used: 0:03
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, ((4, 5), 6), (2, 3)); MP score: 110
lnL(ntime: 9 np: 12): -1173.497185 +0.000000
7..1 7..8 8..9 9..4 9..5 8..6 7..10 10..2 10..3
0.062537 0.057936 0.011859 0.118223 0.080426 0.498686 0.024521 0.017858 0.000004 3.102432 0.943860 0.018924
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.87205
(1: 0.062537, ((4: 0.118223, 5: 0.080426): 0.011859, 6: 0.498686): 0.057936, (2: 0.017858, 3: 0.000004): 0.024521);
(D_melanogaster_Alg-2-PC: 0.062537, ((D_yakuba_Alg-2-PC: 0.118223, D_erecta_Alg-2-PC: 0.080426): 0.011859, D_takahashii_Alg-2-PC: 0.498686): 0.057936, (D_sechellia_Alg-2-PC: 0.017858, D_simulans_Alg-2-PC: 0.000004): 0.024521);
Detailed output identifying parameters
kappa (ts/tv) = 3.10243
dN/dS (w) for site classes (K=2)
p: 0.94386 0.05614
w: 0.01892 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.063 402.9 131.1 0.0740 0.0051 0.0692 2.1 9.1
7..8 0.058 402.9 131.1 0.0740 0.0047 0.0641 1.9 8.4
8..9 0.012 402.9 131.1 0.0740 0.0010 0.0131 0.4 1.7
9..4 0.118 402.9 131.1 0.0740 0.0097 0.1308 3.9 17.1
9..5 0.080 402.9 131.1 0.0740 0.0066 0.0890 2.7 11.7
8..6 0.499 402.9 131.1 0.0740 0.0408 0.5516 16.4 72.3
7..10 0.025 402.9 131.1 0.0740 0.0020 0.0271 0.8 3.6
10..2 0.018 402.9 131.1 0.0740 0.0015 0.0198 0.6 2.6
10..3 0.000 402.9 131.1 0.0740 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, ((4, 5), 6), (2, 3)); MP score: 110
lnL(ntime: 9 np: 14): -1173.497185 +0.000000
7..1 7..8 8..9 9..4 9..5 8..6 7..10 10..2 10..3
0.062537 0.057936 0.011859 0.118223 0.080426 0.498686 0.024521 0.017858 0.000004 3.102432 0.943860 0.025435 0.018924 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.87205
(1: 0.062537, ((4: 0.118223, 5: 0.080426): 0.011859, 6: 0.498686): 0.057936, (2: 0.017858, 3: 0.000004): 0.024521);
(D_melanogaster_Alg-2-PC: 0.062537, ((D_yakuba_Alg-2-PC: 0.118223, D_erecta_Alg-2-PC: 0.080426): 0.011859, D_takahashii_Alg-2-PC: 0.498686): 0.057936, (D_sechellia_Alg-2-PC: 0.017858, D_simulans_Alg-2-PC: 0.000004): 0.024521);
Detailed output identifying parameters
kappa (ts/tv) = 3.10243
dN/dS (w) for site classes (K=3)
p: 0.94386 0.02544 0.03070
w: 0.01892 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.063 402.9 131.1 0.0740 0.0051 0.0692 2.1 9.1
7..8 0.058 402.9 131.1 0.0740 0.0047 0.0641 1.9 8.4
8..9 0.012 402.9 131.1 0.0740 0.0010 0.0131 0.4 1.7
9..4 0.118 402.9 131.1 0.0740 0.0097 0.1308 3.9 17.1
9..5 0.080 402.9 131.1 0.0740 0.0066 0.0890 2.7 11.7
8..6 0.499 402.9 131.1 0.0740 0.0408 0.5516 16.4 72.3
7..10 0.025 402.9 131.1 0.0740 0.0020 0.0271 0.8 3.6
10..2 0.018 402.9 131.1 0.0740 0.0015 0.0198 0.6 2.6
10..3 0.000 402.9 131.1 0.0740 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Alg-2-PC)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.676 0.151 0.054 0.029 0.020 0.016 0.015 0.014 0.013 0.013
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.998
sum of density on p0-p1 = 1.000000
Time used: 0:15
Model 3: discrete (3 categories)
TREE # 1: (1, ((4, 5), 6), (2, 3)); MP score: 110
lnL(ntime: 9 np: 15): -1171.792542 +0.000000
7..1 7..8 8..9 9..4 9..5 8..6 7..10 10..2 10..3
0.062876 0.058987 0.010973 0.119268 0.080409 0.490786 0.024757 0.017946 0.000004 2.912070 0.158873 0.682350 0.000001 0.000001 0.357419
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.86601
(1: 0.062876, ((4: 0.119268, 5: 0.080409): 0.010973, 6: 0.490786): 0.058987, (2: 0.017946, 3: 0.000004): 0.024757);
(D_melanogaster_Alg-2-PC: 0.062876, ((D_yakuba_Alg-2-PC: 0.119268, D_erecta_Alg-2-PC: 0.080409): 0.010973, D_takahashii_Alg-2-PC: 0.490786): 0.058987, (D_sechellia_Alg-2-PC: 0.017946, D_simulans_Alg-2-PC: 0.000004): 0.024757);
Detailed output identifying parameters
kappa (ts/tv) = 2.91207
dN/dS (w) for site classes (K=3)
p: 0.15887 0.68235 0.15878
w: 0.00000 0.00000 0.35742
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.063 404.2 129.8 0.0568 0.0042 0.0733 1.7 9.5
7..8 0.059 404.2 129.8 0.0568 0.0039 0.0687 1.6 8.9
8..9 0.011 404.2 129.8 0.0568 0.0007 0.0128 0.3 1.7
9..4 0.119 404.2 129.8 0.0568 0.0079 0.1390 3.2 18.0
9..5 0.080 404.2 129.8 0.0568 0.0053 0.0937 2.1 12.2
8..6 0.491 404.2 129.8 0.0568 0.0325 0.5719 13.1 74.2
7..10 0.025 404.2 129.8 0.0568 0.0016 0.0289 0.7 3.7
10..2 0.018 404.2 129.8 0.0568 0.0012 0.0209 0.5 2.7
10..3 0.000 404.2 129.8 0.0568 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Time used: 0:20
Model 7: beta (10 categories)
TREE # 1: (1, ((4, 5), 6), (2, 3)); MP score: 110
check convergence..
lnL(ntime: 9 np: 12): -1172.041339 +0.000000
7..1 7..8 8..9 9..4 9..5 8..6 7..10 10..2 10..3
0.062652 0.058764 0.010926 0.118840 0.080224 0.491095 0.024650 0.017889 0.000004 2.925828 0.065629 0.990758
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.86504
(1: 0.062652, ((4: 0.118840, 5: 0.080224): 0.010926, 6: 0.491095): 0.058764, (2: 0.017889, 3: 0.000004): 0.024650);
(D_melanogaster_Alg-2-PC: 0.062652, ((D_yakuba_Alg-2-PC: 0.118840, D_erecta_Alg-2-PC: 0.080224): 0.010926, D_takahashii_Alg-2-PC: 0.491095): 0.058764, (D_sechellia_Alg-2-PC: 0.017889, D_simulans_Alg-2-PC: 0.000004): 0.024650);
Detailed output identifying parameters
kappa (ts/tv) = 2.92583
Parameters in M7 (beta):
p = 0.06563 q = 0.99076
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00001 0.00011 0.00143 0.01266 0.08522 0.46228
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.063 404.1 129.9 0.0562 0.0041 0.0731 1.7 9.5
7..8 0.059 404.1 129.9 0.0562 0.0039 0.0685 1.6 8.9
8..9 0.011 404.1 129.9 0.0562 0.0007 0.0127 0.3 1.7
9..4 0.119 404.1 129.9 0.0562 0.0078 0.1386 3.1 18.0
9..5 0.080 404.1 129.9 0.0562 0.0053 0.0936 2.1 12.2
8..6 0.491 404.1 129.9 0.0562 0.0322 0.5728 13.0 74.4
7..10 0.025 404.1 129.9 0.0562 0.0016 0.0288 0.7 3.7
10..2 0.018 404.1 129.9 0.0562 0.0012 0.0209 0.5 2.7
10..3 0.000 404.1 129.9 0.0562 0.0000 0.0000 0.0 0.0
Time used: 0:41
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, ((4, 5), 6), (2, 3)); MP score: 110
lnL(ntime: 9 np: 14): -1172.041468 +0.000000
7..1 7..8 8..9 9..4 9..5 8..6 7..10 10..2 10..3
0.062652 0.058764 0.010926 0.118840 0.080225 0.491097 0.024650 0.017889 0.000004 2.925854 0.999990 0.065626 0.990795 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.86505
(1: 0.062652, ((4: 0.118840, 5: 0.080225): 0.010926, 6: 0.491097): 0.058764, (2: 0.017889, 3: 0.000004): 0.024650);
(D_melanogaster_Alg-2-PC: 0.062652, ((D_yakuba_Alg-2-PC: 0.118840, D_erecta_Alg-2-PC: 0.080225): 0.010926, D_takahashii_Alg-2-PC: 0.491097): 0.058764, (D_sechellia_Alg-2-PC: 0.017889, D_simulans_Alg-2-PC: 0.000004): 0.024650);
Detailed output identifying parameters
kappa (ts/tv) = 2.92585
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.06563 q = 0.99080
(p1 = 0.00001) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00001 0.00011 0.00143 0.01266 0.08521 0.46224 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.063 404.1 129.9 0.0562 0.0041 0.0731 1.7 9.5
7..8 0.059 404.1 129.9 0.0562 0.0039 0.0685 1.6 8.9
8..9 0.011 404.1 129.9 0.0562 0.0007 0.0127 0.3 1.7
9..4 0.119 404.1 129.9 0.0562 0.0078 0.1386 3.1 18.0
9..5 0.080 404.1 129.9 0.0562 0.0053 0.0936 2.1 12.2
8..6 0.491 404.1 129.9 0.0562 0.0322 0.5728 13.0 74.4
7..10 0.025 404.1 129.9 0.0562 0.0016 0.0288 0.7 3.7
10..2 0.018 404.1 129.9 0.0562 0.0012 0.0209 0.5 2.7
10..3 0.000 404.1 129.9 0.0562 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Alg-2-PC)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.000 0.002 0.015 0.054 0.141 0.287 0.501
ws: 0.761 0.120 0.038 0.020 0.014 0.011 0.010 0.009 0.009 0.009
Time used: 1:17
Model 1: NearlyNeutral -1173.497185 Model 2: PositiveSelection -1173.497185 Model 0: one-ratio -1178.199548 Model 3: discrete -1171.792542 Model 7: beta -1172.041339 Model 8: beta&w>1 -1172.041468 Model 0 vs 1 9.40472600000021 Model 2 vs 1 0.0 Model 8 vs 7 2.579999995759863E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
