--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Tue Nov 29 13:39:00 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/64/CG1344-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/64/CG1344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/64/CG1344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/64/CG1344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -4783.69         -4793.78
2      -4783.51         -4792.35
--------------------------------------
TOTAL    -4783.60         -4793.30
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/64/CG1344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/64/CG1344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/64/CG1344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.250808    0.000336    0.216822    0.288058    0.250028   1342.03   1384.94    1.001
r(A<->C){all}   0.123428    0.000361    0.087090    0.161883    0.122593    985.72   1162.08    1.000
r(A<->G){all}   0.263027    0.000712    0.208498    0.314888    0.261896   1084.18   1132.28    1.002
r(A<->T){all}   0.096785    0.000267    0.066172    0.129799    0.095730   1204.00   1235.16    1.001
r(C<->G){all}   0.095878    0.000373    0.059670    0.133158    0.094397   1024.13   1148.36    1.000
r(C<->T){all}   0.329488    0.000933    0.272114    0.388984    0.329193   1024.72   1102.07    1.000
r(G<->T){all}   0.091394    0.000301    0.059480    0.125769    0.090632   1259.32   1312.55    1.000
pi(A){all}      0.297773    0.000092    0.279235    0.315691    0.297438   1272.51   1315.43    1.001
pi(C){all}      0.211934    0.000071    0.196475    0.229431    0.211918   1227.81   1364.40    1.000
pi(G){all}      0.230389    0.000079    0.212989    0.247753    0.230107    984.46   1168.85    1.000
pi(T){all}      0.259904    0.000091    0.242289    0.279084    0.259959   1337.04   1338.82    1.000
alpha{1,2}      0.103134    0.005440    0.000195    0.237264    0.095163   1146.93   1179.10    1.000
alpha{3}        2.032507    0.569109    0.797998    3.522722    1.898284   1501.00   1501.00    1.002
pinvar{all}     0.098146    0.005483    0.000088    0.240080    0.085445   1471.84   1486.42    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-4555.796991
Model 2: PositiveSelection	-4555.196603
Model 0: one-ratio	-4567.151332
Model 3: discrete	-4555.196603
Model 7: beta	-4557.135745
Model 8: beta&w>1	-4555.227071


Model 0 vs 1	22.708682000000408

Model 2 vs 1	1.2007759999996779

Model 8 vs 7	3.817347999998674
>C1
MGNEGSKLKGILVEENAVETNQFWTVYNAKTPETTNDERCSQMLSVFEGK
VFVKAHVWSNGVGPIERAIKNLMVYRHPYILKYIATWEKSGRKYLATERV
RPLDEVLAQQTDIEVCLGLRTILCALIFLVEKALARHLNINTQSIYVTES
GSWRLAGFEYVWRATDVNKQLLDLAHSFIDLTIHGENFEQFFFSILCEKV
LSRKGTDSCITDSTPHVHEFREYCSTHLKHQNTKLRPRLSAILLHPYFNH
EFVLIHSFLFELPLKSVHERHKFFRSLIDRLRYFDEEVVASQLACDLLSR
MVLLDPAAQEFVTPHILRTKVTDKAPASLFSPQIYVQYLMPHILKMFRLR
DAQIRLILLDYFMDYVRLLSDEQLESEILPHLQLGMNDTNDVLVGKTLRC
MADLVSILGANKVLGGDRARCFSDGRPHAAVSRDSNNPYPEPRSISPLMN
TRSFDVEDFMVSGSPLPQESNASPLSIRLSPDGGEDEKLRLNSNEKSISI
KHNIDPEKDSYISGTEHERVANIDEEGTWLDWDNTDHLQQGYQVDHAVTD
SETNSNSFAREIQTGKSLSPSYRTGKCNLSVGVNETISQTEQKVIDDLSE
LDIKVQTVIQRSEFNEFDFFKDMEPIIEIRTSTCETPEQISSRFAAAASA
VNCNELCADQGWGHDEQDDKDDIVWGVTNVSTL
>C2
MGNEGSKLKGILVEENAVETNKFWTVYNAKTPATTNDERCSQMLSVFEGK
VFVKAHVWSNGVGPIERAIKNLMVYRHPYILKYIATWEKSGRKYLATERV
RPLDEVLAQQTDIEVCLGLRTILCALIFLVEKAHARHLNINTQSIYVTES
GSWRLAGFEYVWRATDVNKQLLDLAHSFIDLSIHGENFEQFFFSILCEKV
LSRKGADSCITDSTPHVQEFREYCSTHLKHQNTKLRPRLSAILLHPYFNH
EFVLIHSFLFELPLKSVHERHKFFRSLIDRLRYFDEEVVASQLACDLLSR
MVLLDPAAQEFVTPHILRTKVTDKAPASLFSPQIYVQYLMPHILKMFRLR
DAQIRLILLDYFMDYVRLLSDEQLESEILPHLQLGMNDTNDVLVGKTLRC
MADLVSILGANKVLGGDRTRCFSDGRPHAAVSRDSTNPFPEPRSISPLMN
TRSFDVEDFMVSASPLPQESNASPLSIRLSPDGGEDEKVGLNSNEKSISI
KHNIDPERNSNISGTEHEKVTNVDEEGTWLDWDNTDHLQQGYQVDQAPTD
SETNSNALTREIQISKSLSPSYRTGVNETISQTEQKVIDDLSELDIKVQT
VIQRSELHEFDFFKDMEPTIEIRTSTCETPEQISSRFAAAASAVNCNELC
ADQGWGHDEQDKDDIVWGVTNASTLoooooooo
>C3
MGNEGSKLKGILVEENAVETNQFWTVYNAKTPATTNDERCSQMLSVFEGK
VFVKAHVWSNGVGPIERAIKNLMVYRHPYILKYIATWEKSGRKYLATERV
RPLDEVLAQQTDIEVCLGLRTILCALIFLVEKAHARHLNINTQSIYVTES
GSWRLAGFEYVWRATDVNKQLLDLAHSFIDLSIHGENFEQFFFSILCEKV
LSRKGADSCITDSTPHVQEFREYCSTHLKHQNTKLRPRLSAILLHPYFNH
EFVLIHSFLFELPLKSVHERHKFFRSLIDRLRYFDEEVVASQMACDLLSR
MVLLDPAAQEFVTPHILRTKVTDKAPASLFSPQIYVQYLMPHILKMFRLR
DAQIRLILLDYFMDYVRLLSDEQLESEILPHLQLGMNDTNDVLVGKTLRC
MADLVSILGANKVLGGDRARCFSDGRPHAAVSRDSTNPFPEPRSISPLMN
TRSFDVEDFMVSASPLPQESNASPLSIRLSPDGGEDEKVRLNSNEKSISI
KHNRDPEKNSNISGTEHEKVTNVDEEGTWLDWDNTDHLQQGYQVDQALTD
SETNSNALTREIQIGKSLSPSYRTGVNETISQTEQKVIDDLSELDIKVQT
VIQRSELNEFDFFKDMEPTIEIRTSTCETPEQISSRFAAAASAVNCNELC
ADQGWGHDEQDKDDIVWGVTNASTLoooooooo
>C4
MGTEGSKLKGIIIEENEVEINKFWTVYNAKTPTKSNDERCSQLLSVFEGK
VFVKTHVWSHGVGPIERAIKNLMVYRHPYILKYVATWEKSGRKYLATERV
RPLDVVLAKQTDTEVCLGLRTILCALIFLVEKALARHLNLNTLSIYVTES
GSWRLAGFEYVWRATDVDKELLDLAHSYIDLSIHGENFEQFFFAILCEKV
LGRKGTDSCITDSTPHVQDFREYCSTHLKHQNTKLRPRLSAILLHPYFNH
EFVLIHSFLFELPLKSVHERYQFFRSLIDRLRYFDEEVVASQLSCDLLSR
MVLLDPAAQEFVTPHILRTKITDKALASLFSPQIYVKYLMPHILKMFRLR
DAQIRLILLDYFMDYIRLLSDEQLESEILPHLQLGMKDTNEILVAKTLRC
MADLVSILGADKVLGGDRSRCFSDGRPHAAVSTDIANSFPEPRSISPLMN
TRSFDVENFMVSGSPLPQERNASPLSIRLSPDGGEDEKLRLNLNENAISI
NHNSDAEKDLRRTLTEHENRANDDEEGIWFDWDNTDQLQQDYREDQVRTD
TETKSNALTTEIQISKSLLPPYRTATFNLSVGINETISMAEQKINDDLSE
LDIKVQPVIQSSELSEFDFFKDMEPVIEIKTSTCETPQQISSRLAASASA
MNCNDLCADQGWGHDEQDKDDIQWGVRNATooo
>C5
MGTEGSKLKGIIVEENAVEINKFWTVYNAKTPTTSNDERWSQMLSVFEGK
VFPKTHIWSHGVGPIERAIKNLMVYRHPYILKYIASWEKSGRKYLATERV
RHLDEVLAQQTDIEVCLGLRTILCALIFLVEKALARHLNINTLSIYVTES
GSWRLAGFEYVWRATDVNKELLDLAHSYIDLSIHGENFEQFFFAILCEKV
LGRRGKDSCITDSTPHVQEFREYCNTHLKHQNTKLRPRLSAILLHPYFNH
EFVLIHSFLFELPLKSVQERHKFFRSLIDRLRYFDEEVVASQLASDLLSR
MVLLDPAAQEFVTPYILRTKVTDKSLASLFSPQIYVQYLIPHILKMFRLR
DAQIRLILLDYFIDYIRLLSDEQLEREILPHLQLGMNDTNDILVAKTLRC
MADLVSILGANKVLGGDRARCFSDGRPHAAVSRDIANSFPEPRSISPLMN
TRSFDVEDFMVSGSPLPQESNVSPLSIRLSPDGGEDEKVRLNSNEKSISI
NHNSDPEKDSNRSFTEHERANVDEEGIWFDWDNTDQLQQDYREDQVRTES
ETNSNALTREIQTNKSLSPSYRTATFNLSVGINETISQKEQQVNDDLSEL
DIKVQPVIQRSELSEFDFFKDMEPVIEIKTSTCETPEQISSRFAASAVNC
NDLCADQGWGHDEQDKDDIVWGVTNATTIoooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=691 

C1              MGNEGSKLKGILVEENAVETNQFWTVYNAKTPETTNDERCSQMLSVFEGK
C2              MGNEGSKLKGILVEENAVETNKFWTVYNAKTPATTNDERCSQMLSVFEGK
C3              MGNEGSKLKGILVEENAVETNQFWTVYNAKTPATTNDERCSQMLSVFEGK
C4              MGTEGSKLKGIIIEENEVEINKFWTVYNAKTPTKSNDERCSQLLSVFEGK
C5              MGTEGSKLKGIIVEENAVEINKFWTVYNAKTPTTSNDERWSQMLSVFEGK
                **.********::*** ** *:********** .:**** **:*******

C1              VFVKAHVWSNGVGPIERAIKNLMVYRHPYILKYIATWEKSGRKYLATERV
C2              VFVKAHVWSNGVGPIERAIKNLMVYRHPYILKYIATWEKSGRKYLATERV
C3              VFVKAHVWSNGVGPIERAIKNLMVYRHPYILKYIATWEKSGRKYLATERV
C4              VFVKTHVWSHGVGPIERAIKNLMVYRHPYILKYVATWEKSGRKYLATERV
C5              VFPKTHIWSHGVGPIERAIKNLMVYRHPYILKYIASWEKSGRKYLATERV
                ** *:*:**:***********************:*:**************

C1              RPLDEVLAQQTDIEVCLGLRTILCALIFLVEKALARHLNINTQSIYVTES
C2              RPLDEVLAQQTDIEVCLGLRTILCALIFLVEKAHARHLNINTQSIYVTES
C3              RPLDEVLAQQTDIEVCLGLRTILCALIFLVEKAHARHLNINTQSIYVTES
C4              RPLDVVLAKQTDTEVCLGLRTILCALIFLVEKALARHLNLNTLSIYVTES
C5              RHLDEVLAQQTDIEVCLGLRTILCALIFLVEKALARHLNINTLSIYVTES
                * ** ***:*** ******************** *****:** *******

C1              GSWRLAGFEYVWRATDVNKQLLDLAHSFIDLTIHGENFEQFFFSILCEKV
C2              GSWRLAGFEYVWRATDVNKQLLDLAHSFIDLSIHGENFEQFFFSILCEKV
C3              GSWRLAGFEYVWRATDVNKQLLDLAHSFIDLSIHGENFEQFFFSILCEKV
C4              GSWRLAGFEYVWRATDVDKELLDLAHSYIDLSIHGENFEQFFFAILCEKV
C5              GSWRLAGFEYVWRATDVNKELLDLAHSYIDLSIHGENFEQFFFAILCEKV
                *****************:*:*******:***:***********:******

C1              LSRKGTDSCITDSTPHVHEFREYCSTHLKHQNTKLRPRLSAILLHPYFNH
C2              LSRKGADSCITDSTPHVQEFREYCSTHLKHQNTKLRPRLSAILLHPYFNH
C3              LSRKGADSCITDSTPHVQEFREYCSTHLKHQNTKLRPRLSAILLHPYFNH
C4              LGRKGTDSCITDSTPHVQDFREYCSTHLKHQNTKLRPRLSAILLHPYFNH
C5              LGRRGKDSCITDSTPHVQEFREYCNTHLKHQNTKLRPRLSAILLHPYFNH
                *.*:* ***********::*****.*************************

C1              EFVLIHSFLFELPLKSVHERHKFFRSLIDRLRYFDEEVVASQLACDLLSR
C2              EFVLIHSFLFELPLKSVHERHKFFRSLIDRLRYFDEEVVASQLACDLLSR
C3              EFVLIHSFLFELPLKSVHERHKFFRSLIDRLRYFDEEVVASQMACDLLSR
C4              EFVLIHSFLFELPLKSVHERYQFFRSLIDRLRYFDEEVVASQLSCDLLSR
C5              EFVLIHSFLFELPLKSVQERHKFFRSLIDRLRYFDEEVVASQLASDLLSR
                *****************:**::********************::.*****

C1              MVLLDPAAQEFVTPHILRTKVTDKAPASLFSPQIYVQYLMPHILKMFRLR
C2              MVLLDPAAQEFVTPHILRTKVTDKAPASLFSPQIYVQYLMPHILKMFRLR
C3              MVLLDPAAQEFVTPHILRTKVTDKAPASLFSPQIYVQYLMPHILKMFRLR
C4              MVLLDPAAQEFVTPHILRTKITDKALASLFSPQIYVKYLMPHILKMFRLR
C5              MVLLDPAAQEFVTPYILRTKVTDKSLASLFSPQIYVQYLIPHILKMFRLR
                **************:*****:***: **********:**:**********

C1              DAQIRLILLDYFMDYVRLLSDEQLESEILPHLQLGMNDTNDVLVGKTLRC
C2              DAQIRLILLDYFMDYVRLLSDEQLESEILPHLQLGMNDTNDVLVGKTLRC
C3              DAQIRLILLDYFMDYVRLLSDEQLESEILPHLQLGMNDTNDVLVGKTLRC
C4              DAQIRLILLDYFMDYIRLLSDEQLESEILPHLQLGMKDTNEILVAKTLRC
C5              DAQIRLILLDYFIDYIRLLSDEQLEREILPHLQLGMNDTNDILVAKTLRC
                ************:**:********* **********:***::**.*****

C1              MADLVSILGANKVLGGDRARCFSDGRPHAAVSRDSNNPYPEPRSISPLMN
C2              MADLVSILGANKVLGGDRTRCFSDGRPHAAVSRDSTNPFPEPRSISPLMN
C3              MADLVSILGANKVLGGDRARCFSDGRPHAAVSRDSTNPFPEPRSISPLMN
C4              MADLVSILGADKVLGGDRSRCFSDGRPHAAVSTDIANSFPEPRSISPLMN
C5              MADLVSILGANKVLGGDRARCFSDGRPHAAVSRDIANSFPEPRSISPLMN
                **********:*******:************* *  *.:***********

C1              TRSFDVEDFMVSGSPLPQESNASPLSIRLSPDGGEDEKLRLNSNEKSISI
C2              TRSFDVEDFMVSASPLPQESNASPLSIRLSPDGGEDEKVGLNSNEKSISI
C3              TRSFDVEDFMVSASPLPQESNASPLSIRLSPDGGEDEKVRLNSNEKSISI
C4              TRSFDVENFMVSGSPLPQERNASPLSIRLSPDGGEDEKLRLNLNENAISI
C5              TRSFDVEDFMVSGSPLPQESNVSPLSIRLSPDGGEDEKVRLNSNEKSISI
                *******:****.****** *.****************: ** **::***

C1              KHNIDPEKDSYISGTEHERVANIDEEGTWLDWDNTDHLQQGYQVDHAVTD
C2              KHNIDPERNSNISGTEHEKVTNVDEEGTWLDWDNTDHLQQGYQVDQAPTD
C3              KHNRDPEKNSNISGTEHEKVTNVDEEGTWLDWDNTDHLQQGYQVDQALTD
C4              NHNSDAEKDLRRTLTEHENRANDDEEGIWFDWDNTDQLQQDYREDQVRTD
C5              NHNSDPEKDSNRSFTEHER-ANVDEEGIWFDWDNTDQLQQDYREDQVRTE
                :** *.*::   : ****. :* **** *:******:***.*: *:. *:

C1              SETNSNSFAREIQTGKSLSPSYRTGKCNLSVGVNETISQTEQKVIDDLSE
C2              SETNSNALTREIQISKSLSPSYRT-------GVNETISQTEQKVIDDLSE
C3              SETNSNALTREIQIGKSLSPSYRT-------GVNETISQTEQKVIDDLSE
C4              TETKSNALTTEIQISKSLLPPYRTATFNLSVGINETISMAEQKINDDLSE
C5              SETNSNALTREIQTNKSLSPSYRTATFNLSVGINETISQKEQQVNDDLSE
                :**:**::: *** .*** *.***       *:*****  **:: *****

C1              LDIKVQTVIQRSEFNEFDFFKDMEPIIEIRTSTCETPEQISSRFAAAASA
C2              LDIKVQTVIQRSELHEFDFFKDMEPTIEIRTSTCETPEQISSRFAAAASA
C3              LDIKVQTVIQRSELNEFDFFKDMEPTIEIRTSTCETPEQISSRFAAAASA
C4              LDIKVQPVIQSSELSEFDFFKDMEPVIEIKTSTCETPQQISSRLAASASA
C5              LDIKVQPVIQRSELSEFDFFKDMEPVIEIKTSTCETPEQISSRFAAS--A
                ******.*** **: ********** ***:*******:*****:**:  *

C1              VNCNELCADQGWGHDEQDDKDDIVWGVTNVSTL--------
C2              VNCNELCADQGWGHDEQD-KDDIVWGVTNASTLoooooooo
C3              VNCNELCADQGWGHDEQD-KDDIVWGVTNASTLoooooooo
C4              MNCNDLCADQGWGHDEQD-KDDIQWGVRNATooo-------
C5              VNCNDLCADQGWGHDEQD-KDDIVWGVTNATTIoooo----
                :***:************* **** *** *.:          




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  683 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  683 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14150]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [14150]--->[13964]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/64/CG1344-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.381 Mb, Max= 30.954 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MGNEGSKLKGILVEENAVETNQFWTVYNAKTPETTNDERCSQMLSVFEGK
VFVKAHVWSNGVGPIERAIKNLMVYRHPYILKYIATWEKSGRKYLATERV
RPLDEVLAQQTDIEVCLGLRTILCALIFLVEKALARHLNINTQSIYVTES
GSWRLAGFEYVWRATDVNKQLLDLAHSFIDLTIHGENFEQFFFSILCEKV
LSRKGTDSCITDSTPHVHEFREYCSTHLKHQNTKLRPRLSAILLHPYFNH
EFVLIHSFLFELPLKSVHERHKFFRSLIDRLRYFDEEVVASQLACDLLSR
MVLLDPAAQEFVTPHILRTKVTDKAPASLFSPQIYVQYLMPHILKMFRLR
DAQIRLILLDYFMDYVRLLSDEQLESEILPHLQLGMNDTNDVLVGKTLRC
MADLVSILGANKVLGGDRARCFSDGRPHAAVSRDSNNPYPEPRSISPLMN
TRSFDVEDFMVSGSPLPQESNASPLSIRLSPDGGEDEKLRLNSNEKSISI
KHNIDPEKDSYISGTEHERVANIDEEGTWLDWDNTDHLQQGYQVDHAVTD
SETNSNSFAREIQTGKSLSPSYRTGKCNLSVGVNETISQTEQKVIDDLSE
LDIKVQTVIQRSEFNEFDFFKDMEPIIEIRTSTCETPEQISSRFAAAASA
VNCNELCADQGWGHDEQDDKDDIVWGVTNVSTL--------
>C2
MGNEGSKLKGILVEENAVETNKFWTVYNAKTPATTNDERCSQMLSVFEGK
VFVKAHVWSNGVGPIERAIKNLMVYRHPYILKYIATWEKSGRKYLATERV
RPLDEVLAQQTDIEVCLGLRTILCALIFLVEKAHARHLNINTQSIYVTES
GSWRLAGFEYVWRATDVNKQLLDLAHSFIDLSIHGENFEQFFFSILCEKV
LSRKGADSCITDSTPHVQEFREYCSTHLKHQNTKLRPRLSAILLHPYFNH
EFVLIHSFLFELPLKSVHERHKFFRSLIDRLRYFDEEVVASQLACDLLSR
MVLLDPAAQEFVTPHILRTKVTDKAPASLFSPQIYVQYLMPHILKMFRLR
DAQIRLILLDYFMDYVRLLSDEQLESEILPHLQLGMNDTNDVLVGKTLRC
MADLVSILGANKVLGGDRTRCFSDGRPHAAVSRDSTNPFPEPRSISPLMN
TRSFDVEDFMVSASPLPQESNASPLSIRLSPDGGEDEKVGLNSNEKSISI
KHNIDPERNSNISGTEHEKVTNVDEEGTWLDWDNTDHLQQGYQVDQAPTD
SETNSNALTREIQISKSLSPSYRT-------GVNETISQTEQKVIDDLSE
LDIKVQTVIQRSELHEFDFFKDMEPTIEIRTSTCETPEQISSRFAAAASA
VNCNELCADQGWGHDEQD-KDDIVWGVTNASTLoooooooo
>C3
MGNEGSKLKGILVEENAVETNQFWTVYNAKTPATTNDERCSQMLSVFEGK
VFVKAHVWSNGVGPIERAIKNLMVYRHPYILKYIATWEKSGRKYLATERV
RPLDEVLAQQTDIEVCLGLRTILCALIFLVEKAHARHLNINTQSIYVTES
GSWRLAGFEYVWRATDVNKQLLDLAHSFIDLSIHGENFEQFFFSILCEKV
LSRKGADSCITDSTPHVQEFREYCSTHLKHQNTKLRPRLSAILLHPYFNH
EFVLIHSFLFELPLKSVHERHKFFRSLIDRLRYFDEEVVASQMACDLLSR
MVLLDPAAQEFVTPHILRTKVTDKAPASLFSPQIYVQYLMPHILKMFRLR
DAQIRLILLDYFMDYVRLLSDEQLESEILPHLQLGMNDTNDVLVGKTLRC
MADLVSILGANKVLGGDRARCFSDGRPHAAVSRDSTNPFPEPRSISPLMN
TRSFDVEDFMVSASPLPQESNASPLSIRLSPDGGEDEKVRLNSNEKSISI
KHNRDPEKNSNISGTEHEKVTNVDEEGTWLDWDNTDHLQQGYQVDQALTD
SETNSNALTREIQIGKSLSPSYRT-------GVNETISQTEQKVIDDLSE
LDIKVQTVIQRSELNEFDFFKDMEPTIEIRTSTCETPEQISSRFAAAASA
VNCNELCADQGWGHDEQD-KDDIVWGVTNASTLoooooooo
>C4
MGTEGSKLKGIIIEENEVEINKFWTVYNAKTPTKSNDERCSQLLSVFEGK
VFVKTHVWSHGVGPIERAIKNLMVYRHPYILKYVATWEKSGRKYLATERV
RPLDVVLAKQTDTEVCLGLRTILCALIFLVEKALARHLNLNTLSIYVTES
GSWRLAGFEYVWRATDVDKELLDLAHSYIDLSIHGENFEQFFFAILCEKV
LGRKGTDSCITDSTPHVQDFREYCSTHLKHQNTKLRPRLSAILLHPYFNH
EFVLIHSFLFELPLKSVHERYQFFRSLIDRLRYFDEEVVASQLSCDLLSR
MVLLDPAAQEFVTPHILRTKITDKALASLFSPQIYVKYLMPHILKMFRLR
DAQIRLILLDYFMDYIRLLSDEQLESEILPHLQLGMKDTNEILVAKTLRC
MADLVSILGADKVLGGDRSRCFSDGRPHAAVSTDIANSFPEPRSISPLMN
TRSFDVENFMVSGSPLPQERNASPLSIRLSPDGGEDEKLRLNLNENAISI
NHNSDAEKDLRRTLTEHENRANDDEEGIWFDWDNTDQLQQDYREDQVRTD
TETKSNALTTEIQISKSLLPPYRTATFNLSVGINETISMAEQKINDDLSE
LDIKVQPVIQSSELSEFDFFKDMEPVIEIKTSTCETPQQISSRLAASASA
MNCNDLCADQGWGHDEQD-KDDIQWGVRNATooo-------
>C5
MGTEGSKLKGIIVEENAVEINKFWTVYNAKTPTTSNDERWSQMLSVFEGK
VFPKTHIWSHGVGPIERAIKNLMVYRHPYILKYIASWEKSGRKYLATERV
RHLDEVLAQQTDIEVCLGLRTILCALIFLVEKALARHLNINTLSIYVTES
GSWRLAGFEYVWRATDVNKELLDLAHSYIDLSIHGENFEQFFFAILCEKV
LGRRGKDSCITDSTPHVQEFREYCNTHLKHQNTKLRPRLSAILLHPYFNH
EFVLIHSFLFELPLKSVQERHKFFRSLIDRLRYFDEEVVASQLASDLLSR
MVLLDPAAQEFVTPYILRTKVTDKSLASLFSPQIYVQYLIPHILKMFRLR
DAQIRLILLDYFIDYIRLLSDEQLEREILPHLQLGMNDTNDILVAKTLRC
MADLVSILGANKVLGGDRARCFSDGRPHAAVSRDIANSFPEPRSISPLMN
TRSFDVEDFMVSGSPLPQESNVSPLSIRLSPDGGEDEKVRLNSNEKSISI
NHNSDPEKDSNRSFTEHER-ANVDEEGIWFDWDNTDQLQQDYREDQVRTE
SETNSNALTREIQTNKSLSPSYRTATFNLSVGINETISQKEQQVNDDLSE
LDIKVQPVIQRSELSEFDFFKDMEPVIEIKTSTCETPEQISSRFAAS--A
VNCNDLCADQGWGHDEQD-KDDIVWGVTNATTIoooo----

FORMAT of file /tmp/tmp8144273725244847591aln Not Supported[FATAL:T-COFFEE]
>C1
MGNEGSKLKGILVEENAVETNQFWTVYNAKTPETTNDERCSQMLSVFEGK
VFVKAHVWSNGVGPIERAIKNLMVYRHPYILKYIATWEKSGRKYLATERV
RPLDEVLAQQTDIEVCLGLRTILCALIFLVEKALARHLNINTQSIYVTES
GSWRLAGFEYVWRATDVNKQLLDLAHSFIDLTIHGENFEQFFFSILCEKV
LSRKGTDSCITDSTPHVHEFREYCSTHLKHQNTKLRPRLSAILLHPYFNH
EFVLIHSFLFELPLKSVHERHKFFRSLIDRLRYFDEEVVASQLACDLLSR
MVLLDPAAQEFVTPHILRTKVTDKAPASLFSPQIYVQYLMPHILKMFRLR
DAQIRLILLDYFMDYVRLLSDEQLESEILPHLQLGMNDTNDVLVGKTLRC
MADLVSILGANKVLGGDRARCFSDGRPHAAVSRDSNNPYPEPRSISPLMN
TRSFDVEDFMVSGSPLPQESNASPLSIRLSPDGGEDEKLRLNSNEKSISI
KHNIDPEKDSYISGTEHERVANIDEEGTWLDWDNTDHLQQGYQVDHAVTD
SETNSNSFAREIQTGKSLSPSYRTGKCNLSVGVNETISQTEQKVIDDLSE
LDIKVQTVIQRSEFNEFDFFKDMEPIIEIRTSTCETPEQISSRFAAAASA
VNCNELCADQGWGHDEQDDKDDIVWGVTNVSTL--------
>C2
MGNEGSKLKGILVEENAVETNKFWTVYNAKTPATTNDERCSQMLSVFEGK
VFVKAHVWSNGVGPIERAIKNLMVYRHPYILKYIATWEKSGRKYLATERV
RPLDEVLAQQTDIEVCLGLRTILCALIFLVEKAHARHLNINTQSIYVTES
GSWRLAGFEYVWRATDVNKQLLDLAHSFIDLSIHGENFEQFFFSILCEKV
LSRKGADSCITDSTPHVQEFREYCSTHLKHQNTKLRPRLSAILLHPYFNH
EFVLIHSFLFELPLKSVHERHKFFRSLIDRLRYFDEEVVASQLACDLLSR
MVLLDPAAQEFVTPHILRTKVTDKAPASLFSPQIYVQYLMPHILKMFRLR
DAQIRLILLDYFMDYVRLLSDEQLESEILPHLQLGMNDTNDVLVGKTLRC
MADLVSILGANKVLGGDRTRCFSDGRPHAAVSRDSTNPFPEPRSISPLMN
TRSFDVEDFMVSASPLPQESNASPLSIRLSPDGGEDEKVGLNSNEKSISI
KHNIDPERNSNISGTEHEKVTNVDEEGTWLDWDNTDHLQQGYQVDQAPTD
SETNSNALTREIQISKSLSPSYRT-------GVNETISQTEQKVIDDLSE
LDIKVQTVIQRSELHEFDFFKDMEPTIEIRTSTCETPEQISSRFAAAASA
VNCNELCADQGWGHDEQD-KDDIVWGVTNASTLoooooooo
>C3
MGNEGSKLKGILVEENAVETNQFWTVYNAKTPATTNDERCSQMLSVFEGK
VFVKAHVWSNGVGPIERAIKNLMVYRHPYILKYIATWEKSGRKYLATERV
RPLDEVLAQQTDIEVCLGLRTILCALIFLVEKAHARHLNINTQSIYVTES
GSWRLAGFEYVWRATDVNKQLLDLAHSFIDLSIHGENFEQFFFSILCEKV
LSRKGADSCITDSTPHVQEFREYCSTHLKHQNTKLRPRLSAILLHPYFNH
EFVLIHSFLFELPLKSVHERHKFFRSLIDRLRYFDEEVVASQMACDLLSR
MVLLDPAAQEFVTPHILRTKVTDKAPASLFSPQIYVQYLMPHILKMFRLR
DAQIRLILLDYFMDYVRLLSDEQLESEILPHLQLGMNDTNDVLVGKTLRC
MADLVSILGANKVLGGDRARCFSDGRPHAAVSRDSTNPFPEPRSISPLMN
TRSFDVEDFMVSASPLPQESNASPLSIRLSPDGGEDEKVRLNSNEKSISI
KHNRDPEKNSNISGTEHEKVTNVDEEGTWLDWDNTDHLQQGYQVDQALTD
SETNSNALTREIQIGKSLSPSYRT-------GVNETISQTEQKVIDDLSE
LDIKVQTVIQRSELNEFDFFKDMEPTIEIRTSTCETPEQISSRFAAAASA
VNCNELCADQGWGHDEQD-KDDIVWGVTNASTLoooooooo
>C4
MGTEGSKLKGIIIEENEVEINKFWTVYNAKTPTKSNDERCSQLLSVFEGK
VFVKTHVWSHGVGPIERAIKNLMVYRHPYILKYVATWEKSGRKYLATERV
RPLDVVLAKQTDTEVCLGLRTILCALIFLVEKALARHLNLNTLSIYVTES
GSWRLAGFEYVWRATDVDKELLDLAHSYIDLSIHGENFEQFFFAILCEKV
LGRKGTDSCITDSTPHVQDFREYCSTHLKHQNTKLRPRLSAILLHPYFNH
EFVLIHSFLFELPLKSVHERYQFFRSLIDRLRYFDEEVVASQLSCDLLSR
MVLLDPAAQEFVTPHILRTKITDKALASLFSPQIYVKYLMPHILKMFRLR
DAQIRLILLDYFMDYIRLLSDEQLESEILPHLQLGMKDTNEILVAKTLRC
MADLVSILGADKVLGGDRSRCFSDGRPHAAVSTDIANSFPEPRSISPLMN
TRSFDVENFMVSGSPLPQERNASPLSIRLSPDGGEDEKLRLNLNENAISI
NHNSDAEKDLRRTLTEHENRANDDEEGIWFDWDNTDQLQQDYREDQVRTD
TETKSNALTTEIQISKSLLPPYRTATFNLSVGINETISMAEQKINDDLSE
LDIKVQPVIQSSELSEFDFFKDMEPVIEIKTSTCETPQQISSRLAASASA
MNCNDLCADQGWGHDEQD-KDDIQWGVRNATooo-------
>C5
MGTEGSKLKGIIVEENAVEINKFWTVYNAKTPTTSNDERWSQMLSVFEGK
VFPKTHIWSHGVGPIERAIKNLMVYRHPYILKYIASWEKSGRKYLATERV
RHLDEVLAQQTDIEVCLGLRTILCALIFLVEKALARHLNINTLSIYVTES
GSWRLAGFEYVWRATDVNKELLDLAHSYIDLSIHGENFEQFFFAILCEKV
LGRRGKDSCITDSTPHVQEFREYCNTHLKHQNTKLRPRLSAILLHPYFNH
EFVLIHSFLFELPLKSVQERHKFFRSLIDRLRYFDEEVVASQLASDLLSR
MVLLDPAAQEFVTPYILRTKVTDKSLASLFSPQIYVQYLIPHILKMFRLR
DAQIRLILLDYFIDYIRLLSDEQLEREILPHLQLGMNDTNDILVAKTLRC
MADLVSILGANKVLGGDRARCFSDGRPHAAVSRDIANSFPEPRSISPLMN
TRSFDVEDFMVSGSPLPQESNVSPLSIRLSPDGGEDEKVRLNSNEKSISI
NHNSDPEKDSNRSFTEHER-ANVDEEGIWFDWDNTDQLQQDYREDQVRTE
SETNSNALTREIQTNKSLSPSYRTATFNLSVGINETISQKEQQVNDDLSE
LDIKVQPVIQRSELSEFDFFKDMEPVIEIKTSTCETPEQISSRFAAS--A
VNCNDLCADQGWGHDEQD-KDDIVWGVTNATTIoooo----
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:691 S:99 BS:691
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES 
BOT	    0    1	 95.70 C1	 C2	 95.70
TOP	    1    0	 95.70 C2	 C1	 95.70
BOT	    0    2	 96.30 C1	 C3	 96.30
TOP	    2    0	 96.30 C3	 C1	 96.30
BOT	    0    3	 84.75 C1	 C4	 84.75
TOP	    3    0	 84.75 C4	 C1	 84.75
BOT	    0    4	 88.66 C1	 C5	 88.66
TOP	    4    0	 88.66 C5	 C1	 88.66
BOT	    1    2	 98.68 C2	 C3	 98.68
TOP	    2    1	 98.68 C3	 C2	 98.68
BOT	    1    3	 85.65 C2	 C4	 85.65
TOP	    3    1	 85.65 C4	 C2	 85.65
BOT	    1    4	 89.64 C2	 C5	 89.64
TOP	    4    1	 89.64 C5	 C2	 89.64
BOT	    2    3	 85.50 C3	 C4	 85.50
TOP	    3    2	 85.50 C4	 C3	 85.50
BOT	    2    4	 89.79 C3	 C5	 89.79
TOP	    4    2	 89.79 C5	 C3	 89.79
BOT	    3    4	 89.71 C4	 C5	 89.71
TOP	    4    3	 89.71 C5	 C4	 89.71
AVG	 0	 C1	  *	 91.35
AVG	 1	 C2	  *	 92.42
AVG	 2	 C3	  *	 92.57
AVG	 3	 C4	  *	 86.40
AVG	 4	 C5	  *	 89.45
TOT	 TOT	  *	 90.44
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGGCAATGAAGGCAGCAAACTAAAAGGAATACTTGTTGAGGAAAATGC
C2              ATGGGCAATGAAGGCAGCAAACTAAAAGGAATACTTGTTGAGGAAAATGC
C3              ATGGGCAATGAAGGCAGCAAACTAAAAGGAATACTTGTTGAGGAAAATGC
C4              ATGGGCACTGAAGGCAGCAAACTAAAAGGAATAATTATTGAGGAAAATGA
C5              ATGGGCACAGAAGGCAGCAAACTAAAAGGAATTATTGTTGAGGAAAATGC
                *******.:***********************:.**.************.

C1              GGTGGAGACTAATCAATTTTGGACAGTTTATAACGCTAAGACGCCAGAGA
C2              GGTGGAGACTAATAAATTTTGGACAGTTTATAACGCAAAGACACCAGCGA
C3              GGTGGAGACTAATCAATTTTGGACAGTTTATAACGCAAAGACACCAGCGA
C4              GGTGGAGATTAATAAATTTTGGACAGTTTATAACGCAAAGACACCAACGA
C5              GGTTGAGATTAATAAATTTTGGACCGTTTATAACGCAAAGACACCAACGA
                *** **** ****.**********.***********:*****.***..**

C1              CAACCAACGATGAACGTTGCAGCCAGATGCTCTCCGTATTCGAAGGAAAA
C2              CAACCAACGATGAACGTTGCAGCCAGATGCTTTCCGTATTCGAAGGAAAG
C3              CAACCAACGATGAACGTTGCAGCCAGATGCTTTCCGTATTCGAAGGAAAG
C4              AATCCAACGATGAGCGTTGCAGCCAATTGCTGTCCGTATTTGAAGGCAAA
C5              CATCCAACGATGAACGTTGGAGCCAGATGCTGTCTGTATTCGAAGGCAAG
                .*:**********.***** *****.:**** ** ***** *****.**.

C1              GTCTTTGTCAAGGCACATGTATGGTCAAATGGAGTGGGCCCGATTGAAAG
C2              GTCTTTGTCAAGGCACACGTTTGGTCTAATGGAGTGGGCCCAATTGAAAG
C3              GTCTTTGTCAAGGCACACGTTTGGTCTAATGGAGTGGGCCCAATTGAAAG
C4              GTGTTTGTCAAGACACATGTTTGGTCCCATGGAGTGGGACCGATTGAAAG
C5              GTCTTTCCCAAGACACATATTTGGTCTCATGGAGTGGGTCCGATTGAAAG
                ** ***  ****.**** .*:***** .********** **.********

C1              AGCAATAAAAAACCTGATGGTCTACCGCCACCCGTACATCTTAAAATATA
C2              AGCAATAAAAAACCTGATGGTCTACCGCCACCCGTACATCTTAAAATATA
C3              AGCAATAAAAAACCTGATGGTCTACCGCCACCCGTACATCTTAAAATATA
C4              GGCAATAAAAAACCTGATGGTCTACCGCCACCCGTACATCTTAAAATATG
C5              GGCAATAAAAAACCTAATGGTCTACCGCCACCCGTACATCCTAAAATATA
                .**************.************************ ********.

C1              TAGCTACCTGGGAGAAGTCGGGACGGAAGTATCTTGCTACAGAGAGAGTC
C2              TAGCTACCTGGGAGAAGTCGGGACGGAAGTATCTTGCTACAGAGAGAGTC
C3              TAGCTACCTGGGAGAAGTCGGGACGGAAGTATCTTGCTACAGAGAGAGTC
C4              TAGCTACCTGGGAAAAGTCGGGAAGGAAGTATCTTGCTACAGAGAGGGTC
C5              TAGCTTCTTGGGAGAAGTCGGGACGGAAGTATCTTGCTACAGAGAGAGTC
                *****:* *****.*********.**********************.***

C1              AGACCTCTAGATGAGGTGCTGGCCCAGCAGACTGACATTGAAGTCTGCCT
C2              AGACCTCTTGATGAGGTGCTGGCCCAGCAGACTGACATTGAAGTCTGTCT
C3              AGACCTCTTGATGAGGTGCTGGCCCAGCAGACTGACATTGAAGTCTGTCT
C4              AGGCCTCTTGATGTGGTACTGGCCAAGCAGACCGACACTGAAGTCTGTTT
C5              AGGCATCTTGATGAGGTTCTGGCCCAGCAGACCGACATTGAAGTCTGTCT
                **.*.***:****:*** ******.******* **** *********  *

C1              AGGGCTGCGAACCATTTTATGCGCTCTAATATTTTTGGTTGAGAAGGCCC
C2              AGGGCTGCGAACCATTCTATGCGCTCTAATATTTCTGGTTGAGAAGGCTC
C3              AGGGCTGCGAACCATTCTATGCGCTCTAATATTTTTGGTTGAGAAGGCTC
C4              AGGCTTGCGAACAATACTATGCGCTCTAATATTTTTAGTTGAGAAGGCTC
C5              AGGCCTGCGAACAATACTTTGCGCTCTAATATTTCTGGTTGAGAAGGCTT
                ***  *******.**: *:*************** *.***********  

C1              TGGCTCGGCACTTAAATATTAACACGCAGTCTATTTACGTAACGGAGAGT
C2              ATGCACGGCACTTAAATATAAACACGCAGTCTATTTACGTAACAGAGAGT
C3              ATGCACGGCACTTAAATATAAACACGCAGTCTATTTACGTAACAGAGAGT
C4              TGGCACGACACTTAAATTTAAACACGCTGTCCATTTACGTAACAGAGAGT
C5              TGGCACGACACTTAAATATTAACACGCTGTCTATTTACGTGACGGAGAGT
                : **:**.*********:*:*******:*** ********.**.******

C1              GGAAGCTGGCGCCTCGCTGGCTTCGAGTACGTTTGGAGGGCCACGGATGT
C2              GGAAGCTGGCGTCTCGCTGGCTTCGAGTACGTTTGGAGGGCCACAGATGT
C3              GGAAGCTGGCGTCTCGCTGGCTTCGAGTACGTTTGGAGGGCCACAGATGT
C4              GGAAGCTGGCGCCTCGCTGGCTTCGAGTACGTTTGGAGGGCTACAGATGT
C5              GGAAGCTGGCGCCTCGCCGGCTTCGAGTACGTTTGGAGAGCCACAGATGT
                *********** ***** ********************.** **.*****

C1              CAACAAACAACTGCTCGACTTGGCACATTCTTTTATAGACTTGACTATTC
C2              CAACAAACAACTGCTCGACTTGGCGCATTCTTTTATAGACTTGAGTATTC
C3              CAACAAACAACTGCTCGACTTGGCGCATTCTTTTATAGACTTGAGTATTC
C4              CGACAAAGAACTGCTTGACTTGGCACATTCCTATATAGACTTGAGTATTC
C5              CAACAAAGAACTGCTCGACTTGGCACATTCCTATATAGACTTGAGTATTC
                *.***** ******* ********.***** *:*********** *****

C1              ACGGAGAGAACTTCGAACAATTTTTCTTCTCCATTTTGTGCGAGAAAGTG
C2              ACGGAGAGAACTTCGAACAATTTTTCTTCTCCATTCTGTGTGAGAAAGTG
C3              ACGGAGAGAACTTCGAACAATTTTTCTTCTCCATTCTGTGTGAGAAAGTG
C4              ATGGAGAGAACTTCGAACAGTTCTTCTTCGCAATTCTGTGTGAGAAAGTG
C5              ACGGAGAGAATTTTGAACAGTTCTTCTTTGCCATTCTCTGTGAGAAAGTG
                * ******** ** *****.** *****  *.*** * ** *********

C1              CTAAGCAGGAAAGGAACTGATAGTTGTATTACTGATAGCACTCCACACGT
C2              CTGAGCAGGAAAGGAGCTGACAGTTGCATTACTGATAGTACTCCACACGT
C3              CTGAGCAGGAAAGGAGCTGACAGTTGCATTACTGATAGCACTCCACACGT
C4              CTGGGCAGGAAAGGAACTGACAGTTGCATTACTGATAGCACTCCACACGT
C5              TTGGGCAGGAGAGGAAAGGACAGTTGCATTACTGATAGCACTCCACACGT
                 *..******.****.. ** ***** *********** ***********

C1              TCATGAGTTCCGTGAGTATTGCAGCACACACCTAAAGCATCAAAATACAA
C2              CCAGGAGTTCCGTGAGTATTGCAGCACACACCTGAAGCATCAAAATACAA
C3              CCAGGAGTTCCGTGAGTATTGCAGCACACACCTAAAGCATCAAAATACAA
C4              TCAGGATTTCCGTGAGTATTGCAGCACACACCTAAAGCATCAAAACACAA
C5              TCAGGAGTTCCGTGAGTATTGCAACACACACCTGAAGCATCAGAATACAA
                 ** ** ****************.*********.********.** ****

C1              AGCTAAGGCCAAGACTTTCTGCTATCTTGCTACATCCATACTTCAACCAT
C2              AGCTAAGGCCAAGACTTTCTGCTATCTTGCTACATCCATACTTCAACCAT
C3              AGCTAAGGCCAAGACTTTCTGCTATCTTGCTACATCCTTACTTCAACCAT
C4              AGCTAAGGCCAAGACTTTCTGCTATCTTGCTACATCCTTACTTTAACCAT
C5              AGCTAAGGCCAAGACTTTCTGCTATCTTGCTACATCCTTACTTCAACCAT
                *************************************:***** ******

C1              GAATTCGTGCTTATACATTCCTTTCTCTTTGAGTTGCCACTGAAGTCAGT
C2              GAATTCGTGCTTATACATTCCTTTCTCTTTGAGTTGCCACTGAAGTCAGT
C3              GAATTCGTGCTTATACATTCCTTTCTCTTTGAGTTGCCACTGAAGTCAGT
C4              GAATTCGTCCTCATACATTCCTTTCTCTTTGAGTTGCCCCTGAAGTCAGT
C5              GAATTCGTGCTCATACATTCCTTTCTCTTTGAGTTACCGCTGAAGTCAGT
                ******** ** ***********************.** ***********

C1              GCACGAGCGCCACAAATTCTTTAGAAGTTTGATTGATCGATTGCGATATT
C2              GCACGAGCGCCACAAATTCTTTAGAAGTTTGATTGATCGATTGCGATATT
C3              GCACGAGCGCCACAAATTCTTTAGAAGTTTGATTGATCGATTGCGATATT
C4              GCACGAGCGTTACCAATTCTTTAGAAGTTTGATTGATCGATTGCGATATT
C5              GCAAGAACGCCACAAATTCTTTAGAAGTTTGATTGATCGACTGCGATATT
                ***.**.**  **.************************** *********

C1              TCGACGAGGAAGTAGTGGCTTCGCAGCTGGCATGTGACTTACTCTCTAGA
C2              TCGACGAGGAAGTAGTGGCTTCGCAGCTGGCGTGTGACTTACTCTCTAGA
C3              TCGACGAGGAAGTAGTGGCTTCGCAGATGGCGTGTGACTTACTCTCTAGA
C4              TCGACGAGGAAGTAGTGGCTTCGCAGCTGTCGTGTGACTTGCTCTCTAGA
C5              TCGACGAGGAAGTAGTGGCTTCGCAGCTGGCGAGTGACTTACTCTCTAGA
                **************************.** *.:*******.*********

C1              ATGGTTCTGCTGGATCCTGCTGCACAAGAATTTGTGACTCCGCATATACT
C2              ATGGTTCTGCTGGATCCTGCTGCACAGGAATTTGTGACTCCGCATATACT
C3              ATGGTTCTGCTGGATCCTGCTGCACAAGAATTTGTGACTCCGCATATACT
C4              ATGGTTCTGCTGGATCCTGCTGCACAAGAATTCGTGACTCCACATATACT
C5              ATGGTTCTGCTGGATCCTGCTGCACAAGAATTCGTGACTCCATATATACT
                **************************.***** ********. *******

C1              CCGTACAAAAGTTACTGATAAAGCACCGGCATCGCTATTTTCTCCGCAAA
C2              CCGTACAAAAGTTACTGATAAAGCACCGGCATCGCTATTTTCTCCGCAAA
C3              CCGTACAAAAGTTACTGATAAAGCACCGGCATCGCTATTTTCTCCGCAAA
C4              CCGTACAAAAATTACGGATAAAGCACTGGCGTCGTTATTTTCTCCGCAAA
C5              CCGTACAAAAGTTACGGATAAATCACTGGCATCGCTATTTTCTCCGCAAA
                **********.**** ****** *** ***.*** ***************

C1              TCTACGTACAATACTTAATGCCACACATACTCAAGATGTTCCGCTTGCGT
C2              TCTATGTACAATACCTAATGCCACACATACTGAAGATGTTCCGCTTGCGT
C3              TCTATGTACAATACCTAATGCCACACATACTGAAGATGTTCCGCTTGCGT
C4              TCTACGTCAAATATTTAATGCCACACATACTCAAGATGTTCCGCTTGCGT
C5              TCTACGTTCAATATTTAATTCCACACATACTCAAGATGTTCCGATTGCGT
                **** ** .****  **** *********** ***********.******

C1              GATGCACAGATTCGATTAATACTTCTTGACTATTTTATGGACTATGTTCG
C2              GATGCACAGATTCGATTAATACTTCTTGACTATTTTATGGACTATGTTCG
C3              GATGCACAGATTCGATTAATACTTCTTGACTATTTTATGGACTATGTTCG
C4              GATGCGCAGATTCGGTTAATACTTCTTGACTATTTTATGGACTATATTCG
C5              GATGCACAGATTCGGTTAATACTTCTTGACTATTTTATAGACTATATTCG
                *****.********.***********************.******.****

C1              TCTCTTAAGCGATGAGCAACTAGAGAGCGAAATTCTTCCTCATTTACAGC
C2              TCTCTTAAGCGATGAGCAACTAGAGAGCGAGATTCTTCCTCATTTACAGC
C3              TCTCTTAAGCGATGAGCAACTAGAGAGCGAGATTCTTCCTCATTTACAGC
C4              TCTCTTGAGCGATGAGCAATTAGAGAGCGAGATTCTTCCTCATTTACAGC
C5              TCTATTAAGCGATGAGCAACTTGAGAGGGAGATTCTTCCTCATTTACAGC
                ***.**.************ *:***** **.*******************

C1              TTGGTATGAACGATACTAACGACGTCTTGGTAGGCAAAACACTAAGGTGC
C2              TTGGTATGAACGACACTAACGACGTCTTGGTAGGCAAAACACTTAGGTGC
C3              TTGGTATGAACGATACTAACGACGTCTTGGTAGGCAAAACACTCAGGTGC
C4              TTGGTATGAAGGATACTAACGAGATCTTGGTAGCCAAAACACTTAGATGC
C5              TGGGTATGAACGATACTAACGACATCTTGGTAGCCAAAACGCTTAGGTGC
                * ******** ** ******** .********* ******.** **.***

C1              ATGGCTGATTTAGTTTCCATATTAGGAGCTAACAAAGTTTTGGGCGGTGA
C2              ATGGCTGATTTAGTTTCCATATTAGGAGCCAACAAAGTTTTGGGAGGCGA
C3              ATGGCTGATTTAGTTTCCATATTAGGAGCCAACAAAGTTTTGGGCGGCGA
C4              ATGGCTGATTTAGTTTCCATATTAGGAGCCGACAAAGTCTTAGGAGGGGA
C5              ATGGCTGATTTAGTTTCCATATTAGGAGCCAACAAAGTCTTAGGAGGGGA
                ***************************** .******* **.**.** **

C1              TCGTGCACGATGTTTTTCTGATGGCCGTCCACACGCTGCTGTTTCCAGAG
C2              TCGTACACGATGTTTTTCTGATGGGCGTCCACACGCTGCTGTTTCCAGAG
C3              TCGTGCACGATGTTTTTCTGATGGGCGTCCACACGCTGCTGTTTCCAGAG
C4              TCGATCAAGATGTTTTTCTGATGGCCGTCCGCACGCTGCCGTTTCCACAG
C5              CCGAGCCCGATGTTTTTCTGATGGTCGTCCGCACGCTGCTGTGTCCAGAG
                 **: *..**************** *****.******** ** **** **

C1              ACAGCAACAATCCTTATCCCGAACCGCGGTCTATTAGTCCTTTAATGAAT
C2              ACAGCACCAATCCTTTTCCCGAACCGCGTTCTATTAGTCCCTTAATGAAT
C3              ACAGCACCAATCCTTTTCCCGAACCGCGTTCTATTAGTCCCTTAATGAAT
C4              ACATCGCAAATTCTTTTCCAGAACCGCGGTCCATTAGTCCCTTGATGAAT
C5              ACATCGCAAATTCTTTCCCAGAACCGCGATCCATTAGTCCCTTAATGAAT
                *** *...*** ***: **.******** ** ******** **.******

C1              ACTAGATCCTTCGACGTAGAAGACTTTATGGTTTCTGGGAGCCCATTGCC
C2              ACTAGATCCTTCGACGTAGAAGACTTTATGGTTTCTGCGAGCCCATTGCC
C3              ACTAGATCCTTCGACGTAGAAGACTTTATGGTTTCTGCGAGCCCATTGCC
C4              ACTAGATCTTTTGATGTGGAAAACTTTATGGTTTCTGGGAGCCCATTGCC
C5              ACTAGATCTTTCGACGTGGAAGACTTTATGGTTTCTGGGAGCCCATTGCC
                ******** ** ** **.***.*************** ************

C1              ACAAGAAAGCAATGCCTCACCTTTATCTATTCGCCTTAGCCCGGACGGTG
C2              CCAAGAAAGCAATGCCTCCCCTTTATCTATTCGCCTAAGCCCAGACGGTG
C3              CCAAGAAAGCAATGCCTCCCCTTTATCCATTCGCCTAAGCCCAGACGGTG
C4              ACAAGAACGCAACGCCTCCCCCTTATCTATTCGCCTTAGCCCAGACGGCG
C5              ACAAGAAAGCAATGTCTCCCCCTTATCAATTCGCCTTAGCCCAGACGGCG
                .******.**** * ***.** ***** ********:*****.***** *

C1              GGGAGGACGAGAAACTTCGGTTAAATTCAAATGAAAAATCCATAAGTATA
C2              GGGAGGACGAGAAAGTGGGGTTAAATTCAAATGAAAAATCTATAAGCATA
C3              GGGAGGACGAGAAAGTGCGGTTAAATTCAAATGAAAAATCTATAAGCATA
C4              GAGAAGACGAGAAATTGCGGTTAAATTTAAATGAAAATGCTATAAGTATA
C5              GTGAAGACGAGAAAGTCCGGTTAAATTCAAATGAAAAATCCATAAGTATA
                * **.********* *  ********* *********: * ***** ***

C1              AAACATAATATAGACCCCGAGAAGGACTCGTATATATCTGGCACAGAGCA
C2              AAACATAATATAGACCCCGAGAGAAACTCGAATATATCTGGCACAGAGCA
C3              AAACATAATAGAGACCCTGAGAAGAACTCGAATATATCTGGCACAGAGCA
C4              AATCATAATAGCGATGCCGAAAAGGATTTAAGAAGAACCCTCACAGAGCA
C5              AATCATAATAGCGACCCTGAAAAGGACTCAAATAGATCCTTCACAGAGCA
                **:******* .**  * **.*...* * .:.:* *:*   *********

C1              TGAAAGAGTGGCCAACATTGATGAGGAGGGGACTTGGCTTGATTGGGACA
C2              TGAAAAAGTGACCAACGTTGATGAGGAGGGAACTTGGCTTGATTGGGACA
C3              TGAAAAAGTGACCAACGTTGATGAGGAGGGAACTTGGCTTGATTGGGACA
C4              TGAAAACAGAGCCAACGATGATGAGGAGGGGATTTGGTTTGATTGGGACA
C5              TGAAAGA---GCCAACGTTGATGAAGAGGGGATTTGGTTTGATTGGGACA
                *****..   .*****.:******.*****.* **** ************

C1              ATACAGACCACCTTCAACAGGGCTACCAAGTGGATCACGCTGTAACCGAC
C2              ATACAGACCACCTTCAACAGGGCTACCAAGTGGATCAGGCTCCAACCGAC
C3              ATACAGACCACCTTCAACAGGGCTACCAAGTGGATCAGGCTCTAACCGAC
C4              ATACAGACCAGCTTCAGCAGGACTACCGAGAGGATCAGGTTCGAACGGAT
C5              ATACAGACCAGCTTCAGCAGGACTACCGAGAGGATCAGGTTCGAACCGAG
                ********** *****.****.*****.**:****** * *  *** ** 

C1              TCTGAAACAAACAGTAATTCATTTGCTAGAGAGATCCAAACTGGCAAATC
C2              TCTGAAACAAACAGTAATGCATTGACTAGAGAGATCCAAATAAGCAAATC
C3              TCTGAAACAAACAGTAATGCATTGACTAGAGAGATCCAAATAGGCAAATC
C4              ACGGAAACCAAAAGTAATGCATTGACTACAGAGATCCAAATAAGCAAATC
C5              TCGGAAACCAACAGTAATGCATTGACTAGAGAGATCCAAACAAACAAATC
                :* *****.**.****** **** .*** *********** :..******

C1              TTTATCGCCCTCATATCGCACTGGAAAATGTAATTTATCAGTTGGAGTAA
C2              TTTATCGCCCTCATATCGCACT---------------------GGAGTAA
C3              TTTATCGCCCTCATATCGCACT---------------------GGAGTAA
C4              GTTATTGCCCCCATATCGCACTGCAACATTTAACTTATCCGTTGGAATAA
C5              GTTGTCGCCCTCATATCGCACTGCAACCTTTAACTTATCCGTTGGAATAA
                 **.* **** ***********                     ***.***

C1              ACGAGACAATATCCCAGACAGAACAGAAAGTTATCGATGATCTCAGTGAG
C2              ACGAGACAATATCTCAGACAGAACAGAAAGTTATCGATGATCTCAGTGAG
C3              ACGAGACAATATCTCAGACAGAACAGAAAGTTATCGATGATCTCAGTGAG
C4              ACGAGACAATATCTATGGCAGAACAAAAAATTAACGATGATCTCAGTGAG
C5              ACGAAACAATATCTCAAAAAGAACAACAAGTTAACGATGATCTCAGTGAG
                ****.******** .:...******..**.***:****************

C1              CTGGACATAAAAGTGCAAACGGTGATTCAAAGGTCTGAGTTCAACGAATT
C2              CTGGACATAAAAGTGCAAACGGTGATTCAAAGGTCTGAGTTACACGAATT
C3              CTGGACATAAAAGTGCAAACGGTGATTCAAAGGTCTGAGCTAAACGAATT
C4              CTGGACATAAAGGTGCAACCGGTGATACAAAGTTCTGAGTTAAGCGAATT
C5              CTGGACATAAAAGTGCAACCGGTGATACAAAGATCTGAGTTAAGCGAATT
                ***********.******.*******:***** ****** *...******

C1              TGATTTCTTCAAAGATATGGAACCGATCATCGAAATCCGGACTAGTACCT
C2              TGATTTCTTCAAAGATATGGAACCAACCATCGAAATAAGGACTAGTACCT
C3              TGATTTCTTCAAAGATATGGAACCGACCATCGAAATAAGGACTAGTACCT
C4              TGATTTCTTTAAAGATATGGAACCGGTCATCGAAATAAAAACTAGTACCT
C5              TGATTTCTTTAAGGATATGGAACCGGTCATCGAAATAAAAACTAGTACCT
                ********* **.***********.. *********....**********

C1              GTGAGACACCGGAGCAAATAAGCAGCCGTTTTGCTGCTGCTGCGTCAGCC
C2              GCGAGACACCGGAGCAAATAAGCAGCCGTTTTGCTGCTGCTGCGTCAGCC
C3              GCGAGACACCGGAGCAAATAAGCAGCCGTTTTGCTGCTGCTGCGTCAGCC
C4              GTGAGACACCGCAGCAAATAAGCAGCCGTTTGGCTGCTTCTGCGTCAGCC
C5              GTGAGACACCGGAGCAAATAAGCAGTCGATTTGCTGCTTCT------GCC
                * ********* ************* **:** ****** **      ***

C1              GTGAACTGTAATGAGCTGTGTGCCGATCAGGGTTGGGGTCATGATGAACA
C2              GTGAACTGTAATGAGCTGTGTGCCGATCAGGGTTGGGGTCATGATGAACA
C3              GTGAACTGTAATGAGCTGTGTGCCGATCAGGGTTGGGGTCATGATGAACA
C4              ATGAACTGTAATGATCTGTGTGCCGATCAGGGTTGGGGACATGATGAACA
C5              GTTAACTGTAATGATCTGTGCGCCGATCAGGGTTGGGGTCATGATGAACA
                .* *********** ***** *****************:***********

C1              GGATGATAAGGACGATATTGTCTGGGGCGTGACGAATGTATCAACGCTT-
C2              GGAT---AAGGACGACATTGTCTGGGGCGTGACGAATGCATCAACGCTT-
C3              GGAT---AAGGACGACATTGTCTGGGGCGTGACGAATGCATCAACGCTT-
C4              AGAT---AAGGACGATATCCAGTGGGGCGTGAGGAATGCAACG-------
C5              GGAT---AAGGACGACATTGTCTGGGGAGTGACGAATGCAACGACGATT-
                .***   ******** **  : *****.**** ***** *:*.       

C1              -----------------------
C2              -----------------------
C3              -----------------------
C4              -----------------------
C5              -----------------------
                                       



>C1
ATGGGCAATGAAGGCAGCAAACTAAAAGGAATACTTGTTGAGGAAAATGC
GGTGGAGACTAATCAATTTTGGACAGTTTATAACGCTAAGACGCCAGAGA
CAACCAACGATGAACGTTGCAGCCAGATGCTCTCCGTATTCGAAGGAAAA
GTCTTTGTCAAGGCACATGTATGGTCAAATGGAGTGGGCCCGATTGAAAG
AGCAATAAAAAACCTGATGGTCTACCGCCACCCGTACATCTTAAAATATA
TAGCTACCTGGGAGAAGTCGGGACGGAAGTATCTTGCTACAGAGAGAGTC
AGACCTCTAGATGAGGTGCTGGCCCAGCAGACTGACATTGAAGTCTGCCT
AGGGCTGCGAACCATTTTATGCGCTCTAATATTTTTGGTTGAGAAGGCCC
TGGCTCGGCACTTAAATATTAACACGCAGTCTATTTACGTAACGGAGAGT
GGAAGCTGGCGCCTCGCTGGCTTCGAGTACGTTTGGAGGGCCACGGATGT
CAACAAACAACTGCTCGACTTGGCACATTCTTTTATAGACTTGACTATTC
ACGGAGAGAACTTCGAACAATTTTTCTTCTCCATTTTGTGCGAGAAAGTG
CTAAGCAGGAAAGGAACTGATAGTTGTATTACTGATAGCACTCCACACGT
TCATGAGTTCCGTGAGTATTGCAGCACACACCTAAAGCATCAAAATACAA
AGCTAAGGCCAAGACTTTCTGCTATCTTGCTACATCCATACTTCAACCAT
GAATTCGTGCTTATACATTCCTTTCTCTTTGAGTTGCCACTGAAGTCAGT
GCACGAGCGCCACAAATTCTTTAGAAGTTTGATTGATCGATTGCGATATT
TCGACGAGGAAGTAGTGGCTTCGCAGCTGGCATGTGACTTACTCTCTAGA
ATGGTTCTGCTGGATCCTGCTGCACAAGAATTTGTGACTCCGCATATACT
CCGTACAAAAGTTACTGATAAAGCACCGGCATCGCTATTTTCTCCGCAAA
TCTACGTACAATACTTAATGCCACACATACTCAAGATGTTCCGCTTGCGT
GATGCACAGATTCGATTAATACTTCTTGACTATTTTATGGACTATGTTCG
TCTCTTAAGCGATGAGCAACTAGAGAGCGAAATTCTTCCTCATTTACAGC
TTGGTATGAACGATACTAACGACGTCTTGGTAGGCAAAACACTAAGGTGC
ATGGCTGATTTAGTTTCCATATTAGGAGCTAACAAAGTTTTGGGCGGTGA
TCGTGCACGATGTTTTTCTGATGGCCGTCCACACGCTGCTGTTTCCAGAG
ACAGCAACAATCCTTATCCCGAACCGCGGTCTATTAGTCCTTTAATGAAT
ACTAGATCCTTCGACGTAGAAGACTTTATGGTTTCTGGGAGCCCATTGCC
ACAAGAAAGCAATGCCTCACCTTTATCTATTCGCCTTAGCCCGGACGGTG
GGGAGGACGAGAAACTTCGGTTAAATTCAAATGAAAAATCCATAAGTATA
AAACATAATATAGACCCCGAGAAGGACTCGTATATATCTGGCACAGAGCA
TGAAAGAGTGGCCAACATTGATGAGGAGGGGACTTGGCTTGATTGGGACA
ATACAGACCACCTTCAACAGGGCTACCAAGTGGATCACGCTGTAACCGAC
TCTGAAACAAACAGTAATTCATTTGCTAGAGAGATCCAAACTGGCAAATC
TTTATCGCCCTCATATCGCACTGGAAAATGTAATTTATCAGTTGGAGTAA
ACGAGACAATATCCCAGACAGAACAGAAAGTTATCGATGATCTCAGTGAG
CTGGACATAAAAGTGCAAACGGTGATTCAAAGGTCTGAGTTCAACGAATT
TGATTTCTTCAAAGATATGGAACCGATCATCGAAATCCGGACTAGTACCT
GTGAGACACCGGAGCAAATAAGCAGCCGTTTTGCTGCTGCTGCGTCAGCC
GTGAACTGTAATGAGCTGTGTGCCGATCAGGGTTGGGGTCATGATGAACA
GGATGATAAGGACGATATTGTCTGGGGCGTGACGAATGTATCAACGCTT-
-----------------------
>C2
ATGGGCAATGAAGGCAGCAAACTAAAAGGAATACTTGTTGAGGAAAATGC
GGTGGAGACTAATAAATTTTGGACAGTTTATAACGCAAAGACACCAGCGA
CAACCAACGATGAACGTTGCAGCCAGATGCTTTCCGTATTCGAAGGAAAG
GTCTTTGTCAAGGCACACGTTTGGTCTAATGGAGTGGGCCCAATTGAAAG
AGCAATAAAAAACCTGATGGTCTACCGCCACCCGTACATCTTAAAATATA
TAGCTACCTGGGAGAAGTCGGGACGGAAGTATCTTGCTACAGAGAGAGTC
AGACCTCTTGATGAGGTGCTGGCCCAGCAGACTGACATTGAAGTCTGTCT
AGGGCTGCGAACCATTCTATGCGCTCTAATATTTCTGGTTGAGAAGGCTC
ATGCACGGCACTTAAATATAAACACGCAGTCTATTTACGTAACAGAGAGT
GGAAGCTGGCGTCTCGCTGGCTTCGAGTACGTTTGGAGGGCCACAGATGT
CAACAAACAACTGCTCGACTTGGCGCATTCTTTTATAGACTTGAGTATTC
ACGGAGAGAACTTCGAACAATTTTTCTTCTCCATTCTGTGTGAGAAAGTG
CTGAGCAGGAAAGGAGCTGACAGTTGCATTACTGATAGTACTCCACACGT
CCAGGAGTTCCGTGAGTATTGCAGCACACACCTGAAGCATCAAAATACAA
AGCTAAGGCCAAGACTTTCTGCTATCTTGCTACATCCATACTTCAACCAT
GAATTCGTGCTTATACATTCCTTTCTCTTTGAGTTGCCACTGAAGTCAGT
GCACGAGCGCCACAAATTCTTTAGAAGTTTGATTGATCGATTGCGATATT
TCGACGAGGAAGTAGTGGCTTCGCAGCTGGCGTGTGACTTACTCTCTAGA
ATGGTTCTGCTGGATCCTGCTGCACAGGAATTTGTGACTCCGCATATACT
CCGTACAAAAGTTACTGATAAAGCACCGGCATCGCTATTTTCTCCGCAAA
TCTATGTACAATACCTAATGCCACACATACTGAAGATGTTCCGCTTGCGT
GATGCACAGATTCGATTAATACTTCTTGACTATTTTATGGACTATGTTCG
TCTCTTAAGCGATGAGCAACTAGAGAGCGAGATTCTTCCTCATTTACAGC
TTGGTATGAACGACACTAACGACGTCTTGGTAGGCAAAACACTTAGGTGC
ATGGCTGATTTAGTTTCCATATTAGGAGCCAACAAAGTTTTGGGAGGCGA
TCGTACACGATGTTTTTCTGATGGGCGTCCACACGCTGCTGTTTCCAGAG
ACAGCACCAATCCTTTTCCCGAACCGCGTTCTATTAGTCCCTTAATGAAT
ACTAGATCCTTCGACGTAGAAGACTTTATGGTTTCTGCGAGCCCATTGCC
CCAAGAAAGCAATGCCTCCCCTTTATCTATTCGCCTAAGCCCAGACGGTG
GGGAGGACGAGAAAGTGGGGTTAAATTCAAATGAAAAATCTATAAGCATA
AAACATAATATAGACCCCGAGAGAAACTCGAATATATCTGGCACAGAGCA
TGAAAAAGTGACCAACGTTGATGAGGAGGGAACTTGGCTTGATTGGGACA
ATACAGACCACCTTCAACAGGGCTACCAAGTGGATCAGGCTCCAACCGAC
TCTGAAACAAACAGTAATGCATTGACTAGAGAGATCCAAATAAGCAAATC
TTTATCGCCCTCATATCGCACT---------------------GGAGTAA
ACGAGACAATATCTCAGACAGAACAGAAAGTTATCGATGATCTCAGTGAG
CTGGACATAAAAGTGCAAACGGTGATTCAAAGGTCTGAGTTACACGAATT
TGATTTCTTCAAAGATATGGAACCAACCATCGAAATAAGGACTAGTACCT
GCGAGACACCGGAGCAAATAAGCAGCCGTTTTGCTGCTGCTGCGTCAGCC
GTGAACTGTAATGAGCTGTGTGCCGATCAGGGTTGGGGTCATGATGAACA
GGAT---AAGGACGACATTGTCTGGGGCGTGACGAATGCATCAACGCTT-
-----------------------
>C3
ATGGGCAATGAAGGCAGCAAACTAAAAGGAATACTTGTTGAGGAAAATGC
GGTGGAGACTAATCAATTTTGGACAGTTTATAACGCAAAGACACCAGCGA
CAACCAACGATGAACGTTGCAGCCAGATGCTTTCCGTATTCGAAGGAAAG
GTCTTTGTCAAGGCACACGTTTGGTCTAATGGAGTGGGCCCAATTGAAAG
AGCAATAAAAAACCTGATGGTCTACCGCCACCCGTACATCTTAAAATATA
TAGCTACCTGGGAGAAGTCGGGACGGAAGTATCTTGCTACAGAGAGAGTC
AGACCTCTTGATGAGGTGCTGGCCCAGCAGACTGACATTGAAGTCTGTCT
AGGGCTGCGAACCATTCTATGCGCTCTAATATTTTTGGTTGAGAAGGCTC
ATGCACGGCACTTAAATATAAACACGCAGTCTATTTACGTAACAGAGAGT
GGAAGCTGGCGTCTCGCTGGCTTCGAGTACGTTTGGAGGGCCACAGATGT
CAACAAACAACTGCTCGACTTGGCGCATTCTTTTATAGACTTGAGTATTC
ACGGAGAGAACTTCGAACAATTTTTCTTCTCCATTCTGTGTGAGAAAGTG
CTGAGCAGGAAAGGAGCTGACAGTTGCATTACTGATAGCACTCCACACGT
CCAGGAGTTCCGTGAGTATTGCAGCACACACCTAAAGCATCAAAATACAA
AGCTAAGGCCAAGACTTTCTGCTATCTTGCTACATCCTTACTTCAACCAT
GAATTCGTGCTTATACATTCCTTTCTCTTTGAGTTGCCACTGAAGTCAGT
GCACGAGCGCCACAAATTCTTTAGAAGTTTGATTGATCGATTGCGATATT
TCGACGAGGAAGTAGTGGCTTCGCAGATGGCGTGTGACTTACTCTCTAGA
ATGGTTCTGCTGGATCCTGCTGCACAAGAATTTGTGACTCCGCATATACT
CCGTACAAAAGTTACTGATAAAGCACCGGCATCGCTATTTTCTCCGCAAA
TCTATGTACAATACCTAATGCCACACATACTGAAGATGTTCCGCTTGCGT
GATGCACAGATTCGATTAATACTTCTTGACTATTTTATGGACTATGTTCG
TCTCTTAAGCGATGAGCAACTAGAGAGCGAGATTCTTCCTCATTTACAGC
TTGGTATGAACGATACTAACGACGTCTTGGTAGGCAAAACACTCAGGTGC
ATGGCTGATTTAGTTTCCATATTAGGAGCCAACAAAGTTTTGGGCGGCGA
TCGTGCACGATGTTTTTCTGATGGGCGTCCACACGCTGCTGTTTCCAGAG
ACAGCACCAATCCTTTTCCCGAACCGCGTTCTATTAGTCCCTTAATGAAT
ACTAGATCCTTCGACGTAGAAGACTTTATGGTTTCTGCGAGCCCATTGCC
CCAAGAAAGCAATGCCTCCCCTTTATCCATTCGCCTAAGCCCAGACGGTG
GGGAGGACGAGAAAGTGCGGTTAAATTCAAATGAAAAATCTATAAGCATA
AAACATAATAGAGACCCTGAGAAGAACTCGAATATATCTGGCACAGAGCA
TGAAAAAGTGACCAACGTTGATGAGGAGGGAACTTGGCTTGATTGGGACA
ATACAGACCACCTTCAACAGGGCTACCAAGTGGATCAGGCTCTAACCGAC
TCTGAAACAAACAGTAATGCATTGACTAGAGAGATCCAAATAGGCAAATC
TTTATCGCCCTCATATCGCACT---------------------GGAGTAA
ACGAGACAATATCTCAGACAGAACAGAAAGTTATCGATGATCTCAGTGAG
CTGGACATAAAAGTGCAAACGGTGATTCAAAGGTCTGAGCTAAACGAATT
TGATTTCTTCAAAGATATGGAACCGACCATCGAAATAAGGACTAGTACCT
GCGAGACACCGGAGCAAATAAGCAGCCGTTTTGCTGCTGCTGCGTCAGCC
GTGAACTGTAATGAGCTGTGTGCCGATCAGGGTTGGGGTCATGATGAACA
GGAT---AAGGACGACATTGTCTGGGGCGTGACGAATGCATCAACGCTT-
-----------------------
>C4
ATGGGCACTGAAGGCAGCAAACTAAAAGGAATAATTATTGAGGAAAATGA
GGTGGAGATTAATAAATTTTGGACAGTTTATAACGCAAAGACACCAACGA
AATCCAACGATGAGCGTTGCAGCCAATTGCTGTCCGTATTTGAAGGCAAA
GTGTTTGTCAAGACACATGTTTGGTCCCATGGAGTGGGACCGATTGAAAG
GGCAATAAAAAACCTGATGGTCTACCGCCACCCGTACATCTTAAAATATG
TAGCTACCTGGGAAAAGTCGGGAAGGAAGTATCTTGCTACAGAGAGGGTC
AGGCCTCTTGATGTGGTACTGGCCAAGCAGACCGACACTGAAGTCTGTTT
AGGCTTGCGAACAATACTATGCGCTCTAATATTTTTAGTTGAGAAGGCTC
TGGCACGACACTTAAATTTAAACACGCTGTCCATTTACGTAACAGAGAGT
GGAAGCTGGCGCCTCGCTGGCTTCGAGTACGTTTGGAGGGCTACAGATGT
CGACAAAGAACTGCTTGACTTGGCACATTCCTATATAGACTTGAGTATTC
ATGGAGAGAACTTCGAACAGTTCTTCTTCGCAATTCTGTGTGAGAAAGTG
CTGGGCAGGAAAGGAACTGACAGTTGCATTACTGATAGCACTCCACACGT
TCAGGATTTCCGTGAGTATTGCAGCACACACCTAAAGCATCAAAACACAA
AGCTAAGGCCAAGACTTTCTGCTATCTTGCTACATCCTTACTTTAACCAT
GAATTCGTCCTCATACATTCCTTTCTCTTTGAGTTGCCCCTGAAGTCAGT
GCACGAGCGTTACCAATTCTTTAGAAGTTTGATTGATCGATTGCGATATT
TCGACGAGGAAGTAGTGGCTTCGCAGCTGTCGTGTGACTTGCTCTCTAGA
ATGGTTCTGCTGGATCCTGCTGCACAAGAATTCGTGACTCCACATATACT
CCGTACAAAAATTACGGATAAAGCACTGGCGTCGTTATTTTCTCCGCAAA
TCTACGTCAAATATTTAATGCCACACATACTCAAGATGTTCCGCTTGCGT
GATGCGCAGATTCGGTTAATACTTCTTGACTATTTTATGGACTATATTCG
TCTCTTGAGCGATGAGCAATTAGAGAGCGAGATTCTTCCTCATTTACAGC
TTGGTATGAAGGATACTAACGAGATCTTGGTAGCCAAAACACTTAGATGC
ATGGCTGATTTAGTTTCCATATTAGGAGCCGACAAAGTCTTAGGAGGGGA
TCGATCAAGATGTTTTTCTGATGGCCGTCCGCACGCTGCCGTTTCCACAG
ACATCGCAAATTCTTTTCCAGAACCGCGGTCCATTAGTCCCTTGATGAAT
ACTAGATCTTTTGATGTGGAAAACTTTATGGTTTCTGGGAGCCCATTGCC
ACAAGAACGCAACGCCTCCCCCTTATCTATTCGCCTTAGCCCAGACGGCG
GAGAAGACGAGAAATTGCGGTTAAATTTAAATGAAAATGCTATAAGTATA
AATCATAATAGCGATGCCGAAAAGGATTTAAGAAGAACCCTCACAGAGCA
TGAAAACAGAGCCAACGATGATGAGGAGGGGATTTGGTTTGATTGGGACA
ATACAGACCAGCTTCAGCAGGACTACCGAGAGGATCAGGTTCGAACGGAT
ACGGAAACCAAAAGTAATGCATTGACTACAGAGATCCAAATAAGCAAATC
GTTATTGCCCCCATATCGCACTGCAACATTTAACTTATCCGTTGGAATAA
ACGAGACAATATCTATGGCAGAACAAAAAATTAACGATGATCTCAGTGAG
CTGGACATAAAGGTGCAACCGGTGATACAAAGTTCTGAGTTAAGCGAATT
TGATTTCTTTAAAGATATGGAACCGGTCATCGAAATAAAAACTAGTACCT
GTGAGACACCGCAGCAAATAAGCAGCCGTTTGGCTGCTTCTGCGTCAGCC
ATGAACTGTAATGATCTGTGTGCCGATCAGGGTTGGGGACATGATGAACA
AGAT---AAGGACGATATCCAGTGGGGCGTGAGGAATGCAACG-------
-----------------------
>C5
ATGGGCACAGAAGGCAGCAAACTAAAAGGAATTATTGTTGAGGAAAATGC
GGTTGAGATTAATAAATTTTGGACCGTTTATAACGCAAAGACACCAACGA
CATCCAACGATGAACGTTGGAGCCAGATGCTGTCTGTATTCGAAGGCAAG
GTCTTTCCCAAGACACATATTTGGTCTCATGGAGTGGGTCCGATTGAAAG
GGCAATAAAAAACCTAATGGTCTACCGCCACCCGTACATCCTAAAATATA
TAGCTTCTTGGGAGAAGTCGGGACGGAAGTATCTTGCTACAGAGAGAGTC
AGGCATCTTGATGAGGTTCTGGCCCAGCAGACCGACATTGAAGTCTGTCT
AGGCCTGCGAACAATACTTTGCGCTCTAATATTTCTGGTTGAGAAGGCTT
TGGCACGACACTTAAATATTAACACGCTGTCTATTTACGTGACGGAGAGT
GGAAGCTGGCGCCTCGCCGGCTTCGAGTACGTTTGGAGAGCCACAGATGT
CAACAAAGAACTGCTCGACTTGGCACATTCCTATATAGACTTGAGTATTC
ACGGAGAGAATTTTGAACAGTTCTTCTTTGCCATTCTCTGTGAGAAAGTG
TTGGGCAGGAGAGGAAAGGACAGTTGCATTACTGATAGCACTCCACACGT
TCAGGAGTTCCGTGAGTATTGCAACACACACCTGAAGCATCAGAATACAA
AGCTAAGGCCAAGACTTTCTGCTATCTTGCTACATCCTTACTTCAACCAT
GAATTCGTGCTCATACATTCCTTTCTCTTTGAGTTACCGCTGAAGTCAGT
GCAAGAACGCCACAAATTCTTTAGAAGTTTGATTGATCGACTGCGATATT
TCGACGAGGAAGTAGTGGCTTCGCAGCTGGCGAGTGACTTACTCTCTAGA
ATGGTTCTGCTGGATCCTGCTGCACAAGAATTCGTGACTCCATATATACT
CCGTACAAAAGTTACGGATAAATCACTGGCATCGCTATTTTCTCCGCAAA
TCTACGTTCAATATTTAATTCCACACATACTCAAGATGTTCCGATTGCGT
GATGCACAGATTCGGTTAATACTTCTTGACTATTTTATAGACTATATTCG
TCTATTAAGCGATGAGCAACTTGAGAGGGAGATTCTTCCTCATTTACAGC
TGGGTATGAACGATACTAACGACATCTTGGTAGCCAAAACGCTTAGGTGC
ATGGCTGATTTAGTTTCCATATTAGGAGCCAACAAAGTCTTAGGAGGGGA
CCGAGCCCGATGTTTTTCTGATGGTCGTCCGCACGCTGCTGTGTCCAGAG
ACATCGCAAATTCTTTCCCAGAACCGCGATCCATTAGTCCCTTAATGAAT
ACTAGATCTTTCGACGTGGAAGACTTTATGGTTTCTGGGAGCCCATTGCC
ACAAGAAAGCAATGTCTCCCCCTTATCAATTCGCCTTAGCCCAGACGGCG
GTGAAGACGAGAAAGTCCGGTTAAATTCAAATGAAAAATCCATAAGTATA
AATCATAATAGCGACCCTGAAAAGGACTCAAATAGATCCTTCACAGAGCA
TGAAAGA---GCCAACGTTGATGAAGAGGGGATTTGGTTTGATTGGGACA
ATACAGACCAGCTTCAGCAGGACTACCGAGAGGATCAGGTTCGAACCGAG
TCGGAAACCAACAGTAATGCATTGACTAGAGAGATCCAAACAAACAAATC
GTTGTCGCCCTCATATCGCACTGCAACCTTTAACTTATCCGTTGGAATAA
ACGAAACAATATCTCAAAAAGAACAACAAGTTAACGATGATCTCAGTGAG
CTGGACATAAAAGTGCAACCGGTGATACAAAGATCTGAGTTAAGCGAATT
TGATTTCTTTAAGGATATGGAACCGGTCATCGAAATAAAAACTAGTACCT
GTGAGACACCGGAGCAAATAAGCAGTCGATTTGCTGCTTCT------GCC
GTTAACTGTAATGATCTGTGCGCCGATCAGGGTTGGGGTCATGATGAACA
GGAT---AAGGACGACATTGTCTGGGGAGTGACGAATGCAACGACGATT-
-----------------------
>C1
MGNEGSKLKGILVEENAVETNQFWTVYNAKTPETTNDERCSQMLSVFEGK
VFVKAHVWSNGVGPIERAIKNLMVYRHPYILKYIATWEKSGRKYLATERV
RPLDEVLAQQTDIEVCLGLRTILCALIFLVEKALARHLNINTQSIYVTES
GSWRLAGFEYVWRATDVNKQLLDLAHSFIDLTIHGENFEQFFFSILCEKV
LSRKGTDSCITDSTPHVHEFREYCSTHLKHQNTKLRPRLSAILLHPYFNH
EFVLIHSFLFELPLKSVHERHKFFRSLIDRLRYFDEEVVASQLACDLLSR
MVLLDPAAQEFVTPHILRTKVTDKAPASLFSPQIYVQYLMPHILKMFRLR
DAQIRLILLDYFMDYVRLLSDEQLESEILPHLQLGMNDTNDVLVGKTLRC
MADLVSILGANKVLGGDRARCFSDGRPHAAVSRDSNNPYPEPRSISPLMN
TRSFDVEDFMVSGSPLPQESNASPLSIRLSPDGGEDEKLRLNSNEKSISI
KHNIDPEKDSYISGTEHERVANIDEEGTWLDWDNTDHLQQGYQVDHAVTD
SETNSNSFAREIQTGKSLSPSYRTGKCNLSVGVNETISQTEQKVIDDLSE
LDIKVQTVIQRSEFNEFDFFKDMEPIIEIRTSTCETPEQISSRFAAAASA
VNCNELCADQGWGHDEQDDKDDIVWGVTNVSTL
>C2
MGNEGSKLKGILVEENAVETNKFWTVYNAKTPATTNDERCSQMLSVFEGK
VFVKAHVWSNGVGPIERAIKNLMVYRHPYILKYIATWEKSGRKYLATERV
RPLDEVLAQQTDIEVCLGLRTILCALIFLVEKAHARHLNINTQSIYVTES
GSWRLAGFEYVWRATDVNKQLLDLAHSFIDLSIHGENFEQFFFSILCEKV
LSRKGADSCITDSTPHVQEFREYCSTHLKHQNTKLRPRLSAILLHPYFNH
EFVLIHSFLFELPLKSVHERHKFFRSLIDRLRYFDEEVVASQLACDLLSR
MVLLDPAAQEFVTPHILRTKVTDKAPASLFSPQIYVQYLMPHILKMFRLR
DAQIRLILLDYFMDYVRLLSDEQLESEILPHLQLGMNDTNDVLVGKTLRC
MADLVSILGANKVLGGDRTRCFSDGRPHAAVSRDSTNPFPEPRSISPLMN
TRSFDVEDFMVSASPLPQESNASPLSIRLSPDGGEDEKVGLNSNEKSISI
KHNIDPERNSNISGTEHEKVTNVDEEGTWLDWDNTDHLQQGYQVDQAPTD
SETNSNALTREIQISKSLSPSYRToooooooGVNETISQTEQKVIDDLSE
LDIKVQTVIQRSELHEFDFFKDMEPTIEIRTSTCETPEQISSRFAAAASA
VNCNELCADQGWGHDEQDoKDDIVWGVTNASTL
>C3
MGNEGSKLKGILVEENAVETNQFWTVYNAKTPATTNDERCSQMLSVFEGK
VFVKAHVWSNGVGPIERAIKNLMVYRHPYILKYIATWEKSGRKYLATERV
RPLDEVLAQQTDIEVCLGLRTILCALIFLVEKAHARHLNINTQSIYVTES
GSWRLAGFEYVWRATDVNKQLLDLAHSFIDLSIHGENFEQFFFSILCEKV
LSRKGADSCITDSTPHVQEFREYCSTHLKHQNTKLRPRLSAILLHPYFNH
EFVLIHSFLFELPLKSVHERHKFFRSLIDRLRYFDEEVVASQMACDLLSR
MVLLDPAAQEFVTPHILRTKVTDKAPASLFSPQIYVQYLMPHILKMFRLR
DAQIRLILLDYFMDYVRLLSDEQLESEILPHLQLGMNDTNDVLVGKTLRC
MADLVSILGANKVLGGDRARCFSDGRPHAAVSRDSTNPFPEPRSISPLMN
TRSFDVEDFMVSASPLPQESNASPLSIRLSPDGGEDEKVRLNSNEKSISI
KHNRDPEKNSNISGTEHEKVTNVDEEGTWLDWDNTDHLQQGYQVDQALTD
SETNSNALTREIQIGKSLSPSYRToooooooGVNETISQTEQKVIDDLSE
LDIKVQTVIQRSELNEFDFFKDMEPTIEIRTSTCETPEQISSRFAAAASA
VNCNELCADQGWGHDEQDoKDDIVWGVTNASTL
>C4
MGTEGSKLKGIIIEENEVEINKFWTVYNAKTPTKSNDERCSQLLSVFEGK
VFVKTHVWSHGVGPIERAIKNLMVYRHPYILKYVATWEKSGRKYLATERV
RPLDVVLAKQTDTEVCLGLRTILCALIFLVEKALARHLNLNTLSIYVTES
GSWRLAGFEYVWRATDVDKELLDLAHSYIDLSIHGENFEQFFFAILCEKV
LGRKGTDSCITDSTPHVQDFREYCSTHLKHQNTKLRPRLSAILLHPYFNH
EFVLIHSFLFELPLKSVHERYQFFRSLIDRLRYFDEEVVASQLSCDLLSR
MVLLDPAAQEFVTPHILRTKITDKALASLFSPQIYVKYLMPHILKMFRLR
DAQIRLILLDYFMDYIRLLSDEQLESEILPHLQLGMKDTNEILVAKTLRC
MADLVSILGADKVLGGDRSRCFSDGRPHAAVSTDIANSFPEPRSISPLMN
TRSFDVENFMVSGSPLPQERNASPLSIRLSPDGGEDEKLRLNLNENAISI
NHNSDAEKDLRRTLTEHENRANDDEEGIWFDWDNTDQLQQDYREDQVRTD
TETKSNALTTEIQISKSLLPPYRTATFNLSVGINETISMAEQKINDDLSE
LDIKVQPVIQSSELSEFDFFKDMEPVIEIKTSTCETPQQISSRLAASASA
MNCNDLCADQGWGHDEQDoKDDIQWGVRNAToo
>C5
MGTEGSKLKGIIVEENAVEINKFWTVYNAKTPTTSNDERWSQMLSVFEGK
VFPKTHIWSHGVGPIERAIKNLMVYRHPYILKYIASWEKSGRKYLATERV
RHLDEVLAQQTDIEVCLGLRTILCALIFLVEKALARHLNINTLSIYVTES
GSWRLAGFEYVWRATDVNKELLDLAHSYIDLSIHGENFEQFFFAILCEKV
LGRRGKDSCITDSTPHVQEFREYCNTHLKHQNTKLRPRLSAILLHPYFNH
EFVLIHSFLFELPLKSVQERHKFFRSLIDRLRYFDEEVVASQLASDLLSR
MVLLDPAAQEFVTPYILRTKVTDKSLASLFSPQIYVQYLIPHILKMFRLR
DAQIRLILLDYFIDYIRLLSDEQLEREILPHLQLGMNDTNDILVAKTLRC
MADLVSILGANKVLGGDRARCFSDGRPHAAVSRDIANSFPEPRSISPLMN
TRSFDVEDFMVSGSPLPQESNVSPLSIRLSPDGGEDEKVRLNSNEKSISI
NHNSDPEKDSNRSFTEHERoANVDEEGIWFDWDNTDQLQQDYREDQVRTE
SETNSNALTREIQTNKSLSPSYRTATFNLSVGINETISQKEQQVNDDLSE
LDIKVQPVIQRSELSEFDFFKDMEPVIEIKTSTCETPEQISSRFAASooA
VNCNDLCADQGWGHDEQDoKDDIVWGVTNATTI


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/64/CG1344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 5 taxa and 2073 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1480426280
      Setting output file names to "/opt/ADOPS/64/CG1344-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1577231198
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 3326361418
      Seed = 605847470
      Swapseed = 1480426280
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 64 unique site patterns
      Division 2 has 50 unique site patterns
      Division 3 has 97 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -5734.658261 -- -25.624409
         Chain 2 -- -5768.397299 -- -25.624409
         Chain 3 -- -5727.278611 -- -25.624409
         Chain 4 -- -5767.839612 -- -25.624409

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -5786.418242 -- -25.624409
         Chain 2 -- -5786.418242 -- -25.624409
         Chain 3 -- -5787.610556 -- -25.624409
         Chain 4 -- -5787.610556 -- -25.624409


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-5734.658] (-5768.397) (-5727.279) (-5767.840) * [-5786.418] (-5786.418) (-5787.611) (-5787.611) 
        500 -- [-4816.126] (-4840.142) (-4842.322) (-4840.580) * [-4833.012] (-4839.199) (-4836.720) (-4834.144) -- 0:00:00
       1000 -- (-4806.780) (-4821.992) [-4803.771] (-4821.210) * (-4816.757) (-4827.872) (-4822.006) [-4805.928] -- 0:16:39
       1500 -- [-4798.497] (-4814.752) (-4797.728) (-4815.273) * (-4813.922) (-4825.764) [-4809.182] (-4803.523) -- 0:11:05
       2000 -- [-4794.781] (-4811.025) (-4795.895) (-4808.356) * (-4804.444) (-4825.921) [-4795.689] (-4797.409) -- 0:08:19
       2500 -- (-4791.176) (-4799.354) [-4792.449] (-4805.539) * (-4798.838) (-4814.448) [-4790.324] (-4791.759) -- 0:06:39
       3000 -- (-4787.071) [-4794.840] (-4788.571) (-4799.179) * (-4803.950) (-4797.663) (-4789.999) [-4788.413] -- 0:05:32
       3500 -- [-4791.511] (-4794.896) (-4785.082) (-4798.361) * (-4794.951) [-4784.419] (-4789.272) (-4798.615) -- 0:04:44
       4000 -- [-4786.691] (-4789.716) (-4786.376) (-4795.941) * [-4790.994] (-4788.246) (-4795.323) (-4792.190) -- 0:08:18
       4500 -- (-4789.188) (-4802.095) [-4789.184] (-4788.052) * (-4796.054) (-4784.632) (-4787.110) [-4784.569] -- 0:07:22
       5000 -- (-4788.621) [-4785.780] (-4790.736) (-4787.021) * (-4793.915) (-4781.724) (-4787.706) [-4784.335] -- 0:06:38

      Average standard deviation of split frequencies: 0.000000

       5500 -- (-4782.301) [-4783.069] (-4789.380) (-4783.410) * (-4796.286) (-4786.312) [-4786.648] (-4789.721) -- 0:06:01
       6000 -- [-4787.841] (-4787.285) (-4796.271) (-4787.538) * (-4790.023) (-4790.887) (-4784.971) [-4785.597] -- 0:05:31
       6500 -- [-4788.229] (-4789.063) (-4791.670) (-4788.176) * (-4783.795) (-4785.282) (-4783.017) [-4785.444] -- 0:05:05
       7000 -- (-4785.866) (-4788.396) (-4798.562) [-4788.157] * (-4785.483) (-4785.843) [-4788.579] (-4785.239) -- 0:07:05
       7500 -- (-4783.714) (-4792.266) (-4789.403) [-4787.075] * (-4786.009) (-4782.243) (-4788.267) [-4785.126] -- 0:06:37
       8000 -- (-4791.285) (-4791.462) (-4784.561) [-4788.139] * [-4783.509] (-4786.987) (-4786.362) (-4788.061) -- 0:06:12
       8500 -- (-4789.952) (-4785.208) [-4787.435] (-4791.916) * [-4785.999] (-4783.140) (-4783.689) (-4788.143) -- 0:05:49
       9000 -- (-4788.997) (-4790.125) [-4788.935] (-4793.302) * (-4788.387) (-4791.426) [-4790.759] (-4792.157) -- 0:05:30
       9500 -- (-4783.868) [-4782.853] (-4785.886) (-4784.568) * (-4791.034) (-4786.549) (-4794.304) [-4790.655] -- 0:05:12
      10000 -- [-4788.462] (-4791.983) (-4786.440) (-4786.242) * [-4786.790] (-4786.635) (-4791.677) (-4793.995) -- 0:06:36

      Average standard deviation of split frequencies: 0.000000

      10500 -- [-4785.321] (-4784.090) (-4786.848) (-4784.719) * [-4784.999] (-4790.684) (-4793.312) (-4789.736) -- 0:06:16
      11000 -- (-4785.644) (-4789.576) (-4785.149) [-4782.608] * (-4785.848) [-4786.740] (-4788.261) (-4786.908) -- 0:05:59
      11500 -- (-4785.488) (-4792.582) (-4788.723) [-4784.409] * (-4787.805) (-4784.556) (-4796.717) [-4789.393] -- 0:05:43
      12000 -- (-4786.551) (-4783.686) (-4791.887) [-4788.688] * (-4789.125) (-4789.319) [-4787.407] (-4788.041) -- 0:05:29
      12500 -- (-4789.961) (-4785.242) (-4797.336) [-4784.033] * (-4782.767) (-4788.381) [-4788.590] (-4786.781) -- 0:05:16
      13000 -- (-4788.179) [-4784.606] (-4789.844) (-4787.378) * (-4789.285) (-4786.113) (-4785.519) [-4790.516] -- 0:06:19
      13500 -- (-4786.469) (-4786.196) (-4787.363) [-4786.073] * (-4784.339) (-4791.517) [-4783.778] (-4784.613) -- 0:06:05
      14000 -- (-4786.203) [-4783.770] (-4789.570) (-4781.499) * (-4793.400) (-4791.725) [-4783.088] (-4792.076) -- 0:05:52
      14500 -- (-4783.319) [-4785.137] (-4794.076) (-4789.510) * [-4790.326] (-4795.834) (-4784.518) (-4793.772) -- 0:05:39
      15000 -- (-4786.388) (-4790.237) [-4782.929] (-4790.291) * (-4785.962) [-4791.136] (-4781.263) (-4787.129) -- 0:05:28

      Average standard deviation of split frequencies: 0.000000

      15500 -- (-4788.096) (-4786.903) (-4784.826) [-4789.937] * [-4787.126] (-4793.865) (-4785.218) (-4790.331) -- 0:06:21
      16000 -- (-4787.947) [-4784.657] (-4786.220) (-4787.171) * (-4785.849) (-4790.992) [-4787.005] (-4787.431) -- 0:06:09
      16500 -- (-4792.737) [-4789.852] (-4785.189) (-4786.756) * [-4790.875] (-4786.440) (-4788.868) (-4786.504) -- 0:05:57
      17000 -- (-4791.183) (-4784.791) (-4783.684) [-4786.413] * (-4783.440) (-4783.168) [-4786.080] (-4791.137) -- 0:05:46
      17500 -- (-4789.562) (-4788.557) [-4781.714] (-4788.423) * (-4785.890) (-4789.269) [-4791.605] (-4790.157) -- 0:05:36
      18000 -- (-4790.185) (-4782.194) (-4786.266) [-4786.108] * (-4789.431) (-4789.622) (-4785.458) [-4786.211] -- 0:05:27
      18500 -- [-4784.856] (-4783.238) (-4782.975) (-4785.861) * (-4785.506) (-4790.864) [-4782.991] (-4789.615) -- 0:06:11
      19000 -- (-4788.143) (-4789.798) [-4785.431] (-4785.943) * [-4782.359] (-4795.684) (-4790.241) (-4791.519) -- 0:06:01
      19500 -- (-4790.909) (-4788.999) (-4785.288) [-4785.284] * (-4787.864) [-4790.493] (-4795.129) (-4787.493) -- 0:05:51
      20000 -- (-4794.931) [-4789.859] (-4792.129) (-4787.397) * (-4788.264) (-4785.114) (-4785.972) [-4787.402] -- 0:05:43

      Average standard deviation of split frequencies: 0.000000

      20500 -- [-4787.762] (-4790.157) (-4789.658) (-4788.978) * [-4783.643] (-4786.406) (-4790.486) (-4785.207) -- 0:05:34
      21000 -- [-4784.999] (-4791.048) (-4791.526) (-4785.827) * (-4790.661) [-4786.047] (-4785.170) (-4787.921) -- 0:05:26
      21500 -- [-4783.793] (-4788.697) (-4786.696) (-4791.263) * (-4792.072) [-4786.700] (-4784.921) (-4793.189) -- 0:06:04
      22000 -- (-4791.033) (-4786.814) (-4787.060) [-4791.092] * [-4786.077] (-4788.031) (-4787.881) (-4789.901) -- 0:05:55
      22500 -- (-4795.921) (-4786.829) [-4784.131] (-4791.399) * (-4790.526) (-4786.765) [-4783.975] (-4783.213) -- 0:05:47
      23000 -- (-4793.365) [-4784.626] (-4785.520) (-4786.446) * (-4787.078) (-4784.975) [-4786.855] (-4785.438) -- 0:05:39
      23500 -- (-4787.836) (-4782.833) [-4785.055] (-4789.228) * (-4786.021) [-4786.082] (-4786.461) (-4788.380) -- 0:05:32
      24000 -- (-4787.547) (-4788.076) (-4787.594) [-4789.090] * [-4783.746] (-4790.187) (-4783.475) (-4792.370) -- 0:05:25
      24500 -- [-4798.838] (-4785.633) (-4784.788) (-4787.839) * (-4791.685) [-4784.797] (-4782.062) (-4790.512) -- 0:05:58
      25000 -- (-4793.098) [-4783.017] (-4790.769) (-4784.861) * (-4788.917) (-4787.345) (-4785.550) [-4786.702] -- 0:05:51

      Average standard deviation of split frequencies: 0.000000

      25500 -- (-4788.311) (-4788.435) [-4782.595] (-4789.238) * [-4787.107] (-4785.548) (-4793.324) (-4792.214) -- 0:05:43
      26000 -- (-4790.352) (-4785.877) [-4786.098] (-4787.408) * (-4783.611) (-4792.702) [-4785.825] (-4794.236) -- 0:05:37
      26500 -- (-4786.223) [-4788.034] (-4791.020) (-4780.240) * (-4789.248) [-4787.681] (-4784.545) (-4792.391) -- 0:05:30
      27000 -- (-4788.726) (-4783.997) (-4783.476) [-4779.726] * (-4794.949) (-4789.218) [-4783.712] (-4789.337) -- 0:05:24
      27500 -- (-4792.202) [-4784.146] (-4786.402) (-4783.728) * (-4791.949) (-4784.035) [-4783.744] (-4785.117) -- 0:05:53
      28000 -- (-4791.087) [-4781.818] (-4790.257) (-4784.941) * [-4790.737] (-4791.480) (-4795.628) (-4787.363) -- 0:05:47
      28500 -- [-4789.685] (-4789.848) (-4789.849) (-4789.330) * (-4793.831) (-4794.775) [-4785.572] (-4787.856) -- 0:05:40
      29000 -- [-4786.349] (-4793.797) (-4790.063) (-4796.508) * (-4791.115) (-4788.126) [-4788.920] (-4787.801) -- 0:05:34
      29500 -- (-4788.075) (-4786.767) [-4783.732] (-4783.485) * (-4791.452) [-4784.933] (-4791.473) (-4790.337) -- 0:05:28
      30000 -- [-4788.996] (-4790.784) (-4780.846) (-4787.680) * (-4791.539) [-4782.620] (-4793.779) (-4788.516) -- 0:05:23

      Average standard deviation of split frequencies: 0.000000

      30500 -- (-4784.875) [-4787.421] (-4786.376) (-4784.229) * (-4800.774) [-4789.114] (-4787.083) (-4787.519) -- 0:05:49
      31000 -- (-4787.798) (-4786.864) [-4787.464] (-4786.833) * (-4789.896) (-4789.193) (-4788.079) [-4788.688] -- 0:05:43
      31500 -- (-4786.633) (-4791.161) [-4785.442] (-4785.265) * (-4785.840) [-4783.475] (-4789.802) (-4785.933) -- 0:05:38
      32000 -- [-4790.020] (-4791.344) (-4783.772) (-4794.359) * (-4786.839) (-4784.310) (-4789.137) [-4788.251] -- 0:05:32
      32500 -- (-4788.551) (-4789.585) (-4786.165) [-4783.810] * [-4787.613] (-4784.914) (-4785.030) (-4785.290) -- 0:05:27
      33000 -- [-4791.523] (-4796.870) (-4788.426) (-4786.700) * (-4790.295) (-4797.810) (-4790.128) [-4792.116] -- 0:05:22
      33500 -- (-4791.747) [-4792.025] (-4786.916) (-4784.116) * (-4790.706) (-4798.151) [-4785.339] (-4785.745) -- 0:05:46
      34000 -- (-4785.817) (-4789.634) (-4787.872) [-4783.486] * (-4791.658) (-4802.187) (-4790.292) [-4783.322] -- 0:05:40
      34500 -- [-4786.023] (-4788.595) (-4790.177) (-4786.629) * (-4790.543) (-4810.333) [-4784.033] (-4790.892) -- 0:05:35
      35000 -- (-4785.891) (-4789.797) (-4788.282) [-4784.574] * (-4786.671) (-4801.711) (-4784.510) [-4788.097] -- 0:05:30

      Average standard deviation of split frequencies: 0.000000

      35500 -- (-4789.673) (-4789.507) [-4787.982] (-4789.189) * (-4801.864) (-4796.668) (-4787.242) [-4789.452] -- 0:05:26
      36000 -- (-4787.035) (-4788.882) [-4788.460] (-4787.379) * (-4789.102) [-4792.535] (-4787.658) (-4789.146) -- 0:05:21
      36500 -- (-4788.363) [-4781.308] (-4788.575) (-4797.927) * (-4791.289) [-4788.361] (-4790.273) (-4788.217) -- 0:05:43
      37000 -- (-4789.363) (-4782.984) [-4787.833] (-4785.668) * (-4784.680) (-4784.039) [-4788.812] (-4788.996) -- 0:05:38
      37500 -- [-4786.730] (-4789.528) (-4789.356) (-4783.191) * [-4786.622] (-4790.459) (-4796.100) (-4794.226) -- 0:05:33
      38000 -- (-4791.580) [-4783.800] (-4791.538) (-4790.854) * [-4791.461] (-4790.150) (-4798.464) (-4793.111) -- 0:05:29
      38500 -- (-4790.655) (-4788.896) (-4788.771) [-4787.254] * (-4785.951) [-4785.498] (-4800.180) (-4791.194) -- 0:05:24
      39000 -- (-4786.906) [-4786.698] (-4791.196) (-4789.842) * (-4783.795) [-4788.453] (-4796.176) (-4787.240) -- 0:05:44
      39500 -- (-4790.497) [-4787.209] (-4788.485) (-4786.788) * (-4789.820) (-4790.803) [-4787.223] (-4794.707) -- 0:05:40
      40000 -- (-4787.978) (-4793.319) (-4793.055) [-4786.264] * (-4787.246) (-4785.461) (-4788.991) [-4792.735] -- 0:05:36

      Average standard deviation of split frequencies: 0.000000

      40500 -- [-4780.845] (-4786.447) (-4792.285) (-4794.321) * (-4786.128) [-4782.834] (-4788.384) (-4786.101) -- 0:05:31
      41000 -- (-4788.007) (-4784.861) [-4797.496] (-4794.362) * (-4793.878) (-4790.457) [-4795.404] (-4784.290) -- 0:05:27
      41500 -- (-4792.893) (-4782.177) (-4791.536) [-4788.929] * (-4794.817) (-4787.144) (-4788.828) [-4783.596] -- 0:05:23
      42000 -- [-4785.184] (-4783.888) (-4792.056) (-4787.780) * [-4787.261] (-4790.203) (-4785.175) (-4788.828) -- 0:05:42
      42500 -- (-4788.155) [-4788.098] (-4790.974) (-4786.694) * (-4785.313) (-4790.305) (-4789.345) [-4789.621] -- 0:05:37
      43000 -- (-4786.713) [-4786.887] (-4789.920) (-4786.676) * (-4788.162) [-4780.283] (-4792.287) (-4796.247) -- 0:05:33
      43500 -- (-4784.583) (-4786.556) [-4786.235] (-4783.776) * (-4790.055) (-4787.402) (-4790.096) [-4785.573] -- 0:05:29
      44000 -- (-4790.251) [-4784.441] (-4782.244) (-4790.586) * (-4785.952) (-4790.567) [-4785.769] (-4783.865) -- 0:05:25
      44500 -- (-4785.052) (-4783.282) [-4786.865] (-4784.128) * (-4794.244) (-4791.630) (-4788.895) [-4788.989] -- 0:05:22
      45000 -- [-4786.679] (-4788.286) (-4792.990) (-4785.054) * [-4784.599] (-4786.719) (-4787.927) (-4790.138) -- 0:05:39

      Average standard deviation of split frequencies: 0.000000

      45500 -- (-4790.417) (-4789.306) (-4787.639) [-4789.266] * (-4783.619) [-4792.318] (-4783.813) (-4795.371) -- 0:05:35
      46000 -- (-4789.417) (-4798.391) (-4790.745) [-4783.313] * (-4785.610) [-4791.514] (-4791.626) (-4796.523) -- 0:05:31
      46500 -- (-4783.429) [-4784.405] (-4794.186) (-4787.942) * (-4788.390) [-4794.733] (-4785.798) (-4791.662) -- 0:05:28
      47000 -- (-4782.904) (-4781.692) [-4786.685] (-4789.571) * (-4789.227) (-4788.936) (-4787.303) [-4788.553] -- 0:05:24
      47500 -- (-4789.423) [-4786.720] (-4786.527) (-4786.638) * (-4790.170) [-4790.396] (-4787.187) (-4786.385) -- 0:05:20
      48000 -- (-4783.295) [-4786.237] (-4790.967) (-4782.387) * (-4788.432) (-4793.462) (-4786.519) [-4786.781] -- 0:05:37
      48500 -- [-4784.355] (-4786.905) (-4788.107) (-4783.919) * (-4790.159) (-4791.193) (-4784.453) [-4787.091] -- 0:05:33
      49000 -- (-4789.486) (-4791.574) (-4784.474) [-4780.633] * [-4785.524] (-4786.210) (-4790.162) (-4782.578) -- 0:05:29
      49500 -- (-4787.133) [-4787.656] (-4790.432) (-4787.391) * (-4785.604) (-4788.365) (-4785.247) [-4785.650] -- 0:05:26
      50000 -- (-4786.649) (-4784.158) (-4788.618) [-4788.457] * (-4786.935) (-4786.074) [-4786.988] (-4788.444) -- 0:05:23

      Average standard deviation of split frequencies: 0.000000

      50500 -- [-4784.258] (-4789.474) (-4784.833) (-4785.722) * (-4790.180) [-4788.430] (-4785.077) (-4784.170) -- 0:05:19
      51000 -- (-4784.250) (-4791.250) (-4793.182) [-4784.563] * (-4787.874) (-4785.586) (-4785.414) [-4783.140] -- 0:05:34
      51500 -- (-4782.873) (-4788.299) [-4790.170] (-4786.558) * (-4787.294) (-4786.252) (-4786.923) [-4782.410] -- 0:05:31
      52000 -- (-4788.862) [-4787.280] (-4786.974) (-4788.193) * (-4786.076) (-4789.812) (-4790.263) [-4788.439] -- 0:05:28
      52500 -- (-4784.365) (-4790.611) [-4783.574] (-4791.166) * (-4790.930) (-4788.538) [-4791.969] (-4786.017) -- 0:05:24
      53000 -- (-4794.939) [-4786.593] (-4783.162) (-4787.027) * [-4790.710] (-4788.296) (-4802.775) (-4790.730) -- 0:05:21
      53500 -- (-4781.723) [-4783.917] (-4795.572) (-4788.140) * (-4788.416) (-4788.265) [-4789.523] (-4789.970) -- 0:05:18
      54000 -- (-4784.362) (-4784.614) (-4789.285) [-4787.302] * [-4784.031] (-4793.317) (-4787.196) (-4794.636) -- 0:05:32
      54500 -- [-4790.748] (-4785.220) (-4791.164) (-4789.013) * (-4788.195) [-4787.035] (-4789.254) (-4786.138) -- 0:05:29
      55000 -- (-4787.172) (-4788.939) [-4786.599] (-4786.277) * (-4787.506) (-4789.277) (-4790.229) [-4782.582] -- 0:05:26

      Average standard deviation of split frequencies: 0.000000

      55500 -- (-4787.953) (-4784.342) [-4785.621] (-4787.063) * (-4787.069) (-4792.608) [-4788.699] (-4785.170) -- 0:05:23
      56000 -- (-4786.718) [-4783.284] (-4783.084) (-4788.820) * (-4791.294) (-4786.197) [-4790.905] (-4786.367) -- 0:05:20
      56500 -- (-4785.442) [-4785.776] (-4787.081) (-4788.290) * (-4796.198) (-4787.474) [-4785.290] (-4788.305) -- 0:05:33
      57000 -- [-4786.504] (-4790.188) (-4788.251) (-4789.380) * (-4789.282) [-4786.643] (-4788.022) (-4787.968) -- 0:05:30
      57500 -- [-4786.430] (-4788.167) (-4792.756) (-4789.483) * (-4787.231) (-4785.486) (-4788.133) [-4784.116] -- 0:05:27
      58000 -- (-4786.149) [-4784.450] (-4789.572) (-4788.663) * (-4792.987) (-4787.607) (-4789.927) [-4789.032] -- 0:05:24
      58500 -- (-4787.783) (-4789.448) (-4793.163) [-4787.763] * (-4792.366) [-4788.280] (-4786.051) (-4787.471) -- 0:05:21
      59000 -- (-4788.754) (-4786.536) [-4787.802] (-4786.036) * (-4791.653) (-4783.475) (-4785.291) [-4786.505] -- 0:05:18
      59500 -- [-4783.853] (-4788.436) (-4793.193) (-4785.783) * [-4785.030] (-4787.102) (-4782.917) (-4789.379) -- 0:05:31
      60000 -- (-4787.526) (-4794.546) (-4790.669) [-4784.793] * (-4786.817) (-4784.651) [-4784.226] (-4788.284) -- 0:05:29

      Average standard deviation of split frequencies: 0.000000

      60500 -- [-4785.113] (-4789.808) (-4787.049) (-4788.182) * (-4783.209) (-4788.061) (-4786.352) [-4785.575] -- 0:05:26
      61000 -- (-4789.242) (-4787.799) [-4784.987] (-4789.270) * (-4787.125) (-4782.381) [-4790.439] (-4784.059) -- 0:05:23
      61500 -- (-4789.466) (-4788.197) [-4792.061] (-4791.680) * [-4789.674] (-4789.248) (-4789.598) (-4787.499) -- 0:05:20
      62000 -- [-4786.111] (-4788.551) (-4784.710) (-4793.826) * [-4792.605] (-4785.959) (-4785.190) (-4784.909) -- 0:05:17
      62500 -- (-4788.350) (-4787.212) (-4789.402) [-4791.611] * [-4787.316] (-4791.110) (-4786.167) (-4787.178) -- 0:05:30
      63000 -- (-4790.415) (-4789.479) [-4793.330] (-4792.040) * (-4786.372) (-4782.649) (-4791.635) [-4782.317] -- 0:05:27
      63500 -- (-4800.115) [-4793.718] (-4790.905) (-4787.301) * (-4789.962) (-4788.516) (-4787.971) [-4790.375] -- 0:05:24
      64000 -- (-4788.993) [-4793.686] (-4784.294) (-4782.910) * (-4790.298) (-4789.543) [-4782.383] (-4782.307) -- 0:05:21
      64500 -- (-4788.231) (-4786.734) (-4780.942) [-4780.941] * [-4781.825] (-4791.265) (-4787.653) (-4785.815) -- 0:05:19
      65000 -- (-4784.110) (-4786.784) (-4786.490) [-4784.677] * (-4785.811) (-4789.243) (-4781.274) [-4788.865] -- 0:05:16

      Average standard deviation of split frequencies: 0.000000

      65500 -- (-4788.711) (-4791.802) (-4786.775) [-4782.126] * (-4788.980) [-4787.886] (-4785.198) (-4787.448) -- 0:05:28
      66000 -- (-4788.465) (-4788.423) (-4790.402) [-4784.692] * (-4787.530) (-4785.835) [-4785.161] (-4798.036) -- 0:05:25
      66500 -- [-4787.692] (-4789.822) (-4785.858) (-4786.110) * [-4786.426] (-4788.644) (-4783.163) (-4786.925) -- 0:05:22
      67000 -- [-4789.023] (-4790.797) (-4788.100) (-4786.138) * (-4790.726) (-4782.606) [-4782.606] (-4785.659) -- 0:05:20
      67500 -- (-4791.156) (-4792.859) (-4792.846) [-4783.375] * (-4790.669) (-4786.956) [-4782.234] (-4786.724) -- 0:05:17
      68000 -- (-4784.716) [-4788.702] (-4791.537) (-4784.860) * (-4791.607) [-4788.401] (-4790.174) (-4786.714) -- 0:05:15
      68500 -- (-4790.274) [-4782.992] (-4789.679) (-4791.518) * (-4790.577) (-4789.593) (-4781.855) [-4785.406] -- 0:05:26
      69000 -- (-4794.053) (-4795.256) (-4785.075) [-4788.616] * (-4790.061) (-4788.701) [-4784.714] (-4790.676) -- 0:05:23
      69500 -- (-4788.367) (-4792.837) (-4793.992) [-4788.231] * (-4783.195) (-4788.941) [-4784.924] (-4784.153) -- 0:05:21
      70000 -- [-4788.232] (-4788.684) (-4790.492) (-4786.178) * (-4786.468) (-4786.740) [-4780.972] (-4796.995) -- 0:05:18

      Average standard deviation of split frequencies: 0.000000

      70500 -- (-4790.444) [-4788.935] (-4786.235) (-4791.286) * (-4786.198) [-4795.563] (-4789.310) (-4786.779) -- 0:05:16
      71000 -- [-4792.220] (-4786.863) (-4786.568) (-4795.588) * [-4784.022] (-4785.633) (-4793.114) (-4783.607) -- 0:05:14
      71500 -- (-4790.726) [-4788.071] (-4789.711) (-4789.026) * (-4782.585) (-4792.737) [-4787.360] (-4787.260) -- 0:05:24
      72000 -- [-4785.819] (-4786.565) (-4789.123) (-4787.662) * (-4788.102) [-4789.926] (-4790.439) (-4789.276) -- 0:05:22
      72500 -- (-4782.886) (-4793.143) [-4789.820] (-4788.540) * (-4787.181) (-4784.084) [-4788.115] (-4792.275) -- 0:05:19
      73000 -- (-4782.604) (-4782.460) [-4784.484] (-4785.200) * (-4790.468) [-4785.168] (-4786.675) (-4783.090) -- 0:05:17
      73500 -- (-4790.934) [-4785.597] (-4786.970) (-4794.802) * [-4785.089] (-4787.367) (-4787.151) (-4788.511) -- 0:05:15
      74000 -- (-4787.640) (-4783.483) [-4783.236] (-4787.762) * [-4786.750] (-4786.675) (-4786.619) (-4788.990) -- 0:05:12
      74500 -- (-4786.711) (-4792.930) [-4784.687] (-4783.375) * (-4786.072) (-4780.658) (-4794.394) [-4784.468] -- 0:05:22
      75000 -- (-4788.596) [-4791.317] (-4788.296) (-4785.313) * (-4781.242) [-4787.527] (-4786.226) (-4788.473) -- 0:05:20

      Average standard deviation of split frequencies: 0.000000

      75500 -- [-4785.218] (-4793.434) (-4796.005) (-4787.188) * (-4785.106) [-4785.823] (-4791.543) (-4785.150) -- 0:05:18
      76000 -- (-4786.221) (-4798.624) [-4787.102] (-4785.519) * [-4788.085] (-4786.760) (-4785.977) (-4793.288) -- 0:05:16
      76500 -- (-4783.902) (-4789.063) [-4785.511] (-4796.060) * (-4795.270) (-4783.426) (-4787.384) [-4785.432] -- 0:05:13
      77000 -- [-4783.830] (-4787.319) (-4787.005) (-4789.705) * (-4794.340) (-4792.996) [-4787.965] (-4789.577) -- 0:05:11
      77500 -- [-4784.706] (-4787.278) (-4782.186) (-4788.598) * [-4790.622] (-4787.799) (-4792.796) (-4791.603) -- 0:05:21
      78000 -- (-4791.557) (-4790.502) [-4782.778] (-4781.446) * (-4794.623) (-4789.504) [-4786.046] (-4789.793) -- 0:05:19
      78500 -- (-4782.800) (-4790.750) [-4783.164] (-4782.415) * (-4785.598) (-4795.208) (-4790.545) [-4784.580] -- 0:05:16
      79000 -- (-4784.096) (-4788.800) [-4788.126] (-4781.631) * [-4790.085] (-4786.698) (-4785.013) (-4787.616) -- 0:05:14
      79500 -- (-4788.241) (-4786.322) (-4783.827) [-4782.144] * (-4786.893) (-4782.687) (-4787.502) [-4785.354] -- 0:05:12
      80000 -- (-4797.173) [-4786.632] (-4783.807) (-4787.069) * [-4784.578] (-4785.995) (-4789.774) (-4787.958) -- 0:05:22

      Average standard deviation of split frequencies: 0.000000

      80500 -- (-4794.199) [-4789.270] (-4794.709) (-4786.962) * (-4783.183) (-4792.789) [-4787.726] (-4785.892) -- 0:05:19
      81000 -- (-4793.395) [-4787.359] (-4789.471) (-4785.720) * (-4784.703) (-4794.728) (-4785.566) [-4783.620] -- 0:05:17
      81500 -- (-4792.238) (-4785.812) (-4789.153) [-4782.153] * (-4794.191) (-4789.065) (-4787.381) [-4786.204] -- 0:05:15
      82000 -- (-4784.535) [-4790.176] (-4790.026) (-4783.102) * (-4784.888) [-4791.443] (-4789.932) (-4794.733) -- 0:05:13
      82500 -- (-4784.733) (-4788.756) [-4790.000] (-4785.333) * (-4784.908) (-4784.741) (-4789.232) [-4788.433] -- 0:05:11
      83000 -- (-4788.776) (-4783.031) [-4784.911] (-4784.229) * (-4788.469) (-4785.048) [-4785.504] (-4785.690) -- 0:05:20
      83500 -- [-4784.738] (-4789.178) (-4784.588) (-4785.872) * (-4791.634) (-4788.562) [-4790.071] (-4790.281) -- 0:05:18
      84000 -- (-4789.118) [-4794.572] (-4784.047) (-4786.424) * (-4791.030) (-4786.952) [-4785.225] (-4781.855) -- 0:05:16
      84500 -- (-4794.812) (-4794.476) (-4786.093) [-4788.778] * (-4788.686) (-4787.723) [-4789.327] (-4785.616) -- 0:05:14
      85000 -- [-4785.044] (-4789.820) (-4785.544) (-4786.109) * (-4785.090) (-4790.522) [-4786.474] (-4792.202) -- 0:05:12

      Average standard deviation of split frequencies: 0.000000

      85500 -- (-4785.533) (-4784.628) (-4783.997) [-4789.003] * [-4787.291] (-4787.996) (-4783.696) (-4785.991) -- 0:05:10
      86000 -- (-4784.190) [-4783.783] (-4784.556) (-4791.053) * (-4791.929) [-4784.882] (-4790.578) (-4787.111) -- 0:05:18
      86500 -- [-4782.578] (-4788.576) (-4787.978) (-4785.646) * (-4787.434) [-4792.815] (-4788.279) (-4793.536) -- 0:05:16
      87000 -- [-4786.831] (-4786.099) (-4783.217) (-4787.833) * (-4794.844) (-4792.427) (-4790.253) [-4790.159] -- 0:05:14
      87500 -- (-4783.216) (-4786.416) (-4785.700) [-4788.637] * (-4788.778) (-4785.683) [-4782.827] (-4790.801) -- 0:05:12
      88000 -- (-4788.578) (-4788.206) (-4783.962) [-4787.592] * [-4791.146] (-4788.046) (-4785.270) (-4792.519) -- 0:05:10
      88500 -- [-4787.641] (-4790.769) (-4785.488) (-4788.293) * [-4792.286] (-4793.653) (-4788.560) (-4783.902) -- 0:05:08
      89000 -- (-4784.282) (-4794.144) [-4786.372] (-4790.358) * (-4782.292) (-4791.447) (-4792.366) [-4786.053] -- 0:05:17
      89500 -- (-4790.262) (-4790.492) [-4783.905] (-4784.522) * [-4781.105] (-4786.452) (-4786.487) (-4791.155) -- 0:05:15
      90000 -- [-4789.340] (-4787.296) (-4784.742) (-4783.986) * [-4786.527] (-4792.231) (-4783.921) (-4786.970) -- 0:05:13

      Average standard deviation of split frequencies: 0.000000

      90500 -- [-4785.187] (-4792.833) (-4786.938) (-4785.547) * [-4783.240] (-4783.756) (-4784.654) (-4790.343) -- 0:05:11
      91000 -- (-4783.135) (-4788.144) (-4785.846) [-4785.793] * (-4788.369) (-4787.215) [-4785.627] (-4789.670) -- 0:05:09
      91500 -- (-4794.483) (-4789.930) [-4787.860] (-4781.741) * (-4788.734) (-4791.706) [-4784.892] (-4793.465) -- 0:05:07
      92000 -- (-4785.649) (-4786.986) (-4789.685) [-4785.620] * [-4783.892] (-4786.185) (-4790.561) (-4787.694) -- 0:05:15
      92500 -- (-4786.857) (-4790.946) (-4786.224) [-4787.501] * [-4787.426] (-4786.613) (-4783.569) (-4791.267) -- 0:05:13
      93000 -- (-4792.795) (-4789.670) (-4794.348) [-4785.211] * (-4783.895) (-4783.074) [-4785.600] (-4784.601) -- 0:05:12
      93500 -- (-4790.028) (-4784.712) [-4789.544] (-4785.720) * [-4788.345] (-4786.352) (-4783.869) (-4784.893) -- 0:05:10
      94000 -- [-4782.896] (-4784.480) (-4788.285) (-4784.830) * [-4789.858] (-4786.065) (-4787.398) (-4793.127) -- 0:05:08
      94500 -- (-4785.594) [-4787.554] (-4793.785) (-4789.281) * (-4788.797) (-4788.468) (-4786.818) [-4786.870] -- 0:05:16
      95000 -- [-4791.859] (-4793.311) (-4795.041) (-4789.998) * (-4787.178) [-4783.814] (-4791.412) (-4796.144) -- 0:05:14

      Average standard deviation of split frequencies: 0.000000

      95500 -- (-4785.191) (-4794.358) (-4790.523) [-4792.066] * (-4785.751) [-4784.577] (-4785.141) (-4786.069) -- 0:05:12
      96000 -- (-4797.001) (-4799.273) (-4783.346) [-4786.111] * (-4788.404) [-4783.590] (-4788.297) (-4785.063) -- 0:05:10
      96500 -- (-4782.589) (-4788.308) [-4780.993] (-4791.311) * (-4793.503) [-4781.869] (-4784.504) (-4790.822) -- 0:05:08
      97000 -- (-4793.026) (-4780.829) [-4786.169] (-4793.355) * (-4787.807) [-4784.909] (-4788.125) (-4794.572) -- 0:05:07
      97500 -- (-4788.023) [-4787.444] (-4789.444) (-4795.024) * (-4787.434) (-4786.671) (-4788.190) [-4786.908] -- 0:05:14
      98000 -- (-4787.172) (-4789.937) (-4794.241) [-4784.252] * (-4786.165) (-4784.291) [-4784.314] (-4793.819) -- 0:05:12
      98500 -- (-4795.233) (-4787.933) (-4790.209) [-4788.657] * (-4794.406) (-4786.367) (-4784.842) [-4786.119] -- 0:05:11
      99000 -- [-4786.047] (-4789.913) (-4792.286) (-4787.765) * (-4789.350) (-4787.909) [-4780.538] (-4786.998) -- 0:05:09
      99500 -- (-4786.398) (-4789.240) [-4792.112] (-4795.802) * (-4783.650) (-4792.789) [-4789.587] (-4783.161) -- 0:05:07
      100000 -- [-4784.189] (-4790.337) (-4783.788) (-4791.178) * (-4790.425) (-4787.863) (-4790.166) [-4788.633] -- 0:05:06

      Average standard deviation of split frequencies: 0.000000

      100500 -- (-4783.845) (-4793.282) [-4787.460] (-4795.482) * (-4784.123) (-4804.000) (-4785.582) [-4789.270] -- 0:05:13
      101000 -- [-4787.886] (-4787.634) (-4795.945) (-4794.951) * [-4782.525] (-4799.435) (-4795.517) (-4790.273) -- 0:05:11
      101500 -- (-4790.468) (-4783.987) [-4785.840] (-4789.031) * (-4784.596) (-4798.570) [-4793.743] (-4784.789) -- 0:05:09
      102000 -- (-4787.255) [-4783.454] (-4780.536) (-4792.763) * (-4787.181) (-4788.560) [-4786.397] (-4790.312) -- 0:05:08
      102500 -- (-4788.897) (-4787.622) [-4784.867] (-4794.692) * [-4778.900] (-4787.703) (-4786.873) (-4792.550) -- 0:05:06
      103000 -- [-4783.546] (-4792.026) (-4783.633) (-4789.801) * (-4789.653) (-4784.845) (-4786.650) [-4786.659] -- 0:05:04
      103500 -- (-4783.107) (-4793.771) [-4783.999] (-4790.202) * (-4791.478) [-4788.109] (-4782.997) (-4786.077) -- 0:05:11
      104000 -- [-4781.214] (-4794.123) (-4785.556) (-4795.139) * (-4783.986) (-4786.315) (-4788.022) [-4783.675] -- 0:05:10
      104500 -- (-4783.405) (-4794.215) (-4785.719) [-4791.092] * (-4783.831) (-4783.782) (-4784.994) [-4783.971] -- 0:05:08
      105000 -- (-4787.327) [-4797.732] (-4794.369) (-4789.674) * (-4787.006) [-4789.146] (-4788.776) (-4787.961) -- 0:05:06

      Average standard deviation of split frequencies: 0.000000

      105500 -- (-4785.195) [-4788.915] (-4792.044) (-4783.842) * (-4787.389) (-4791.267) (-4785.502) [-4782.802] -- 0:05:05
      106000 -- (-4786.599) [-4785.896] (-4790.542) (-4784.551) * (-4790.295) [-4786.215] (-4791.309) (-4792.726) -- 0:05:03
      106500 -- (-4789.381) [-4783.831] (-4789.061) (-4794.858) * [-4787.254] (-4788.653) (-4790.078) (-4787.363) -- 0:05:10
      107000 -- (-4793.800) (-4785.996) [-4785.095] (-4784.705) * (-4789.277) (-4790.709) [-4792.509] (-4784.123) -- 0:05:08
      107500 -- (-4786.823) (-4793.166) (-4783.624) [-4787.491] * (-4790.376) (-4794.078) [-4788.161] (-4784.387) -- 0:05:07
      108000 -- [-4791.271] (-4787.281) (-4783.836) (-4786.897) * (-4787.283) (-4789.106) [-4785.179] (-4783.607) -- 0:05:05
      108500 -- [-4783.988] (-4784.744) (-4791.518) (-4789.995) * (-4786.776) (-4786.789) [-4790.307] (-4783.274) -- 0:05:04
      109000 -- [-4788.751] (-4785.192) (-4789.764) (-4793.368) * (-4784.427) [-4787.088] (-4788.832) (-4790.736) -- 0:05:02
      109500 -- (-4789.450) [-4786.408] (-4787.934) (-4788.993) * (-4786.553) (-4786.686) (-4782.050) [-4792.291] -- 0:05:09
      110000 -- (-4784.103) [-4786.477] (-4786.521) (-4788.687) * (-4787.720) [-4785.990] (-4782.509) (-4783.049) -- 0:05:07

      Average standard deviation of split frequencies: 0.000000

      110500 -- [-4784.597] (-4787.469) (-4789.960) (-4786.001) * (-4798.995) (-4785.937) [-4785.667] (-4784.581) -- 0:05:05
      111000 -- (-4783.337) (-4783.854) [-4783.460] (-4783.842) * (-4792.271) (-4785.289) [-4787.596] (-4786.615) -- 0:05:04
      111500 -- (-4784.734) (-4784.581) [-4784.938] (-4785.744) * (-4785.435) [-4788.842] (-4793.934) (-4795.024) -- 0:05:02
      112000 -- (-4785.266) (-4787.336) [-4784.599] (-4785.659) * [-4792.091] (-4790.934) (-4795.696) (-4798.282) -- 0:05:01
      112500 -- [-4787.165] (-4784.341) (-4786.104) (-4784.497) * [-4792.517] (-4790.797) (-4798.879) (-4790.202) -- 0:05:07
      113000 -- (-4792.659) [-4782.675] (-4793.975) (-4788.996) * (-4792.183) (-4784.668) [-4786.483] (-4790.171) -- 0:05:06
      113500 -- (-4792.382) [-4782.999] (-4788.814) (-4783.223) * (-4790.167) (-4782.898) [-4786.344] (-4787.586) -- 0:05:04
      114000 -- (-4793.259) (-4784.243) (-4784.887) [-4782.788] * (-4789.921) (-4791.699) (-4786.351) [-4783.338] -- 0:05:03
      114500 -- (-4796.469) (-4789.404) [-4785.742] (-4783.750) * (-4786.911) [-4783.854] (-4783.103) (-4794.514) -- 0:05:01
      115000 -- (-4792.335) [-4789.132] (-4785.671) (-4785.450) * [-4783.312] (-4784.156) (-4787.288) (-4792.229) -- 0:05:07

      Average standard deviation of split frequencies: 0.000000

      115500 -- (-4791.923) (-4782.601) (-4789.829) [-4782.949] * (-4789.455) (-4785.743) (-4792.922) [-4784.461] -- 0:05:06
      116000 -- (-4793.399) (-4784.826) [-4786.228] (-4786.267) * (-4789.591) (-4788.336) [-4788.029] (-4788.052) -- 0:05:04
      116500 -- (-4788.166) [-4792.503] (-4786.954) (-4788.180) * [-4789.300] (-4783.304) (-4794.366) (-4788.472) -- 0:05:03
      117000 -- (-4787.221) (-4793.875) (-4791.227) [-4784.868] * [-4782.807] (-4785.549) (-4790.746) (-4789.075) -- 0:05:01
      117500 -- (-4788.421) [-4787.467] (-4794.078) (-4787.123) * (-4789.467) (-4789.811) [-4788.867] (-4785.364) -- 0:05:00
      118000 -- (-4784.753) (-4792.762) [-4788.298] (-4785.422) * (-4780.965) [-4793.826] (-4785.451) (-4784.940) -- 0:05:06
      118500 -- (-4785.539) [-4789.631] (-4789.587) (-4786.804) * (-4783.095) (-4795.774) [-4786.237] (-4784.105) -- 0:05:04
      119000 -- (-4787.659) (-4785.587) (-4800.466) [-4787.214] * (-4782.738) [-4783.755] (-4784.976) (-4783.755) -- 0:05:03
      119500 -- [-4782.244] (-4790.537) (-4793.394) (-4790.397) * (-4784.389) (-4789.216) (-4785.196) [-4786.355] -- 0:05:02
      120000 -- (-4788.542) (-4790.153) [-4786.439] (-4789.925) * (-4783.286) (-4789.003) (-4789.850) [-4785.861] -- 0:05:00

      Average standard deviation of split frequencies: 0.000000

      120500 -- [-4789.090] (-4789.004) (-4789.315) (-4801.852) * (-4784.776) [-4782.464] (-4789.957) (-4793.794) -- 0:04:59
      121000 -- [-4785.812] (-4794.412) (-4787.650) (-4796.111) * [-4785.522] (-4787.775) (-4783.554) (-4796.058) -- 0:05:05
      121500 -- (-4784.379) (-4790.788) [-4786.752] (-4787.338) * (-4790.353) (-4791.670) [-4786.985] (-4789.038) -- 0:05:03
      122000 -- (-4788.336) [-4789.276] (-4789.034) (-4784.824) * [-4790.971] (-4790.477) (-4788.759) (-4786.283) -- 0:05:02
      122500 -- (-4789.017) (-4792.314) (-4786.857) [-4785.585] * (-4785.614) [-4785.643] (-4787.759) (-4784.463) -- 0:05:00
      123000 -- (-4797.011) (-4782.526) [-4792.315] (-4791.534) * (-4788.887) (-4785.757) [-4785.634] (-4784.004) -- 0:04:59
      123500 -- (-4792.905) (-4789.163) [-4787.284] (-4785.044) * (-4787.824) (-4789.184) (-4782.733) [-4782.655] -- 0:04:58
      124000 -- (-4783.044) (-4786.202) [-4783.801] (-4783.145) * [-4784.486] (-4786.009) (-4789.629) (-4787.552) -- 0:05:03
      124500 -- [-4783.244] (-4794.582) (-4782.578) (-4791.997) * [-4781.107] (-4786.574) (-4791.726) (-4788.366) -- 0:05:02
      125000 -- (-4784.443) (-4791.129) (-4795.627) [-4788.621] * (-4786.805) [-4786.654] (-4793.194) (-4793.601) -- 0:05:01

      Average standard deviation of split frequencies: 0.000000

      125500 -- [-4788.064] (-4788.133) (-4785.849) (-4786.071) * (-4783.841) (-4789.393) (-4792.732) [-4787.397] -- 0:04:59
      126000 -- (-4791.952) [-4787.789] (-4786.095) (-4792.215) * [-4784.013] (-4791.689) (-4786.004) (-4787.365) -- 0:04:58
      126500 -- (-4784.946) (-4787.753) [-4788.619] (-4789.787) * [-4784.788] (-4782.943) (-4782.147) (-4788.367) -- 0:04:56
      127000 -- (-4782.702) (-4783.834) [-4791.684] (-4789.102) * (-4785.071) (-4784.543) [-4787.123] (-4796.870) -- 0:05:02
      127500 -- [-4786.279] (-4786.656) (-4789.178) (-4789.047) * (-4789.820) (-4789.311) (-4791.772) [-4790.377] -- 0:05:01
      128000 -- [-4783.235] (-4789.063) (-4789.345) (-4783.125) * (-4783.145) (-4785.157) (-4784.541) [-4785.979] -- 0:04:59
      128500 -- [-4792.264] (-4785.133) (-4793.041) (-4783.251) * (-4788.244) [-4784.759] (-4785.936) (-4789.657) -- 0:04:58
      129000 -- (-4785.965) (-4790.383) [-4782.380] (-4793.056) * (-4787.135) [-4784.233] (-4786.965) (-4784.402) -- 0:04:57
      129500 -- (-4781.620) [-4781.581] (-4790.392) (-4789.760) * [-4783.607] (-4785.343) (-4791.382) (-4785.914) -- 0:04:55
      130000 -- (-4789.448) (-4784.517) (-4788.396) [-4793.061] * [-4788.916] (-4784.519) (-4790.836) (-4784.375) -- 0:05:01

      Average standard deviation of split frequencies: 0.000000

      130500 -- (-4783.436) (-4783.002) (-4782.958) [-4785.773] * (-4789.342) [-4786.376] (-4788.524) (-4792.268) -- 0:04:59
      131000 -- (-4785.203) (-4785.905) [-4787.365] (-4793.780) * (-4781.528) (-4785.137) (-4783.655) [-4788.835] -- 0:04:58
      131500 -- (-4781.848) (-4783.453) [-4785.731] (-4796.969) * [-4787.219] (-4793.445) (-4783.604) (-4783.115) -- 0:04:57
      132000 -- [-4786.486] (-4788.273) (-4792.410) (-4787.851) * (-4785.848) (-4790.907) (-4791.773) [-4789.061] -- 0:04:55
      132500 -- (-4788.970) (-4792.142) [-4788.191] (-4785.301) * (-4786.173) (-4792.413) [-4786.590] (-4790.662) -- 0:05:01
      133000 -- (-4784.287) (-4793.856) [-4786.321] (-4788.791) * (-4789.774) [-4783.692] (-4783.853) (-4788.735) -- 0:04:59
      133500 -- [-4790.708] (-4783.490) (-4782.529) (-4787.743) * (-4787.683) (-4786.189) (-4785.890) [-4787.469] -- 0:04:58
      134000 -- (-4791.112) (-4788.555) (-4783.350) [-4787.999] * (-4787.363) (-4788.773) (-4787.191) [-4785.006] -- 0:04:57
      134500 -- (-4792.264) (-4788.402) (-4782.775) [-4783.996] * (-4785.951) (-4783.370) [-4789.254] (-4788.440) -- 0:04:56
      135000 -- (-4791.875) (-4789.095) [-4786.863] (-4783.822) * (-4780.429) (-4785.870) [-4784.691] (-4783.272) -- 0:04:54

      Average standard deviation of split frequencies: 0.000000

      135500 -- (-4789.385) [-4787.804] (-4787.477) (-4784.182) * (-4784.507) (-4793.417) [-4785.287] (-4789.869) -- 0:04:59
      136000 -- (-4795.868) [-4790.338] (-4791.993) (-4785.566) * (-4783.323) [-4789.565] (-4780.978) (-4785.822) -- 0:04:58
      136500 -- (-4785.109) [-4785.237] (-4790.905) (-4789.247) * (-4784.212) [-4786.766] (-4785.328) (-4785.832) -- 0:04:57
      137000 -- [-4785.219] (-4789.866) (-4793.489) (-4785.275) * (-4788.547) [-4786.294] (-4788.566) (-4786.005) -- 0:04:56
      137500 -- (-4784.950) [-4780.938] (-4787.469) (-4784.291) * (-4787.196) [-4786.395] (-4790.526) (-4786.131) -- 0:04:54
      138000 -- [-4786.630] (-4788.233) (-4785.345) (-4783.015) * (-4787.508) [-4782.652] (-4786.374) (-4786.288) -- 0:04:53
      138500 -- (-4788.066) (-4789.812) (-4784.138) [-4788.906] * (-4788.708) (-4781.785) [-4785.658] (-4788.018) -- 0:04:58
      139000 -- (-4788.055) (-4785.732) (-4785.219) [-4782.942] * (-4793.292) [-4786.823] (-4786.689) (-4786.536) -- 0:04:57
      139500 -- (-4785.542) (-4781.877) (-4793.861) [-4785.261] * (-4785.675) (-4788.099) [-4785.591] (-4794.085) -- 0:04:56
      140000 -- (-4787.437) (-4781.601) (-4786.734) [-4781.015] * (-4790.540) (-4790.895) (-4788.522) [-4787.868] -- 0:04:54

      Average standard deviation of split frequencies: 0.000000

      140500 -- (-4783.199) (-4790.957) [-4785.474] (-4785.938) * (-4799.774) (-4793.657) (-4794.667) [-4784.305] -- 0:04:53
      141000 -- (-4783.274) (-4788.989) (-4791.871) [-4786.987] * [-4792.348] (-4783.958) (-4790.966) (-4787.417) -- 0:04:52
      141500 -- (-4784.982) [-4786.614] (-4784.623) (-4790.621) * (-4787.594) [-4781.380] (-4785.300) (-4788.172) -- 0:04:57
      142000 -- [-4784.362] (-4792.469) (-4785.580) (-4788.597) * (-4790.971) (-4795.546) [-4781.585] (-4786.671) -- 0:04:56
      142500 -- (-4794.526) (-4788.030) [-4786.168] (-4787.449) * [-4790.390] (-4793.203) (-4784.129) (-4793.178) -- 0:04:54
      143000 -- (-4793.012) (-4786.783) (-4788.709) [-4783.903] * (-4787.787) (-4784.792) (-4786.092) [-4794.482] -- 0:04:53
      143500 -- (-4793.425) [-4783.410] (-4789.098) (-4792.832) * [-4786.631] (-4785.873) (-4786.167) (-4789.642) -- 0:04:52
      144000 -- (-4796.785) (-4784.418) [-4786.403] (-4784.873) * (-4784.186) (-4785.548) (-4789.554) [-4784.489] -- 0:04:51
      144500 -- (-4786.566) (-4792.092) [-4787.648] (-4786.535) * (-4789.247) (-4787.166) [-4784.005] (-4786.602) -- 0:04:56
      145000 -- (-4793.186) (-4783.712) (-4788.022) [-4789.502] * (-4796.390) [-4782.136] (-4787.913) (-4791.731) -- 0:04:54

      Average standard deviation of split frequencies: 0.000000

      145500 -- (-4788.588) (-4793.790) (-4789.113) [-4785.675] * (-4790.443) (-4794.062) [-4789.344] (-4788.326) -- 0:04:53
      146000 -- (-4787.763) (-4793.109) [-4787.677] (-4785.993) * [-4792.335] (-4790.239) (-4787.716) (-4787.633) -- 0:04:52
      146500 -- (-4800.089) (-4791.293) (-4786.486) [-4789.443] * (-4795.290) [-4786.128] (-4792.971) (-4792.379) -- 0:04:51
      147000 -- (-4788.379) (-4785.367) [-4788.699] (-4794.027) * (-4796.013) (-4792.024) (-4788.800) [-4790.980] -- 0:04:50
      147500 -- (-4789.292) (-4788.832) (-4791.648) [-4786.730] * (-4789.123) (-4786.460) (-4787.834) [-4791.819] -- 0:04:54
      148000 -- (-4790.477) (-4793.306) [-4784.105] (-4788.406) * (-4784.889) [-4783.277] (-4788.527) (-4791.603) -- 0:04:53
      148500 -- (-4789.573) (-4796.575) [-4787.763] (-4789.691) * (-4785.563) (-4790.282) [-4784.950] (-4793.868) -- 0:04:52
      149000 -- [-4789.346] (-4788.943) (-4785.733) (-4793.831) * (-4791.445) (-4782.394) [-4786.906] (-4788.901) -- 0:04:51
      149500 -- (-4794.649) [-4785.724] (-4786.324) (-4785.261) * [-4783.288] (-4782.309) (-4788.889) (-4782.634) -- 0:04:50
      150000 -- (-4789.306) [-4791.224] (-4784.788) (-4786.858) * (-4790.668) (-4785.442) [-4790.881] (-4783.718) -- 0:04:49

      Average standard deviation of split frequencies: 0.000000

      150500 -- (-4786.560) [-4786.527] (-4789.068) (-4797.391) * [-4785.927] (-4785.776) (-4789.131) (-4782.639) -- 0:04:53
      151000 -- [-4782.548] (-4792.227) (-4792.632) (-4787.609) * (-4791.856) (-4790.001) [-4784.729] (-4787.847) -- 0:04:52
      151500 -- (-4784.675) (-4786.570) [-4786.922] (-4788.186) * (-4783.913) (-4785.482) (-4782.753) [-4786.493] -- 0:04:51
      152000 -- (-4784.885) [-4785.709] (-4785.491) (-4787.265) * (-4785.764) (-4786.674) [-4785.962] (-4782.796) -- 0:04:50
      152500 -- [-4787.340] (-4786.241) (-4791.767) (-4792.108) * (-4780.731) [-4783.337] (-4791.642) (-4783.646) -- 0:04:48
      153000 -- [-4788.852] (-4794.155) (-4784.914) (-4789.233) * (-4786.320) (-4785.261) [-4784.792] (-4787.658) -- 0:04:47
      153500 -- (-4785.581) [-4787.737] (-4790.403) (-4789.456) * [-4790.450] (-4791.382) (-4795.157) (-4789.359) -- 0:04:52
      154000 -- [-4781.289] (-4788.442) (-4789.911) (-4788.947) * [-4790.462] (-4788.171) (-4785.677) (-4789.569) -- 0:04:51
      154500 -- (-4787.822) (-4789.766) [-4789.769] (-4788.341) * (-4789.366) [-4784.936] (-4790.893) (-4786.969) -- 0:04:50
      155000 -- (-4783.205) (-4793.889) (-4788.354) [-4783.961] * (-4784.117) (-4785.468) [-4786.370] (-4790.708) -- 0:04:48

      Average standard deviation of split frequencies: 0.000000

      155500 -- (-4787.409) [-4790.962] (-4791.380) (-4783.162) * [-4788.345] (-4785.878) (-4783.017) (-4786.582) -- 0:04:47
      156000 -- (-4787.187) (-4790.001) (-4786.087) [-4780.235] * (-4789.330) (-4784.187) (-4788.101) [-4782.582] -- 0:04:52
      156500 -- [-4788.546] (-4790.708) (-4787.249) (-4782.740) * (-4783.417) (-4783.968) (-4788.428) [-4783.841] -- 0:04:51
      157000 -- [-4785.593] (-4783.943) (-4788.874) (-4788.944) * (-4790.358) (-4784.829) [-4784.119] (-4789.231) -- 0:04:49
      157500 -- (-4784.336) (-4786.225) [-4788.843] (-4790.122) * (-4790.285) [-4782.560] (-4785.439) (-4789.915) -- 0:04:48
      158000 -- [-4782.198] (-4793.763) (-4795.321) (-4788.933) * (-4784.399) (-4789.968) [-4788.154] (-4789.685) -- 0:04:47
      158500 -- (-4789.887) (-4784.913) (-4788.213) [-4785.241] * (-4790.109) [-4783.018] (-4786.734) (-4787.135) -- 0:04:46
      159000 -- (-4785.309) (-4786.968) (-4786.150) [-4784.324] * (-4785.787) (-4784.790) (-4787.348) [-4785.942] -- 0:04:50
      159500 -- (-4796.088) (-4785.642) (-4789.579) [-4785.932] * (-4789.061) (-4786.312) (-4789.785) [-4785.779] -- 0:04:49
      160000 -- (-4792.256) [-4783.756] (-4785.493) (-4784.806) * [-4782.951] (-4787.180) (-4796.881) (-4793.849) -- 0:04:48

      Average standard deviation of split frequencies: 0.000000

      160500 -- (-4788.649) [-4782.065] (-4785.964) (-4790.701) * (-4791.765) (-4794.214) (-4797.129) [-4794.167] -- 0:04:47
      161000 -- (-4786.294) [-4788.231] (-4785.876) (-4791.140) * (-4789.897) (-4793.062) (-4789.242) [-4783.881] -- 0:04:46
      161500 -- (-4785.276) (-4789.729) [-4781.314] (-4784.896) * (-4785.775) (-4792.736) [-4786.110] (-4789.974) -- 0:04:45
      162000 -- (-4787.754) (-4785.679) (-4789.044) [-4786.125] * [-4783.384] (-4798.169) (-4787.915) (-4787.357) -- 0:04:49
      162500 -- [-4788.179] (-4784.639) (-4790.223) (-4780.868) * (-4781.952) [-4784.543] (-4788.847) (-4789.945) -- 0:04:48
      163000 -- (-4788.013) (-4786.175) [-4787.547] (-4783.872) * (-4786.813) (-4785.780) (-4784.073) [-4785.869] -- 0:04:47
      163500 -- [-4786.116] (-4786.157) (-4802.766) (-4788.448) * [-4787.038] (-4783.266) (-4784.524) (-4791.889) -- 0:04:46
      164000 -- [-4783.115] (-4787.631) (-4791.500) (-4788.119) * (-4783.802) [-4791.696] (-4792.774) (-4786.220) -- 0:04:45
      164500 -- [-4785.078] (-4786.926) (-4787.046) (-4786.207) * (-4787.410) (-4787.094) [-4789.467] (-4781.683) -- 0:04:44
      165000 -- [-4782.984] (-4795.838) (-4787.143) (-4786.416) * [-4789.638] (-4788.628) (-4784.103) (-4786.232) -- 0:04:48

      Average standard deviation of split frequencies: 0.000000

      165500 -- [-4780.008] (-4792.335) (-4780.818) (-4784.640) * (-4783.542) [-4789.735] (-4792.679) (-4787.650) -- 0:04:47
      166000 -- (-4798.995) (-4790.350) (-4785.776) [-4791.893] * (-4790.206) [-4786.259] (-4787.170) (-4788.517) -- 0:04:46
      166500 -- (-4789.800) [-4792.759] (-4785.615) (-4787.763) * [-4785.739] (-4787.530) (-4783.665) (-4798.660) -- 0:04:45
      167000 -- (-4792.126) (-4792.602) [-4781.464] (-4788.232) * (-4794.030) (-4781.893) (-4788.758) [-4783.677] -- 0:04:44
      167500 -- (-4790.652) (-4783.240) [-4784.411] (-4783.896) * [-4786.965] (-4786.350) (-4789.272) (-4789.064) -- 0:04:43
      168000 -- [-4785.569] (-4783.561) (-4790.347) (-4787.789) * (-4784.901) [-4789.956] (-4785.980) (-4787.264) -- 0:04:47
      168500 -- (-4791.683) (-4792.403) [-4788.327] (-4790.320) * (-4784.318) (-4786.754) (-4782.710) [-4788.201] -- 0:04:46
      169000 -- (-4794.379) [-4786.532] (-4792.483) (-4787.161) * (-4787.053) (-4791.228) (-4785.674) [-4783.957] -- 0:04:45
      169500 -- (-4786.581) [-4785.732] (-4789.048) (-4788.815) * (-4790.788) [-4787.052] (-4785.311) (-4789.124) -- 0:04:44
      170000 -- (-4783.059) [-4786.087] (-4791.067) (-4786.612) * (-4784.805) [-4785.584] (-4785.218) (-4785.007) -- 0:04:43

      Average standard deviation of split frequencies: 0.000000

      170500 -- [-4781.434] (-4783.689) (-4793.751) (-4795.000) * (-4786.462) (-4782.449) [-4791.737] (-4788.298) -- 0:04:42
      171000 -- (-4785.000) (-4792.960) [-4790.358] (-4784.810) * (-4787.835) (-4781.193) (-4792.275) [-4788.034] -- 0:04:46
      171500 -- (-4784.490) (-4788.916) (-4785.753) [-4785.259] * (-4789.933) (-4789.499) [-4788.222] (-4791.323) -- 0:04:45
      172000 -- (-4785.090) (-4800.855) [-4786.526] (-4788.810) * (-4788.957) [-4787.367] (-4789.532) (-4789.840) -- 0:04:44
      172500 -- (-4788.387) (-4793.988) (-4788.496) [-4783.031] * (-4788.716) (-4785.607) (-4787.032) [-4788.747] -- 0:04:43
      173000 -- (-4787.556) [-4783.600] (-4785.852) (-4788.780) * (-4785.662) (-4789.615) [-4787.385] (-4779.810) -- 0:04:42
      173500 -- (-4793.747) (-4790.812) [-4785.967] (-4787.928) * [-4789.981] (-4787.807) (-4785.283) (-4784.071) -- 0:04:45
      174000 -- (-4787.394) [-4788.875] (-4781.867) (-4785.273) * (-4788.258) [-4789.676] (-4787.981) (-4781.993) -- 0:04:44
      174500 -- (-4793.848) (-4793.898) [-4784.949] (-4789.056) * (-4789.915) [-4789.764] (-4785.454) (-4786.784) -- 0:04:43
      175000 -- (-4787.934) (-4787.796) [-4785.784] (-4788.884) * (-4790.222) (-4793.385) [-4790.184] (-4794.271) -- 0:04:42

      Average standard deviation of split frequencies: 0.000000

      175500 -- (-4785.419) (-4784.993) [-4785.702] (-4783.695) * (-4792.600) (-4792.644) [-4785.680] (-4802.541) -- 0:04:41
      176000 -- [-4787.480] (-4790.851) (-4783.638) (-4786.879) * (-4794.372) (-4782.282) [-4789.021] (-4792.938) -- 0:04:40
      176500 -- [-4790.683] (-4783.945) (-4787.170) (-4795.019) * (-4785.188) [-4782.434] (-4785.938) (-4784.608) -- 0:04:44
      177000 -- (-4793.406) (-4791.427) (-4795.467) [-4784.482] * (-4790.771) (-4785.373) [-4794.608] (-4785.763) -- 0:04:43
      177500 -- (-4793.387) (-4789.478) [-4786.905] (-4787.108) * (-4786.396) (-4790.902) (-4791.227) [-4785.933] -- 0:04:42
      178000 -- (-4792.812) (-4782.251) [-4795.129] (-4786.809) * [-4788.454] (-4785.235) (-4781.770) (-4786.922) -- 0:04:41
      178500 -- (-4785.417) [-4784.430] (-4797.535) (-4784.923) * (-4783.045) [-4786.323] (-4784.898) (-4786.199) -- 0:04:40
      179000 -- (-4798.503) (-4788.075) (-4788.654) [-4784.191] * (-4786.479) (-4791.587) [-4785.816] (-4784.403) -- 0:04:39
      179500 -- (-4784.144) (-4787.753) [-4784.059] (-4786.866) * (-4790.557) [-4786.552] (-4792.759) (-4790.603) -- 0:04:43
      180000 -- (-4783.964) (-4788.783) [-4782.983] (-4782.713) * (-4789.150) (-4786.189) (-4787.252) [-4783.754] -- 0:04:42

      Average standard deviation of split frequencies: 0.000000

      180500 -- [-4781.503] (-4785.755) (-4786.635) (-4795.100) * (-4788.789) (-4782.913) [-4785.426] (-4783.591) -- 0:04:41
      181000 -- [-4785.679] (-4784.974) (-4784.644) (-4789.410) * (-4793.875) (-4794.376) (-4786.983) [-4786.152] -- 0:04:40
      181500 -- [-4785.147] (-4783.555) (-4788.907) (-4782.493) * (-4792.185) (-4784.425) [-4793.999] (-4786.711) -- 0:04:39
      182000 -- (-4783.928) [-4786.782] (-4786.438) (-4785.508) * (-4792.681) [-4782.582] (-4787.633) (-4784.130) -- 0:04:38
      182500 -- [-4780.530] (-4791.352) (-4789.237) (-4785.203) * [-4786.679] (-4789.515) (-4789.256) (-4786.001) -- 0:04:42
      183000 -- (-4786.960) (-4792.946) [-4784.056] (-4789.387) * (-4787.083) [-4786.642] (-4785.367) (-4783.586) -- 0:04:41
      183500 -- (-4790.091) [-4791.435] (-4786.377) (-4783.100) * (-4788.246) (-4789.725) (-4781.238) [-4788.097] -- 0:04:40
      184000 -- [-4780.167] (-4789.259) (-4783.263) (-4784.862) * (-4792.984) [-4783.741] (-4786.675) (-4784.145) -- 0:04:39
      184500 -- (-4787.158) (-4789.732) [-4786.690] (-4785.060) * [-4787.347] (-4785.041) (-4791.957) (-4784.473) -- 0:04:38
      185000 -- (-4788.510) (-4790.734) [-4788.060] (-4782.381) * (-4790.357) [-4785.214] (-4792.255) (-4783.785) -- 0:04:37

      Average standard deviation of split frequencies: 0.000000

      185500 -- (-4787.364) [-4784.376] (-4790.330) (-4785.660) * (-4792.703) (-4786.860) (-4790.794) [-4787.636] -- 0:04:41
      186000 -- (-4787.575) (-4782.861) (-4786.062) [-4787.003] * (-4786.416) (-4781.869) [-4787.808] (-4786.475) -- 0:04:40
      186500 -- [-4780.693] (-4784.481) (-4785.622) (-4790.992) * (-4790.750) [-4785.052] (-4793.868) (-4785.997) -- 0:04:39
      187000 -- [-4786.147] (-4789.944) (-4790.799) (-4790.991) * (-4790.543) [-4792.740] (-4797.391) (-4796.250) -- 0:04:38
      187500 -- (-4785.812) (-4784.060) (-4786.115) [-4786.544] * (-4794.176) (-4790.572) (-4790.625) [-4785.545] -- 0:04:37
      188000 -- (-4790.096) (-4783.684) (-4786.993) [-4785.969] * (-4795.716) (-4783.016) (-4803.918) [-4785.595] -- 0:04:36
      188500 -- [-4783.954] (-4789.221) (-4790.883) (-4787.463) * (-4787.176) [-4784.476] (-4790.543) (-4788.832) -- 0:04:39
      189000 -- (-4782.588) (-4790.052) [-4787.224] (-4782.106) * (-4788.659) (-4782.957) [-4789.040] (-4786.671) -- 0:04:38
      189500 -- (-4784.459) [-4786.719] (-4791.652) (-4785.320) * (-4788.467) [-4783.184] (-4788.320) (-4789.766) -- 0:04:38
      190000 -- (-4788.468) (-4787.851) (-4789.176) [-4783.468] * (-4789.355) [-4782.588] (-4790.103) (-4792.402) -- 0:04:37

      Average standard deviation of split frequencies: 0.000000

      190500 -- (-4786.994) (-4791.131) [-4791.483] (-4791.263) * (-4786.297) [-4784.990] (-4788.127) (-4784.927) -- 0:04:36
      191000 -- (-4791.411) (-4786.694) (-4787.691) [-4786.307] * (-4782.899) [-4791.752] (-4787.789) (-4788.692) -- 0:04:35
      191500 -- (-4788.724) (-4789.466) [-4787.285] (-4788.409) * (-4783.665) [-4790.054] (-4789.419) (-4788.716) -- 0:04:38
      192000 -- (-4790.084) (-4794.187) [-4784.652] (-4788.957) * [-4784.060] (-4792.295) (-4789.724) (-4784.429) -- 0:04:37
      192500 -- [-4791.901] (-4787.720) (-4785.356) (-4786.556) * [-4789.424] (-4783.667) (-4785.223) (-4792.111) -- 0:04:36
      193000 -- (-4789.350) [-4787.813] (-4784.078) (-4782.780) * (-4784.648) (-4788.257) (-4788.104) [-4785.123] -- 0:04:35
      193500 -- [-4785.144] (-4787.590) (-4788.396) (-4784.404) * (-4788.819) (-4784.947) (-4787.868) [-4782.574] -- 0:04:35
      194000 -- (-4793.699) (-4787.373) (-4785.672) [-4787.420] * (-4790.785) [-4784.966] (-4790.636) (-4785.435) -- 0:04:38
      194500 -- (-4789.057) (-4785.178) [-4786.804] (-4787.834) * (-4792.135) (-4787.058) [-4786.373] (-4792.065) -- 0:04:37
      195000 -- (-4789.412) (-4789.540) (-4786.726) [-4790.259] * (-4786.126) (-4783.884) (-4786.137) [-4785.410] -- 0:04:36

      Average standard deviation of split frequencies: 0.000000

      195500 -- [-4783.950] (-4788.451) (-4784.335) (-4783.856) * (-4790.779) [-4784.757] (-4785.149) (-4792.267) -- 0:04:35
      196000 -- (-4792.372) [-4790.182] (-4789.083) (-4790.314) * (-4788.132) (-4789.417) [-4785.975] (-4791.059) -- 0:04:34
      196500 -- (-4787.498) (-4787.518) [-4786.568] (-4790.839) * (-4797.882) (-4787.167) [-4785.193] (-4786.154) -- 0:04:33
      197000 -- [-4784.600] (-4785.448) (-4788.058) (-4791.533) * (-4783.374) (-4792.195) (-4794.405) [-4786.246] -- 0:04:37
      197500 -- [-4788.297] (-4789.922) (-4787.012) (-4787.306) * (-4789.638) (-4784.271) (-4788.174) [-4787.487] -- 0:04:36
      198000 -- (-4781.771) (-4784.683) (-4790.406) [-4784.194] * (-4790.974) (-4786.583) [-4791.833] (-4783.160) -- 0:04:35
      198500 -- (-4786.280) (-4785.842) [-4784.562] (-4790.740) * (-4789.084) (-4787.118) (-4792.860) [-4791.022] -- 0:04:34
      199000 -- (-4785.714) [-4785.156] (-4787.454) (-4797.150) * (-4787.286) (-4786.882) (-4793.613) [-4784.953] -- 0:04:33
      199500 -- (-4785.103) (-4786.112) (-4787.954) [-4788.038] * (-4787.174) [-4794.058] (-4790.629) (-4791.221) -- 0:04:32
      200000 -- (-4784.130) (-4782.183) [-4780.931] (-4785.843) * (-4787.141) [-4790.726] (-4789.554) (-4793.522) -- 0:04:36

      Average standard deviation of split frequencies: 0.000000

      200500 -- (-4789.282) (-4788.405) (-4785.686) [-4781.909] * [-4788.628] (-4788.093) (-4787.248) (-4790.662) -- 0:04:35
      201000 -- [-4789.064] (-4782.497) (-4781.474) (-4785.218) * (-4797.858) (-4788.142) (-4794.078) [-4783.551] -- 0:04:34
      201500 -- (-4792.299) [-4789.351] (-4794.912) (-4787.284) * (-4789.983) (-4785.201) [-4782.009] (-4783.755) -- 0:04:33
      202000 -- [-4784.119] (-4786.318) (-4787.327) (-4788.838) * (-4786.824) (-4784.370) (-4785.386) [-4789.008] -- 0:04:32
      202500 -- (-4787.601) [-4784.908] (-4792.044) (-4791.182) * [-4787.476] (-4784.803) (-4786.819) (-4785.421) -- 0:04:31
      203000 -- (-4791.098) (-4786.423) (-4786.556) [-4789.435] * (-4794.210) (-4787.936) (-4781.227) [-4787.029] -- 0:04:34
      203500 -- (-4789.391) (-4792.897) [-4787.016] (-4784.002) * (-4792.823) (-4790.526) [-4782.664] (-4788.104) -- 0:04:33
      204000 -- (-4787.327) [-4786.443] (-4786.150) (-4786.028) * (-4789.737) [-4792.191] (-4784.013) (-4786.188) -- 0:04:33
      204500 -- (-4788.585) [-4786.947] (-4782.773) (-4791.650) * (-4789.311) [-4788.678] (-4789.166) (-4791.752) -- 0:04:32
      205000 -- (-4785.926) [-4787.251] (-4792.605) (-4795.725) * [-4792.160] (-4790.257) (-4791.572) (-4789.785) -- 0:04:31

      Average standard deviation of split frequencies: 0.000000

      205500 -- (-4786.649) [-4789.848] (-4795.047) (-4795.164) * (-4787.394) (-4785.891) (-4785.081) [-4784.744] -- 0:04:30
      206000 -- (-4788.458) (-4785.138) (-4799.324) [-4793.324] * (-4791.799) (-4787.712) (-4784.085) [-4781.489] -- 0:04:33
      206500 -- (-4785.423) (-4783.849) (-4791.423) [-4792.692] * (-4786.347) (-4788.946) (-4786.651) [-4784.267] -- 0:04:32
      207000 -- [-4786.183] (-4786.569) (-4797.402) (-4787.613) * [-4781.566] (-4784.964) (-4797.448) (-4786.840) -- 0:04:31
      207500 -- (-4788.260) [-4783.777] (-4792.996) (-4787.390) * (-4783.263) (-4786.978) [-4785.817] (-4791.978) -- 0:04:31
      208000 -- (-4791.953) [-4782.402] (-4792.330) (-4784.116) * (-4791.378) (-4789.403) [-4782.251] (-4796.791) -- 0:04:30
      208500 -- (-4784.489) (-4784.092) [-4783.976] (-4788.534) * (-4788.202) [-4787.078] (-4783.235) (-4791.188) -- 0:04:29
      209000 -- (-4790.359) (-4784.974) (-4796.641) [-4794.527] * (-4785.599) (-4789.577) (-4789.698) [-4788.159] -- 0:04:32
      209500 -- (-4785.551) [-4783.864] (-4785.601) (-4787.661) * [-4783.409] (-4795.818) (-4787.165) (-4785.745) -- 0:04:31
      210000 -- [-4786.088] (-4784.167) (-4789.125) (-4791.453) * (-4789.384) [-4786.024] (-4785.959) (-4787.901) -- 0:04:30

      Average standard deviation of split frequencies: 0.000000

      210500 -- (-4790.709) [-4785.459] (-4787.659) (-4791.453) * (-4789.175) [-4786.476] (-4782.922) (-4792.142) -- 0:04:30
      211000 -- [-4790.852] (-4787.868) (-4782.652) (-4791.739) * (-4788.893) (-4789.901) (-4785.074) [-4786.053] -- 0:04:29
      211500 -- [-4789.092] (-4788.653) (-4788.985) (-4796.487) * (-4785.219) (-4785.230) (-4786.025) [-4785.633] -- 0:04:28
      212000 -- (-4787.639) [-4789.936] (-4785.163) (-4784.914) * (-4784.769) [-4782.964] (-4783.232) (-4792.885) -- 0:04:31
      212500 -- (-4787.121) [-4789.274] (-4785.216) (-4786.145) * (-4785.641) (-4785.702) (-4784.961) [-4795.507] -- 0:04:30
      213000 -- (-4786.323) [-4788.339] (-4791.935) (-4791.399) * (-4783.176) (-4784.586) (-4788.552) [-4784.787] -- 0:04:29
      213500 -- (-4787.300) (-4788.116) [-4788.884] (-4788.892) * [-4785.983] (-4787.843) (-4796.876) (-4790.190) -- 0:04:28
      214000 -- (-4785.259) (-4786.980) (-4789.098) [-4788.589] * (-4784.157) (-4790.206) (-4790.692) [-4782.749] -- 0:04:28
      214500 -- (-4789.073) (-4793.617) (-4788.837) [-4788.395] * [-4786.330] (-4792.064) (-4788.171) (-4783.408) -- 0:04:27
      215000 -- (-4791.003) [-4789.069] (-4785.594) (-4787.066) * (-4785.477) (-4790.968) (-4786.284) [-4786.716] -- 0:04:30

      Average standard deviation of split frequencies: 0.000000

      215500 -- (-4787.377) (-4782.762) (-4783.774) [-4785.936] * (-4785.331) (-4794.670) (-4796.993) [-4788.974] -- 0:04:29
      216000 -- (-4786.871) (-4781.573) [-4787.705] (-4789.519) * (-4783.539) (-4790.288) (-4788.159) [-4786.296] -- 0:04:28
      216500 -- [-4788.305] (-4788.147) (-4784.587) (-4790.443) * (-4789.595) (-4786.720) [-4786.148] (-4788.975) -- 0:04:27
      217000 -- [-4791.235] (-4784.113) (-4787.383) (-4782.910) * (-4789.121) (-4794.065) (-4784.367) [-4785.574] -- 0:04:27
      217500 -- (-4789.460) [-4780.252] (-4786.625) (-4785.527) * (-4788.771) [-4790.223] (-4786.125) (-4787.196) -- 0:04:29
      218000 -- (-4788.269) (-4784.490) (-4789.870) [-4788.258] * (-4786.316) [-4786.778] (-4785.286) (-4787.283) -- 0:04:29
      218500 -- (-4785.729) [-4785.485] (-4788.037) (-4784.621) * (-4787.377) (-4788.412) [-4782.696] (-4786.205) -- 0:04:28
      219000 -- (-4789.330) (-4789.154) [-4787.031] (-4788.957) * [-4786.450] (-4794.162) (-4782.882) (-4787.861) -- 0:04:27
      219500 -- [-4785.031] (-4784.393) (-4783.884) (-4794.025) * [-4789.007] (-4786.706) (-4790.635) (-4800.786) -- 0:04:26
      220000 -- (-4790.469) (-4786.534) [-4781.509] (-4788.758) * (-4788.541) [-4783.205] (-4785.576) (-4796.796) -- 0:04:25

      Average standard deviation of split frequencies: 0.000000

      220500 -- (-4786.802) (-4786.922) [-4784.424] (-4789.375) * [-4787.306] (-4785.528) (-4786.157) (-4792.128) -- 0:04:28
      221000 -- (-4786.760) (-4795.130) (-4786.206) [-4787.645] * (-4785.589) (-4786.482) (-4792.309) [-4786.357] -- 0:04:27
      221500 -- (-4790.228) (-4791.475) [-4786.196] (-4785.394) * (-4789.187) (-4783.896) (-4797.143) [-4781.225] -- 0:04:27
      222000 -- (-4789.298) (-4785.967) [-4786.752] (-4786.030) * [-4792.817] (-4783.266) (-4786.156) (-4785.501) -- 0:04:26
      222500 -- (-4790.864) (-4787.447) (-4784.707) [-4782.873] * (-4788.843) [-4786.745] (-4787.377) (-4786.474) -- 0:04:25
      223000 -- (-4788.729) (-4787.712) (-4785.742) [-4780.578] * [-4789.256] (-4788.411) (-4789.300) (-4787.816) -- 0:04:24
      223500 -- (-4787.367) (-4797.001) (-4784.962) [-4785.886] * (-4791.260) (-4787.236) [-4784.610] (-4784.865) -- 0:04:27
      224000 -- (-4784.125) (-4794.713) (-4790.592) [-4784.744] * [-4791.515] (-4786.481) (-4791.794) (-4789.216) -- 0:04:26
      224500 -- [-4782.544] (-4792.383) (-4784.396) (-4785.522) * (-4796.311) [-4788.749] (-4792.222) (-4786.169) -- 0:04:25
      225000 -- [-4787.009] (-4788.854) (-4786.760) (-4784.315) * [-4787.692] (-4795.237) (-4786.255) (-4788.816) -- 0:04:25

      Average standard deviation of split frequencies: 0.000000

      225500 -- (-4789.932) (-4788.117) [-4789.324] (-4790.651) * (-4785.225) (-4791.669) (-4782.993) [-4784.424] -- 0:04:24
      226000 -- (-4790.109) [-4786.426] (-4785.670) (-4785.465) * (-4782.824) (-4790.394) (-4779.787) [-4788.457] -- 0:04:23
      226500 -- [-4788.444] (-4784.454) (-4788.770) (-4790.679) * [-4782.616] (-4789.099) (-4790.214) (-4787.619) -- 0:04:26
      227000 -- (-4784.230) [-4788.490] (-4789.594) (-4788.209) * (-4800.838) [-4786.862] (-4789.123) (-4784.869) -- 0:04:25
      227500 -- (-4788.028) (-4788.286) (-4788.385) [-4782.608] * (-4795.265) (-4791.337) (-4789.138) [-4786.291] -- 0:04:24
      228000 -- (-4786.492) [-4784.242] (-4784.530) (-4783.651) * (-4791.132) [-4787.509] (-4786.452) (-4786.796) -- 0:04:24
      228500 -- (-4781.877) (-4782.812) [-4788.962] (-4786.121) * (-4789.073) (-4786.722) [-4787.946] (-4786.738) -- 0:04:23
      229000 -- [-4787.272] (-4784.066) (-4789.870) (-4790.722) * (-4792.352) [-4790.098] (-4787.716) (-4786.949) -- 0:04:22
      229500 -- (-4787.186) (-4786.815) [-4791.974] (-4790.407) * (-4786.375) (-4789.084) (-4783.856) [-4785.894] -- 0:04:25
      230000 -- (-4787.821) [-4785.464] (-4787.910) (-4789.491) * (-4796.038) (-4785.885) (-4785.814) [-4784.787] -- 0:04:24

      Average standard deviation of split frequencies: 0.000000

      230500 -- (-4781.419) (-4787.230) [-4783.791] (-4787.188) * (-4785.788) [-4790.048] (-4788.496) (-4790.887) -- 0:04:23
      231000 -- (-4787.020) (-4787.100) [-4784.668] (-4792.088) * [-4786.434] (-4787.912) (-4787.270) (-4785.990) -- 0:04:22
      231500 -- (-4791.572) (-4789.595) (-4785.077) [-4784.371] * (-4790.106) (-4784.005) (-4787.906) [-4790.161] -- 0:04:22
      232000 -- (-4786.249) (-4789.263) (-4786.801) [-4785.736] * [-4791.268] (-4793.437) (-4787.058) (-4790.218) -- 0:04:21
      232500 -- (-4788.286) (-4791.504) (-4783.093) [-4782.333] * [-4785.254] (-4787.711) (-4790.212) (-4791.798) -- 0:04:24
      233000 -- [-4786.225] (-4786.928) (-4787.456) (-4785.000) * (-4784.729) (-4787.592) [-4782.160] (-4793.300) -- 0:04:23
      233500 -- (-4791.035) [-4785.385] (-4789.138) (-4791.964) * (-4784.269) (-4786.959) (-4786.111) [-4788.448] -- 0:04:22
      234000 -- [-4790.028] (-4785.518) (-4789.459) (-4792.028) * (-4788.074) [-4787.323] (-4790.454) (-4783.034) -- 0:04:21
      234500 -- [-4785.998] (-4791.097) (-4785.917) (-4787.859) * (-4787.452) (-4789.110) [-4782.818] (-4792.077) -- 0:04:21
      235000 -- (-4786.076) (-4791.871) (-4789.847) [-4790.030] * [-4788.574] (-4785.001) (-4786.274) (-4793.268) -- 0:04:20

      Average standard deviation of split frequencies: 0.000000

      235500 -- (-4794.347) (-4786.155) [-4782.767] (-4795.229) * [-4782.049] (-4791.614) (-4787.998) (-4789.501) -- 0:04:22
      236000 -- [-4789.068] (-4787.660) (-4789.010) (-4788.483) * (-4785.673) [-4791.865] (-4792.121) (-4790.963) -- 0:04:22
      236500 -- [-4789.680] (-4785.938) (-4788.308) (-4786.764) * (-4785.838) (-4802.625) (-4790.488) [-4789.703] -- 0:04:21
      237000 -- (-4790.877) (-4792.421) [-4790.840] (-4781.867) * (-4784.456) (-4792.050) (-4791.354) [-4784.357] -- 0:04:20
      237500 -- (-4791.430) (-4785.742) (-4786.076) [-4785.218] * (-4784.594) (-4782.428) (-4789.056) [-4786.622] -- 0:04:20
      238000 -- (-4790.252) (-4785.993) (-4787.964) [-4785.106] * (-4788.785) (-4785.615) [-4785.357] (-4785.402) -- 0:04:22
      238500 -- (-4787.023) (-4789.731) (-4785.341) [-4782.872] * (-4788.804) (-4786.806) [-4784.692] (-4786.064) -- 0:04:21
      239000 -- (-4785.010) [-4786.039] (-4785.144) (-4789.466) * (-4785.535) (-4786.951) [-4784.908] (-4788.890) -- 0:04:21
      239500 -- (-4785.933) (-4788.208) [-4784.648] (-4801.554) * (-4785.092) (-4789.860) (-4783.602) [-4784.253] -- 0:04:20
      240000 -- [-4783.426] (-4788.084) (-4785.515) (-4795.197) * (-4790.339) [-4784.131] (-4783.574) (-4787.536) -- 0:04:19

      Average standard deviation of split frequencies: 0.000000

      240500 -- [-4788.529] (-4787.004) (-4787.185) (-4786.011) * (-4785.847) [-4790.668] (-4786.023) (-4792.135) -- 0:04:18
      241000 -- (-4783.088) [-4787.809] (-4787.416) (-4787.973) * (-4788.035) (-4791.487) (-4785.842) [-4785.789] -- 0:04:21
      241500 -- (-4784.857) (-4785.056) (-4790.763) [-4785.246] * (-4786.730) (-4785.946) [-4785.335] (-4787.052) -- 0:04:20
      242000 -- (-4783.856) (-4783.845) (-4794.056) [-4783.881] * (-4793.567) (-4793.513) (-4788.305) [-4784.698] -- 0:04:19
      242500 -- (-4789.241) (-4785.604) (-4782.812) [-4782.299] * (-4795.703) (-4791.712) (-4788.712) [-4781.944] -- 0:04:19
      243000 -- (-4791.073) [-4785.620] (-4788.222) (-4784.068) * (-4795.591) (-4792.603) (-4783.657) [-4786.518] -- 0:04:18
      243500 -- (-4786.991) (-4784.927) [-4786.371] (-4787.397) * (-4793.868) (-4791.371) (-4782.835) [-4783.603] -- 0:04:17
      244000 -- (-4787.489) (-4787.311) (-4786.763) [-4789.914] * [-4786.973] (-4788.992) (-4789.931) (-4783.330) -- 0:04:20
      244500 -- [-4782.809] (-4781.355) (-4784.173) (-4781.131) * (-4787.407) (-4784.861) (-4787.002) [-4785.739] -- 0:04:19
      245000 -- [-4783.094] (-4782.734) (-4784.517) (-4787.381) * (-4794.375) (-4781.640) (-4785.900) [-4786.992] -- 0:04:18

      Average standard deviation of split frequencies: 0.000000

      245500 -- (-4784.356) [-4784.358] (-4786.723) (-4786.824) * (-4791.164) [-4780.960] (-4786.730) (-4780.378) -- 0:04:18
      246000 -- [-4784.828] (-4784.063) (-4785.395) (-4783.887) * (-4786.016) (-4787.279) (-4786.470) [-4786.778] -- 0:04:17
      246500 -- [-4787.621] (-4787.537) (-4785.333) (-4786.989) * (-4790.288) (-4789.693) [-4788.165] (-4787.261) -- 0:04:16
      247000 -- (-4784.119) (-4787.561) (-4787.225) [-4785.614] * (-4797.442) (-4785.297) [-4798.864] (-4788.161) -- 0:04:19
      247500 -- (-4783.218) [-4782.672] (-4784.671) (-4783.172) * (-4784.695) [-4782.939] (-4790.120) (-4789.702) -- 0:04:18
      248000 -- (-4786.045) (-4787.333) [-4793.573] (-4786.800) * (-4787.238) [-4784.267] (-4788.971) (-4788.112) -- 0:04:17
      248500 -- [-4786.889] (-4787.921) (-4785.178) (-4788.918) * (-4782.747) (-4786.878) (-4786.196) [-4788.194] -- 0:04:17
      249000 -- (-4795.479) [-4786.722] (-4788.878) (-4789.188) * [-4782.955] (-4784.664) (-4785.239) (-4784.498) -- 0:04:16
      249500 -- (-4790.978) (-4783.988) [-4790.843] (-4788.622) * (-4789.457) (-4790.518) (-4786.330) [-4783.158] -- 0:04:15
      250000 -- (-4784.857) (-4784.819) (-4789.685) [-4789.784] * (-4792.721) (-4788.439) (-4786.343) [-4787.841] -- 0:04:18

      Average standard deviation of split frequencies: 0.000000

      250500 -- (-4790.365) (-4792.914) [-4785.439] (-4785.802) * (-4788.732) [-4785.941] (-4788.933) (-4789.149) -- 0:04:17
      251000 -- (-4790.731) (-4791.049) (-4789.078) [-4788.274] * (-4782.769) (-4789.191) (-4788.965) [-4785.125] -- 0:04:16
      251500 -- (-4784.386) (-4787.439) (-4791.618) [-4787.643] * (-4789.799) (-4782.431) (-4789.329) [-4782.569] -- 0:04:15
      252000 -- [-4783.225] (-4791.390) (-4789.046) (-4790.333) * (-4782.540) (-4792.137) (-4786.531) [-4785.812] -- 0:04:15
      252500 -- [-4788.235] (-4794.147) (-4783.597) (-4787.901) * [-4786.952] (-4785.606) (-4793.171) (-4793.520) -- 0:04:14
      253000 -- [-4789.731] (-4786.282) (-4783.912) (-4785.002) * [-4787.264] (-4791.061) (-4782.424) (-4787.416) -- 0:04:16
      253500 -- (-4784.174) (-4785.601) [-4787.277] (-4785.548) * (-4788.790) (-4782.519) [-4788.085] (-4787.700) -- 0:04:16
      254000 -- (-4787.322) [-4793.421] (-4782.317) (-4785.272) * (-4787.884) (-4786.332) (-4789.075) [-4785.711] -- 0:04:15
      254500 -- (-4792.373) (-4785.312) (-4789.953) [-4786.849] * (-4786.748) (-4788.392) [-4786.345] (-4789.703) -- 0:04:14
      255000 -- (-4785.189) [-4786.730] (-4789.329) (-4785.842) * (-4783.553) (-4788.195) [-4785.506] (-4787.677) -- 0:04:14

      Average standard deviation of split frequencies: 0.000000

      255500 -- (-4786.136) (-4789.654) [-4787.842] (-4788.172) * [-4790.610] (-4787.144) (-4785.819) (-4788.852) -- 0:04:16
      256000 -- (-4791.406) (-4786.022) [-4788.467] (-4786.231) * (-4782.802) [-4785.319] (-4798.602) (-4789.427) -- 0:04:15
      256500 -- (-4789.764) [-4791.030] (-4790.902) (-4786.832) * (-4785.233) [-4781.468] (-4783.939) (-4783.125) -- 0:04:15
      257000 -- [-4785.048] (-4788.086) (-4785.759) (-4781.204) * [-4789.403] (-4782.543) (-4788.398) (-4788.697) -- 0:04:14
      257500 -- (-4784.664) [-4787.944] (-4783.269) (-4790.914) * (-4783.124) (-4784.990) (-4784.687) [-4788.735] -- 0:04:13
      258000 -- (-4785.459) (-4790.232) [-4786.218] (-4780.410) * [-4784.043] (-4790.493) (-4782.296) (-4784.748) -- 0:04:13
      258500 -- (-4786.545) (-4793.794) (-4786.661) [-4782.681] * [-4793.974] (-4785.353) (-4787.490) (-4788.205) -- 0:04:15
      259000 -- (-4781.606) [-4787.528] (-4787.912) (-4782.664) * (-4785.741) (-4784.153) (-4785.770) [-4788.528] -- 0:04:14
      259500 -- (-4785.381) (-4788.337) (-4787.751) [-4786.756] * (-4789.913) (-4793.380) (-4789.957) [-4786.671] -- 0:04:13
      260000 -- (-4789.093) (-4785.051) (-4791.833) [-4785.466] * (-4788.902) [-4786.869] (-4782.470) (-4786.406) -- 0:04:13

      Average standard deviation of split frequencies: 0.000000

      260500 -- (-4787.544) [-4786.298] (-4795.039) (-4788.413) * (-4792.671) (-4791.940) [-4786.431] (-4788.149) -- 0:04:12
      261000 -- (-4784.368) (-4790.858) [-4784.658] (-4787.083) * (-4785.285) (-4785.613) [-4785.821] (-4787.644) -- 0:04:11
      261500 -- [-4784.465] (-4789.782) (-4786.452) (-4788.265) * (-4788.066) (-4784.234) (-4786.590) [-4787.039] -- 0:04:14
      262000 -- (-4783.213) (-4790.979) [-4791.931] (-4784.502) * (-4788.268) (-4783.285) (-4783.881) [-4782.608] -- 0:04:13
      262500 -- (-4782.238) [-4785.510] (-4795.152) (-4790.140) * (-4786.308) [-4783.412] (-4788.757) (-4788.171) -- 0:04:12
      263000 -- (-4802.722) (-4790.527) [-4790.180] (-4783.026) * (-4791.483) (-4783.180) [-4782.982] (-4792.355) -- 0:04:12
      263500 -- [-4786.828] (-4783.502) (-4786.873) (-4789.933) * (-4789.015) (-4788.983) (-4787.540) [-4785.510] -- 0:04:11
      264000 -- [-4786.328] (-4782.813) (-4789.850) (-4789.706) * (-4789.774) [-4782.073] (-4787.656) (-4785.954) -- 0:04:10
      264500 -- (-4788.509) (-4787.914) (-4786.605) [-4786.652] * (-4786.760) (-4789.159) [-4784.282] (-4783.376) -- 0:04:13
      265000 -- (-4786.983) (-4793.891) [-4785.683] (-4791.023) * (-4786.768) [-4787.530] (-4785.634) (-4787.636) -- 0:04:12

      Average standard deviation of split frequencies: 0.000000

      265500 -- (-4787.250) [-4787.600] (-4787.471) (-4786.974) * [-4790.958] (-4786.719) (-4783.029) (-4790.863) -- 0:04:11
      266000 -- [-4782.482] (-4783.914) (-4781.950) (-4788.825) * (-4787.890) (-4798.544) (-4784.300) [-4788.678] -- 0:04:11
      266500 -- (-4783.564) (-4787.101) (-4782.708) [-4784.309] * (-4785.277) [-4786.035] (-4784.687) (-4790.402) -- 0:04:10
      267000 -- (-4784.619) (-4784.576) (-4786.763) [-4790.080] * [-4785.125] (-4793.236) (-4786.236) (-4788.395) -- 0:04:09
      267500 -- (-4783.359) (-4794.485) [-4783.250] (-4784.336) * (-4785.053) (-4785.332) (-4786.933) [-4788.882] -- 0:04:11
      268000 -- (-4784.005) (-4785.212) (-4787.186) [-4784.843] * (-4783.620) [-4788.122] (-4790.412) (-4790.357) -- 0:04:11
      268500 -- (-4789.576) (-4789.057) (-4787.408) [-4786.790] * [-4785.936] (-4787.381) (-4788.695) (-4789.803) -- 0:04:10
      269000 -- (-4789.245) (-4789.238) [-4781.888] (-4784.735) * (-4788.843) [-4788.177] (-4790.148) (-4785.814) -- 0:04:10
      269500 -- (-4790.418) (-4784.186) [-4781.349] (-4789.963) * (-4791.815) (-4782.211) [-4784.197] (-4791.732) -- 0:04:09
      270000 -- (-4785.701) (-4789.847) [-4789.725] (-4784.737) * (-4787.397) (-4788.166) (-4792.568) [-4783.535] -- 0:04:08

      Average standard deviation of split frequencies: 0.000000

      270500 -- (-4790.484) (-4787.667) [-4792.217] (-4786.499) * (-4788.216) (-4784.873) (-4797.551) [-4786.997] -- 0:04:10
      271000 -- [-4787.889] (-4800.889) (-4790.249) (-4790.889) * (-4785.479) (-4787.413) (-4793.058) [-4789.087] -- 0:04:10
      271500 -- (-4792.552) [-4793.307] (-4791.344) (-4786.449) * (-4788.156) (-4785.844) (-4783.044) [-4791.169] -- 0:04:09
      272000 -- [-4788.005] (-4789.659) (-4789.876) (-4788.425) * (-4789.424) (-4790.426) [-4787.412] (-4787.456) -- 0:04:08
      272500 -- (-4791.773) [-4784.371] (-4786.127) (-4786.905) * (-4790.371) (-4785.087) (-4784.771) [-4784.913] -- 0:04:08
      273000 -- (-4783.706) [-4784.850] (-4788.089) (-4785.439) * (-4783.206) (-4787.642) (-4788.131) [-4785.605] -- 0:04:07
      273500 -- (-4784.875) (-4787.873) [-4788.505] (-4790.917) * (-4784.354) (-4785.891) (-4782.313) [-4782.359] -- 0:04:09
      274000 -- (-4787.619) [-4785.953] (-4796.098) (-4793.666) * [-4786.324] (-4784.557) (-4791.545) (-4789.695) -- 0:04:09
      274500 -- [-4783.185] (-4785.792) (-4799.779) (-4786.322) * (-4784.944) (-4792.064) [-4786.562] (-4787.627) -- 0:04:08
      275000 -- (-4780.471) (-4788.185) (-4794.255) [-4787.094] * (-4793.721) [-4791.251] (-4786.081) (-4781.110) -- 0:04:07

      Average standard deviation of split frequencies: 0.000000

      275500 -- [-4784.437] (-4786.537) (-4782.814) (-4789.819) * [-4789.156] (-4787.537) (-4790.810) (-4785.366) -- 0:04:07
      276000 -- (-4787.738) (-4782.964) (-4783.546) [-4788.833] * (-4792.653) (-4784.655) [-4786.042] (-4785.294) -- 0:04:09
      276500 -- [-4783.823] (-4786.990) (-4786.040) (-4788.258) * (-4785.507) (-4784.071) [-4783.812] (-4796.401) -- 0:04:08
      277000 -- (-4783.241) (-4789.548) (-4785.531) [-4788.442] * (-4789.865) (-4787.357) (-4782.722) [-4783.885] -- 0:04:07
      277500 -- (-4788.406) (-4785.745) [-4790.751] (-4793.268) * [-4786.371] (-4791.445) (-4784.479) (-4794.005) -- 0:04:07
      278000 -- (-4795.430) [-4791.358] (-4790.367) (-4787.477) * [-4789.275] (-4792.985) (-4783.266) (-4789.665) -- 0:04:06
      278500 -- [-4785.187] (-4788.672) (-4784.854) (-4792.912) * (-4792.553) [-4783.703] (-4788.248) (-4789.627) -- 0:04:06
      279000 -- [-4787.379] (-4783.878) (-4790.755) (-4785.452) * (-4783.553) (-4785.552) (-4787.065) [-4791.432] -- 0:04:08
      279500 -- (-4784.760) [-4788.175] (-4790.923) (-4788.632) * (-4786.678) (-4791.274) [-4787.212] (-4784.303) -- 0:04:07
      280000 -- (-4781.958) [-4785.724] (-4795.663) (-4785.928) * [-4791.680] (-4784.064) (-4788.129) (-4789.960) -- 0:04:06

      Average standard deviation of split frequencies: 0.000000

      280500 -- [-4782.181] (-4789.854) (-4790.691) (-4793.152) * [-4786.956] (-4787.068) (-4787.157) (-4791.298) -- 0:04:06
      281000 -- (-4798.015) (-4793.343) [-4785.961] (-4791.415) * (-4784.860) [-4783.457] (-4790.721) (-4785.443) -- 0:04:05
      281500 -- (-4785.285) (-4783.979) [-4786.570] (-4782.997) * (-4785.981) (-4787.082) (-4783.900) [-4784.563] -- 0:04:05
      282000 -- (-4788.878) (-4782.811) [-4785.407] (-4785.832) * (-4785.130) (-4792.906) [-4788.759] (-4785.467) -- 0:04:06
      282500 -- (-4786.494) [-4785.262] (-4786.892) (-4787.074) * (-4784.204) (-4791.509) [-4781.498] (-4786.736) -- 0:04:06
      283000 -- (-4791.507) (-4785.507) (-4782.514) [-4782.480] * (-4789.252) (-4784.363) [-4787.015] (-4787.053) -- 0:04:05
      283500 -- [-4788.725] (-4786.718) (-4782.253) (-4780.727) * (-4784.075) (-4795.751) (-4785.978) [-4781.376] -- 0:04:05
      284000 -- (-4790.986) (-4793.298) [-4783.929] (-4784.230) * (-4783.457) [-4790.753] (-4787.014) (-4782.233) -- 0:04:04
      284500 -- (-4792.671) (-4796.430) (-4790.433) [-4782.492] * [-4786.473] (-4791.637) (-4787.533) (-4788.635) -- 0:04:03
      285000 -- (-4789.588) (-4797.459) (-4788.764) [-4783.923] * (-4788.909) (-4786.285) (-4788.927) [-4786.231] -- 0:04:05

      Average standard deviation of split frequencies: 0.000000

      285500 -- (-4789.629) (-4782.256) [-4784.744] (-4783.709) * [-4782.225] (-4786.377) (-4784.753) (-4787.309) -- 0:04:05
      286000 -- [-4783.564] (-4787.986) (-4788.915) (-4789.942) * [-4789.211] (-4791.180) (-4784.616) (-4783.705) -- 0:04:04
      286500 -- [-4788.245] (-4795.687) (-4787.675) (-4784.231) * [-4782.016] (-4792.178) (-4781.108) (-4788.789) -- 0:04:04
      287000 -- (-4785.043) [-4786.269] (-4785.712) (-4798.575) * (-4786.770) [-4788.457] (-4784.227) (-4787.336) -- 0:04:03
      287500 -- (-4783.351) (-4786.752) [-4794.983] (-4794.933) * (-4782.643) (-4781.738) (-4785.808) [-4786.988] -- 0:04:02
      288000 -- [-4787.924] (-4782.333) (-4787.559) (-4800.454) * [-4786.959] (-4785.516) (-4789.124) (-4789.899) -- 0:04:04
      288500 -- (-4785.934) (-4792.329) [-4788.372] (-4791.495) * (-4783.589) [-4786.360] (-4792.712) (-4790.142) -- 0:04:04
      289000 -- (-4788.834) [-4783.708] (-4786.153) (-4789.672) * (-4784.822) (-4793.294) (-4790.389) [-4788.016] -- 0:04:03
      289500 -- (-4790.324) (-4787.174) (-4783.813) [-4785.597] * (-4786.703) (-4788.531) (-4786.407) [-4784.354] -- 0:04:02
      290000 -- (-4787.695) (-4789.012) (-4789.371) [-4790.250] * (-4783.775) (-4794.835) [-4786.086] (-4782.468) -- 0:04:02

      Average standard deviation of split frequencies: 0.000000

      290500 -- (-4794.664) [-4795.882] (-4789.959) (-4784.010) * [-4788.882] (-4791.303) (-4783.059) (-4785.170) -- 0:04:01
      291000 -- [-4789.197] (-4791.116) (-4788.014) (-4783.732) * (-4785.859) (-4787.572) [-4785.501] (-4791.053) -- 0:04:03
      291500 -- (-4786.408) [-4787.392] (-4784.943) (-4787.687) * [-4782.531] (-4793.758) (-4787.223) (-4796.321) -- 0:04:03
      292000 -- (-4785.882) [-4784.816] (-4792.172) (-4786.581) * (-4784.770) (-4795.577) [-4781.936] (-4796.987) -- 0:04:02
      292500 -- [-4785.068] (-4785.450) (-4790.897) (-4789.531) * [-4786.803] (-4796.023) (-4788.958) (-4791.221) -- 0:04:01
      293000 -- [-4786.085] (-4787.157) (-4789.580) (-4790.714) * [-4783.938] (-4791.692) (-4780.845) (-4785.278) -- 0:04:01
      293500 -- (-4783.261) (-4784.053) (-4789.990) [-4784.361] * [-4783.591] (-4790.798) (-4786.748) (-4785.400) -- 0:04:00
      294000 -- (-4786.740) (-4782.372) (-4786.138) [-4780.957] * (-4791.527) (-4786.533) (-4788.242) [-4787.452] -- 0:04:02
      294500 -- (-4789.652) (-4787.382) (-4789.023) [-4783.499] * (-4789.242) (-4787.828) (-4788.777) [-4788.193] -- 0:04:01
      295000 -- (-4788.447) [-4785.094] (-4786.486) (-4785.039) * [-4788.495] (-4787.526) (-4784.864) (-4791.649) -- 0:04:01

      Average standard deviation of split frequencies: 0.000000

      295500 -- (-4786.647) [-4793.597] (-4790.501) (-4781.525) * (-4787.359) [-4784.552] (-4787.156) (-4788.804) -- 0:04:00
      296000 -- (-4786.578) (-4787.781) [-4785.797] (-4783.124) * [-4787.927] (-4794.559) (-4792.376) (-4789.351) -- 0:04:00
      296500 -- (-4789.294) (-4785.733) [-4792.280] (-4791.581) * (-4792.598) (-4792.061) [-4784.867] (-4785.328) -- 0:04:02
      297000 -- (-4788.445) (-4791.090) (-4784.718) [-4786.596] * (-4792.377) [-4789.835] (-4790.118) (-4788.583) -- 0:04:01
      297500 -- (-4784.420) (-4794.352) (-4788.012) [-4788.778] * (-4785.645) (-4784.541) (-4790.221) [-4787.661] -- 0:04:00
      298000 -- (-4783.084) [-4785.565] (-4787.094) (-4792.772) * (-4789.536) [-4792.712] (-4789.724) (-4796.281) -- 0:04:00
      298500 -- (-4785.254) (-4790.871) [-4786.565] (-4780.948) * (-4792.310) (-4791.992) (-4783.699) [-4785.927] -- 0:03:59
      299000 -- (-4792.769) [-4786.312] (-4789.526) (-4785.394) * (-4785.462) [-4787.645] (-4788.078) (-4788.554) -- 0:03:59
      299500 -- (-4783.703) [-4784.683] (-4784.575) (-4787.583) * (-4792.274) [-4783.248] (-4789.219) (-4785.185) -- 0:04:00
      300000 -- (-4782.597) (-4785.546) (-4788.319) [-4787.827] * (-4792.659) (-4789.725) [-4783.131] (-4787.011) -- 0:04:00

      Average standard deviation of split frequencies: 0.000000

      300500 -- (-4790.701) [-4786.019] (-4792.442) (-4785.056) * (-4789.997) (-4788.769) [-4788.005] (-4787.297) -- 0:03:59
      301000 -- (-4791.393) (-4788.386) (-4788.358) [-4784.751] * (-4782.674) [-4785.196] (-4781.181) (-4787.386) -- 0:03:59
      301500 -- (-4788.905) (-4787.128) (-4785.291) [-4784.701] * (-4783.348) [-4785.504] (-4784.482) (-4784.835) -- 0:03:58
      302000 -- [-4790.672] (-4785.481) (-4784.947) (-4784.710) * (-4786.631) (-4785.675) (-4789.562) [-4784.256] -- 0:03:58
      302500 -- (-4788.871) [-4784.315] (-4786.502) (-4790.051) * (-4787.195) [-4784.097] (-4783.412) (-4787.822) -- 0:03:59
      303000 -- (-4783.517) (-4788.677) (-4787.867) [-4789.162] * (-4790.316) (-4784.711) (-4786.305) [-4787.972] -- 0:03:59
      303500 -- [-4780.950] (-4789.370) (-4784.810) (-4782.880) * [-4788.270] (-4788.636) (-4785.272) (-4788.841) -- 0:03:58
      304000 -- (-4783.844) [-4789.823] (-4791.524) (-4785.903) * [-4782.289] (-4790.679) (-4791.985) (-4781.838) -- 0:03:58
      304500 -- (-4786.856) (-4782.424) [-4788.646] (-4787.582) * (-4790.166) [-4788.891] (-4783.095) (-4790.885) -- 0:03:57
      305000 -- (-4787.345) [-4784.384] (-4789.281) (-4790.306) * (-4782.896) [-4783.435] (-4787.517) (-4787.756) -- 0:03:56

      Average standard deviation of split frequencies: 0.000000

      305500 -- (-4786.269) (-4788.360) [-4790.884] (-4790.861) * (-4783.749) [-4793.996] (-4785.696) (-4788.513) -- 0:03:58
      306000 -- (-4790.904) (-4786.722) (-4792.345) [-4789.630] * [-4788.267] (-4795.488) (-4784.309) (-4791.810) -- 0:03:58
      306500 -- (-4790.501) (-4782.675) [-4789.061] (-4797.379) * (-4785.748) [-4783.298] (-4786.372) (-4800.068) -- 0:03:57
      307000 -- [-4787.129] (-4784.135) (-4789.828) (-4792.435) * (-4783.660) [-4784.351] (-4790.998) (-4793.603) -- 0:03:57
      307500 -- (-4785.285) [-4786.304] (-4790.727) (-4787.723) * [-4789.729] (-4790.248) (-4788.262) (-4794.801) -- 0:03:56
      308000 -- [-4781.382] (-4786.013) (-4788.288) (-4793.183) * (-4788.779) [-4782.675] (-4792.546) (-4790.539) -- 0:03:55
      308500 -- [-4787.139] (-4784.549) (-4784.666) (-4792.288) * (-4782.546) [-4781.192] (-4785.878) (-4782.229) -- 0:03:57
      309000 -- (-4786.497) (-4782.320) [-4784.401] (-4797.796) * [-4791.981] (-4783.841) (-4789.257) (-4786.628) -- 0:03:57
      309500 -- (-4785.734) (-4794.557) [-4782.790] (-4799.133) * (-4789.102) [-4785.106] (-4789.486) (-4785.930) -- 0:03:56
      310000 -- (-4782.657) (-4791.017) [-4784.432] (-4792.207) * (-4788.550) [-4783.366] (-4788.249) (-4788.481) -- 0:03:55

      Average standard deviation of split frequencies: 0.000000

      310500 -- (-4787.280) [-4792.365] (-4786.973) (-4793.571) * [-4784.529] (-4781.224) (-4784.307) (-4782.093) -- 0:03:55
      311000 -- [-4787.889] (-4788.593) (-4794.647) (-4790.062) * (-4784.141) [-4783.622] (-4786.693) (-4784.567) -- 0:03:54
      311500 -- (-4784.853) [-4788.053] (-4789.525) (-4782.787) * (-4785.107) [-4782.714] (-4787.265) (-4790.346) -- 0:03:56
      312000 -- [-4784.987] (-4786.292) (-4792.893) (-4794.846) * [-4788.430] (-4786.796) (-4788.830) (-4785.415) -- 0:03:55
      312500 -- (-4784.364) [-4785.461] (-4794.070) (-4786.143) * (-4783.110) (-4789.175) [-4789.754] (-4780.016) -- 0:03:55
      313000 -- (-4788.829) [-4787.116] (-4786.109) (-4785.605) * [-4787.577] (-4788.237) (-4786.545) (-4788.769) -- 0:03:54
      313500 -- (-4791.055) (-4789.316) (-4784.302) [-4788.500] * (-4790.893) [-4783.707] (-4787.097) (-4781.889) -- 0:03:54
      314000 -- [-4788.406] (-4787.940) (-4791.743) (-4786.728) * [-4787.697] (-4786.051) (-4791.186) (-4793.688) -- 0:03:53
      314500 -- (-4788.750) (-4791.274) (-4790.498) [-4784.227] * (-4785.645) (-4789.342) [-4785.580] (-4794.859) -- 0:03:55
      315000 -- (-4792.854) [-4787.792] (-4794.460) (-4785.846) * (-4790.574) [-4782.613] (-4787.984) (-4793.782) -- 0:03:54

      Average standard deviation of split frequencies: 0.000000

      315500 -- [-4785.595] (-4788.058) (-4788.410) (-4782.892) * (-4781.642) (-4789.557) (-4787.833) [-4787.451] -- 0:03:54
      316000 -- (-4786.659) (-4786.156) (-4794.294) [-4785.454] * (-4784.941) [-4786.837] (-4789.776) (-4786.127) -- 0:03:53
      316500 -- (-4789.382) (-4782.805) (-4785.191) [-4785.019] * [-4792.571] (-4784.982) (-4792.640) (-4787.232) -- 0:03:53
      317000 -- (-4784.068) (-4780.862) [-4786.341] (-4794.281) * (-4789.357) (-4784.807) (-4792.272) [-4785.868] -- 0:03:54
      317500 -- (-4784.351) [-4791.274] (-4793.137) (-4781.774) * (-4784.696) (-4783.800) [-4787.626] (-4785.640) -- 0:03:54
      318000 -- (-4797.401) (-4788.944) [-4784.391] (-4786.247) * (-4789.495) (-4789.648) [-4786.904] (-4784.651) -- 0:03:53
      318500 -- [-4781.197] (-4791.541) (-4788.731) (-4787.735) * (-4790.664) [-4787.712] (-4796.546) (-4785.603) -- 0:03:53
      319000 -- (-4787.916) (-4790.175) (-4790.373) [-4790.423] * (-4787.494) (-4791.980) (-4790.512) [-4785.038] -- 0:03:52
      319500 -- [-4786.388] (-4786.718) (-4785.719) (-4783.892) * [-4781.104] (-4786.334) (-4789.143) (-4785.331) -- 0:03:52
      320000 -- (-4789.549) [-4783.935] (-4787.466) (-4786.068) * (-4792.798) (-4782.868) (-4791.403) [-4784.593] -- 0:03:53

      Average standard deviation of split frequencies: 0.000000

      320500 -- (-4788.737) (-4792.031) [-4792.240] (-4783.399) * (-4790.775) (-4783.619) (-4783.013) [-4789.911] -- 0:03:53
      321000 -- (-4786.643) (-4787.348) [-4787.694] (-4785.478) * (-4788.601) (-4785.498) (-4785.813) [-4787.663] -- 0:03:52
      321500 -- (-4786.698) (-4786.270) (-4783.913) [-4787.008] * (-4792.439) [-4784.837] (-4788.590) (-4790.369) -- 0:03:52
      322000 -- (-4783.041) (-4788.662) [-4783.346] (-4784.135) * (-4788.010) [-4790.314] (-4794.354) (-4782.839) -- 0:03:51
      322500 -- (-4786.586) (-4783.647) (-4784.999) [-4788.851] * (-4789.929) (-4784.926) (-4793.535) [-4786.042] -- 0:03:51
      323000 -- (-4785.950) (-4787.569) [-4789.086] (-4785.199) * (-4796.996) [-4787.289] (-4788.112) (-4786.113) -- 0:03:52
      323500 -- (-4785.893) (-4786.369) (-4786.479) [-4783.771] * (-4790.882) (-4786.489) [-4786.112] (-4787.162) -- 0:03:52
      324000 -- [-4786.358] (-4780.845) (-4786.578) (-4791.289) * (-4788.279) [-4788.553] (-4793.285) (-4794.086) -- 0:03:51
      324500 -- (-4789.358) [-4783.639] (-4790.226) (-4784.654) * (-4791.858) [-4786.080] (-4790.279) (-4788.516) -- 0:03:51
      325000 -- (-4790.839) (-4783.637) [-4787.664] (-4787.422) * (-4788.998) (-4783.547) (-4792.115) [-4783.574] -- 0:03:50

      Average standard deviation of split frequencies: 0.000000

      325500 -- (-4788.802) (-4787.010) (-4787.685) [-4780.349] * [-4795.412] (-4794.491) (-4781.687) (-4785.066) -- 0:03:50
      326000 -- (-4794.278) (-4789.294) [-4785.228] (-4786.843) * (-4799.509) (-4788.590) (-4784.069) [-4786.705] -- 0:03:51
      326500 -- (-4789.848) [-4783.303] (-4786.792) (-4787.456) * (-4790.090) [-4788.931] (-4783.942) (-4789.138) -- 0:03:51
      327000 -- (-4784.352) [-4788.412] (-4787.873) (-4789.883) * [-4783.555] (-4784.726) (-4787.913) (-4796.029) -- 0:03:50
      327500 -- (-4785.247) (-4788.862) (-4794.135) [-4793.621] * (-4792.183) (-4795.725) (-4797.169) [-4785.775] -- 0:03:49
      328000 -- (-4782.736) (-4783.694) [-4786.258] (-4783.459) * (-4786.505) (-4791.763) (-4785.533) [-4784.449] -- 0:03:49
      328500 -- (-4791.121) [-4786.509] (-4786.562) (-4782.370) * [-4781.923] (-4785.730) (-4784.642) (-4782.237) -- 0:03:48
      329000 -- [-4792.182] (-4786.326) (-4787.595) (-4785.334) * (-4785.732) (-4786.563) [-4784.855] (-4783.931) -- 0:03:50
      329500 -- (-4787.860) [-4789.939] (-4787.134) (-4789.244) * (-4783.157) (-4787.590) (-4787.413) [-4787.078] -- 0:03:49
      330000 -- (-4787.161) (-4792.240) [-4784.972] (-4792.447) * [-4781.830] (-4788.438) (-4790.364) (-4787.836) -- 0:03:49

      Average standard deviation of split frequencies: 0.000000

      330500 -- [-4786.506] (-4787.093) (-4791.089) (-4792.449) * (-4783.664) (-4790.030) (-4785.309) [-4786.572] -- 0:03:48
      331000 -- [-4786.074] (-4784.607) (-4787.044) (-4790.794) * (-4782.417) [-4786.759] (-4791.523) (-4791.346) -- 0:03:48
      331500 -- (-4782.946) (-4789.011) (-4789.780) [-4786.249] * (-4786.680) (-4784.324) [-4784.089] (-4785.526) -- 0:03:47
      332000 -- (-4789.702) [-4790.022] (-4787.715) (-4785.535) * (-4787.566) [-4782.367] (-4794.394) (-4786.078) -- 0:03:49
      332500 -- (-4787.346) (-4782.938) (-4783.416) [-4786.554] * [-4786.633] (-4789.848) (-4790.901) (-4784.699) -- 0:03:48
      333000 -- (-4782.509) [-4787.556] (-4785.648) (-4788.491) * (-4797.948) (-4794.084) (-4782.716) [-4785.991] -- 0:03:48
      333500 -- (-4785.154) (-4789.760) [-4788.519] (-4786.000) * (-4786.005) (-4790.637) (-4793.586) [-4785.460] -- 0:03:47
      334000 -- (-4791.068) (-4784.492) (-4788.184) [-4782.989] * [-4786.010] (-4789.315) (-4791.940) (-4784.191) -- 0:03:47
      334500 -- (-4785.668) [-4785.814] (-4791.150) (-4785.889) * (-4783.133) [-4788.821] (-4784.401) (-4791.577) -- 0:03:46
      335000 -- (-4787.658) [-4785.345] (-4786.977) (-4782.130) * (-4788.375) (-4796.046) (-4787.469) [-4785.043] -- 0:03:48

      Average standard deviation of split frequencies: 0.000000

      335500 -- (-4789.297) (-4781.897) (-4787.578) [-4785.610] * (-4784.013) [-4785.322] (-4784.377) (-4786.716) -- 0:03:47
      336000 -- [-4790.123] (-4791.234) (-4785.052) (-4785.862) * (-4785.899) (-4785.329) (-4786.101) [-4781.960] -- 0:03:47
      336500 -- (-4787.779) (-4792.704) [-4785.284] (-4787.821) * (-4783.514) (-4786.952) (-4793.023) [-4782.246] -- 0:03:46
      337000 -- [-4785.636] (-4786.919) (-4788.656) (-4786.010) * (-4789.729) (-4787.196) (-4788.096) [-4783.680] -- 0:03:46
      337500 -- (-4784.032) (-4784.049) [-4787.715] (-4788.084) * [-4793.269] (-4786.041) (-4788.138) (-4783.441) -- 0:03:45
      338000 -- (-4790.274) (-4785.446) [-4788.659] (-4783.257) * [-4783.938] (-4786.858) (-4784.973) (-4784.782) -- 0:03:47
      338500 -- (-4793.441) [-4790.004] (-4787.886) (-4784.180) * (-4790.484) (-4794.858) [-4784.461] (-4785.642) -- 0:03:46
      339000 -- (-4788.707) (-4786.756) (-4784.322) [-4791.303] * (-4796.147) (-4787.926) [-4785.830] (-4783.718) -- 0:03:46
      339500 -- [-4786.828] (-4793.007) (-4787.544) (-4788.444) * (-4797.110) (-4787.817) (-4788.119) [-4786.291] -- 0:03:45
      340000 -- (-4787.610) (-4783.409) (-4787.646) [-4785.186] * (-4790.561) (-4785.535) [-4784.024] (-4785.523) -- 0:03:45

      Average standard deviation of split frequencies: 0.000000

      340500 -- [-4786.627] (-4783.551) (-4785.756) (-4789.031) * (-4782.376) (-4790.281) [-4793.656] (-4785.851) -- 0:03:44
      341000 -- [-4783.179] (-4783.083) (-4786.370) (-4787.451) * (-4786.846) (-4783.594) (-4794.009) [-4789.589] -- 0:03:46
      341500 -- [-4784.672] (-4788.302) (-4790.502) (-4784.104) * [-4784.421] (-4783.577) (-4790.407) (-4790.502) -- 0:03:45
      342000 -- (-4788.249) (-4795.153) (-4785.867) [-4788.891] * (-4783.495) (-4787.373) [-4788.846] (-4789.359) -- 0:03:45
      342500 -- (-4792.364) (-4786.379) [-4785.454] (-4792.355) * [-4793.178] (-4788.855) (-4793.560) (-4787.362) -- 0:03:44
      343000 -- (-4793.330) [-4783.108] (-4790.353) (-4790.439) * [-4784.954] (-4787.104) (-4790.751) (-4793.683) -- 0:03:44
      343500 -- (-4785.833) (-4787.135) (-4789.102) [-4786.748] * (-4790.874) (-4786.705) (-4783.704) [-4792.577] -- 0:03:45
      344000 -- [-4789.098] (-4789.134) (-4789.012) (-4793.024) * (-4781.913) [-4784.825] (-4786.010) (-4792.542) -- 0:03:45
      344500 -- (-4790.785) [-4784.948] (-4788.148) (-4791.244) * [-4783.570] (-4789.472) (-4792.248) (-4791.432) -- 0:03:44
      345000 -- (-4791.292) (-4790.827) (-4785.876) [-4784.653] * (-4784.630) (-4783.130) (-4798.321) [-4792.841] -- 0:03:44

      Average standard deviation of split frequencies: 0.000000

      345500 -- (-4797.105) (-4786.813) (-4788.917) [-4786.299] * (-4782.504) [-4781.646] (-4786.222) (-4800.000) -- 0:03:43
      346000 -- (-4790.465) (-4789.500) (-4783.817) [-4786.381] * [-4788.887] (-4786.128) (-4789.806) (-4797.138) -- 0:03:43
      346500 -- [-4783.158] (-4788.058) (-4791.653) (-4786.962) * (-4787.177) [-4785.129] (-4800.819) (-4788.236) -- 0:03:44
      347000 -- (-4782.973) [-4786.340] (-4784.385) (-4789.910) * (-4783.928) (-4783.496) [-4786.460] (-4790.070) -- 0:03:43
      347500 -- (-4793.657) (-4785.113) [-4787.591] (-4784.723) * [-4790.191] (-4787.217) (-4789.509) (-4786.881) -- 0:03:43
      348000 -- (-4791.583) (-4788.059) [-4785.768] (-4781.853) * (-4783.680) (-4785.524) [-4781.375] (-4796.461) -- 0:03:42
      348500 -- (-4791.148) (-4792.477) [-4789.248] (-4788.483) * (-4784.941) (-4789.126) [-4778.962] (-4786.059) -- 0:03:42
      349000 -- (-4785.589) (-4787.066) (-4783.490) [-4781.757] * (-4790.372) [-4785.485] (-4787.298) (-4790.296) -- 0:03:41
      349500 -- (-4790.221) (-4791.648) (-4783.059) [-4784.894] * (-4786.126) (-4790.304) (-4781.456) [-4784.478] -- 0:03:43
      350000 -- (-4785.126) (-4786.936) [-4784.147] (-4781.911) * (-4785.550) (-4790.848) (-4783.191) [-4787.423] -- 0:03:42

      Average standard deviation of split frequencies: 0.000000

      350500 -- (-4790.636) (-4787.311) [-4786.979] (-4784.559) * (-4786.291) (-4788.308) [-4788.640] (-4793.116) -- 0:03:42
      351000 -- (-4791.545) [-4783.142] (-4794.904) (-4789.229) * [-4783.735] (-4791.436) (-4786.762) (-4797.489) -- 0:03:41
      351500 -- (-4788.667) (-4784.989) (-4784.362) [-4788.177] * (-4786.407) [-4787.119] (-4785.092) (-4787.926) -- 0:03:41
      352000 -- (-4786.595) (-4795.096) (-4787.347) [-4784.951] * (-4790.006) (-4790.172) [-4784.166] (-4787.910) -- 0:03:40
      352500 -- (-4785.711) (-4795.284) (-4782.595) [-4785.947] * (-4787.170) (-4793.358) (-4784.930) [-4785.465] -- 0:03:42
      353000 -- (-4788.452) [-4786.939] (-4788.100) (-4782.554) * [-4786.993] (-4790.706) (-4782.789) (-4786.819) -- 0:03:41
      353500 -- (-4782.897) (-4791.469) [-4781.548] (-4788.793) * (-4786.460) (-4786.014) [-4779.501] (-4791.447) -- 0:03:41
      354000 -- (-4792.742) (-4783.651) (-4788.021) [-4786.337] * (-4791.730) (-4791.043) (-4787.992) [-4785.912] -- 0:03:40
      354500 -- (-4788.136) [-4786.311] (-4791.470) (-4790.667) * (-4788.073) (-4790.999) (-4783.237) [-4785.498] -- 0:03:40
      355000 -- [-4788.375] (-4790.762) (-4786.397) (-4792.791) * (-4790.454) (-4792.341) (-4785.563) [-4784.278] -- 0:03:39

      Average standard deviation of split frequencies: 0.000000

      355500 -- (-4790.402) (-4782.486) [-4783.782] (-4794.799) * (-4788.535) (-4785.600) [-4783.802] (-4791.873) -- 0:03:41
      356000 -- (-4788.776) (-4795.343) [-4782.766] (-4787.003) * (-4785.907) [-4784.633] (-4789.392) (-4789.753) -- 0:03:40
      356500 -- [-4783.144] (-4792.457) (-4786.648) (-4788.045) * (-4790.198) [-4784.776] (-4793.490) (-4789.135) -- 0:03:40
      357000 -- (-4788.146) (-4804.536) [-4785.925] (-4786.573) * (-4782.998) [-4789.522] (-4789.615) (-4789.236) -- 0:03:39
      357500 -- (-4781.474) [-4797.669] (-4789.451) (-4789.713) * (-4790.866) [-4784.051] (-4784.450) (-4787.781) -- 0:03:39
      358000 -- (-4788.042) (-4788.672) [-4782.343] (-4788.531) * (-4789.800) [-4785.185] (-4793.177) (-4789.050) -- 0:03:38
      358500 -- [-4783.076] (-4784.772) (-4790.008) (-4785.674) * (-4788.026) (-4786.240) (-4787.940) [-4787.680] -- 0:03:40
      359000 -- [-4786.584] (-4784.808) (-4785.072) (-4783.668) * (-4787.396) [-4785.378] (-4789.581) (-4790.206) -- 0:03:39
      359500 -- (-4781.386) (-4783.723) (-4796.890) [-4784.781] * (-4791.875) (-4787.648) [-4786.840] (-4790.193) -- 0:03:39
      360000 -- [-4786.360] (-4792.768) (-4790.458) (-4789.374) * [-4783.275] (-4796.572) (-4789.350) (-4787.325) -- 0:03:38

      Average standard deviation of split frequencies: 0.000000

      360500 -- [-4786.604] (-4788.935) (-4784.836) (-4788.335) * (-4785.267) (-4791.855) [-4789.904] (-4785.658) -- 0:03:38
      361000 -- [-4787.300] (-4796.673) (-4791.941) (-4789.622) * [-4787.792] (-4791.580) (-4789.313) (-4793.068) -- 0:03:39
      361500 -- [-4784.161] (-4786.386) (-4788.732) (-4784.363) * (-4790.959) [-4785.608] (-4787.543) (-4787.129) -- 0:03:39
      362000 -- (-4788.651) (-4785.240) (-4786.291) [-4789.675] * (-4789.962) (-4785.102) (-4787.053) [-4786.309] -- 0:03:38
      362500 -- (-4794.695) [-4783.351] (-4794.237) (-4786.427) * [-4795.110] (-4788.797) (-4786.506) (-4786.156) -- 0:03:38
      363000 -- (-4795.372) (-4788.432) [-4787.307] (-4786.238) * [-4791.095] (-4783.999) (-4791.604) (-4786.722) -- 0:03:37
      363500 -- (-4783.288) (-4786.606) (-4787.645) [-4787.855] * (-4790.118) (-4785.952) [-4788.755] (-4788.155) -- 0:03:37
      364000 -- [-4786.944] (-4788.469) (-4782.955) (-4786.095) * (-4795.292) (-4789.031) (-4783.625) [-4788.509] -- 0:03:38
      364500 -- (-4789.799) (-4786.764) (-4788.226) [-4789.333] * (-4797.690) (-4783.964) (-4787.645) [-4789.976] -- 0:03:37
      365000 -- (-4797.378) (-4794.772) (-4784.470) [-4783.855] * [-4783.712] (-4787.252) (-4782.433) (-4787.173) -- 0:03:37

      Average standard deviation of split frequencies: 0.000000

      365500 -- [-4785.578] (-4792.086) (-4789.118) (-4792.238) * (-4788.803) (-4785.428) [-4785.437] (-4785.917) -- 0:03:36
      366000 -- (-4787.028) (-4791.512) (-4783.606)