--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Tue Nov 29 13:31:17 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/64/CG13437-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/64/CG13437-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/64/CG13437-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/64/CG13437-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1465.53 -1479.72
2 -1466.37 -1480.92
--------------------------------------
TOTAL -1465.86 -1480.49
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/64/CG13437-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/64/CG13437-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/64/CG13437-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.277621 0.026815 0.975096 1.599881 1.263421 1406.18 1453.59 1.000
r(A<->C){all} 0.144416 0.001140 0.075064 0.208558 0.143203 850.32 879.84 1.000
r(A<->G){all} 0.292213 0.002590 0.196802 0.394948 0.290827 696.40 768.75 1.000
r(A<->T){all} 0.072289 0.000930 0.017804 0.131197 0.069205 791.16 954.99 1.000
r(C<->G){all} 0.048395 0.000337 0.013903 0.084001 0.046805 1095.66 1110.33 1.000
r(C<->T){all} 0.388771 0.003157 0.283007 0.495945 0.387931 640.85 667.11 1.000
r(G<->T){all} 0.053916 0.000546 0.012753 0.101068 0.051192 895.99 902.68 1.000
pi(A){all} 0.231663 0.000383 0.192301 0.268329 0.230768 1087.50 1144.84 1.000
pi(C){all} 0.291344 0.000390 0.253503 0.329741 0.291166 1028.65 1054.56 1.000
pi(G){all} 0.254996 0.000375 0.215221 0.290583 0.254717 1248.09 1264.71 1.000
pi(T){all} 0.221997 0.000311 0.187087 0.255242 0.221659 779.92 944.29 1.000
alpha{1,2} 0.075216 0.000413 0.023923 0.112844 0.078047 1004.72 1061.98 1.001
alpha{3} 2.568287 0.596214 1.258570 4.081137 2.457264 1248.24 1374.62 1.000
pinvar{all} 0.305945 0.003834 0.179729 0.418067 0.308509 1271.68 1386.34 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1344.872726
Model 2: PositiveSelection -1344.872726
Model 0: one-ratio -1345.815275
Model 3: discrete -1344.822129
Model 7: beta -1345.33688
Model 8: beta&w>1 -1344.979737
Model 0 vs 1 1.8850979999997435
Model 2 vs 1 0.0
Model 8 vs 7 0.7142860000003566
>C1
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
VHVIQLQHDDVEREDHYMNHFHQNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C2
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
VHVIQLQHDDVEREDHYMNHFHQNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C3
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
VHVIQLQHDDVEREDHYMNHFHQNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C4
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADPERRPS
VHVIQLQQDDVEREDHYMNNFHRNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C5
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADPERRPS
VHVIQLQQDDVEREDHYMNNFHRNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C6
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
VHVIQLQHDDVEREDHYMNNFHRNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C7
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
VHVIQLQHDDVEREDHYLDNFHRNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C8
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTDRRPS
VHVIQLQHDDVEREDHYMNNFHQNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C9
MSMLGFVYLVLILGWILIVLFLKCKKSLSAPFRFGENYTDAIAETDRRPS
VHVIQLQHDDVEREDHYMNNFHRNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C10
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
VHVIQLQHDDVEREDHYMNNFHRNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=10, Len=149
C1 MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
C2 MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
C3 MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
C4 MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADPERRPS
C5 MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADPERRPS
C6 MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
C7 MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
C8 MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTDRRPS
C9 MSMLGFVYLVLILGWILIVLFLKCKKSLSAPFRFGENYTDAIAETDRRPS
C10 MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
****************************:**************:.:****
C1 VHVIQLQHDDVEREDHYMNHFHQNTENLQRYSHRSQRSTLEERTIERTYP
C2 VHVIQLQHDDVEREDHYMNHFHQNTENLQRYSHRSQRSTLEERTIERTYP
C3 VHVIQLQHDDVEREDHYMNHFHQNTENLQRYSHRSQRSTLEERTIERTYP
C4 VHVIQLQQDDVEREDHYMNNFHRNTENLQRYSHRSQRSTLEERTIERTYP
C5 VHVIQLQQDDVEREDHYMNNFHRNTENLQRYSHRSQRSTLEERTIERTYP
C6 VHVIQLQHDDVEREDHYMNNFHRNTENLQRYSHRSQRSTLEERTIERTYP
C7 VHVIQLQHDDVEREDHYLDNFHRNTENLQRYSHRSQRSTLEERTIERTYP
C8 VHVIQLQHDDVEREDHYMNNFHQNTENLQRYSHRSQRSTLEERTIERTYP
C9 VHVIQLQHDDVEREDHYMNNFHRNTENLQRYSHRSQRSTLEERTIERTYP
C10 VHVIQLQHDDVEREDHYMNNFHRNTENLQRYSHRSQRSTLEERTIERTYP
*******:*********:::**:***************************
C1 TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
C2 TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
C3 TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
C4 TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
C5 TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
C6 TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
C7 TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
C8 TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
C9 TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
C10 TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
*************************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 149 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 149 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [13410]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [13410]--->[13410]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/64/CG13437-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.520 Mb, Max= 30.870 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
VHVIQLQHDDVEREDHYMNHFHQNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C2
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
VHVIQLQHDDVEREDHYMNHFHQNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C3
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
VHVIQLQHDDVEREDHYMNHFHQNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C4
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADPERRPS
VHVIQLQQDDVEREDHYMNNFHRNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C5
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADPERRPS
VHVIQLQQDDVEREDHYMNNFHRNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C6
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
VHVIQLQHDDVEREDHYMNNFHRNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C7
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
VHVIQLQHDDVEREDHYLDNFHRNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C8
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTDRRPS
VHVIQLQHDDVEREDHYMNNFHQNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C9
MSMLGFVYLVLILGWILIVLFLKCKKSLSAPFRFGENYTDAIAETDRRPS
VHVIQLQHDDVEREDHYMNNFHRNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C10
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
VHVIQLQHDDVEREDHYMNNFHRNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
FORMAT of file /tmp/tmp2103239050023832794aln Not Supported[FATAL:T-COFFEE]
>C1
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
VHVIQLQHDDVEREDHYMNHFHQNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C2
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
VHVIQLQHDDVEREDHYMNHFHQNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C3
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
VHVIQLQHDDVEREDHYMNHFHQNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C4
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADPERRPS
VHVIQLQQDDVEREDHYMNNFHRNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C5
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADPERRPS
VHVIQLQQDDVEREDHYMNNFHRNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C6
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
VHVIQLQHDDVEREDHYMNNFHRNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C7
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
VHVIQLQHDDVEREDHYLDNFHRNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C8
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTDRRPS
VHVIQLQHDDVEREDHYMNNFHQNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C9
MSMLGFVYLVLILGWILIVLFLKCKKSLSAPFRFGENYTDAIAETDRRPS
VHVIQLQHDDVEREDHYMNNFHRNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C10
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
VHVIQLQHDDVEREDHYMNNFHRNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:149 S:100 BS:149
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 97.32 C1 C4 97.32
TOP 3 0 97.32 C4 C1 97.32
BOT 0 4 97.32 C1 C5 97.32
TOP 4 0 97.32 C5 C1 97.32
BOT 0 5 98.66 C1 C6 98.66
TOP 5 0 98.66 C6 C1 98.66
BOT 0 6 97.32 C1 C7 97.32
TOP 6 0 97.32 C7 C1 97.32
BOT 0 7 98.66 C1 C8 98.66
TOP 7 0 98.66 C8 C1 98.66
BOT 0 8 96.64 C1 C9 96.64
TOP 8 0 96.64 C9 C1 96.64
BOT 0 9 98.66 C1 C10 98.66
TOP 9 0 98.66 C10 C1 98.66
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 97.32 C2 C4 97.32
TOP 3 1 97.32 C4 C2 97.32
BOT 1 4 97.32 C2 C5 97.32
TOP 4 1 97.32 C5 C2 97.32
BOT 1 5 98.66 C2 C6 98.66
TOP 5 1 98.66 C6 C2 98.66
BOT 1 6 97.32 C2 C7 97.32
TOP 6 1 97.32 C7 C2 97.32
BOT 1 7 98.66 C2 C8 98.66
TOP 7 1 98.66 C8 C2 98.66
BOT 1 8 96.64 C2 C9 96.64
TOP 8 1 96.64 C9 C2 96.64
BOT 1 9 98.66 C2 C10 98.66
TOP 9 1 98.66 C10 C2 98.66
BOT 2 3 97.32 C3 C4 97.32
TOP 3 2 97.32 C4 C3 97.32
BOT 2 4 97.32 C3 C5 97.32
TOP 4 2 97.32 C5 C3 97.32
BOT 2 5 98.66 C3 C6 98.66
TOP 5 2 98.66 C6 C3 98.66
BOT 2 6 97.32 C3 C7 97.32
TOP 6 2 97.32 C7 C3 97.32
BOT 2 7 98.66 C3 C8 98.66
TOP 7 2 98.66 C8 C3 98.66
BOT 2 8 96.64 C3 C9 96.64
TOP 8 2 96.64 C9 C3 96.64
BOT 2 9 98.66 C3 C10 98.66
TOP 9 2 98.66 C10 C3 98.66
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 98.66 C4 C6 98.66
TOP 5 3 98.66 C6 C4 98.66
BOT 3 6 97.32 C4 C7 97.32
TOP 6 3 97.32 C7 C4 97.32
BOT 3 7 97.32 C4 C8 97.32
TOP 7 3 97.32 C8 C4 97.32
BOT 3 8 96.64 C4 C9 96.64
TOP 8 3 96.64 C9 C4 96.64
BOT 3 9 98.66 C4 C10 98.66
TOP 9 3 98.66 C10 C4 98.66
BOT 4 5 98.66 C5 C6 98.66
TOP 5 4 98.66 C6 C5 98.66
BOT 4 6 97.32 C5 C7 97.32
TOP 6 4 97.32 C7 C5 97.32
BOT 4 7 97.32 C5 C8 97.32
TOP 7 4 97.32 C8 C5 97.32
BOT 4 8 96.64 C5 C9 96.64
TOP 8 4 96.64 C9 C5 96.64
BOT 4 9 98.66 C5 C10 98.66
TOP 9 4 98.66 C10 C5 98.66
BOT 5 6 98.66 C6 C7 98.66
TOP 6 5 98.66 C7 C6 98.66
BOT 5 7 98.66 C6 C8 98.66
TOP 7 5 98.66 C8 C6 98.66
BOT 5 8 97.99 C6 C9 97.99
TOP 8 5 97.99 C9 C6 97.99
BOT 5 9 100.00 C6 C10 100.00
TOP 9 5 100.00 C10 C6 100.00
BOT 6 7 97.32 C7 C8 97.32
TOP 7 6 97.32 C8 C7 97.32
BOT 6 8 96.64 C7 C9 96.64
TOP 8 6 96.64 C9 C7 96.64
BOT 6 9 98.66 C7 C10 98.66
TOP 9 6 98.66 C10 C7 98.66
BOT 7 8 97.99 C8 C9 97.99
TOP 8 7 97.99 C9 C8 97.99
BOT 7 9 98.66 C8 C10 98.66
TOP 9 7 98.66 C10 C8 98.66
BOT 8 9 97.99 C9 C10 97.99
TOP 9 8 97.99 C10 C9 97.99
AVG 0 C1 * 98.28
AVG 1 C2 * 98.28
AVG 2 C3 * 98.28
AVG 3 C4 * 97.84
AVG 4 C5 * 97.84
AVG 5 C6 * 98.73
AVG 6 C7 * 97.54
AVG 7 C8 * 98.14
AVG 8 C9 * 97.09
AVG 9 C10 * 98.73
TOT TOT * 98.08
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGAGCATGCTAGGATTTGTTTACCTGGTTCTCATCCTGGGCTGGATACT
C2 ATGAGCATGCTAGGATTTGTCTACCTGGTTCTCATCCTGGGCTGGATACT
C3 ATGAGCATGCTAGGATTTGTCTACCTGGTTCTTATCCTGGGCTGGATACT
C4 ATGAGCATGCTGGGATTCGTCTATCTGGTTCTCATCCTGGGTTGGATACT
C5 ATGAGCATGCTGGGATTCGTCTATCTGGTTCTCATCCTGGGTTGGATACT
C6 ATGAGCATGCTGGGATTTGTCTACCTGGTTCTTATTCTGGGCTGGATACT
C7 ATGAGCATGCTGGGATTTGTCTACCTGGTCCTCATCCTGGGTTGGATACT
C8 ATGAGCATGCTGGGCTTTGTCTACCTGGTTCTTATCCTGGGCTGGATTCT
C9 ATGAGCATGCTGGGCTTTGTCTACTTGGTTCTCATCCTGGGCTGGATACT
C10 ATGAGCATGCTGGGATTTGTCTATCTGGTTCTCATCCTGGGCTGGATACT
***********.**.** ** ** **** ** ** ***** *****:**
C1 GATCGTTCTGTTCCTGAAGTGCAAAAAGTCCTTGGCCGCTCCGTTTCGGT
C2 GATCGTTCTGTTCCTGAAGTGCAAAAAGTCCTTGGCCGCTCCATTTCGGT
C3 GATCGTTCTGTTCCTGAAGTGCAAAAAGTCCTTGGCCGCTCCATTTCGGT
C4 GATCGTGTTGTTCCTCAAGTGCAAGAAGTCCTTGGCCGCTCCCTTTCGCT
C5 GATCGTCTTGTTCCTCAAGTGCAAAAAGTCCTTGGCCGCTCCCTTTCGCT
C6 GATCGTGTTGTTTCTGAAGTGCAAAAAGTCCTTAGCCGCTCCTTTTCGCT
C7 GATCGTATTGTTTCTGAAATGCAAAAAGTCCTTGGCCGCTCCCTTTCGCT
C8 AATCGTGCTGTTTCTTAAGTGCAAAAAGTCCTTGGCGGCTCCCTTTCGCT
C9 GATCGTCCTGTTTCTCAAGTGCAAAAAGTCCTTGTCCGCTCCATTTCGCT
C10 GATCGTCTTGTTTCTTAAGTGCAAAAAGTCCTTGGCCGCCCCCTTTCGCT
.***** **** ** **.*****.********. * ** ** ***** *
C1 TTGGCGAGAACTACACCGATGCCATCGCCGATACGGAACGTCGCCCATCG
C2 TTGGCGAGAACTACACCGATGCCATCGCCGATACGGAACGTCGCCCATCG
C3 TTGGCGAGAACTACACCGATGCCATCGCCGATACGGAACGTCGCCCATCG
C4 TTGGCGAAAACTACACCGATGCCATCGCCGATCCGGAACGACGTCCCTCA
C5 TTGGCGAAAACTACACCGATGCCATCGCCGATCCAGAACGACGTCCCTCA
C6 TTGGGGAAAACTACACCGATGCTATCGCAGATACTGAACGTCGTCCCTCT
C7 TTGGCGAAAACTACACTGATGCCATCGCCGATACTGAGCGCCGGCCCTCA
C8 TTGGCGAAAACTACACCGACGCCATCGCCGATACGGATCGCCGTCCCTCC
C9 TTGGCGAAAACTACACAGATGCCATCGCCGAAACGGATCGACGTCCATCG
C10 TTGGCGAAAACTACACCGATGCCATCGCCGATACGGAGCGACGTCCCTCA
**** **.******** ** ** *****.**:.* ** ** ** **.**
C1 GTTCACGTTATCCAGTTGCAGCACGATGATGTGGAGCGCGAGGATCACTA
C2 GTCCACGTTATCCAGTTGCAGCACGATGATGTGGAGCGCGAGGATCACTA
C3 GTCCACGTTATCCAGTTGCAGCACGATGATGTGGAGCGCGAGGATCACTA
C4 GTCCATGTGATCCAGCTGCAGCAGGATGATGTGGAGCGCGAAGATCACTA
C5 GTCCATGTGATCCAGCTGCAGCAGGATGATGTGGAGCGCGAAGATCATTA
C6 GTCCACGTAATCCAGCTGCAGCACGATGATGTGGAACGCGAAGATCATTA
C7 GTGCATGTGATCCAACTCCAGCACGATGATGTGGAACGCGAAGATCATTA
C8 GTGCATGTAATCCAGCTGCAACACGATGATGTGGAGCGCGAAGATCATTA
C9 GTGCATGTGATCCAGCTGCAACACGATGATGTGGAGCGGGAAGATCACTA
C10 GTCCATGTGATTCAACTGCAGCACGATGATGTGGAACGAGAAGATCACTA
** ** ** ** **. * **.** ***********.** **.***** **
C1 TATGAACCACTTTCACCAAAACACGGAGAATCTGCAGCGCTACTCGCATC
C2 TATGAACCATTTCCACCAAAACACGGAGAATCTGCAGCGCTACTCGCATC
C3 TATGAACCATTTCCACCAAAACACGGAGAATCTGCAGCGCTACTCGCATC
C4 CATGAACAACTTTCACCGGAACACGGAGAACCTGCAGCGGTACTCGCATC
C5 TATGAACAACTTTCACCGAAACACGGAGAACCTGCAGCGGTACTCGCATC
C6 TATGAACAACTTTCATCGAAACACAGAGAATCTGCAGCGATATTCTCATC
C7 CTTGGACAACTTTCACCGCAACACGGAGAACCTGCAGCGCTACTCGCATC
C8 TATGAACAACTTTCACCAAAACACAGAGAATCTGCAGCGATACTCGCATC
C9 TATGAACAACTTTCACCGGAACACGGAGAATCTGCAGCGCTACTCGCATC
C10 CATGAACAACTTTCACCGAAACACGGAGAATCTGCAGCGATACTCGCATC
:**.**.* ** ** *. *****.***** ******** ** ** ****
C1 GCTCGCAACGTTCCACGTTGGAGGAGCGTACGATCGAGCGGACATATCCC
C2 GCTCGCAACGTTCCACGCTGGAGGAGCGTACGATCGAGCGGACATATCCC
C3 GCTCGCAACGTTCTACGCTGGAGGAGCGTACGATCGAGCGGACATATCCC
C4 GCTCGCAACGCTCCACCCTGGAGGAGCGGACCATCGAGAGGACCTATCCC
C5 GCTCGCAACGCTCCACTTTGGAGGAGCGGACAATCGAAAGGACCTATCCC
C6 GCTCGCAACGCTCGACTTTGGAAGAGCGGACTATCGAGAGAACATATCCC
C7 GCTCGCAACGTTCCACTTTGGAGGAGCGGACAATTGAGCGGACCTATCCC
C8 GTTCGCAACGCTCCACTTTGGAGGAGCGGACAATCGAGAGAACCTATCCA
C9 GTTCGCAACGCTCCACGCTGGAGGAGCGGACCATCGAGCGGACCTATCCC
C10 GCTCGCAGCGATCCACCTTGGAGGAGCGGACAATCGAGAGGACATATCCC
* *****.** ** ** ****.***** ** ** **..*.**.*****.
C1 ACGGATGCGGTGATAAATCCTGCCTATATGCACGACGAGGACTACGTGAT
C2 ACGGATGCGGTGATAAATCCTGCCTATATGCACGACGAGGACTACGTGAT
C3 ACGGATGCGGTGATAAATCCTGCCTATATGCACGACGAGGACTACGTGAT
C4 ACGGATGCGGTGATAAACCCTGCTTATATGCACGACGAGGATTATGTGAT
C5 ACAGATGCGGTGATAAATCCTGCTTATATGCACGATGAGGACTATGTGAT
C6 ACGGATGCCGTGATAAATCCTGCCTATATGCACGATGAGGATTACGTGAT
C7 ACGGATGCGGTGATAAATCCTGCCTATATGCACGATGAGGACTACGTGAT
C8 ACGGATGCGGTGATAAATCCTGCTTATATGCACGATGAGGATTACGTGAT
C9 ACGGATGCGGTGATCAATCCTGCCTACATGCACGATGAGGATTATGTGAT
C10 ACGGATGCGGTGATAAATCCAGCCTATATGCACGATGAGGATTACGTGAT
**.***** *****.** **:** ** ******** ***** ** *****
C1 CAATGCACCTCCTCCGTCCTACGAGGAAGTGATGCGGCAGCCGCAGGTGT
C2 CAATGCACCTCCTCCGTCCTACGAGGAAGTGATGCGGCAGCCGCAGGTGT
C3 CAATGCACCTCCTCCGTCCTACGAGGAAGTGATGCGCCAGCCGCAGGTGT
C4 CAATGCCCCGCCACCTTCCTACGAGGAGGTGATGCGCCAGCCACAGGTGT
C5 CAATGCCCCGCCACCATCCTACGAGGAGGTGATGCGCCAGCCACAGGTGT
C6 CAATGCTCCTCCGCCATCCTATGAGGAAGTGATGCGCCAGCCACAAGTGT
C7 CAATGCCCCGCCACCATCTTACGAGGAGGTGATGCGCCAGCCGCAGGTGT
C8 CAACGCCCCTCCACCATCCTACGAAGAGGTGATGCGCCAGCCGCAGGTAT
C9 CAACGCCCCTCCACCGTCATACGAGGAGGTAATGCGCCAGCCGCAGGTGT
C10 CAACGCCCCTCCACCATCCTACGAGGAGGTGATGCGCCAACCACAGGTGT
*** ** ** ** ** ** ** **.**.**.***** **.**.**.**.*
C1 ATCCACAGGTGCGCCACAACAACCACAAGATCAGCGATGCTGACATC
C2 ATCCACAGGTGCGCCACAACAACCACAAGATCAGCGATGCTGACATC
C3 ATCCACAGGTGCGCCACAACAACCACAAGATCAGCGATGCTGACATC
C4 ATCCCCAGGTGCGCCACAACAACCACAAGATCAGCGATGCTGACATC
C5 ATCCTCAGGTGCGCCATAACAACCACAAGATCAGCGATGCTGACATC
C6 ATCCTCAGGTTCGCCACAACAACCACAAGATCAGCGATGCTGACATC
C7 ATCCTCAGGTGCGCCACAACAACCACAAGATCAGCGATGCTGACATC
C8 ATCCTCAGGTGCGCCACAACAACCACAAGATCAGCGATGCCGACATC
C9 ATCCTCAGGTGCGACACAACAACCACAAGATCAGCGATGCCGACATC
C10 ATCCTCAGGTGCGCCACAACAACCACAAGATCAGCGATGCTGACATC
**** ***** **.** *********************** ******
>C1
ATGAGCATGCTAGGATTTGTTTACCTGGTTCTCATCCTGGGCTGGATACT
GATCGTTCTGTTCCTGAAGTGCAAAAAGTCCTTGGCCGCTCCGTTTCGGT
TTGGCGAGAACTACACCGATGCCATCGCCGATACGGAACGTCGCCCATCG
GTTCACGTTATCCAGTTGCAGCACGATGATGTGGAGCGCGAGGATCACTA
TATGAACCACTTTCACCAAAACACGGAGAATCTGCAGCGCTACTCGCATC
GCTCGCAACGTTCCACGTTGGAGGAGCGTACGATCGAGCGGACATATCCC
ACGGATGCGGTGATAAATCCTGCCTATATGCACGACGAGGACTACGTGAT
CAATGCACCTCCTCCGTCCTACGAGGAAGTGATGCGGCAGCCGCAGGTGT
ATCCACAGGTGCGCCACAACAACCACAAGATCAGCGATGCTGACATC
>C2
ATGAGCATGCTAGGATTTGTCTACCTGGTTCTCATCCTGGGCTGGATACT
GATCGTTCTGTTCCTGAAGTGCAAAAAGTCCTTGGCCGCTCCATTTCGGT
TTGGCGAGAACTACACCGATGCCATCGCCGATACGGAACGTCGCCCATCG
GTCCACGTTATCCAGTTGCAGCACGATGATGTGGAGCGCGAGGATCACTA
TATGAACCATTTCCACCAAAACACGGAGAATCTGCAGCGCTACTCGCATC
GCTCGCAACGTTCCACGCTGGAGGAGCGTACGATCGAGCGGACATATCCC
ACGGATGCGGTGATAAATCCTGCCTATATGCACGACGAGGACTACGTGAT
CAATGCACCTCCTCCGTCCTACGAGGAAGTGATGCGGCAGCCGCAGGTGT
ATCCACAGGTGCGCCACAACAACCACAAGATCAGCGATGCTGACATC
>C3
ATGAGCATGCTAGGATTTGTCTACCTGGTTCTTATCCTGGGCTGGATACT
GATCGTTCTGTTCCTGAAGTGCAAAAAGTCCTTGGCCGCTCCATTTCGGT
TTGGCGAGAACTACACCGATGCCATCGCCGATACGGAACGTCGCCCATCG
GTCCACGTTATCCAGTTGCAGCACGATGATGTGGAGCGCGAGGATCACTA
TATGAACCATTTCCACCAAAACACGGAGAATCTGCAGCGCTACTCGCATC
GCTCGCAACGTTCTACGCTGGAGGAGCGTACGATCGAGCGGACATATCCC
ACGGATGCGGTGATAAATCCTGCCTATATGCACGACGAGGACTACGTGAT
CAATGCACCTCCTCCGTCCTACGAGGAAGTGATGCGCCAGCCGCAGGTGT
ATCCACAGGTGCGCCACAACAACCACAAGATCAGCGATGCTGACATC
>C4
ATGAGCATGCTGGGATTCGTCTATCTGGTTCTCATCCTGGGTTGGATACT
GATCGTGTTGTTCCTCAAGTGCAAGAAGTCCTTGGCCGCTCCCTTTCGCT
TTGGCGAAAACTACACCGATGCCATCGCCGATCCGGAACGACGTCCCTCA
GTCCATGTGATCCAGCTGCAGCAGGATGATGTGGAGCGCGAAGATCACTA
CATGAACAACTTTCACCGGAACACGGAGAACCTGCAGCGGTACTCGCATC
GCTCGCAACGCTCCACCCTGGAGGAGCGGACCATCGAGAGGACCTATCCC
ACGGATGCGGTGATAAACCCTGCTTATATGCACGACGAGGATTATGTGAT
CAATGCCCCGCCACCTTCCTACGAGGAGGTGATGCGCCAGCCACAGGTGT
ATCCCCAGGTGCGCCACAACAACCACAAGATCAGCGATGCTGACATC
>C5
ATGAGCATGCTGGGATTCGTCTATCTGGTTCTCATCCTGGGTTGGATACT
GATCGTCTTGTTCCTCAAGTGCAAAAAGTCCTTGGCCGCTCCCTTTCGCT
TTGGCGAAAACTACACCGATGCCATCGCCGATCCAGAACGACGTCCCTCA
GTCCATGTGATCCAGCTGCAGCAGGATGATGTGGAGCGCGAAGATCATTA
TATGAACAACTTTCACCGAAACACGGAGAACCTGCAGCGGTACTCGCATC
GCTCGCAACGCTCCACTTTGGAGGAGCGGACAATCGAAAGGACCTATCCC
ACAGATGCGGTGATAAATCCTGCTTATATGCACGATGAGGACTATGTGAT
CAATGCCCCGCCACCATCCTACGAGGAGGTGATGCGCCAGCCACAGGTGT
ATCCTCAGGTGCGCCATAACAACCACAAGATCAGCGATGCTGACATC
>C6
ATGAGCATGCTGGGATTTGTCTACCTGGTTCTTATTCTGGGCTGGATACT
GATCGTGTTGTTTCTGAAGTGCAAAAAGTCCTTAGCCGCTCCTTTTCGCT
TTGGGGAAAACTACACCGATGCTATCGCAGATACTGAACGTCGTCCCTCT
GTCCACGTAATCCAGCTGCAGCACGATGATGTGGAACGCGAAGATCATTA
TATGAACAACTTTCATCGAAACACAGAGAATCTGCAGCGATATTCTCATC
GCTCGCAACGCTCGACTTTGGAAGAGCGGACTATCGAGAGAACATATCCC
ACGGATGCCGTGATAAATCCTGCCTATATGCACGATGAGGATTACGTGAT
CAATGCTCCTCCGCCATCCTATGAGGAAGTGATGCGCCAGCCACAAGTGT
ATCCTCAGGTTCGCCACAACAACCACAAGATCAGCGATGCTGACATC
>C7
ATGAGCATGCTGGGATTTGTCTACCTGGTCCTCATCCTGGGTTGGATACT
GATCGTATTGTTTCTGAAATGCAAAAAGTCCTTGGCCGCTCCCTTTCGCT
TTGGCGAAAACTACACTGATGCCATCGCCGATACTGAGCGCCGGCCCTCA
GTGCATGTGATCCAACTCCAGCACGATGATGTGGAACGCGAAGATCATTA
CTTGGACAACTTTCACCGCAACACGGAGAACCTGCAGCGCTACTCGCATC
GCTCGCAACGTTCCACTTTGGAGGAGCGGACAATTGAGCGGACCTATCCC
ACGGATGCGGTGATAAATCCTGCCTATATGCACGATGAGGACTACGTGAT
CAATGCCCCGCCACCATCTTACGAGGAGGTGATGCGCCAGCCGCAGGTGT
ATCCTCAGGTGCGCCACAACAACCACAAGATCAGCGATGCTGACATC
>C8
ATGAGCATGCTGGGCTTTGTCTACCTGGTTCTTATCCTGGGCTGGATTCT
AATCGTGCTGTTTCTTAAGTGCAAAAAGTCCTTGGCGGCTCCCTTTCGCT
TTGGCGAAAACTACACCGACGCCATCGCCGATACGGATCGCCGTCCCTCC
GTGCATGTAATCCAGCTGCAACACGATGATGTGGAGCGCGAAGATCATTA
TATGAACAACTTTCACCAAAACACAGAGAATCTGCAGCGATACTCGCATC
GTTCGCAACGCTCCACTTTGGAGGAGCGGACAATCGAGAGAACCTATCCA
ACGGATGCGGTGATAAATCCTGCTTATATGCACGATGAGGATTACGTGAT
CAACGCCCCTCCACCATCCTACGAAGAGGTGATGCGCCAGCCGCAGGTAT
ATCCTCAGGTGCGCCACAACAACCACAAGATCAGCGATGCCGACATC
>C9
ATGAGCATGCTGGGCTTTGTCTACTTGGTTCTCATCCTGGGCTGGATACT
GATCGTCCTGTTTCTCAAGTGCAAAAAGTCCTTGTCCGCTCCATTTCGCT
TTGGCGAAAACTACACAGATGCCATCGCCGAAACGGATCGACGTCCATCG
GTGCATGTGATCCAGCTGCAACACGATGATGTGGAGCGGGAAGATCACTA
TATGAACAACTTTCACCGGAACACGGAGAATCTGCAGCGCTACTCGCATC
GTTCGCAACGCTCCACGCTGGAGGAGCGGACCATCGAGCGGACCTATCCC
ACGGATGCGGTGATCAATCCTGCCTACATGCACGATGAGGATTATGTGAT
CAACGCCCCTCCACCGTCATACGAGGAGGTAATGCGCCAGCCGCAGGTGT
ATCCTCAGGTGCGACACAACAACCACAAGATCAGCGATGCCGACATC
>C10
ATGAGCATGCTGGGATTTGTCTATCTGGTTCTCATCCTGGGCTGGATACT
GATCGTCTTGTTTCTTAAGTGCAAAAAGTCCTTGGCCGCCCCCTTTCGCT
TTGGCGAAAACTACACCGATGCCATCGCCGATACGGAGCGACGTCCCTCA
GTCCATGTGATTCAACTGCAGCACGATGATGTGGAACGAGAAGATCACTA
CATGAACAACTTTCACCGAAACACGGAGAATCTGCAGCGATACTCGCATC
GCTCGCAGCGATCCACCTTGGAGGAGCGGACAATCGAGAGGACATATCCC
ACGGATGCGGTGATAAATCCAGCCTATATGCACGATGAGGATTACGTGAT
CAACGCCCCTCCACCATCCTACGAGGAGGTGATGCGCCAACCACAGGTGT
ATCCTCAGGTGCGCCACAACAACCACAAGATCAGCGATGCTGACATC
>C1
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
VHVIQLQHDDVEREDHYMNHFHQNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C2
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
VHVIQLQHDDVEREDHYMNHFHQNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C3
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
VHVIQLQHDDVEREDHYMNHFHQNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C4
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADPERRPS
VHVIQLQQDDVEREDHYMNNFHRNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C5
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADPERRPS
VHVIQLQQDDVEREDHYMNNFHRNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C6
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
VHVIQLQHDDVEREDHYMNNFHRNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C7
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
VHVIQLQHDDVEREDHYLDNFHRNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C8
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTDRRPS
VHVIQLQHDDVEREDHYMNNFHQNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C9
MSMLGFVYLVLILGWILIVLFLKCKKSLSAPFRFGENYTDAIAETDRRPS
VHVIQLQHDDVEREDHYMNNFHRNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
>C10
MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
VHVIQLQHDDVEREDHYMNNFHRNTENLQRYSHRSQRSTLEERTIERTYP
TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/64/CG13437-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 10 taxa and 447 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Taxon 10 -> C10
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1480425614
Setting output file names to "/opt/ADOPS/64/CG13437-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 881566832
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 3701588263
Seed = 773550151
Swapseed = 1480425614
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 14 unique site patterns
Division 2 has 5 unique site patterns
Division 3 has 89 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2121.996453 -- -24.412588
Chain 2 -- -2135.729798 -- -24.412588
Chain 3 -- -2137.726658 -- -24.412588
Chain 4 -- -2080.415349 -- -24.412588
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2140.994260 -- -24.412588
Chain 2 -- -2087.535546 -- -24.412588
Chain 3 -- -2167.940649 -- -24.412588
Chain 4 -- -2156.971462 -- -24.412588
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2121.996] (-2135.730) (-2137.727) (-2080.415) * [-2140.994] (-2087.536) (-2167.941) (-2156.971)
500 -- (-1597.751) [-1606.060] (-1603.739) (-1611.174) * (-1608.233) [-1578.564] (-1603.062) (-1595.508) -- 0:00:00
1000 -- (-1584.416) (-1554.844) [-1559.673] (-1583.315) * (-1563.728) [-1520.992] (-1595.873) (-1573.025) -- 0:00:00
1500 -- (-1558.616) (-1517.074) [-1504.441] (-1565.467) * (-1533.267) [-1499.518] (-1571.095) (-1540.876) -- 0:00:00
2000 -- (-1526.415) [-1475.308] (-1480.460) (-1547.198) * [-1491.227] (-1480.587) (-1550.106) (-1505.992) -- 0:00:00
2500 -- (-1495.451) (-1467.995) [-1478.040] (-1505.686) * (-1482.204) (-1485.957) (-1507.166) [-1472.441] -- 0:00:00
3000 -- (-1476.215) (-1470.670) (-1477.906) [-1462.472] * (-1473.872) (-1474.881) [-1484.521] (-1475.179) -- 0:05:32
3500 -- (-1481.212) (-1473.026) (-1480.133) [-1473.490] * [-1474.784] (-1477.854) (-1478.309) (-1471.909) -- 0:04:44
4000 -- (-1474.314) [-1467.003] (-1483.817) (-1469.549) * (-1466.985) [-1475.108] (-1480.537) (-1482.001) -- 0:04:09
4500 -- (-1476.225) (-1469.948) (-1475.555) [-1469.952] * (-1469.931) [-1471.439] (-1485.884) (-1478.913) -- 0:03:41
5000 -- (-1491.629) [-1464.583] (-1466.764) (-1472.784) * [-1476.258] (-1481.463) (-1482.699) (-1474.836) -- 0:06:38
Average standard deviation of split frequencies: 0.075858
5500 -- (-1473.740) [-1464.723] (-1473.997) (-1470.226) * [-1473.040] (-1477.689) (-1472.132) (-1467.834) -- 0:06:01
6000 -- [-1465.990] (-1481.319) (-1465.331) (-1469.680) * (-1471.515) (-1474.529) [-1480.821] (-1485.752) -- 0:05:31
6500 -- (-1468.783) (-1471.128) [-1464.861] (-1473.320) * (-1472.048) (-1477.107) [-1469.727] (-1475.313) -- 0:05:05
7000 -- (-1472.278) (-1474.297) [-1469.006] (-1474.793) * (-1477.267) (-1482.045) (-1476.435) [-1474.509] -- 0:04:43
7500 -- [-1477.306] (-1486.993) (-1468.232) (-1474.410) * (-1471.913) (-1479.779) (-1479.894) [-1470.483] -- 0:04:24
8000 -- (-1468.981) (-1469.786) (-1484.134) [-1476.469] * (-1477.071) (-1476.274) (-1478.166) [-1471.911] -- 0:06:12
8500 -- (-1474.366) (-1469.934) (-1478.992) [-1467.653] * (-1475.859) (-1477.362) [-1463.591] (-1475.497) -- 0:05:49
9000 -- (-1465.747) [-1475.325] (-1479.966) (-1474.552) * (-1467.566) (-1471.833) [-1470.344] (-1482.770) -- 0:05:30
9500 -- [-1466.168] (-1472.769) (-1479.815) (-1474.795) * (-1473.066) (-1474.293) [-1471.225] (-1495.068) -- 0:05:12
10000 -- (-1465.622) [-1466.239] (-1479.755) (-1472.729) * (-1468.765) (-1469.821) (-1465.640) [-1468.918] -- 0:04:57
Average standard deviation of split frequencies: 0.082075
10500 -- (-1469.681) (-1467.794) (-1478.409) [-1467.740] * (-1468.113) (-1476.547) [-1467.238] (-1470.256) -- 0:06:16
11000 -- (-1469.727) [-1473.892] (-1477.386) (-1477.958) * [-1467.998] (-1476.222) (-1473.445) (-1469.701) -- 0:05:59
11500 -- (-1470.433) [-1471.866] (-1467.353) (-1472.794) * (-1473.051) (-1472.772) [-1468.814] (-1470.557) -- 0:05:43
12000 -- [-1471.557] (-1472.330) (-1468.906) (-1470.830) * (-1474.137) (-1474.391) [-1471.280] (-1474.868) -- 0:05:29
12500 -- (-1471.200) (-1475.932) (-1472.994) [-1473.891] * [-1481.287] (-1477.298) (-1469.339) (-1476.353) -- 0:05:16
13000 -- (-1469.310) (-1479.210) [-1474.173] (-1468.325) * [-1474.609] (-1479.812) (-1471.021) (-1466.279) -- 0:05:03
13500 -- (-1480.772) (-1479.950) [-1468.388] (-1479.083) * (-1466.573) (-1480.290) (-1476.469) [-1468.945] -- 0:06:05
14000 -- (-1476.074) [-1469.790] (-1478.908) (-1488.362) * (-1476.977) (-1479.684) (-1473.583) [-1464.988] -- 0:05:52
14500 -- (-1479.466) [-1474.867] (-1476.891) (-1473.816) * [-1472.597] (-1480.435) (-1477.012) (-1475.818) -- 0:05:39
15000 -- (-1475.501) (-1469.614) [-1467.115] (-1485.841) * (-1471.841) (-1486.028) [-1470.828] (-1473.416) -- 0:05:28
Average standard deviation of split frequencies: 0.040317
15500 -- (-1471.305) (-1481.325) [-1465.961] (-1482.339) * (-1471.110) (-1485.315) (-1469.273) [-1475.944] -- 0:05:17
16000 -- (-1480.966) (-1479.591) (-1472.737) [-1469.936] * (-1469.592) (-1478.443) [-1479.549] (-1473.983) -- 0:05:07
16500 -- (-1488.066) (-1471.934) (-1472.917) [-1467.639] * (-1474.326) (-1476.023) (-1471.520) [-1470.454] -- 0:05:57
17000 -- (-1484.269) (-1477.420) [-1472.121] (-1479.582) * (-1470.162) [-1471.187] (-1479.393) (-1471.717) -- 0:05:46
17500 -- [-1471.091] (-1471.315) (-1474.466) (-1474.368) * (-1472.476) (-1481.084) (-1477.727) [-1469.906] -- 0:05:36
18000 -- [-1472.698] (-1477.724) (-1476.926) (-1476.078) * (-1474.425) (-1468.876) [-1482.984] (-1465.228) -- 0:05:27
18500 -- (-1473.600) (-1467.611) (-1478.310) [-1470.106] * (-1468.663) (-1469.397) (-1473.548) [-1473.782] -- 0:05:18
19000 -- (-1479.594) (-1472.339) (-1479.904) [-1473.038] * (-1473.991) (-1467.996) (-1478.067) [-1470.337] -- 0:06:01
19500 -- (-1471.806) [-1476.938] (-1475.848) (-1469.876) * (-1478.044) [-1474.311] (-1478.001) (-1472.996) -- 0:05:51
20000 -- (-1480.821) [-1475.449] (-1472.818) (-1477.760) * [-1468.784] (-1475.027) (-1471.616) (-1472.470) -- 0:05:43
Average standard deviation of split frequencies: 0.049041
20500 -- (-1479.770) (-1468.014) (-1466.752) [-1467.330] * [-1471.747] (-1473.612) (-1480.926) (-1479.542) -- 0:05:34
21000 -- (-1478.655) (-1478.232) [-1467.722] (-1466.950) * (-1470.643) (-1478.988) (-1482.616) [-1474.397] -- 0:05:26
21500 -- (-1471.057) (-1464.519) [-1475.727] (-1471.494) * (-1473.716) [-1467.637] (-1478.447) (-1473.598) -- 0:05:18
22000 -- (-1474.501) (-1470.485) (-1474.138) [-1467.328] * (-1472.686) (-1471.748) (-1478.487) [-1464.322] -- 0:05:55
22500 -- (-1471.265) (-1468.840) (-1475.964) [-1466.680] * (-1476.526) (-1474.650) (-1474.154) [-1468.136] -- 0:05:47
23000 -- (-1474.882) (-1479.885) (-1480.452) [-1474.757] * [-1481.598] (-1471.540) (-1471.980) (-1469.669) -- 0:05:39
23500 -- (-1472.032) (-1481.434) (-1470.644) [-1468.906] * (-1482.431) [-1472.933] (-1476.349) (-1474.765) -- 0:05:32
24000 -- (-1477.663) (-1473.602) (-1480.095) [-1468.756] * (-1467.585) (-1480.312) (-1469.797) [-1468.242] -- 0:05:25
24500 -- (-1474.000) [-1474.720] (-1484.513) (-1479.389) * [-1479.791] (-1475.843) (-1473.538) (-1476.305) -- 0:05:58
25000 -- (-1472.398) (-1470.156) [-1469.281] (-1475.691) * [-1480.298] (-1468.697) (-1475.783) (-1471.309) -- 0:05:51
Average standard deviation of split frequencies: 0.042608
25500 -- (-1480.298) (-1467.984) [-1474.998] (-1478.448) * (-1481.280) (-1475.261) (-1476.057) [-1466.469] -- 0:05:43
26000 -- [-1471.830] (-1475.828) (-1482.068) (-1477.302) * (-1487.958) (-1472.281) (-1470.054) [-1468.561] -- 0:05:37
26500 -- (-1479.873) [-1468.852] (-1477.199) (-1479.031) * [-1476.807] (-1467.880) (-1472.969) (-1469.773) -- 0:05:30
27000 -- [-1473.218] (-1473.067) (-1481.545) (-1476.691) * (-1469.346) (-1483.144) (-1474.364) [-1471.657] -- 0:06:00
27500 -- (-1484.017) (-1472.646) [-1478.897] (-1479.930) * (-1465.982) [-1473.969] (-1477.625) (-1473.887) -- 0:05:53
28000 -- (-1479.977) (-1469.339) [-1471.067] (-1476.219) * (-1480.169) [-1467.603] (-1472.890) (-1487.984) -- 0:05:47
28500 -- (-1479.072) (-1476.127) (-1476.414) [-1480.785] * (-1480.450) (-1474.655) [-1473.022] (-1481.697) -- 0:05:40
29000 -- (-1475.312) [-1474.812] (-1473.201) (-1477.522) * (-1476.562) (-1471.516) (-1475.631) [-1478.070] -- 0:05:34
29500 -- (-1470.195) [-1470.392] (-1478.661) (-1487.270) * [-1480.614] (-1466.108) (-1475.658) (-1479.483) -- 0:05:28
30000 -- (-1473.113) [-1468.755] (-1468.799) (-1477.387) * (-1474.547) [-1472.807] (-1476.740) (-1478.985) -- 0:05:55
Average standard deviation of split frequencies: 0.034404
30500 -- (-1472.289) (-1477.970) [-1474.683] (-1484.368) * (-1470.417) (-1470.171) [-1471.877] (-1468.567) -- 0:05:49
31000 -- (-1471.547) (-1471.172) (-1484.935) [-1467.453] * [-1470.677] (-1467.816) (-1471.254) (-1479.093) -- 0:05:43
31500 -- (-1478.609) (-1467.772) [-1472.097] (-1473.557) * (-1468.931) [-1470.311] (-1471.095) (-1471.595) -- 0:05:38
32000 -- (-1477.231) (-1469.696) (-1470.536) [-1474.068] * (-1477.022) (-1474.408) [-1469.517] (-1470.376) -- 0:05:32
32500 -- (-1479.781) (-1471.179) [-1470.410] (-1478.265) * (-1477.934) (-1471.192) (-1475.514) [-1465.179] -- 0:05:27
33000 -- (-1470.419) (-1469.399) [-1471.593] (-1483.920) * (-1488.837) (-1476.323) (-1471.780) [-1464.799] -- 0:05:51
33500 -- (-1471.601) (-1471.849) [-1469.720] (-1474.615) * (-1471.103) (-1467.572) (-1469.457) [-1472.628] -- 0:05:46
34000 -- (-1483.282) (-1468.485) [-1469.518] (-1477.340) * [-1471.816] (-1477.189) (-1481.206) (-1474.928) -- 0:05:40
34500 -- (-1486.455) [-1479.241] (-1470.787) (-1477.352) * (-1471.503) [-1470.051] (-1478.740) (-1466.924) -- 0:05:35
35000 -- (-1471.995) (-1472.316) (-1476.829) [-1471.017] * [-1480.190] (-1472.591) (-1486.182) (-1476.015) -- 0:05:30
Average standard deviation of split frequencies: 0.035646
35500 -- [-1465.335] (-1474.344) (-1471.295) (-1477.306) * (-1469.708) (-1471.993) (-1473.834) [-1467.287] -- 0:05:53
36000 -- (-1470.394) (-1478.400) (-1482.577) [-1462.101] * (-1465.645) (-1474.486) [-1467.240] (-1475.910) -- 0:05:48
36500 -- [-1477.700] (-1467.441) (-1478.392) (-1467.319) * (-1468.932) [-1468.452] (-1467.989) (-1474.549) -- 0:05:43
37000 -- [-1465.411] (-1473.645) (-1476.485) (-1472.292) * (-1472.659) (-1471.281) [-1468.547] (-1477.487) -- 0:05:38
37500 -- [-1471.167] (-1480.133) (-1471.229) (-1468.280) * [-1467.264] (-1473.750) (-1468.298) (-1480.372) -- 0:05:33
38000 -- [-1473.995] (-1471.912) (-1468.070) (-1477.969) * (-1466.066) [-1473.307] (-1486.717) (-1467.084) -- 0:05:29
38500 -- [-1470.771] (-1471.698) (-1468.971) (-1472.186) * [-1473.134] (-1474.542) (-1470.351) (-1482.476) -- 0:05:49
39000 -- (-1481.836) (-1475.919) [-1475.101] (-1470.447) * [-1466.293] (-1470.638) (-1481.590) (-1481.449) -- 0:05:44
39500 -- (-1477.331) [-1469.774] (-1482.326) (-1467.538) * [-1473.121] (-1475.722) (-1473.652) (-1477.461) -- 0:05:40
40000 -- [-1477.127] (-1472.584) (-1483.140) (-1474.957) * (-1474.643) [-1469.961] (-1475.254) (-1469.351) -- 0:05:36
Average standard deviation of split frequencies: 0.043276
40500 -- (-1472.616) [-1464.986] (-1485.703) (-1474.911) * (-1481.747) (-1471.110) (-1474.087) [-1466.630] -- 0:05:31
41000 -- (-1472.194) [-1472.873] (-1476.589) (-1469.212) * (-1465.551) [-1465.502] (-1468.075) (-1477.548) -- 0:05:50
41500 -- (-1468.429) (-1489.540) (-1472.137) [-1469.074] * (-1471.631) (-1471.079) [-1464.656] (-1475.251) -- 0:05:46
42000 -- (-1472.995) (-1486.108) [-1469.797] (-1470.176) * (-1470.944) (-1467.016) [-1473.286] (-1471.173) -- 0:05:42
42500 -- (-1465.459) [-1469.099] (-1477.081) (-1473.635) * (-1466.716) (-1474.302) (-1476.944) [-1468.661] -- 0:05:37
43000 -- (-1473.925) (-1475.488) (-1478.524) [-1466.031] * (-1470.469) [-1463.756] (-1473.475) (-1472.646) -- 0:05:33
43500 -- (-1479.648) (-1475.741) [-1461.192] (-1470.200) * (-1474.871) [-1472.414] (-1473.645) (-1475.645) -- 0:05:29
44000 -- (-1471.505) (-1474.444) [-1465.972] (-1470.795) * (-1475.356) (-1474.093) [-1474.337] (-1478.274) -- 0:05:47
44500 -- (-1477.563) (-1474.769) (-1483.476) [-1475.933] * (-1471.316) [-1469.066] (-1471.056) (-1467.466) -- 0:05:43
45000 -- (-1471.822) (-1475.061) [-1471.144] (-1479.023) * [-1468.447] (-1475.027) (-1467.082) (-1468.700) -- 0:05:39
Average standard deviation of split frequencies: 0.040452
45500 -- [-1476.829] (-1477.547) (-1471.584) (-1472.171) * (-1472.036) (-1477.056) [-1465.789] (-1468.193) -- 0:05:35
46000 -- (-1464.944) (-1484.010) [-1477.865] (-1469.716) * [-1470.306] (-1482.217) (-1472.926) (-1479.990) -- 0:05:31
46500 -- [-1473.535] (-1478.884) (-1476.923) (-1472.176) * (-1473.946) (-1478.449) (-1472.296) [-1473.060] -- 0:05:28
47000 -- [-1478.911] (-1485.739) (-1471.371) (-1479.576) * (-1474.068) (-1481.141) [-1468.050] (-1477.114) -- 0:05:44
47500 -- (-1475.711) [-1467.656] (-1466.246) (-1476.919) * (-1471.700) (-1470.042) [-1471.210] (-1474.086) -- 0:05:40
48000 -- (-1481.084) (-1473.712) [-1472.675] (-1470.034) * (-1484.844) (-1474.187) [-1466.440] (-1478.933) -- 0:05:37
48500 -- (-1484.099) (-1470.701) (-1469.366) [-1468.940] * (-1469.113) (-1473.640) [-1470.171] (-1478.210) -- 0:05:33
49000 -- [-1471.247] (-1471.496) (-1479.352) (-1466.327) * (-1470.619) [-1475.305] (-1473.825) (-1480.243) -- 0:05:29
49500 -- [-1470.692] (-1477.588) (-1481.253) (-1472.457) * [-1468.532] (-1475.614) (-1481.851) (-1484.691) -- 0:05:45
50000 -- (-1478.710) [-1472.581] (-1474.579) (-1466.027) * [-1471.119] (-1480.176) (-1469.503) (-1471.151) -- 0:05:42
Average standard deviation of split frequencies: 0.033788
50500 -- [-1463.970] (-1478.586) (-1472.517) (-1471.699) * (-1474.185) [-1472.311] (-1470.950) (-1481.176) -- 0:05:38
51000 -- [-1474.915] (-1478.036) (-1477.631) (-1475.861) * (-1471.628) [-1473.234] (-1473.984) (-1480.411) -- 0:05:34
51500 -- (-1472.318) (-1478.800) [-1471.414] (-1471.052) * (-1478.024) [-1464.627] (-1472.573) (-1467.189) -- 0:05:31
52000 -- (-1462.370) (-1470.528) [-1474.245] (-1471.074) * (-1472.767) (-1466.551) (-1473.542) [-1475.991] -- 0:05:46
52500 -- (-1468.837) [-1471.781] (-1486.387) (-1472.591) * [-1465.962] (-1477.429) (-1478.764) (-1477.960) -- 0:05:42
53000 -- (-1477.326) [-1475.631] (-1475.880) (-1473.474) * (-1477.412) (-1479.909) [-1472.337] (-1472.649) -- 0:05:39
53500 -- (-1481.314) (-1475.429) [-1479.289] (-1466.615) * (-1472.977) [-1478.985] (-1479.595) (-1475.990) -- 0:05:36
54000 -- (-1477.428) (-1483.254) (-1474.608) [-1470.003] * (-1472.676) (-1473.832) (-1474.648) [-1475.460] -- 0:05:32
54500 -- (-1474.179) (-1476.732) [-1471.453] (-1475.434) * (-1470.893) [-1473.757] (-1463.571) (-1475.190) -- 0:05:29
55000 -- (-1470.154) [-1465.050] (-1465.922) (-1475.680) * (-1464.637) (-1477.882) [-1470.349] (-1474.500) -- 0:05:43
Average standard deviation of split frequencies: 0.031333
55500 -- (-1472.354) [-1465.986] (-1469.832) (-1466.726) * (-1473.148) (-1472.201) [-1470.040] (-1474.191) -- 0:05:40
56000 -- (-1479.249) [-1469.125] (-1475.520) (-1473.693) * [-1466.917] (-1476.816) (-1481.670) (-1480.755) -- 0:05:37
56500 -- (-1474.743) [-1469.336] (-1473.488) (-1468.143) * [-1470.845] (-1479.865) (-1475.850) (-1479.890) -- 0:05:33
57000 -- (-1471.144) [-1464.817] (-1474.659) (-1470.456) * (-1468.515) [-1471.975] (-1474.103) (-1476.096) -- 0:05:30
57500 -- (-1481.619) (-1472.783) (-1476.880) [-1473.889] * (-1476.294) (-1472.990) [-1466.265] (-1484.868) -- 0:05:44
58000 -- (-1482.976) (-1473.971) (-1472.073) [-1469.761] * (-1473.155) (-1467.915) (-1476.478) [-1470.301] -- 0:05:41
58500 -- (-1483.257) [-1473.851] (-1475.217) (-1472.653) * (-1475.351) (-1474.119) [-1470.229] (-1473.213) -- 0:05:37
59000 -- (-1471.660) [-1471.620] (-1483.641) (-1475.607) * (-1475.387) (-1478.478) (-1476.578) [-1466.448] -- 0:05:34
59500 -- [-1475.566] (-1470.295) (-1477.764) (-1481.736) * (-1471.695) (-1482.337) (-1477.341) [-1469.145] -- 0:05:31
60000 -- (-1469.965) [-1473.249] (-1472.267) (-1476.952) * [-1475.971] (-1472.386) (-1475.783) (-1478.766) -- 0:05:29
Average standard deviation of split frequencies: 0.029446
60500 -- (-1476.073) (-1476.166) [-1465.989] (-1470.641) * [-1464.653] (-1471.623) (-1473.829) (-1478.390) -- 0:05:41
61000 -- [-1474.473] (-1474.922) (-1478.775) (-1471.998) * (-1475.310) (-1471.947) (-1468.709) [-1470.885] -- 0:05:38
61500 -- [-1468.995] (-1475.336) (-1474.082) (-1467.332) * (-1477.053) (-1478.773) [-1474.047] (-1490.048) -- 0:05:35
62000 -- (-1475.395) (-1478.173) (-1475.720) [-1475.643] * [-1476.579] (-1475.328) (-1473.411) (-1468.817) -- 0:05:32
62500 -- (-1475.250) (-1478.116) (-1470.413) [-1469.382] * (-1475.546) (-1480.132) (-1467.972) [-1468.395] -- 0:05:30
63000 -- [-1476.868] (-1474.394) (-1472.450) (-1477.591) * (-1478.396) (-1480.058) (-1477.476) [-1467.902] -- 0:05:27
63500 -- (-1477.946) (-1465.989) (-1474.752) [-1471.419] * (-1467.681) (-1476.092) [-1470.158] (-1472.935) -- 0:05:39
64000 -- (-1475.112) [-1467.173] (-1471.343) (-1464.883) * (-1468.635) [-1468.048] (-1475.768) (-1486.807) -- 0:05:36
64500 -- (-1475.546) (-1468.878) (-1472.914) [-1467.629] * [-1470.463] (-1470.605) (-1472.948) (-1478.804) -- 0:05:33
65000 -- [-1467.304] (-1467.618) (-1475.911) (-1468.763) * (-1473.656) [-1475.831] (-1472.830) (-1471.181) -- 0:05:30
Average standard deviation of split frequencies: 0.025563
65500 -- [-1473.910] (-1477.432) (-1474.517) (-1471.045) * (-1483.332) (-1473.874) (-1470.986) [-1472.421] -- 0:05:28
66000 -- [-1479.418] (-1474.627) (-1481.843) (-1474.011) * (-1479.698) (-1478.350) (-1475.950) [-1472.520] -- 0:05:25
66500 -- (-1480.158) (-1475.536) [-1474.087] (-1480.059) * (-1474.879) [-1469.960] (-1477.244) (-1472.041) -- 0:05:36
67000 -- (-1476.736) [-1472.613] (-1482.718) (-1475.242) * (-1474.920) (-1473.393) [-1462.349] (-1476.242) -- 0:05:34
67500 -- (-1480.286) (-1474.142) [-1468.517] (-1465.569) * (-1473.333) (-1469.819) (-1476.840) [-1471.049] -- 0:05:31
68000 -- (-1479.049) (-1466.767) [-1471.260] (-1468.524) * (-1475.831) (-1471.554) (-1472.764) [-1468.436] -- 0:05:28
68500 -- (-1475.877) (-1469.122) [-1467.742] (-1469.163) * (-1472.016) (-1472.293) [-1479.583] (-1471.313) -- 0:05:26
69000 -- (-1477.056) (-1472.752) [-1469.806] (-1474.004) * (-1469.889) [-1465.279] (-1477.797) (-1478.914) -- 0:05:37
69500 -- [-1468.092] (-1471.746) (-1478.192) (-1470.319) * (-1471.937) (-1469.565) (-1472.913) [-1469.459] -- 0:05:34
70000 -- (-1478.901) (-1475.776) [-1470.353] (-1472.394) * (-1474.692) (-1474.632) [-1472.797] (-1471.564) -- 0:05:32
Average standard deviation of split frequencies: 0.029843
70500 -- (-1479.829) (-1476.715) [-1473.668] (-1480.814) * [-1469.597] (-1465.860) (-1481.426) (-1467.841) -- 0:05:29
71000 -- [-1481.641] (-1474.301) (-1474.485) (-1477.369) * (-1476.160) (-1482.798) (-1469.562) [-1472.500] -- 0:05:27
71500 -- (-1481.182) (-1479.168) (-1472.647) [-1470.113] * (-1473.302) (-1473.385) (-1469.878) [-1468.391] -- 0:05:24
72000 -- (-1477.805) (-1480.701) (-1481.914) [-1478.374] * (-1478.606) [-1474.854] (-1465.165) (-1473.248) -- 0:05:35
72500 -- [-1478.216] (-1478.200) (-1471.612) (-1478.350) * (-1487.399) (-1472.270) [-1466.913] (-1486.214) -- 0:05:32
73000 -- (-1473.516) (-1471.288) (-1471.136) [-1471.163] * (-1479.189) (-1471.749) [-1465.121] (-1483.828) -- 0:05:30
73500 -- (-1472.652) [-1470.825] (-1473.305) (-1475.660) * (-1477.159) [-1469.341] (-1471.058) (-1480.222) -- 0:05:27
74000 -- (-1472.061) [-1485.297] (-1476.749) (-1481.214) * [-1470.298] (-1470.112) (-1484.881) (-1471.391) -- 0:05:25
74500 -- (-1475.973) (-1472.300) (-1468.547) [-1472.880] * (-1477.570) [-1467.457] (-1478.767) (-1493.352) -- 0:05:22
75000 -- [-1477.630] (-1466.885) (-1478.769) (-1465.444) * (-1482.309) [-1475.883] (-1475.857) (-1481.881) -- 0:05:33
Average standard deviation of split frequencies: 0.032646
75500 -- (-1481.243) (-1470.189) (-1469.495) [-1470.774] * [-1478.021] (-1482.984) (-1472.834) (-1482.248) -- 0:05:30
76000 -- (-1475.573) (-1474.504) [-1465.496] (-1466.601) * (-1481.212) [-1470.210] (-1480.431) (-1470.347) -- 0:05:28
76500 -- (-1472.537) (-1471.704) (-1474.312) [-1471.453] * (-1496.241) (-1472.599) (-1462.142) [-1476.905] -- 0:05:25
77000 -- (-1473.752) [-1476.202] (-1474.328) (-1473.362) * (-1485.451) (-1467.318) (-1477.225) [-1470.070] -- 0:05:23
77500 -- [-1469.946] (-1478.394) (-1481.564) (-1475.168) * (-1478.828) (-1475.145) (-1466.870) [-1468.551] -- 0:05:33
78000 -- (-1477.188) (-1481.501) [-1471.251] (-1475.207) * (-1478.825) (-1466.209) [-1473.639] (-1477.565) -- 0:05:30
78500 -- (-1471.853) (-1477.978) (-1476.087) [-1476.619] * (-1488.387) (-1467.335) (-1471.937) [-1469.381] -- 0:05:28
79000 -- (-1480.141) (-1472.502) [-1474.058] (-1475.453) * (-1471.772) [-1475.075] (-1483.044) (-1475.166) -- 0:05:26
79500 -- (-1474.055) (-1479.549) [-1473.499] (-1477.868) * (-1486.700) [-1468.486] (-1475.071) (-1479.610) -- 0:05:24
80000 -- [-1469.717] (-1477.554) (-1470.068) (-1481.700) * (-1479.401) (-1470.491) [-1479.286] (-1479.806) -- 0:05:22
Average standard deviation of split frequencies: 0.027921
80500 -- (-1477.211) (-1472.596) [-1470.637] (-1481.492) * (-1484.214) (-1466.782) (-1485.369) [-1472.365] -- 0:05:31
81000 -- (-1477.723) (-1474.782) (-1480.237) [-1471.438] * (-1481.236) (-1473.267) [-1476.658] (-1477.160) -- 0:05:29
81500 -- (-1473.759) (-1471.464) (-1479.720) [-1464.753] * (-1484.401) (-1470.720) [-1474.882] (-1468.043) -- 0:05:26
82000 -- (-1473.190) (-1464.314) (-1476.779) [-1470.445] * [-1472.682] (-1471.210) (-1469.919) (-1477.666) -- 0:05:24
82500 -- (-1468.630) [-1470.619] (-1477.524) (-1477.290) * (-1478.019) [-1466.879] (-1466.264) (-1473.182) -- 0:05:22
83000 -- (-1472.643) (-1467.788) [-1467.209] (-1478.158) * [-1472.171] (-1475.548) (-1469.841) (-1471.824) -- 0:05:20
83500 -- (-1474.748) (-1478.375) (-1476.384) [-1466.875] * [-1475.729] (-1478.896) (-1473.563) (-1476.315) -- 0:05:29
84000 -- [-1469.626] (-1477.173) (-1484.153) (-1469.305) * (-1474.294) (-1474.740) [-1472.912] (-1475.882) -- 0:05:27
84500 -- [-1474.973] (-1474.097) (-1481.904) (-1476.282) * [-1474.221] (-1481.559) (-1477.549) (-1475.195) -- 0:05:25
85000 -- (-1472.287) [-1465.740] (-1476.619) (-1469.172) * [-1466.602] (-1476.840) (-1471.006) (-1469.897) -- 0:05:22
Average standard deviation of split frequencies: 0.024811
85500 -- [-1476.170] (-1478.458) (-1472.773) (-1473.959) * [-1472.034] (-1477.820) (-1482.183) (-1475.033) -- 0:05:20
86000 -- (-1473.392) (-1471.204) (-1471.035) [-1478.976] * (-1468.368) [-1477.049] (-1474.823) (-1472.961) -- 0:05:29
86500 -- (-1473.870) [-1471.207] (-1478.130) (-1476.059) * (-1478.453) (-1475.879) (-1480.874) [-1477.732] -- 0:05:27
87000 -- (-1468.106) [-1469.020] (-1473.956) (-1486.833) * (-1479.904) (-1474.441) (-1474.308) [-1471.967] -- 0:05:25
87500 -- (-1474.521) (-1473.403) [-1465.843] (-1480.493) * (-1473.121) (-1487.364) (-1477.990) [-1465.804] -- 0:05:23
88000 -- (-1475.394) (-1486.767) [-1465.426] (-1474.107) * (-1483.085) (-1475.566) [-1468.664] (-1473.036) -- 0:05:21
88500 -- [-1475.493] (-1466.515) (-1468.975) (-1476.280) * (-1473.733) (-1473.211) (-1472.702) [-1478.647] -- 0:05:19
89000 -- (-1481.796) (-1468.280) [-1472.728] (-1478.267) * (-1473.078) [-1471.832] (-1470.903) (-1469.493) -- 0:05:27
89500 -- (-1478.037) (-1472.833) (-1470.775) [-1465.989] * (-1474.381) [-1477.208] (-1474.402) (-1475.796) -- 0:05:25
90000 -- (-1479.159) [-1478.859] (-1495.508) (-1474.972) * [-1468.504] (-1484.355) (-1470.416) (-1469.161) -- 0:05:23
Average standard deviation of split frequencies: 0.025449
90500 -- [-1467.325] (-1472.559) (-1474.145) (-1482.864) * (-1478.236) [-1474.666] (-1479.759) (-1476.563) -- 0:05:21
91000 -- [-1483.354] (-1479.812) (-1482.723) (-1473.345) * (-1479.551) [-1466.590] (-1470.040) (-1478.907) -- 0:05:19
91500 -- [-1468.529] (-1480.155) (-1472.050) (-1471.756) * (-1476.705) (-1478.497) (-1461.305) [-1470.080] -- 0:05:17
92000 -- (-1472.544) (-1476.509) (-1469.887) [-1468.695] * [-1474.331] (-1470.299) (-1475.118) (-1470.592) -- 0:05:25
92500 -- [-1468.502] (-1483.127) (-1476.713) (-1471.893) * (-1479.317) (-1482.204) [-1472.038] (-1475.172) -- 0:05:23
93000 -- (-1471.964) (-1484.321) [-1465.361] (-1473.499) * (-1473.214) (-1471.001) (-1474.959) [-1468.512] -- 0:05:21
93500 -- (-1476.861) [-1475.418] (-1470.608) (-1474.204) * (-1466.755) (-1468.500) [-1471.041] (-1480.769) -- 0:05:19
94000 -- (-1469.725) [-1473.781] (-1469.787) (-1479.630) * [-1464.235] (-1474.890) (-1470.835) (-1478.121) -- 0:05:18
94500 -- (-1473.527) [-1477.000] (-1469.818) (-1470.496) * (-1481.437) (-1469.336) [-1470.759] (-1480.560) -- 0:05:25
95000 -- (-1480.236) (-1475.513) (-1472.503) [-1465.749] * [-1468.336] (-1474.932) (-1475.705) (-1466.647) -- 0:05:23
Average standard deviation of split frequencies: 0.024552
95500 -- [-1474.203] (-1467.353) (-1473.306) (-1471.679) * [-1472.569] (-1473.019) (-1471.347) (-1473.663) -- 0:05:22
96000 -- (-1471.564) [-1469.757] (-1476.285) (-1469.025) * (-1471.942) (-1473.798) (-1478.164) [-1472.466] -- 0:05:20
96500 -- (-1475.690) (-1480.279) (-1474.693) [-1474.789] * (-1477.849) (-1469.737) (-1478.814) [-1466.808] -- 0:05:18
97000 -- (-1478.641) (-1477.131) (-1481.089) [-1465.778] * [-1477.022] (-1484.579) (-1470.398) (-1469.034) -- 0:05:16
97500 -- (-1474.105) [-1470.196] (-1475.084) (-1477.992) * [-1470.779] (-1481.450) (-1469.218) (-1475.600) -- 0:05:23
98000 -- (-1471.024) [-1470.301] (-1477.663) (-1482.081) * (-1469.008) (-1474.140) [-1467.202] (-1468.558) -- 0:05:22
98500 -- (-1480.478) (-1473.081) (-1483.524) [-1475.625] * (-1474.028) (-1474.619) [-1467.215] (-1472.676) -- 0:05:20
99000 -- (-1471.065) [-1471.836] (-1475.414) (-1473.321) * [-1482.888] (-1475.666) (-1468.540) (-1479.011) -- 0:05:18
99500 -- [-1469.447] (-1480.728) (-1472.174) (-1467.626) * (-1481.416) [-1469.317] (-1475.219) (-1465.385) -- 0:05:16
100000 -- (-1469.586) (-1478.338) (-1476.645) [-1474.228] * (-1477.466) (-1476.703) (-1471.520) [-1464.803] -- 0:05:15
Average standard deviation of split frequencies: 0.019833
100500 -- (-1475.587) (-1471.552) [-1468.082] (-1472.671) * (-1471.346) (-1470.383) [-1469.571] (-1468.921) -- 0:05:22
101000 -- [-1473.585] (-1481.221) (-1473.768) (-1469.617) * (-1481.643) (-1471.818) [-1469.843] (-1474.102) -- 0:05:20
101500 -- (-1476.477) [-1473.853] (-1473.670) (-1471.635) * (-1481.764) (-1480.757) [-1475.330] (-1482.417) -- 0:05:18
102000 -- (-1475.197) (-1475.269) [-1478.027] (-1472.714) * (-1472.197) (-1475.487) [-1474.291] (-1479.081) -- 0:05:16
102500 -- (-1476.836) (-1474.887) (-1470.439) [-1469.981] * (-1473.107) (-1479.234) (-1466.717) [-1470.848] -- 0:05:15
103000 -- (-1479.382) [-1472.902] (-1473.315) (-1471.125) * (-1481.575) [-1473.798] (-1473.167) (-1474.667) -- 0:05:22
103500 -- (-1471.288) (-1478.148) (-1471.343) [-1469.588] * (-1479.806) (-1476.431) [-1472.791] (-1472.581) -- 0:05:20
104000 -- (-1473.191) (-1473.257) [-1466.633] (-1473.290) * (-1482.602) [-1472.790] (-1465.845) (-1478.936) -- 0:05:18
104500 -- [-1472.082] (-1471.101) (-1473.899) (-1473.544) * (-1478.241) (-1482.304) [-1474.185] (-1471.392) -- 0:05:17
105000 -- (-1472.290) [-1465.371] (-1480.898) (-1476.081) * (-1477.523) [-1469.950] (-1467.880) (-1468.902) -- 0:05:15
Average standard deviation of split frequencies: 0.018574
105500 -- [-1468.935] (-1475.115) (-1476.578) (-1473.266) * (-1468.563) (-1478.441) (-1476.967) [-1468.629] -- 0:05:13
106000 -- (-1473.474) [-1472.430] (-1473.768) (-1481.231) * [-1470.117] (-1473.526) (-1477.810) (-1470.201) -- 0:05:20
106500 -- (-1473.481) (-1471.167) [-1473.063] (-1476.468) * [-1466.739] (-1474.485) (-1467.000) (-1474.024) -- 0:05:18
107000 -- [-1470.493] (-1473.623) (-1468.840) (-1473.483) * (-1478.358) (-1468.409) [-1466.759] (-1486.271) -- 0:05:17
107500 -- (-1465.600) (-1479.851) (-1472.945) [-1471.548] * (-1469.541) [-1472.104] (-1474.455) (-1473.844) -- 0:05:15
108000 -- (-1476.771) (-1480.519) (-1473.470) [-1467.356] * (-1473.377) (-1477.042) [-1475.222] (-1476.695) -- 0:05:13
108500 -- (-1471.448) [-1469.053] (-1474.639) (-1471.792) * (-1482.738) (-1472.847) (-1472.628) [-1475.454] -- 0:05:20
109000 -- (-1470.772) (-1476.191) (-1477.796) [-1470.621] * (-1481.845) [-1473.536] (-1478.280) (-1472.785) -- 0:05:18
109500 -- (-1469.014) (-1467.296) (-1470.916) [-1468.498] * (-1480.040) (-1471.409) [-1467.951] (-1474.644) -- 0:05:17
110000 -- (-1474.399) (-1469.703) (-1474.153) [-1473.016] * (-1482.337) (-1472.268) [-1473.028] (-1478.549) -- 0:05:15
Average standard deviation of split frequencies: 0.020797
110500 -- (-1476.552) [-1465.566] (-1465.024) (-1474.152) * (-1473.233) [-1464.820] (-1474.888) (-1475.713) -- 0:05:13
111000 -- (-1470.716) (-1471.460) (-1477.938) [-1470.585] * (-1475.259) (-1479.703) (-1479.726) [-1471.326] -- 0:05:12
111500 -- [-1472.815] (-1473.173) (-1470.087) (-1470.690) * [-1467.620] (-1474.996) (-1470.702) (-1477.397) -- 0:05:18
112000 -- (-1476.594) [-1472.974] (-1473.784) (-1469.950) * [-1472.807] (-1471.106) (-1464.488) (-1468.099) -- 0:05:17
112500 -- [-1464.792] (-1471.762) (-1472.715) (-1475.443) * (-1473.513) (-1466.238) (-1470.572) [-1468.339] -- 0:05:15
113000 -- (-1473.180) (-1469.023) [-1475.269] (-1475.530) * (-1478.996) (-1465.899) (-1467.161) [-1472.097] -- 0:05:13
113500 -- (-1469.615) [-1477.382] (-1479.656) (-1479.305) * (-1481.382) [-1466.036] (-1472.443) (-1473.766) -- 0:05:12
114000 -- (-1465.579) (-1472.693) (-1476.936) [-1471.373] * (-1481.562) (-1477.359) [-1469.517] (-1482.563) -- 0:05:10
114500 -- [-1472.844] (-1475.541) (-1475.430) (-1467.382) * [-1480.338] (-1475.833) (-1470.881) (-1473.472) -- 0:05:17
115000 -- (-1469.844) (-1475.160) (-1467.736) [-1480.920] * (-1478.447) (-1474.770) [-1468.015] (-1476.331) -- 0:05:15
Average standard deviation of split frequencies: 0.019124
115500 -- [-1470.775] (-1486.614) (-1472.740) (-1466.560) * (-1485.014) (-1474.848) (-1476.563) [-1467.174] -- 0:05:13
116000 -- (-1469.316) (-1479.218) (-1464.130) [-1461.419] * (-1469.664) (-1474.972) (-1465.090) [-1471.168] -- 0:05:12
116500 -- [-1470.137] (-1472.826) (-1467.955) (-1469.581) * (-1468.966) (-1472.320) [-1470.393] (-1476.636) -- 0:05:10
117000 -- (-1469.450) (-1474.699) (-1476.703) [-1467.983] * (-1481.906) [-1474.766] (-1479.154) (-1474.349) -- 0:05:16
117500 -- (-1479.563) (-1480.039) [-1469.900] (-1476.492) * (-1473.878) [-1475.670] (-1479.427) (-1473.163) -- 0:05:15
118000 -- [-1473.438] (-1479.295) (-1466.386) (-1474.452) * (-1472.918) [-1473.685] (-1478.669) (-1468.045) -- 0:05:13
118500 -- (-1471.831) (-1463.896) [-1471.371] (-1479.793) * (-1477.491) [-1465.301] (-1466.176) (-1478.401) -- 0:05:12
119000 -- [-1474.278] (-1477.114) (-1474.633) (-1483.727) * (-1467.731) (-1469.809) [-1468.829] (-1481.907) -- 0:05:10
119500 -- (-1474.445) [-1468.454] (-1474.022) (-1476.279) * (-1483.338) [-1468.164] (-1471.138) (-1484.016) -- 0:05:09
120000 -- (-1477.435) [-1475.724] (-1485.937) (-1475.312) * (-1477.226) [-1473.888] (-1470.913) (-1474.821) -- 0:05:15
Average standard deviation of split frequencies: 0.018557
120500 -- (-1481.005) (-1471.639) (-1473.248) [-1465.629] * (-1475.518) (-1469.897) [-1468.515] (-1479.513) -- 0:05:13
121000 -- (-1480.897) (-1479.533) (-1472.039) [-1471.029] * [-1474.632] (-1466.380) (-1482.032) (-1472.577) -- 0:05:12
121500 -- [-1480.327] (-1472.891) (-1476.769) (-1474.984) * (-1478.215) [-1470.097] (-1476.478) (-1473.136) -- 0:05:10
122000 -- (-1472.188) (-1472.990) [-1465.691] (-1487.304) * [-1474.008] (-1472.694) (-1471.916) (-1469.490) -- 0:05:09
122500 -- (-1476.344) (-1487.717) [-1470.994] (-1469.705) * (-1474.089) [-1473.643] (-1473.548) (-1475.341) -- 0:05:08
123000 -- (-1471.453) (-1471.037) (-1470.601) [-1468.138] * [-1473.300] (-1475.210) (-1480.812) (-1479.408) -- 0:05:13
123500 -- (-1474.849) (-1470.680) [-1477.872] (-1472.404) * (-1468.084) [-1477.338] (-1473.683) (-1472.518) -- 0:05:12
124000 -- [-1479.450] (-1484.739) (-1473.742) (-1479.014) * (-1466.348) (-1475.620) [-1464.307] (-1470.335) -- 0:05:10
124500 -- [-1471.354] (-1466.085) (-1473.354) (-1478.491) * (-1469.537) (-1476.050) (-1484.015) [-1477.740] -- 0:05:09
125000 -- (-1468.072) (-1472.008) (-1472.868) [-1473.910] * (-1476.248) (-1471.228) [-1466.673] (-1470.227) -- 0:05:08
Average standard deviation of split frequencies: 0.021045
125500 -- (-1478.649) (-1478.642) [-1472.697] (-1478.270) * (-1482.334) (-1472.951) (-1474.326) [-1471.311] -- 0:05:13
126000 -- (-1478.176) (-1471.333) (-1470.833) [-1471.232] * (-1482.533) [-1468.832] (-1474.622) (-1472.563) -- 0:05:12
126500 -- (-1473.270) [-1472.700] (-1472.592) (-1471.500) * (-1484.136) [-1472.456] (-1467.896) (-1468.445) -- 0:05:10
127000 -- [-1466.853] (-1475.211) (-1475.611) (-1478.832) * (-1474.950) [-1468.918] (-1473.041) (-1471.828) -- 0:05:09
127500 -- (-1478.206) (-1477.286) [-1465.981] (-1473.413) * (-1468.987) (-1477.565) (-1482.373) [-1470.929] -- 0:05:07
128000 -- [-1473.031] (-1476.237) (-1476.121) (-1476.414) * (-1479.471) (-1471.318) (-1468.143) [-1470.785] -- 0:05:06
128500 -- (-1475.282) (-1482.020) [-1471.288] (-1471.617) * [-1464.317] (-1474.828) (-1465.569) (-1472.056) -- 0:05:11
129000 -- (-1481.974) (-1473.699) [-1470.196] (-1467.983) * (-1474.457) (-1479.831) (-1468.087) [-1474.364] -- 0:05:10
129500 -- (-1480.040) (-1470.511) [-1468.164] (-1473.279) * (-1465.068) (-1474.792) [-1474.760] (-1480.423) -- 0:05:09
130000 -- [-1467.037] (-1484.709) (-1480.348) (-1476.622) * [-1466.965] (-1489.011) (-1466.508) (-1478.744) -- 0:05:07
Average standard deviation of split frequencies: 0.017587
130500 -- [-1476.033] (-1471.388) (-1467.121) (-1466.211) * (-1486.389) (-1481.862) [-1469.565] (-1471.267) -- 0:05:06
131000 -- (-1474.828) [-1468.032] (-1469.213) (-1467.687) * (-1473.587) (-1476.752) [-1466.772] (-1474.614) -- 0:05:11
131500 -- [-1469.203] (-1465.325) (-1478.033) (-1470.280) * [-1472.389] (-1479.086) (-1475.813) (-1483.911) -- 0:05:10
132000 -- (-1468.089) (-1474.981) [-1467.658] (-1480.408) * (-1473.396) [-1465.579] (-1472.277) (-1475.234) -- 0:05:09
132500 -- (-1475.277) (-1474.945) [-1468.738] (-1476.422) * (-1476.025) (-1478.738) [-1473.013] (-1470.852) -- 0:05:07
133000 -- (-1476.174) (-1469.889) [-1466.844] (-1472.793) * (-1481.041) (-1476.534) [-1468.340] (-1466.801) -- 0:05:06
133500 -- (-1474.706) (-1477.595) [-1468.040] (-1476.659) * (-1477.782) [-1477.294] (-1463.109) (-1472.786) -- 0:05:05
134000 -- (-1470.982) (-1480.349) (-1484.385) [-1477.455] * (-1472.552) [-1466.598] (-1464.211) (-1466.689) -- 0:05:10
134500 -- [-1466.588] (-1469.302) (-1479.364) (-1477.051) * [-1471.456] (-1468.060) (-1475.875) (-1468.416) -- 0:05:08
135000 -- [-1464.593] (-1474.245) (-1491.713) (-1474.995) * (-1467.716) [-1469.375] (-1479.366) (-1475.924) -- 0:05:07
Average standard deviation of split frequencies: 0.020581
135500 -- [-1470.148] (-1472.379) (-1482.522) (-1467.920) * (-1468.020) [-1465.731] (-1476.389) (-1473.679) -- 0:05:06
136000 -- (-1472.047) [-1467.294] (-1474.689) (-1471.080) * [-1470.460] (-1465.540) (-1480.171) (-1470.732) -- 0:05:04
136500 -- (-1474.911) (-1478.052) (-1471.974) [-1472.506] * [-1476.064] (-1471.186) (-1470.066) (-1479.062) -- 0:05:03
137000 -- (-1483.628) (-1467.831) [-1473.396] (-1474.492) * (-1475.361) (-1469.236) [-1473.812] (-1479.092) -- 0:05:08
137500 -- (-1468.730) (-1471.424) (-1463.713) [-1474.171] * (-1466.293) (-1469.291) [-1467.067] (-1470.776) -- 0:05:07
138000 -- (-1481.508) [-1471.956] (-1466.959) (-1467.651) * (-1470.944) (-1470.450) (-1474.141) [-1469.172] -- 0:05:06
138500 -- [-1471.862] (-1474.266) (-1468.559) (-1470.963) * (-1464.291) (-1477.324) (-1465.795) [-1476.183] -- 0:05:04
139000 -- [-1471.567] (-1471.487) (-1464.837) (-1477.559) * [-1478.122] (-1475.074) (-1462.929) (-1475.606) -- 0:05:03
139500 -- [-1471.627] (-1475.344) (-1466.458) (-1466.019) * (-1482.095) (-1469.162) (-1483.938) [-1474.857] -- 0:05:08
140000 -- [-1473.939] (-1474.208) (-1474.916) (-1475.299) * (-1471.633) (-1474.735) [-1477.179] (-1471.728) -- 0:05:07
Average standard deviation of split frequencies: 0.020107
140500 -- (-1468.701) (-1477.040) (-1468.172) [-1474.236] * (-1472.594) (-1468.934) [-1468.007] (-1472.190) -- 0:05:05
141000 -- [-1472.727] (-1478.884) (-1469.015) (-1471.699) * (-1486.434) (-1463.019) (-1471.790) [-1464.790] -- 0:05:04
141500 -- [-1472.693] (-1467.392) (-1476.424) (-1471.178) * (-1479.816) [-1468.882] (-1466.827) (-1474.492) -- 0:05:03
142000 -- (-1471.438) (-1478.908) (-1467.086) [-1469.789] * (-1469.127) (-1479.752) (-1479.152) [-1469.316] -- 0:05:02
142500 -- (-1473.888) (-1472.243) (-1486.968) [-1468.593] * [-1467.387] (-1474.675) (-1478.069) (-1468.753) -- 0:05:06
143000 -- [-1468.587] (-1472.749) (-1482.039) (-1469.896) * [-1473.657] (-1470.707) (-1479.000) (-1466.069) -- 0:05:05
143500 -- (-1470.708) [-1466.753] (-1489.716) (-1477.307) * (-1469.387) (-1477.112) (-1471.194) [-1470.404] -- 0:05:04
144000 -- (-1474.712) (-1466.568) (-1482.801) [-1473.803] * (-1478.989) (-1481.947) [-1473.804] (-1468.873) -- 0:05:03
144500 -- (-1472.648) (-1466.830) [-1464.876] (-1473.802) * (-1474.420) (-1475.321) [-1473.104] (-1467.720) -- 0:05:01
145000 -- (-1468.212) [-1474.773] (-1466.402) (-1471.175) * [-1470.603] (-1476.934) (-1484.191) (-1473.692) -- 0:05:00
Average standard deviation of split frequencies: 0.021272
145500 -- (-1477.570) (-1478.110) [-1471.387] (-1467.720) * (-1477.105) (-1467.533) [-1475.056] (-1473.654) -- 0:05:05
146000 -- (-1471.040) (-1484.115) (-1469.390) [-1465.917] * (-1473.028) (-1474.718) (-1468.779) [-1471.051] -- 0:05:04
146500 -- [-1469.254] (-1475.293) (-1474.156) (-1478.577) * (-1471.490) (-1482.812) [-1475.721] (-1468.412) -- 0:05:02
147000 -- (-1472.419) [-1468.326] (-1469.540) (-1475.774) * (-1467.809) (-1481.872) (-1470.193) [-1464.242] -- 0:05:01
147500 -- [-1463.328] (-1475.471) (-1465.928) (-1475.065) * [-1472.796] (-1471.300) (-1478.232) (-1482.295) -- 0:05:00
148000 -- (-1479.535) (-1469.903) [-1469.943] (-1474.033) * (-1483.843) (-1474.400) (-1472.175) [-1472.528] -- 0:05:05
148500 -- (-1482.755) (-1473.574) (-1468.110) [-1470.445] * [-1467.941] (-1469.180) (-1479.819) (-1467.777) -- 0:05:03
149000 -- (-1484.337) [-1481.917] (-1469.618) (-1476.492) * (-1478.015) [-1479.632] (-1478.544) (-1465.921) -- 0:05:02
149500 -- (-1472.564) (-1485.470) [-1472.624] (-1476.098) * (-1476.205) (-1468.085) (-1478.995) [-1466.505] -- 0:05:01
150000 -- [-1468.266] (-1485.962) (-1470.576) (-1476.349) * (-1472.701) (-1472.699) (-1469.932) [-1476.409] -- 0:05:00
Average standard deviation of split frequencies: 0.021119
150500 -- (-1472.896) (-1470.941) (-1465.242) [-1476.942] * [-1477.692] (-1473.648) (-1472.707) (-1478.629) -- 0:04:59
151000 -- (-1474.100) (-1472.224) (-1475.255) [-1469.277] * (-1476.378) (-1470.998) (-1471.335) [-1474.580] -- 0:05:03
151500 -- (-1469.325) (-1472.483) [-1471.857] (-1469.725) * [-1474.828] (-1485.111) (-1468.802) (-1480.339) -- 0:05:02
152000 -- (-1480.108) (-1477.279) [-1473.506] (-1471.219) * (-1474.802) (-1476.688) (-1470.926) [-1469.676] -- 0:05:01
152500 -- (-1469.545) [-1466.739] (-1475.248) (-1466.331) * (-1473.144) (-1467.553) (-1473.633) [-1467.693] -- 0:05:00
153000 -- (-1480.356) (-1477.717) [-1472.543] (-1467.829) * (-1470.817) (-1472.006) [-1471.062] (-1478.862) -- 0:04:58
153500 -- (-1470.787) (-1484.693) (-1472.374) [-1467.505] * (-1473.533) (-1476.171) [-1465.027] (-1474.644) -- 0:05:03
154000 -- [-1466.135] (-1477.902) (-1469.966) (-1472.877) * (-1477.243) (-1466.973) [-1472.316] (-1473.735) -- 0:05:02
154500 -- [-1474.816] (-1487.060) (-1471.249) (-1474.482) * [-1469.024] (-1473.470) (-1472.959) (-1471.710) -- 0:05:00
155000 -- (-1475.017) (-1471.984) [-1480.351] (-1480.826) * (-1479.900) (-1475.430) (-1466.515) [-1468.250] -- 0:04:59
Average standard deviation of split frequencies: 0.018886
155500 -- (-1470.954) [-1467.446] (-1478.861) (-1474.490) * (-1473.771) (-1481.181) (-1471.907) [-1469.331] -- 0:04:58
156000 -- (-1472.071) [-1471.054] (-1477.666) (-1479.191) * (-1491.020) (-1475.168) (-1467.131) [-1478.598] -- 0:04:57
156500 -- [-1467.609] (-1477.732) (-1487.027) (-1468.673) * (-1485.371) [-1470.750] (-1470.618) (-1479.840) -- 0:05:01
157000 -- (-1481.588) (-1483.655) [-1470.526] (-1469.257) * (-1478.221) [-1470.728] (-1475.493) (-1473.795) -- 0:05:00
157500 -- [-1471.131] (-1482.675) (-1478.701) (-1469.029) * (-1469.585) (-1470.504) [-1473.747] (-1488.325) -- 0:04:59
158000 -- (-1470.655) (-1482.552) (-1476.748) [-1473.745] * [-1465.150] (-1473.996) (-1480.046) (-1487.434) -- 0:04:58
158500 -- (-1474.189) (-1477.268) [-1468.761] (-1469.772) * (-1471.190) (-1471.046) [-1473.162] (-1470.163) -- 0:04:57
159000 -- (-1466.084) (-1471.963) (-1468.166) [-1468.339] * (-1471.452) (-1476.147) [-1472.304] (-1472.619) -- 0:04:56
159500 -- (-1470.634) (-1482.126) (-1469.715) [-1467.400] * [-1474.433] (-1475.757) (-1479.210) (-1478.578) -- 0:05:00
160000 -- (-1472.264) (-1470.533) (-1472.109) [-1472.508] * [-1467.217] (-1482.067) (-1471.693) (-1471.790) -- 0:04:59
Average standard deviation of split frequencies: 0.016321
160500 -- (-1467.870) [-1473.082] (-1473.263) (-1470.527) * (-1479.227) (-1489.447) [-1468.861] (-1469.420) -- 0:04:58
161000 -- (-1472.041) (-1472.959) (-1471.879) [-1474.186] * (-1472.842) [-1474.184] (-1474.730) (-1470.169) -- 0:04:57
161500 -- (-1466.636) (-1473.587) [-1467.304] (-1476.803) * (-1472.439) (-1486.262) [-1467.574] (-1481.656) -- 0:04:55
162000 -- (-1473.121) (-1472.887) (-1472.877) [-1470.973] * (-1473.050) (-1474.334) [-1472.541] (-1474.036) -- 0:05:00
162500 -- (-1472.182) [-1468.407] (-1479.219) (-1477.643) * (-1473.694) (-1473.970) (-1475.388) [-1469.325] -- 0:04:58
163000 -- (-1477.590) [-1471.301] (-1470.397) (-1486.176) * (-1471.096) (-1468.054) (-1482.023) [-1476.454] -- 0:04:57
163500 -- (-1476.766) [-1469.786] (-1466.059) (-1479.896) * (-1474.741) [-1472.298] (-1473.180) (-1473.029) -- 0:04:56
164000 -- (-1482.837) (-1474.027) (-1473.327) [-1478.338] * (-1473.457) (-1481.266) (-1475.542) [-1463.880] -- 0:04:55
164500 -- [-1475.832] (-1476.708) (-1468.685) (-1475.204) * (-1480.087) [-1474.930] (-1475.387) (-1464.962) -- 0:04:54
165000 -- [-1467.811] (-1483.200) (-1474.067) (-1472.571) * (-1492.146) [-1474.260] (-1468.361) (-1471.646) -- 0:04:58
Average standard deviation of split frequencies: 0.019169
165500 -- (-1474.315) (-1474.427) [-1469.759] (-1478.559) * (-1481.493) (-1475.518) [-1470.434] (-1471.057) -- 0:04:57
166000 -- (-1475.820) (-1475.861) (-1467.874) [-1478.489] * (-1483.574) (-1483.494) (-1471.983) [-1472.275] -- 0:04:56
166500 -- (-1483.092) (-1474.309) [-1471.012] (-1476.418) * [-1470.284] (-1476.830) (-1469.409) (-1468.796) -- 0:04:55
167000 -- (-1469.333) [-1475.206] (-1470.638) (-1478.646) * [-1470.809] (-1469.067) (-1479.268) (-1470.544) -- 0:04:54
167500 -- (-1479.555) (-1480.585) [-1464.660] (-1477.322) * (-1475.202) (-1469.867) (-1477.944) [-1465.305] -- 0:04:53
168000 -- (-1473.848) (-1476.666) [-1463.554] (-1475.926) * [-1474.312] (-1477.969) (-1483.699) (-1470.989) -- 0:04:57
168500 -- (-1468.864) [-1469.664] (-1478.108) (-1483.612) * (-1482.116) (-1471.015) [-1472.319] (-1472.408) -- 0:04:56
169000 -- (-1475.430) (-1474.382) (-1472.484) [-1479.336] * (-1481.320) (-1470.545) [-1465.692] (-1474.219) -- 0:04:55
169500 -- [-1468.811] (-1475.422) (-1466.826) (-1480.989) * [-1471.742] (-1472.934) (-1471.661) (-1470.361) -- 0:04:53
170000 -- (-1464.387) (-1463.452) [-1471.552] (-1479.177) * [-1464.128] (-1472.035) (-1475.306) (-1471.134) -- 0:04:52
Average standard deviation of split frequencies: 0.018299
170500 -- (-1477.390) (-1470.434) [-1465.029] (-1474.681) * (-1472.323) (-1481.139) [-1464.868] (-1472.510) -- 0:04:56
171000 -- (-1473.743) [-1468.660] (-1470.911) (-1470.621) * [-1474.363] (-1474.138) (-1466.977) (-1468.524) -- 0:04:55
171500 -- (-1469.543) (-1468.934) (-1472.925) [-1469.100] * [-1473.319] (-1480.121) (-1471.926) (-1465.920) -- 0:04:54
172000 -- (-1467.594) [-1467.176] (-1472.040) (-1472.478) * (-1474.777) [-1468.475] (-1472.536) (-1467.779) -- 0:04:53
172500 -- (-1470.349) (-1465.870) [-1468.141] (-1474.368) * (-1471.645) (-1480.757) (-1467.922) [-1468.936] -- 0:04:52
173000 -- (-1467.611) (-1471.446) [-1469.346] (-1472.872) * [-1467.896] (-1481.917) (-1468.275) (-1469.047) -- 0:04:51
173500 -- (-1474.350) (-1471.758) (-1476.302) [-1474.993] * (-1484.722) (-1472.997) [-1469.230] (-1480.576) -- 0:04:55
174000 -- (-1483.125) [-1472.804] (-1488.620) (-1477.530) * (-1471.091) [-1464.299] (-1478.868) (-1477.798) -- 0:04:54
174500 -- (-1482.287) (-1472.496) [-1473.370] (-1479.273) * [-1469.992] (-1469.027) (-1467.747) (-1477.101) -- 0:04:53
175000 -- [-1470.812] (-1470.062) (-1488.548) (-1471.103) * (-1471.057) (-1472.851) [-1466.773] (-1470.984) -- 0:04:52
Average standard deviation of split frequencies: 0.021427
175500 -- (-1471.129) (-1470.799) (-1470.688) [-1466.787] * (-1469.262) (-1476.546) [-1471.094] (-1469.234) -- 0:04:51
176000 -- (-1479.917) [-1475.156] (-1471.455) (-1475.411) * (-1477.267) (-1466.301) (-1468.430) [-1469.556] -- 0:04:54
176500 -- (-1476.287) (-1482.011) [-1468.912] (-1472.010) * (-1476.872) [-1474.014] (-1467.409) (-1477.262) -- 0:04:53
177000 -- [-1475.296] (-1477.541) (-1475.425) (-1468.966) * (-1480.446) (-1475.044) [-1474.168] (-1479.331) -- 0:04:52
177500 -- (-1482.228) (-1472.728) [-1466.533] (-1477.567) * [-1470.496] (-1484.028) (-1470.996) (-1472.889) -- 0:04:51
178000 -- [-1478.750] (-1473.388) (-1475.730) (-1477.169) * (-1469.099) (-1471.490) (-1467.467) [-1475.379] -- 0:04:50
178500 -- (-1474.248) (-1469.644) (-1466.796) [-1470.205] * [-1468.042] (-1477.408) (-1463.867) (-1481.849) -- 0:04:49
179000 -- (-1483.690) (-1470.238) (-1468.308) [-1471.373] * [-1468.003] (-1476.950) (-1470.243) (-1475.928) -- 0:04:53
179500 -- (-1476.414) (-1475.629) [-1467.585] (-1468.759) * (-1470.566) (-1480.534) [-1466.211] (-1480.245) -- 0:04:52
180000 -- (-1479.098) (-1473.939) (-1471.970) [-1476.421] * [-1469.650] (-1468.833) (-1475.114) (-1489.324) -- 0:04:51
Average standard deviation of split frequencies: 0.021852
180500 -- (-1472.228) (-1466.333) (-1474.148) [-1472.584] * (-1487.153) (-1476.236) [-1474.837] (-1476.208) -- 0:04:50
181000 -- [-1478.797] (-1471.510) (-1470.031) (-1467.253) * (-1474.110) [-1470.695] (-1476.691) (-1476.637) -- 0:04:49
181500 -- (-1465.600) (-1470.921) (-1479.515) [-1466.000] * (-1482.801) [-1477.846] (-1470.334) (-1468.929) -- 0:04:48
182000 -- (-1471.678) (-1470.441) (-1468.367) [-1469.861] * (-1470.542) [-1468.723] (-1464.622) (-1469.889) -- 0:04:52
182500 -- (-1471.242) (-1469.481) [-1467.905] (-1470.560) * (-1472.525) (-1473.972) [-1470.279] (-1463.745) -- 0:04:51
183000 -- (-1483.733) (-1475.211) (-1469.241) [-1470.069] * (-1472.205) (-1473.219) (-1473.351) [-1468.274] -- 0:04:50
183500 -- (-1475.417) [-1467.541] (-1472.558) (-1467.190) * (-1473.915) (-1464.898) (-1478.295) [-1472.724] -- 0:04:49
184000 -- (-1470.780) (-1474.042) [-1467.751] (-1470.467) * (-1475.738) (-1472.898) [-1486.687] (-1486.440) -- 0:04:48
184500 -- (-1471.610) [-1469.000] (-1470.180) (-1468.572) * (-1468.282) (-1472.324) (-1480.928) [-1473.179] -- 0:04:51
185000 -- [-1471.009] (-1463.249) (-1467.289) (-1476.805) * (-1484.815) (-1467.509) (-1474.022) [-1472.586] -- 0:04:50
Average standard deviation of split frequencies: 0.022214
185500 -- (-1477.691) (-1471.771) [-1474.449] (-1476.017) * (-1470.122) (-1470.629) (-1478.447) [-1473.788] -- 0:04:49
186000 -- (-1474.143) [-1474.159] (-1479.062) (-1469.890) * [-1469.015] (-1478.899) (-1473.003) (-1473.541) -- 0:04:48
186500 -- (-1478.774) [-1468.679] (-1477.899) (-1474.115) * [-1469.579] (-1461.935) (-1475.971) (-1472.152) -- 0:04:47
187000 -- (-1479.066) [-1468.316] (-1484.070) (-1472.278) * (-1470.684) (-1472.013) [-1473.768] (-1478.562) -- 0:04:46
187500 -- (-1477.274) (-1477.216) [-1470.998] (-1473.168) * (-1473.256) (-1468.020) [-1468.888] (-1473.755) -- 0:04:50
188000 -- (-1473.435) (-1474.448) [-1464.564] (-1468.496) * [-1471.018] (-1470.094) (-1471.704) (-1471.499) -- 0:04:49
188500 -- (-1473.765) [-1465.824] (-1472.725) (-1478.681) * (-1477.369) (-1465.149) [-1472.170] (-1471.764) -- 0:04:48
189000 -- (-1473.033) (-1471.891) [-1474.314] (-1471.291) * (-1474.524) (-1476.217) (-1467.120) [-1466.213] -- 0:04:47
189500 -- [-1474.359] (-1481.010) (-1482.129) (-1469.732) * (-1482.628) (-1472.097) (-1470.918) [-1471.942] -- 0:04:46
190000 -- (-1478.870) (-1477.618) [-1471.935] (-1486.633) * (-1469.535) (-1470.163) [-1471.400] (-1475.003) -- 0:04:49
Average standard deviation of split frequencies: 0.023024
190500 -- (-1478.515) (-1476.107) (-1480.700) [-1472.584] * (-1474.916) [-1470.909] (-1465.811) (-1480.690) -- 0:04:48
191000 -- [-1468.690] (-1477.047) (-1475.402) (-1472.049) * (-1473.231) (-1470.240) [-1465.740] (-1472.228) -- 0:04:48
191500 -- [-1471.993] (-1473.739) (-1473.729) (-1472.774) * [-1473.798] (-1470.339) (-1472.321) (-1467.779) -- 0:04:47
192000 -- (-1469.732) (-1472.424) (-1466.728) [-1467.861] * (-1474.178) (-1469.103) (-1464.708) [-1472.402] -- 0:04:46
192500 -- (-1465.361) (-1471.011) (-1477.922) [-1473.474] * (-1473.785) (-1482.281) [-1469.819] (-1475.570) -- 0:04:45
193000 -- (-1478.392) (-1474.253) (-1468.071) [-1473.215] * [-1461.889] (-1472.906) (-1483.944) (-1475.149) -- 0:04:48
193500 -- [-1469.187] (-1471.649) (-1472.241) (-1472.723) * (-1473.714) [-1473.954] (-1478.514) (-1484.388) -- 0:04:47
194000 -- (-1470.978) (-1476.465) [-1478.240] (-1476.847) * (-1473.962) (-1470.117) (-1463.467) [-1471.312] -- 0:04:46
194500 -- (-1468.553) [-1471.035] (-1476.437) (-1482.625) * (-1482.169) (-1481.752) [-1469.715] (-1476.238) -- 0:04:45
195000 -- [-1466.372] (-1469.230) (-1481.685) (-1481.919) * (-1475.102) (-1474.126) [-1467.563] (-1471.368) -- 0:04:44
Average standard deviation of split frequencies: 0.022698
195500 -- (-1471.197) [-1467.483] (-1481.590) (-1472.852) * (-1478.809) (-1487.098) [-1467.896] (-1479.266) -- 0:04:48
196000 -- [-1472.280] (-1474.560) (-1472.266) (-1468.485) * [-1474.353] (-1473.496) (-1482.363) (-1471.244) -- 0:04:47
196500 -- (-1476.981) (-1471.432) (-1471.373) [-1466.068] * [-1474.045] (-1473.957) (-1475.897) (-1475.341) -- 0:04:46
197000 -- [-1472.183] (-1468.079) (-1475.082) (-1464.315) * (-1478.939) (-1475.828) (-1473.392) [-1470.173] -- 0:04:45
197500 -- [-1468.348] (-1468.262) (-1483.728) (-1479.692) * (-1470.711) (-1475.659) [-1466.922] (-1475.647) -- 0:04:44
198000 -- (-1473.414) (-1474.771) (-1475.857) [-1469.980] * (-1469.453) (-1472.772) [-1466.973] (-1467.384) -- 0:04:43
198500 -- [-1468.006] (-1474.653) (-1480.403) (-1466.734) * (-1479.256) [-1470.047] (-1486.860) (-1470.934) -- 0:04:46
199000 -- (-1479.693) (-1478.337) (-1474.447) [-1467.674] * (-1473.435) (-1477.113) [-1472.659] (-1485.694) -- 0:04:45
199500 -- (-1467.492) (-1478.273) (-1471.529) [-1468.556] * (-1486.139) [-1484.592] (-1470.424) (-1475.431) -- 0:04:44
200000 -- [-1468.541] (-1481.190) (-1469.085) (-1472.979) * (-1476.728) (-1479.337) [-1468.067] (-1480.730) -- 0:04:44
Average standard deviation of split frequencies: 0.022024
200500 -- (-1474.826) (-1469.276) [-1477.449] (-1470.862) * [-1469.075] (-1473.950) (-1471.477) (-1477.847) -- 0:04:43
201000 -- (-1469.660) [-1466.656] (-1470.610) (-1474.830) * (-1471.442) [-1469.693] (-1464.854) (-1470.074) -- 0:04:42
201500 -- (-1479.911) (-1472.814) [-1466.232] (-1471.087) * [-1472.857] (-1475.854) (-1468.654) (-1472.397) -- 0:04:45
202000 -- (-1478.508) [-1461.694] (-1470.189) (-1476.694) * (-1470.343) [-1469.347] (-1465.178) (-1468.882) -- 0:04:44
202500 -- (-1476.255) [-1468.820] (-1481.767) (-1468.677) * (-1481.769) [-1475.852] (-1484.148) (-1468.027) -- 0:04:43
203000 -- (-1477.381) (-1475.900) [-1471.187] (-1471.122) * (-1476.127) (-1468.867) [-1474.586] (-1479.874) -- 0:04:42
203500 -- (-1470.081) (-1470.058) (-1474.978) [-1473.521] * (-1475.485) (-1477.546) (-1473.939) [-1473.285] -- 0:04:41
204000 -- (-1470.022) (-1491.178) [-1468.626] (-1466.801) * (-1470.140) (-1479.361) [-1468.475] (-1473.926) -- 0:04:44
204500 -- [-1467.651] (-1472.379) (-1476.404) (-1474.745) * [-1475.685] (-1471.388) (-1469.448) (-1473.915) -- 0:04:43
205000 -- (-1469.711) (-1470.827) (-1476.047) [-1473.935] * (-1479.042) [-1478.897] (-1469.866) (-1476.271) -- 0:04:43
Average standard deviation of split frequencies: 0.021883
205500 -- [-1476.981] (-1478.250) (-1482.168) (-1476.167) * (-1476.322) (-1476.040) [-1471.826] (-1469.419) -- 0:04:42
206000 -- [-1474.450] (-1474.982) (-1480.966) (-1471.633) * (-1470.659) (-1472.925) [-1468.816] (-1470.334) -- 0:04:41
206500 -- (-1465.837) (-1476.439) (-1471.869) [-1474.724] * [-1468.368] (-1469.959) (-1475.394) (-1465.309) -- 0:04:40
207000 -- (-1468.721) (-1476.935) [-1474.966] (-1479.607) * [-1468.129] (-1469.675) (-1482.427) (-1473.057) -- 0:04:43
207500 -- (-1471.654) [-1469.110] (-1467.285) (-1470.649) * [-1468.648] (-1479.543) (-1482.601) (-1470.229) -- 0:04:42
208000 -- (-1483.404) (-1468.635) (-1470.376) [-1475.693] * (-1472.667) [-1471.412] (-1470.311) (-1466.484) -- 0:04:41
208500 -- (-1471.050) [-1467.856] (-1479.291) (-1469.950) * (-1465.244) (-1471.986) [-1467.350] (-1472.256) -- 0:04:40
209000 -- (-1469.006) [-1469.781] (-1475.569) (-1467.743) * (-1466.840) (-1483.806) [-1474.376] (-1468.714) -- 0:04:40
209500 -- (-1476.815) [-1473.547] (-1472.532) (-1473.393) * (-1465.777) (-1479.618) (-1481.572) [-1469.274] -- 0:04:42
210000 -- (-1462.603) (-1480.560) (-1463.535) [-1472.324] * [-1469.011] (-1476.972) (-1481.533) (-1466.768) -- 0:04:42
Average standard deviation of split frequencies: 0.022237
210500 -- (-1473.563) [-1466.708] (-1472.882) (-1467.075) * [-1473.605] (-1472.638) (-1482.156) (-1476.805) -- 0:04:41
211000 -- (-1474.098) (-1475.539) [-1469.246] (-1483.785) * (-1473.732) (-1477.298) [-1477.216] (-1476.696) -- 0:04:40
211500 -- (-1486.461) (-1471.825) [-1474.752] (-1470.391) * (-1476.662) [-1469.696] (-1478.129) (-1478.934) -- 0:04:39
212000 -- (-1485.383) (-1470.852) [-1468.673] (-1475.223) * (-1476.700) (-1468.529) (-1477.772) [-1466.258] -- 0:04:38
212500 -- (-1484.399) (-1472.397) [-1467.164] (-1478.536) * (-1478.809) [-1470.724] (-1472.202) (-1480.611) -- 0:04:41
213000 -- (-1478.810) [-1469.997] (-1470.763) (-1474.527) * (-1473.642) (-1474.396) [-1466.768] (-1479.347) -- 0:04:40
213500 -- (-1476.688) [-1470.809] (-1467.510) (-1478.314) * [-1465.373] (-1471.168) (-1470.981) (-1471.848) -- 0:04:39
214000 -- (-1484.870) (-1472.479) (-1483.397) [-1472.720] * (-1468.693) (-1466.461) [-1468.615] (-1477.679) -- 0:04:39
214500 -- (-1476.119) (-1464.894) (-1468.920) [-1467.854] * (-1475.219) (-1468.947) (-1471.946) [-1479.721] -- 0:04:38
215000 -- (-1475.941) (-1467.085) [-1477.126] (-1465.942) * (-1483.403) [-1471.640] (-1474.383) (-1480.638) -- 0:04:37
Average standard deviation of split frequencies: 0.023365
215500 -- [-1476.968] (-1475.632) (-1482.797) (-1471.458) * (-1475.075) (-1473.557) (-1476.452) [-1475.508] -- 0:04:40
216000 -- (-1475.916) (-1473.843) (-1469.454) [-1470.927] * [-1466.798] (-1481.156) (-1478.265) (-1473.044) -- 0:04:39
216500 -- [-1476.825] (-1479.921) (-1471.927) (-1473.158) * (-1471.329) (-1473.425) (-1480.463) [-1474.199] -- 0:04:38
217000 -- (-1473.225) (-1465.730) [-1468.260] (-1463.881) * (-1469.744) [-1474.746] (-1476.840) (-1476.127) -- 0:04:37
217500 -- (-1469.068) (-1474.685) (-1475.363) [-1467.053] * [-1472.212] (-1470.806) (-1466.164) (-1466.659) -- 0:04:37
218000 -- [-1464.730] (-1479.945) (-1476.242) (-1475.707) * (-1476.293) [-1470.882] (-1483.012) (-1475.839) -- 0:04:39
218500 -- [-1465.928] (-1470.432) (-1474.508) (-1472.368) * (-1470.433) (-1467.597) (-1472.192) [-1466.665] -- 0:04:38
219000 -- (-1468.652) (-1478.766) (-1478.887) [-1466.539] * (-1473.293) (-1476.136) (-1473.685) [-1475.387] -- 0:04:38
219500 -- [-1466.859] (-1474.785) (-1472.167) (-1475.991) * [-1473.235] (-1474.991) (-1479.686) (-1464.515) -- 0:04:37
220000 -- [-1466.298] (-1472.193) (-1469.496) (-1467.816) * [-1470.430] (-1470.256) (-1474.398) (-1474.521) -- 0:04:36
Average standard deviation of split frequencies: 0.020734
220500 -- [-1485.202] (-1479.506) (-1466.837) (-1468.300) * (-1487.477) [-1471.455] (-1484.140) (-1470.932) -- 0:04:35
221000 -- (-1478.015) (-1485.522) [-1473.567] (-1470.974) * [-1468.805] (-1468.598) (-1490.287) (-1480.203) -- 0:04:38
221500 -- [-1468.556] (-1483.811) (-1469.437) (-1468.829) * [-1469.177] (-1474.688) (-1479.249) (-1470.688) -- 0:04:37
222000 -- (-1472.385) (-1469.678) [-1474.433] (-1472.214) * [-1469.247] (-1463.518) (-1474.139) (-1477.671) -- 0:04:36
222500 -- [-1470.415] (-1474.343) (-1479.669) (-1473.886) * (-1472.088) (-1483.121) (-1469.685) [-1473.375] -- 0:04:36
223000 -- (-1475.921) (-1481.934) (-1475.894) [-1464.975] * (-1475.679) (-1471.906) [-1467.752] (-1473.096) -- 0:04:35
223500 -- (-1468.790) (-1479.647) [-1470.592] (-1469.408) * (-1476.950) (-1481.409) (-1469.285) [-1478.432] -- 0:04:37
224000 -- [-1473.099] (-1483.801) (-1483.807) (-1481.304) * (-1478.251) (-1473.048) (-1471.651) [-1478.800] -- 0:04:37
224500 -- [-1477.293] (-1478.396) (-1481.321) (-1476.230) * (-1477.795) (-1473.573) (-1470.288) [-1475.440] -- 0:04:36
225000 -- (-1486.730) (-1475.902) (-1474.568) [-1465.901] * (-1482.497) [-1466.911] (-1478.076) (-1476.405) -- 0:04:35
Average standard deviation of split frequencies: 0.019877
225500 -- (-1466.132) (-1477.296) (-1472.602) [-1472.389] * (-1479.914) [-1473.132] (-1480.542) (-1468.498) -- 0:04:34
226000 -- (-1470.477) [-1465.312] (-1473.152) (-1473.012) * (-1487.493) [-1465.874] (-1479.210) (-1484.860) -- 0:04:33
226500 -- [-1469.108] (-1472.543) (-1478.217) (-1472.800) * (-1477.411) [-1472.531] (-1472.779) (-1482.783) -- 0:04:36
227000 -- [-1468.794] (-1474.693) (-1485.392) (-1470.458) * [-1467.746] (-1470.902) (-1473.232) (-1478.041) -- 0:04:35
227500 -- (-1475.195) [-1466.827] (-1478.530) (-1464.681) * [-1469.035] (-1475.932) (-1472.677) (-1473.365) -- 0:04:35
228000 -- (-1476.614) (-1478.006) (-1482.153) [-1467.822] * (-1483.694) (-1470.866) [-1476.115] (-1479.640) -- 0:04:34
228500 -- (-1471.253) [-1473.385] (-1477.141) (-1472.256) * (-1477.021) (-1469.318) (-1470.517) [-1463.118] -- 0:04:33
229000 -- [-1478.750] (-1466.927) (-1481.285) (-1482.723) * (-1474.457) [-1475.143] (-1467.886) (-1471.272) -- 0:04:32
229500 -- (-1472.323) (-1475.076) [-1465.815] (-1470.896) * (-1470.734) [-1468.972] (-1475.580) (-1470.603) -- 0:04:35
230000 -- (-1465.144) [-1469.308] (-1471.877) (-1470.945) * (-1474.918) (-1471.300) (-1470.546) [-1473.201] -- 0:04:34
Average standard deviation of split frequencies: 0.020797
230500 -- (-1474.758) (-1473.336) [-1476.161] (-1478.678) * (-1470.897) (-1475.857) [-1470.585] (-1478.677) -- 0:04:33
231000 -- (-1473.993) (-1481.860) (-1470.183) [-1468.322] * [-1468.495] (-1478.809) (-1467.059) (-1475.134) -- 0:04:32
231500 -- (-1479.495) (-1492.367) (-1470.293) [-1472.017] * (-1467.929) [-1469.024] (-1473.497) (-1477.061) -- 0:04:32
232000 -- (-1484.194) (-1484.114) [-1466.655] (-1470.260) * [-1467.207] (-1477.210) (-1478.029) (-1474.818) -- 0:04:34
232500 -- (-1475.056) (-1477.955) [-1464.535] (-1471.375) * (-1468.964) (-1466.231) [-1474.555] (-1472.939) -- 0:04:33
233000 -- (-1480.628) [-1473.531] (-1477.712) (-1470.709) * (-1468.461) [-1463.399] (-1470.738) (-1474.027) -- 0:04:33
233500 -- (-1474.998) [-1479.870] (-1481.700) (-1471.541) * (-1476.244) [-1467.269] (-1477.985) (-1472.288) -- 0:04:32
234000 -- (-1476.229) (-1476.050) [-1473.613] (-1465.362) * (-1470.236) (-1462.693) [-1475.724] (-1469.457) -- 0:04:31
234500 -- [-1472.292] (-1477.176) (-1471.082) (-1476.588) * (-1471.446) (-1478.010) (-1472.139) [-1468.893] -- 0:04:30
235000 -- (-1475.049) [-1475.457] (-1477.097) (-1472.789) * (-1481.440) [-1475.340] (-1478.251) (-1473.073) -- 0:04:33
Average standard deviation of split frequencies: 0.019600
235500 -- [-1472.734] (-1472.640) (-1470.781) (-1480.573) * (-1475.674) [-1468.219] (-1467.787) (-1479.164) -- 0:04:32
236000 -- (-1473.590) (-1481.187) [-1479.596] (-1474.992) * (-1482.521) (-1471.755) (-1476.400) [-1468.237] -- 0:04:31
236500 -- (-1475.909) (-1472.467) [-1470.845] (-1474.475) * (-1473.874) (-1483.314) (-1469.717) [-1482.662] -- 0:04:31
237000 -- (-1473.341) [-1465.782] (-1479.126) (-1475.454) * [-1471.637] (-1477.944) (-1469.323) (-1480.807) -- 0:04:30
237500 -- [-1470.639] (-1473.239) (-1476.315) (-1479.104) * (-1472.800) (-1471.926) [-1476.994] (-1472.598) -- 0:04:29
238000 -- [-1468.167] (-1479.141) (-1480.668) (-1474.125) * (-1466.219) [-1469.346] (-1475.189) (-1475.284) -- 0:04:32
238500 -- [-1467.712] (-1476.702) (-1468.847) (-1468.376) * (-1472.524) [-1477.964] (-1475.234) (-1479.075) -- 0:04:31
239000 -- (-1469.434) (-1473.090) (-1485.808) [-1475.020] * (-1473.380) (-1483.840) [-1469.661] (-1474.585) -- 0:04:30
239500 -- (-1474.743) (-1475.299) [-1464.811] (-1473.658) * (-1481.534) (-1476.303) (-1473.175) [-1475.123] -- 0:04:29
240000 -- (-1473.493) (-1485.358) (-1476.086) [-1474.754] * (-1481.643) (-1470.388) [-1478.076] (-1475.342) -- 0:04:29
Average standard deviation of split frequencies: 0.019710
240500 -- [-1471.016] (-1471.796) (-1473.958) (-1473.947) * (-1472.974) (-1476.316) (-1477.118) [-1470.483] -- 0:04:31
241000 -- [-1467.626] (-1477.664) (-1466.530) (-1472.900) * (-1479.068) (-1475.073) [-1470.293] (-1467.560) -- 0:04:30
241500 -- [-1466.344] (-1474.152) (-1481.635) (-1478.257) * (-1466.339) [-1468.727] (-1483.461) (-1476.140) -- 0:04:30
242000 -- [-1465.686] (-1478.199) (-1473.977) (-1470.082) * (-1470.907) (-1471.431) [-1470.096] (-1471.815) -- 0:04:29
242500 -- [-1476.253] (-1478.743) (-1469.166) (-1474.346) * (-1474.558) (-1478.099) (-1477.952) [-1475.462] -- 0:04:28
243000 -- [-1472.096] (-1472.227) (-1473.740) (-1472.097) * (-1480.352) (-1479.813) [-1472.529] (-1475.721) -- 0:04:27
243500 -- (-1475.001) (-1484.167) (-1467.968) [-1473.240] * (-1476.670) [-1470.813] (-1481.373) (-1477.092) -- 0:04:30
244000 -- [-1471.211] (-1471.138) (-1475.286) (-1471.992) * [-1475.423] (-1469.354) (-1471.225) (-1469.420) -- 0:04:29
244500 -- [-1470.503] (-1472.979) (-1481.236) (-1476.240) * (-1468.857) [-1469.674] (-1472.021) (-1473.045) -- 0:04:28
245000 -- (-1470.336) (-1482.288) (-1480.029) [-1471.677] * (-1478.364) [-1466.876] (-1473.268) (-1475.766) -- 0:04:28
Average standard deviation of split frequencies: 0.018923
245500 -- (-1472.234) (-1467.546) [-1470.885] (-1467.818) * (-1484.864) (-1471.409) (-1472.770) [-1464.785] -- 0:04:27
246000 -- [-1480.052] (-1474.041) (-1472.796) (-1475.683) * (-1478.994) (-1471.251) (-1480.253) [-1474.869] -- 0:04:26
246500 -- (-1474.389) (-1477.549) [-1475.592] (-1479.779) * (-1472.935) [-1468.952] (-1479.883) (-1477.011) -- 0:04:28
247000 -- (-1473.189) (-1474.434) [-1467.467] (-1482.513) * [-1476.649] (-1477.115) (-1484.390) (-1478.489) -- 0:04:28
247500 -- (-1479.971) (-1466.916) (-1484.260) [-1475.308] * (-1477.226) (-1471.402) [-1478.384] (-1476.099) -- 0:04:27
248000 -- [-1474.573] (-1474.173) (-1472.017) (-1479.910) * [-1471.721] (-1467.580) (-1475.630) (-1468.576) -- 0:04:26
248500 -- (-1468.789) [-1466.605] (-1472.633) (-1475.937) * (-1468.643) [-1475.307] (-1473.545) (-1478.025) -- 0:04:26
249000 -- [-1469.851] (-1479.063) (-1473.964) (-1475.248) * [-1473.976] (-1470.678) (-1473.816) (-1476.876) -- 0:04:28
249500 -- (-1474.172) (-1473.841) [-1472.243] (-1472.475) * (-1466.641) (-1470.867) (-1487.256) [-1472.289] -- 0:04:27
250000 -- (-1469.577) (-1467.737) (-1477.296) [-1471.542] * [-1468.680] (-1474.797) (-1482.023) (-1475.328) -- 0:04:27
Average standard deviation of split frequencies: 0.018924
250500 -- (-1483.039) (-1484.180) (-1477.799) [-1474.934] * (-1478.305) (-1478.309) (-1488.701) [-1477.015] -- 0:04:26
251000 -- (-1471.118) (-1485.129) (-1471.225) [-1471.200] * [-1475.953] (-1469.151) (-1484.220) (-1475.304) -- 0:04:25
251500 -- [-1470.585] (-1474.128) (-1470.039) (-1486.634) * [-1472.161] (-1472.644) (-1492.893) (-1470.570) -- 0:04:24
252000 -- (-1472.866) [-1475.547] (-1470.511) (-1477.674) * (-1472.133) (-1469.315) (-1483.008) [-1474.225] -- 0:04:27
252500 -- (-1484.805) (-1476.171) (-1470.490) [-1470.032] * (-1472.423) (-1464.053) (-1467.295) [-1463.920] -- 0:04:26
253000 -- (-1474.447) (-1470.347) (-1471.950) [-1469.888] * (-1476.305) [-1477.653] (-1481.636) (-1469.056) -- 0:04:25
253500 -- (-1466.998) (-1464.904) (-1466.500) [-1477.830] * (-1476.095) (-1472.582) (-1476.401) [-1466.563] -- 0:04:25
254000 -- (-1464.557) (-1482.520) [-1468.904] (-1483.016) * (-1467.471) (-1471.396) (-1472.907) [-1477.672] -- 0:04:24
254500 -- [-1473.499] (-1469.339) (-1472.664) (-1479.713) * (-1477.054) (-1468.746) (-1468.714) [-1470.147] -- 0:04:23
255000 -- (-1472.789) [-1470.222] (-1466.513) (-1483.164) * (-1469.698) (-1486.563) (-1474.522) [-1468.281] -- 0:04:25
Average standard deviation of split frequencies: 0.018069
255500 -- (-1484.008) (-1466.037) [-1472.539] (-1475.532) * (-1474.939) (-1465.694) (-1469.762) [-1468.231] -- 0:04:25
256000 -- [-1474.473] (-1474.069) (-1477.399) (-1475.163) * (-1474.370) [-1469.647] (-1473.214) (-1468.424) -- 0:04:24
256500 -- [-1467.426] (-1475.083) (-1478.843) (-1478.790) * [-1474.198] (-1473.220) (-1471.316) (-1471.933) -- 0:04:23
257000 -- (-1471.530) (-1470.335) [-1471.038] (-1468.883) * (-1468.551) (-1469.008) [-1482.370] (-1473.719) -- 0:04:23
257500 -- (-1472.425) (-1472.011) [-1470.178] (-1470.937) * [-1469.202] (-1464.064) (-1474.784) (-1473.656) -- 0:04:25
258000 -- (-1473.455) (-1465.285) [-1471.323] (-1479.143) * (-1473.631) [-1471.233] (-1478.331) (-1469.074) -- 0:04:24
258500 -- [-1483.278] (-1473.883) (-1469.060) (-1469.100) * (-1479.935) (-1473.472) (-1475.369) [-1469.288] -- 0:04:23
259000 -- [-1465.405] (-1470.146) (-1476.122) (-1470.661) * [-1467.782] (-1470.953) (-1466.796) (-1482.980) -- 0:04:23
259500 -- (-1475.352) [-1470.552] (-1471.939) (-1472.976) * (-1475.021) [-1470.164] (-1470.993) (-1477.621) -- 0:04:22
260000 -- (-1470.679) [-1469.641] (-1483.133) (-1474.507) * (-1475.442) (-1472.682) (-1472.965) [-1472.216] -- 0:04:21
Average standard deviation of split frequencies: 0.018424
260500 -- (-1467.755) [-1466.508] (-1473.382) (-1481.202) * (-1469.859) (-1469.368) (-1472.845) [-1477.260] -- 0:04:24
261000 -- (-1482.756) (-1472.808) [-1472.867] (-1480.228) * (-1469.329) (-1474.900) [-1481.112] (-1476.512) -- 0:04:23
261500 -- (-1473.699) (-1468.901) [-1467.755] (-1470.804) * (-1471.147) (-1468.879) [-1474.241] (-1472.564) -- 0:04:22
262000 -- (-1484.148) (-1462.728) (-1470.759) [-1474.450] * (-1487.127) (-1476.541) [-1475.344] (-1477.042) -- 0:04:21
262500 -- [-1469.621] (-1476.742) (-1476.514) (-1473.512) * (-1477.477) (-1476.516) (-1480.535) [-1480.006] -- 0:04:21
263000 -- (-1469.890) (-1467.233) (-1468.008) [-1474.910] * (-1471.623) (-1478.136) (-1479.111) [-1467.025] -- 0:04:23
263500 -- (-1474.617) (-1471.405) (-1473.925) [-1474.054] * (-1471.957) (-1478.200) [-1481.663] (-1471.921) -- 0:04:22
264000 -- (-1470.825) [-1477.897] (-1470.372) (-1469.257) * [-1466.759] (-1467.952) (-1468.075) (-1479.718) -- 0:04:22
264500 -- [-1467.084] (-1487.875) (-1476.933) (-1473.999) * (-1466.686) (-1480.303) [-1475.656] (-1477.826) -- 0:04:21
265000 -- [-1466.663] (-1477.376) (-1469.262) (-1473.526) * (-1480.079) [-1472.317] (-1481.787) (-1477.458) -- 0:04:20
Average standard deviation of split frequencies: 0.019162
265500 -- [-1470.849] (-1462.094) (-1468.115) (-1470.295) * (-1481.492) (-1468.405) (-1485.167) [-1466.252] -- 0:04:20
266000 -- [-1467.537] (-1470.514) (-1480.627) (-1472.397) * [-1477.107] (-1480.334) (-1481.946) (-1474.920) -- 0:04:22
266500 -- [-1468.319] (-1471.576) (-1475.701) (-1476.858) * (-1486.727) [-1472.884] (-1475.119) (-1470.401) -- 0:04:21
267000 -- (-1470.121) [-1472.111] (-1470.371) (-1469.847) * (-1491.290) [-1468.144] (-1473.337) (-1478.930) -- 0:04:20
267500 -- [-1470.690] (-1477.469) (-1471.455) (-1475.523) * [-1470.321] (-1469.174) (-1467.872) (-1485.158) -- 0:04:20
268000 -- (-1474.494) (-1482.848) [-1473.827] (-1477.046) * (-1471.638) (-1474.596) [-1463.449] (-1479.805) -- 0:04:19
268500 -- (-1478.539) [-1467.506] (-1473.677) (-1474.512) * (-1468.884) (-1469.535) [-1474.835] (-1482.682) -- 0:04:18
269000 -- (-1473.786) (-1475.480) [-1471.533] (-1470.842) * (-1466.333) (-1471.002) [-1467.443] (-1479.588) -- 0:04:20
269500 -- (-1483.888) (-1475.840) [-1471.974] (-1472.398) * (-1475.171) (-1466.967) (-1476.168) [-1474.203] -- 0:04:20
270000 -- (-1481.424) [-1477.510] (-1470.109) (-1473.349) * (-1468.857) (-1472.928) [-1476.699] (-1475.272) -- 0:04:19
Average standard deviation of split frequencies: 0.019485
270500 -- (-1471.911) (-1480.437) [-1462.930] (-1471.090) * (-1471.764) (-1470.667) (-1481.512) [-1466.050] -- 0:04:18
271000 -- (-1469.513) [-1471.775] (-1468.393) (-1479.765) * (-1475.845) (-1476.297) (-1478.777) [-1471.415] -- 0:04:18
271500 -- (-1468.230) (-1475.279) [-1470.842] (-1474.513) * (-1483.415) (-1473.675) [-1462.583] (-1466.985) -- 0:04:20
272000 -- [-1468.864] (-1477.795) (-1475.993) (-1470.676) * (-1480.920) [-1469.103] (-1471.409) (-1474.438) -- 0:04:19
272500 -- (-1469.664) (-1468.694) [-1484.275] (-1472.255) * (-1474.399) [-1474.330] (-1467.351) (-1479.996) -- 0:04:18
273000 -- (-1476.295) [-1469.424] (-1472.346) (-1473.174) * [-1469.229] (-1474.974) (-1471.015) (-1482.241) -- 0:04:18
273500 -- (-1487.388) [-1470.059] (-1475.406) (-1480.861) * (-1472.489) (-1469.707) [-1484.850] (-1481.588) -- 0:04:17
274000 -- (-1476.621) (-1466.921) [-1469.844] (-1484.336) * (-1472.828) (-1471.108) [-1477.586] (-1478.988) -- 0:04:17
274500 -- (-1473.685) [-1472.091] (-1476.188) (-1479.548) * (-1467.098) [-1469.179] (-1477.002) (-1476.940) -- 0:04:19
275000 -- (-1475.415) [-1472.131] (-1466.127) (-1476.917) * (-1470.825) (-1474.539) [-1475.805] (-1470.938) -- 0:04:18
Average standard deviation of split frequencies: 0.018681
275500 -- (-1474.950) (-1476.495) [-1464.306] (-1480.299) * [-1465.436] (-1483.338) (-1471.740) (-1472.265) -- 0:04:17
276000 -- [-1468.508] (-1474.390) (-1471.059) (-1493.263) * [-1478.249] (-1470.259) (-1481.450) (-1473.484) -- 0:04:17
276500 -- (-1465.728) (-1480.915) [-1467.711] (-1471.108) * (-1472.819) (-1473.828) (-1471.544) [-1471.017] -- 0:04:16
277000 -- (-1477.506) [-1469.256] (-1471.557) (-1475.029) * (-1467.765) (-1472.012) [-1471.260] (-1474.927) -- 0:04:15
277500 -- (-1476.362) [-1473.973] (-1478.165) (-1473.181) * (-1476.186) [-1465.895] (-1479.529) (-1480.412) -- 0:04:17
278000 -- (-1471.869) (-1473.493) [-1473.539] (-1478.845) * (-1471.454) (-1465.162) [-1466.794] (-1478.453) -- 0:04:17
278500 -- [-1472.407] (-1472.712) (-1483.060) (-1472.932) * (-1483.129) (-1471.219) [-1469.979] (-1474.398) -- 0:04:16
279000 -- (-1479.915) [-1465.188] (-1479.407) (-1470.425) * (-1475.362) (-1476.666) (-1468.619) [-1465.581] -- 0:04:15
279500 -- (-1474.463) (-1466.802) [-1469.938] (-1471.606) * (-1473.406) [-1475.081] (-1472.644) (-1477.150) -- 0:04:15
280000 -- (-1470.941) (-1477.279) (-1474.883) [-1463.087] * [-1475.176] (-1468.781) (-1474.753) (-1484.117) -- 0:04:17
Average standard deviation of split frequencies: 0.019945
280500 -- [-1483.570] (-1471.074) (-1474.657) (-1478.467) * (-1468.462) (-1466.913) [-1465.374] (-1474.545) -- 0:04:16
281000 -- (-1473.308) (-1475.626) (-1486.009) [-1473.409] * (-1478.650) [-1468.983] (-1473.289) (-1474.695) -- 0:04:15
281500 -- (-1474.790) (-1475.943) (-1479.131) [-1472.391] * (-1483.594) (-1471.569) (-1478.862) [-1472.309] -- 0:04:15
282000 -- (-1471.695) [-1470.692] (-1476.069) (-1471.062) * [-1471.487] (-1482.137) (-1477.120) (-1468.024) -- 0:04:14
282500 -- (-1469.889) (-1472.746) (-1469.148) [-1473.711] * [-1473.093] (-1470.976) (-1481.830) (-1470.991) -- 0:04:13
283000 -- (-1467.052) [-1473.030] (-1467.781) (-1474.413) * [-1472.933] (-1472.366) (-1473.831) (-1475.324) -- 0:04:15
283500 -- (-1467.878) (-1482.066) [-1466.553] (-1471.688) * [-1475.609] (-1479.993) (-1481.489) (-1484.546) -- 0:04:15
284000 -- (-1468.130) (-1484.907) (-1471.457) [-1474.645] * [-1478.027] (-1476.000) (-1481.989) (-1476.765) -- 0:04:14
284500 -- [-1469.312] (-1474.049) (-1474.847) (-1471.314) * (-1472.697) (-1477.465) [-1470.528] (-1484.547) -- 0:04:14
285000 -- (-1473.429) (-1470.767) (-1469.061) [-1468.677] * (-1473.218) [-1471.502] (-1475.384) (-1475.272) -- 0:04:13
Average standard deviation of split frequencies: 0.017204
285500 -- (-1478.192) (-1470.775) [-1468.743] (-1475.811) * (-1469.282) (-1467.374) [-1475.005] (-1471.578) -- 0:04:15
286000 -- (-1485.351) (-1466.611) (-1475.320) [-1474.487] * (-1473.260) (-1475.684) (-1472.309) [-1468.677] -- 0:04:14
286500 -- (-1480.554) (-1467.612) [-1476.659] (-1482.033) * [-1470.899] (-1476.656) (-1469.087) (-1480.769) -- 0:04:14
287000 -- (-1476.962) [-1475.614] (-1466.732) (-1479.163) * [-1472.146] (-1479.040) (-1470.972) (-1488.430) -- 0:04:13
287500 -- [-1484.141] (-1476.509) (-1466.160) (-1482.828) * (-1476.293) (-1473.080) [-1471.080] (-1479.194) -- 0:04:12
288000 -- [-1480.475] (-1470.190) (-1473.383) (-1467.771) * [-1469.221] (-1475.721) (-1475.296) (-1475.917) -- 0:04:12
288500 -- (-1486.876) (-1476.059) [-1464.371] (-1472.659) * (-1469.061) (-1478.019) (-1475.739) [-1473.285] -- 0:04:14
289000 -- (-1473.000) [-1475.395] (-1472.338) (-1482.097) * [-1471.787] (-1476.154) (-1467.862) (-1482.908) -- 0:04:13
289500 -- (-1479.873) [-1467.901] (-1478.383) (-1474.515) * [-1471.310] (-1480.490) (-1464.846) (-1480.669) -- 0:04:12
290000 -- (-1479.694) (-1468.830) (-1478.901) [-1466.093] * (-1483.135) (-1477.353) [-1466.328] (-1472.641) -- 0:04:12
Average standard deviation of split frequencies: 0.017536
290500 -- (-1487.047) (-1468.327) [-1471.966] (-1481.704) * (-1480.439) [-1477.647] (-1475.548) (-1476.467) -- 0:04:11
291000 -- [-1472.398] (-1479.114) (-1471.017) (-1471.059) * (-1471.300) (-1483.278) [-1468.051] (-1478.903) -- 0:04:10
291500 -- [-1474.546] (-1480.005) (-1478.013) (-1475.366) * (-1482.606) (-1473.975) (-1471.371) [-1470.334] -- 0:04:12
292000 -- (-1474.393) (-1473.574) (-1474.034) [-1475.006] * (-1466.707) [-1469.301] (-1469.191) (-1472.841) -- 0:04:12
292500 -- [-1468.748] (-1484.171) (-1471.238) (-1474.527) * (-1465.659) [-1467.549] (-1464.573) (-1470.693) -- 0:04:11
293000 -- [-1474.278] (-1481.986) (-1473.037) (-1473.584) * (-1466.393) [-1471.047] (-1470.788) (-1470.620) -- 0:04:10
293500 -- (-1474.785) (-1480.878) [-1469.633] (-1470.868) * [-1484.318] (-1473.461) (-1480.649) (-1466.841) -- 0:04:10
294000 -- (-1482.425) (-1489.427) [-1469.739] (-1466.382) * (-1474.571) (-1469.584) [-1473.450] (-1472.419) -- 0:04:12
294500 -- (-1472.617) (-1474.294) (-1485.992) [-1467.348] * (-1471.070) (-1471.870) (-1481.997) [-1471.431] -- 0:04:11
295000 -- (-1466.460) (-1474.508) [-1474.289] (-1492.067) * (-1472.939) [-1469.605] (-1489.241) (-1474.092) -- 0:04:10
Average standard deviation of split frequencies: 0.018215
295500 -- [-1470.573] (-1477.380) (-1474.500) (-1472.386) * (-1476.434) [-1472.867] (-1474.197) (-1478.990) -- 0:04:10
296000 -- (-1478.390) (-1477.329) (-1479.864) [-1469.531] * (-1473.238) [-1471.875] (-1472.142) (-1477.203) -- 0:04:09
296500 -- [-1472.770] (-1480.609) (-1475.120) (-1471.852) * [-1470.488] (-1476.225) (-1479.359) (-1474.872) -- 0:04:09
297000 -- (-1467.976) [-1477.019] (-1475.496) (-1482.666) * [-1467.548] (-1472.131) (-1478.241) (-1473.020) -- 0:04:10
297500 -- (-1463.714) [-1471.996] (-1480.380) (-1470.093) * [-1467.932] (-1482.609) (-1471.098) (-1469.715) -- 0:04:10
298000 -- [-1478.991] (-1472.272) (-1474.284) (-1469.274) * (-1474.043) (-1475.581) [-1471.316] (-1484.855) -- 0:04:09
298500 -- (-1469.404) (-1474.166) (-1474.251) [-1462.813] * (-1479.989) (-1468.262) [-1465.714] (-1481.242) -- 0:04:09
299000 -- (-1476.846) [-1475.085] (-1477.664) (-1464.990) * (-1476.222) (-1480.325) [-1468.611] (-1471.352) -- 0:04:08
299500 -- (-1476.354) (-1485.501) [-1469.706] (-1474.569) * (-1474.348) [-1467.019] (-1479.170) (-1477.491) -- 0:04:10
300000 -- (-1467.797) [-1477.844] (-1475.228) (-1488.129) * (-1470.031) [-1472.149] (-1476.393) (-1472.969) -- 0:04:09
Average standard deviation of split frequencies: 0.018716
300500 -- [-1469.705] (-1478.751) (-1476.438) (-1470.587) * (-1470.133) (-1476.958) (-1481.680) [-1473.222] -- 0:04:09
301000 -- (-1468.665) [-1475.820] (-1474.599) (-1472.863) * (-1481.406) (-1470.746) (-1470.315) [-1468.539] -- 0:04:08
301500 -- [-1472.701] (-1475.572) (-1479.950) (-1472.897) * [-1467.791] (-1467.601) (-1475.427) (-1464.433) -- 0:04:07
302000 -- (-1474.277) [-1472.363] (-1483.019) (-1476.474) * (-1471.650) (-1481.312) (-1469.979) [-1470.755] -- 0:04:07
302500 -- (-1476.394) [-1469.231] (-1474.758) (-1474.747) * (-1473.547) (-1473.865) [-1470.370] (-1469.302) -- 0:04:09
303000 -- [-1471.544] (-1472.224) (-1477.379) (-1473.547) * [-1471.216] (-1483.826) (-1475.688) (-1477.227) -- 0:04:08
303500 -- [-1480.318] (-1471.336) (-1473.222) (-1476.589) * (-1486.500) (-1481.847) [-1472.764] (-1471.859) -- 0:04:07
304000 -- (-1478.747) (-1478.138) [-1468.409] (-1475.667) * (-1469.327) (-1472.285) (-1466.667) [-1469.704] -- 0:04:07
304500 -- (-1469.124) (-1474.874) (-1474.279) [-1472.697] * (-1479.820) [-1471.868] (-1472.202) (-1473.035) -- 0:04:06
305000 -- (-1469.396) [-1475.984] (-1466.552) (-1467.329) * [-1473.763] (-1479.569) (-1475.424) (-1470.055) -- 0:04:06
Average standard deviation of split frequencies: 0.017812
305500 -- (-1475.745) (-1474.263) [-1467.193] (-1481.786) * (-1473.391) (-1470.593) (-1471.709) [-1465.433] -- 0:04:07
306000 -- (-1479.526) (-1474.786) [-1476.860] (-1470.965) * (-1470.320) (-1474.070) [-1473.515] (-1474.240) -- 0:04:07
306500 -- (-1477.859) (-1466.458) [-1470.692] (-1471.261) * [-1467.818] (-1480.252) (-1467.556) (-1478.910) -- 0:04:06
307000 -- (-1475.298) [-1477.798] (-1467.394) (-1470.638) * (-1476.305) (-1475.254) [-1475.329] (-1471.825) -- 0:04:06
307500 -- (-1484.759) (-1469.744) [-1469.295] (-1473.768) * (-1466.839) (-1476.916) [-1465.592] (-1471.672) -- 0:04:05
308000 -- (-1504.288) [-1473.111] (-1474.261) (-1473.728) * [-1475.702] (-1474.329) (-1479.324) (-1467.711) -- 0:04:07
308500 -- (-1475.449) [-1477.159] (-1477.863) (-1474.581) * [-1469.010] (-1473.626) (-1471.708) (-1473.875) -- 0:04:06
309000 -- (-1469.473) (-1480.132) [-1466.602] (-1474.853) * [-1468.534] (-1475.243) (-1478.250) (-1467.315) -- 0:04:05
309500 -- (-1470.971) [-1472.015] (-1484.760) (-1485.508) * (-1465.525) (-1470.338) [-1475.355] (-1475.246) -- 0:04:05
310000 -- (-1479.053) (-1474.703) [-1466.304] (-1479.490) * [-1474.406] (-1484.305) (-1475.663) (-1468.837) -- 0:04:04
Average standard deviation of split frequencies: 0.015648
310500 -- (-1474.572) [-1470.564] (-1468.553) (-1470.171) * [-1473.654] (-1476.941) (-1484.180) (-1469.877) -- 0:04:04
311000 -- (-1474.340) (-1473.939) (-1474.253) [-1476.050] * [-1475.340] (-1476.440) (-1485.724) (-1468.669) -- 0:04:05
311500 -- (-1471.560) (-1485.184) [-1470.001] (-1467.861) * (-1479.122) (-1477.016) [-1477.146] (-1469.432) -- 0:04:05
312000 -- (-1472.006) [-1477.964] (-1475.336) (-1485.712) * (-1471.228) (-1467.555) (-1476.381) [-1469.563] -- 0:04:04
312500 -- (-1489.603) [-1470.694] (-1477.935) (-1470.444) * [-1473.609] (-1467.803) (-1470.903) (-1466.087) -- 0:04:04
313000 -- (-1470.931) [-1472.775] (-1477.411) (-1471.589) * (-1472.768) (-1472.499) [-1471.613] (-1470.100) -- 0:04:03
313500 -- (-1478.736) [-1465.145] (-1475.898) (-1480.745) * (-1476.106) (-1473.726) (-1488.275) [-1467.425] -- 0:04:03
314000 -- (-1473.003) [-1466.435] (-1476.569) (-1471.985) * (-1470.548) [-1470.213] (-1480.850) (-1478.806) -- 0:04:04
314500 -- (-1476.722) (-1475.320) [-1467.449] (-1468.743) * (-1465.748) [-1479.594] (-1474.174) (-1470.831) -- 0:04:04
315000 -- [-1481.088] (-1470.347) (-1471.345) (-1477.308) * (-1470.720) (-1476.594) [-1477.377] (-1480.585) -- 0:04:03
Average standard deviation of split frequencies: 0.014545
315500 -- (-1473.659) (-1475.372) [-1468.919] (-1475.193) * (-1469.684) [-1475.750] (-1471.350) (-1471.132) -- 0:04:02
316000 -- [-1471.425] (-1471.569) (-1470.512) (-1475.088) * (-1472.498) (-1470.038) (-1471.557) [-1473.905] -- 0:04:02
316500 -- [-1467.556] (-1474.150) (-1471.516) (-1469.808) * (-1472.762) [-1469.066] (-1477.806) (-1475.437) -- 0:04:04
317000 -- (-1468.550) [-1469.988] (-1469.294) (-1477.458) * (-1471.047) (-1471.244) [-1474.846] (-1481.203) -- 0:04:03
317500 -- (-1474.486) (-1475.615) (-1469.413) [-1470.744] * (-1476.997) (-1474.193) [-1476.393] (-1477.529) -- 0:04:02
318000 -- (-1476.224) [-1472.300] (-1466.507) (-1475.412) * (-1473.528) [-1465.861] (-1474.302) (-1472.221) -- 0:04:02
318500 -- (-1468.846) [-1471.551] (-1472.146) (-1478.271) * (-1467.021) (-1467.664) [-1476.095] (-1470.775) -- 0:04:01
319000 -- [-1472.048] (-1472.624) (-1472.059) (-1476.064) * (-1471.562) (-1465.335) [-1467.206] (-1468.924) -- 0:04:01
319500 -- (-1471.425) (-1471.584) [-1471.000] (-1469.710) * (-1463.461) (-1467.555) [-1469.478] (-1484.572) -- 0:04:02
320000 -- (-1465.645) (-1473.851) [-1469.165] (-1466.526) * (-1472.126) (-1466.828) (-1475.576) [-1466.970] -- 0:04:02
Average standard deviation of split frequencies: 0.015068
320500 -- (-1483.570) [-1467.183] (-1475.892) (-1478.426) * (-1466.370) [-1472.720] (-1468.685) (-1481.674) -- 0:04:01
321000 -- (-1472.272) (-1463.474) (-1469.430) [-1469.984] * [-1470.357] (-1473.289) (-1476.641) (-1476.364) -- 0:04:01
321500 -- (-1477.111) (-1474.152) (-1471.411) [-1468.773] * (-1477.055) [-1465.438] (-1475.487) (-1472.158) -- 0:04:00
322000 -- (-1466.575) (-1474.879) [-1475.550] (-1477.632) * (-1470.108) (-1475.717) [-1472.988] (-1475.807) -- 0:04:02
322500 -- (-1472.623) (-1476.647) [-1474.008] (-1470.945) * (-1471.999) (-1472.639) [-1467.554] (-1475.833) -- 0:04:01
323000 -- (-1480.788) [-1467.561] (-1484.685) (-1465.406) * (-1487.593) (-1469.132) (-1471.378) [-1471.810] -- 0:04:01
323500 -- (-1478.592) [-1480.508] (-1469.349) (-1472.135) * [-1474.336] (-1473.722) (-1467.021) (-1482.555) -- 0:04:00
324000 -- (-1473.874) [-1484.201] (-1470.580) (-1475.230) * [-1464.945] (-1472.379) (-1474.495) (-1478.830) -- 0:03:59
324500 -- (-1474.034) (-1476.392) (-1470.087) [-1471.208] * (-1474.653) (-1475.260) [-1471.376] (-1477.115) -- 0:03:59
325000 -- (-1470.011) (-1471.820) (-1477.040) [-1474.058] * (-1481.592) (-1478.364) [-1472.834] (-1473.666) -- 0:04:00
Average standard deviation of split frequencies: 0.014099
325500 -- (-1471.296) (-1480.343) [-1474.458] (-1473.467) * (-1482.271) (-1473.225) (-1468.787) [-1473.359] -- 0:04:00
326000 -- (-1467.579) (-1480.866) (-1473.350) [-1471.101] * (-1475.024) [-1469.038] (-1475.426) (-1470.194) -- 0:03:59
326500 -- [-1468.413] (-1474.602) (-1474.865) (-1468.980) * [-1472.424] (-1471.399) (-1470.497) (-1484.249) -- 0:03:59
327000 -- (-1471.799) [-1472.469] (-1466.596) (-1475.635) * (-1476.156) [-1464.165] (-1465.851) (-1470.449) -- 0:03:58
327500 -- (-1468.962) (-1471.262) (-1478.660) [-1467.855] * (-1469.144) (-1495.730) [-1477.090] (-1467.327) -- 0:03:58
328000 -- (-1467.858) (-1469.436) [-1474.431] (-1467.203) * [-1463.766] (-1472.880) (-1467.390) (-1472.182) -- 0:03:59
328500 -- (-1474.848) (-1474.090) [-1473.792] (-1471.317) * (-1469.644) (-1474.354) [-1467.724] (-1484.151) -- 0:03:59
329000 -- (-1469.732) (-1465.123) (-1469.040) [-1477.030] * [-1471.733] (-1480.930) (-1472.946) (-1481.799) -- 0:03:58
329500 -- (-1473.334) [-1471.533] (-1478.179) (-1482.315) * (-1465.665) (-1480.765) [-1468.495] (-1474.808) -- 0:03:58
330000 -- (-1468.328) [-1468.189] (-1473.195) (-1478.479) * (-1469.401) [-1465.964] (-1474.512) (-1472.277) -- 0:03:57
Average standard deviation of split frequencies: 0.013009
330500 -- (-1466.186) (-1475.166) [-1470.788] (-1474.332) * [-1463.118] (-1476.748) (-1470.044) (-1483.087) -- 0:03:59
331000 -- (-1473.914) (-1469.577) [-1472.867] (-1471.119) * (-1474.452) [-1466.862] (-1477.180) (-1469.484) -- 0:03:58
331500 -- (-1479.300) (-1470.939) [-1473.835] (-1482.685) * (-1469.265) [-1468.105] (-1482.295) (-1478.095) -- 0:03:57
332000 -- (-1472.661) (-1478.646) [-1468.272] (-1474.140) * (-1469.852) (-1464.411) [-1469.653] (-1477.915) -- 0:03:57
332500 -- (-1478.163) (-1469.938) [-1467.110] (-1476.074) * [-1471.887] (-1467.219) (-1467.733) (-1478.096) -- 0:03:56
333000 -- (-1480.495) (-1477.509) (-1474.794) [-1469.369] * (-1468.679) (-1482.135) [-1469.477] (-1474.301) -- 0:03:56
333500 -- [-1468.183] (-1466.355) (-1468.074) (-1479.682) * [-1475.345] (-1471.009) (-1462.045) (-1475.824) -- 0:03:57
334000 -- (-1475.084) [-1468.755] (-1468.679) (-1469.320) * [-1479.401] (-1470.702) (-1477.171) (-1473.638) -- 0:03:57
334500 -- [-1468.843] (-1471.505) (-1472.127) (-1473.934) * (-1474.057) (-1473.707) [-1463.793] (-1474.255) -- 0:03:56
335000 -- [-1467.485] (-1482.314) (-1474.785) (-1468.741) * (-1473.678) (-1474.105) [-1471.130] (-1464.377) -- 0:03:56
Average standard deviation of split frequencies: 0.012802
335500 -- (-1472.915) (-1475.602) (-1476.469) [-1471.437] * (-1474.336) [-1472.268] (-1476.085) (-1473.068) -- 0:03:55
336000 -- (-1477.742) [-1469.906] (-1474.927) (-1477.810) * (-1477.682) (-1469.587) (-1472.386) [-1471.155] -- 0:03:57
336500 -- (-1476.444) (-1482.253) [-1469.648] (-1476.218) * (-1482.198) (-1476.207) (-1469.965) [-1471.921] -- 0:03:56
337000 -- (-1477.898) (-1477.896) [-1465.451] (-1471.979) * [-1468.296] (-1471.260) (-1463.146) (-1473.665) -- 0:03:56
337500 -- (-1473.552) [-1472.055] (-1473.360) (-1466.658) * [-1476.772] (-1474.946) (-1471.780) (-1477.391) -- 0:03:55
338000 -- (-1474.619) (-1470.111) (-1486.007) [-1466.093] * (-1472.134) (-1475.133) (-1477.073) [-1469.576] -- 0:03:55
338500 -- (-1469.167) [-1465.626] (-1469.997) (-1471.337) * [-1474.155] (-1480.000) (-1474.947) (-1475.031) -- 0:03:54
339000 -- (-1479.009) (-1468.115) [-1472.160] (-1466.152) * [-1473.184] (-1476.297) (-1473.791) (-1481.176) -- 0:03:55
339500 -- (-1474.117) [-1468.078] (-1475.503) (-1479.029) * (-1471.955) [-1468.798] (-1471.393) (-1480.137) -- 0:03:55
340000 -- [-1466.982] (-1476.261) (-1481.349) (-1490.434) * (-1480.592) (-1478.333) [-1468.597] (-1479.385) -- 0:03:54
Average standard deviation of split frequencies: 0.013751
340500 -- [-1473.281] (-1479.092) (-1475.171) (-1491.732) * [-1470.778] (-1476.485) (-1469.239) (-1473.552) -- 0:03:54
341000 -- (-1481.227) (-1486.352) [-1464.190] (-1483.835) * (-1475.395) (-1481.443) [-1468.409] (-1473.575) -- 0:03:53
341500 -- (-1466.575) (-1473.630) (-1472.568) [-1471.285] * (-1471.664) (-1474.357) (-1480.692) [-1479.117] -- 0:03:53
342000 -- (-1469.738) [-1476.047] (-1473.076) (-1470.816) * (-1469.426) (-1470.876) (-1475.853) [-1471.051] -- 0:03:54
342500 -- [-1466.672] (-1476.050) (-1472.740) (-1469.245) * (-1464.585) (-1474.436) [-1468.849] (-1473.245) -- 0:03:54
343000 -- (-1473.743) (-1476.420) (-1485.028) [-1466.219] * (-1474.829) (-1479.857) [-1463.625] (-1475.981) -- 0:03:53
343500 -- (-1476.178) (-1476.031) (-1476.000) [-1468.348] * [-1465.135] (-1479.453) (-1480.653) (-1473.022) -- 0:03:53
344000 -- (-1468.833) (-1475.032) (-1466.298) [-1475.783] * (-1467.505) (-1481.093) [-1469.645] (-1475.575) -- 0:03:52
344500 -- [-1469.809] (-1470.365) (-1479.235) (-1472.368) * (-1470.811) (-1478.391) [-1468.069] (-1480.767) -- 0:03:54
345000 -- [-1463.353] (-1475.021) (-1474.340) (-1479.172) * (-1476.501) (-1470.237) [-1471.616] (-1472.200) -- 0:03:53
Average standard deviation of split frequencies: 0.012347
345500 -- (-1473.329) [-1471.655] (-1472.346) (-1478.001) * (-1473.510) (-1481.915) [-1465.171] (-1472.948) -- 0:03:53
346000 -- (-1470.773) (-1477.595) [-1471.151] (-1477.143) * (-1467.852) (-1484.938) [-1476.075] (-1480.823) -- 0:03:52
346500 -- (-1477.449) (-1472.862) (-1475.192) [-1471.998] * (-1472.605) [-1466.231] (-1475.663) (-1478.347) -- 0:03:51
347000 -- [-1470.268] (-1470.574) (-1471.477) (-1466.952) * (-1480.012) [-1467.694] (-1469.945) (-1476.842) -- 0:03:51
347500 -- [-1470.160] (-1474.620) (-1478.435) (-1468.471) * [-1477.188] (-1479.522) (-1471.024) (-1486.564) -- 0:03:52
348000 -- (-1475.839) [-1467.841] (-1472.043) (-1482.121) * (-1473.685) (-1471.891) [-1470.927] (-1487.156) -- 0:03:52
348500 -- (-1474.509) [-1474.619] (-1475.720) (-1483.648) * [-1471.161] (-1473.084) (-1475.228) (-1485.424) -- 0:03:51
349000 -- [-1468.829] (-1474.183) (-1464.231) (-1474.412) * (-1477.516) [-1469.649] (-1474.571) (-1476.325) -- 0:03:51
349500 -- (-1467.926) (-1467.090) [-1467.747] (-1479.661) * (-1468.930) (-1471.936) [-1470.140] (-1483.032) -- 0:03:50
350000 -- (-1471.226) (-1476.888) (-1464.884) [-1471.386] * [-1474.250] (-1472.070) (-1483.615) (-1475.429) -- 0:03:50
Average standard deviation of split frequencies: 0.012015
350500 -- (-1468.565) (-1471.262) [-1469.150] (-1483.763) * [-1465.854] (-1477.136) (-1476.408) (-1477.238) -- 0:03:51
351000 -- (-1474.524) [-1466.326] (-1473.689) (-1472.459) * (-1475.697) [-1474.174] (-1474.435) (-1476.301) -- 0:03:51
351500 -- [-1470.641] (-1474.153) (-1482.088) (-1480.510) * [-1473.683] (-1473.997) (-1478.218) (-1481.576) -- 0:03:50
352000 -- (-1485.409) (-1469.710) [-1477.955] (-1470.182) * (-1476.224) (-1474.720) [-1473.980] (-1468.711) -- 0:03:50
352500 -- (-1480.557) [-1471.112] (-1476.010) (-1476.124) * (-1470.450) (-1475.101) (-1480.308) [-1467.246] -- 0:03:49
353000 -- (-1474.897) [-1472.065] (-1470.970) (-1470.917) * (-1482.032) [-1474.005] (-1471.102) (-1483.548) -- 0:03:50
353500 -- (-1479.189) (-1479.148) (-1477.442) [-1462.714] * (-1472.902) (-1476.099) (-1469.680) [-1479.761] -- 0:03:50
354000 -- (-1474.496) (-1473.055) [-1474.852] (-1476.746) * (-1470.549) (-1469.871) (-1483.390) [-1470.777] -- 0:03:49
354500 -- (-1473.162) [-1474.226] (-1478.170) (-1473.009) * (-1470.722) (-1473.398) (-1481.886) [-1474.260] -- 0:03:49
355000 -- (-1464.924) [-1473.960] (-1474.650) (-1468.812) * (-1481.750) [-1473.897] (-1469.416) (-1475.719) -- 0:03:48
Average standard deviation of split frequencies: 0.011421
355500 -- (-1471.234) (-1477.489) (-1479.693) [-1469.605] * (-1475.836) (-1470.552) (-1471.789) [-1467.223] -- 0:03:48
356000 -- (-1473.176) (-1474.018) (-1472.974) [-1465.418] * (-1469.040) (-1479.233) (-1469.729) [-1467.895] -- 0:03:49
356500 -- (-1470.055) (-1467.830) [-1473.333] (-1470.814) * (-1469.070) (-1470.311) [-1480.814] (-1469.512) -- 0:03:49
357000 -- (-1471.522) (-1471.571) [-1470.457] (-1470.522) * [-1472.495] (-1469.989) (-1470.299) (-1481.687) -- 0:03:48
357500 -- (-1471.583) (-1473.548) [-1466.351] (-1472.159) * (-1471.367) (-1473.271) [-1464.735] (-1476.843) -- 0:03:48
358000 -- (-1472.125) (-1478.925) (-1493.206) [-1470.171] * (-1469.292) (-1467.136) [-1475.721] (-1481.921) -- 0:03:47
358500 -- [-1471.345] (-1485.140) (-1482.872) (-1464.586) * (-1471.027) (-1479.391) [-1472.353] (-1474.895) -- 0:03:47
359000 -- [-1470.762] (-1476.114) (-1470.988) (-1476.162) * (-1469.493) (-1472.691) [-1476.996] (-1479.621) -- 0:03:48
359500 -- (-1488.200) [-1469.825] (-1471.958) (-1474.313) * (-1475.541) (-1479.622) [-1468.412] (-1471.875) -- 0:03:48
360000 -- (-1469.693) (-1473.475) (-1470.427) [-1469.143] * [-1475.290] (-1489.991) (-1475.331) (-1471.463) -- 0:03:47
Average standard deviation of split frequencies: 0.011028
360500 -- [-1463.940] (-1474.644) (-1474.106) (-1476.144) * [-1475.677] (-1473.595) (-1472.037) (-1473.526) -- 0:03:47
361000 -- (-1467.605) (-1472.161) [-1467.645] (-1474.202) * [-1472.973] (-1475.390) (-1473.523) (-1479.044) -- 0:03:46
361500 -- (-1472.114) (-1467.493) (-1471.114) [-1481.565] * (-1467.734) (-1476.986) (-1476.706) [-1466.944] -- 0:03:47
362000 -- (-1469.903) (-1480.572) (-1474.945) [-1473.483] * (-1465.811) [-1470.542] (-1503.046) (-1475.169) -- 0:03:47
362500 -- (-1465.546) [-1469.052] (-1475.198) (-1488.898) * (-1478.105) (-1471.852) (-1485.297) [-1468.544] -- 0:03:46
363000 -- (-1480.877) [-1469.097] (-1476.925) (-1471.276) * (-1473.526) (-1470.675) [-1469.151] (-1478.971) -- 0:03:46
363500 -- (-1471.858) (-1466.255) (-1467.161) [-1463.505] * (-1474.462) [-1470.131] (-1475.571) (-1490.692) -- 0:03:45
364000 -- (-1467.601) (-1478.603) [-1469.423] (-1470.586) * [-1472.203] (-1466.967) (-1477.181) (-1476.524) -- 0:03:45
364500 -- (-1469.807) (-1490.107) (-1482.809) [-1477.746] * (-1474.714) (-1473.264) [-1479.009] (-1475.756) -- 0:03:46
365000 -- (-1468.382) (-1474.213) [-1468.088] (-1481.303) * [-1474.508] (-1474.755) (-1472.404) (-1478.902) -- 0:03:46
Average standard deviation of split frequencies: 0.011592
365500 -- (-1471.954) [-1476.666] (-1471.275) (-1480.663) * (-1476.261) (-1481.304) [-1468.184] (-1477.722) -- 0:03:45
366000 -- [-1469.709] (-1475.508) (-1469.820) (-1476.871) * (-1475.541) (-1481.263) [-1472.040] (-1476.749) -- 0:03:45
366500 -- (-1470.155) [-1477.556] (-1473.800) (-1478.774) * [-1468.819] (-1481.947) (-1480.277) (-1474.513) -- 0:03:44
367000 -- [-1477.189] (-1471.638) (-1477.170) (-1469.022) * (-1476.454) [-1475.062] (-1474.159) (-1468.798) -- 0:03:44
367500 -- (-1472.040) (-1477.556) [-1473.896] (-1479.700) * (-1472.781) [-1464.741] (-1471.443) (-1475.842) -- 0:03:45
368000 -- (-1476.344) [-1467.804] (-1472.702) (-1473.042) * (-1473.614) [-1464.648] (-1478.549) (-1476.296) -- 0:03:44
368500 -- (-1470.372) [-1466.739] (-1477.352) (-1478.070) * (-1478.154) (-1473.390) [-1475.071] (-1481.333) -- 0:03:44
369000 -- (-1467.966) (-1475.288) (-1472.592) [-1468.830] * [-1471.175] (-1473.429) (-1483.809) (-1468.543) -- 0:03:44
369500 -- [-1472.762] (-1486.226) (-1480.003) (-1487.683) * (-1472.949) (-1465.577) (-1478.428) [-1468.034] -- 0:03:43
370000 -- (-1464.783) (-1468.362) (-1473.100) [-1472.101] * (-1479.396) (-1473.811) [-1467.143] (-1483.026) -- 0:03:43
Average standard deviation of split frequencies: 0.011128
370500 -- (-1468.848) [-1471.386] (-1479.403) (-1478.432) * (-1474.459) (-1469.776) (-1476.976) [-1470.050] -- 0:03:44
371000 -- [-1467.692] (-1471.443) (-1478.745) (-1470.084) * (-1476.195) (-1470.444) (-1470.829) [-1472.958] -- 0:03:43
371500 -- [-1475.032] (-1473.028) (-1475.908) (-1472.305) * (-1470.222) (-1482.307) [-1469.005] (-1477.621) -- 0:03:43
372000 -- [-1480.378] (-1470.585) (-1483.515) (-1474.710) * [-1464.915] (-1479.765) (-1468.561) (-1476.415) -- 0:03:42
372500 -- (-1475.595) (-1476.027) [-1476.001] (-1468.360) * [-1476.282] (-1486.998) (-1470.000) (-1472.576) -- 0:03:42
373000 -- (-1479.344) [-1471.910] (-1477.141) (-1474.752) * [-1474.458] (-1468.686) (-1470.640) (-1476.138) -- 0:03:43
373500 -- (-1476.694) (-1469.974) [-1474.977] (-1477.129) * (-1483.142) (-1469.449) [-1471.535] (-1482.858) -- 0:03:43
374000 -- (-1467.897) (-1481.048) (-1476.112) [-1470.108] * [-1467.056] (-1472.726) (-1478.217) (-1482.270) -- 0:03:42
374500 -- (-1466.248) (-1481.058) (-1484.979) [-1469.148] * (-1471.505) [-1475.672] (-1483.301) (-1477.155) -- 0:03:42
375000 -- (-1468.981) [-1476.926] (-1475.754) (-1473.594) * [-1468.249] (-1475.843) (-1478.979) (-1472.859) -- 0:03:41
Average standard deviation of split frequencies: 0.010892
375500 -- [-1469.740] (-1471.680) (-1476.269) (-1475.783) * (-1477.956) (-1467.713) (-1478.255) [-1468.641] -- 0:03:41
376000 -- [-1474.042] (-1475.162) (-1481.781) (-1472.975) * (-1474.081) (-1462.872) [-1469.789] (-1466.038) -- 0:03:42
376500 -- (-1485.239) [-1464.335] (-1473.482) (-1474.864) * (-1482.321) (-1467.711) (-1466.187) [-1468.095] -- 0:03:41
377000 -- [-1470.072] (-1487.080) (-1473.121) (-1475.646) * (-1470.280) (-1468.154) (-1475.339) [-1468.141] -- 0:03:41
377500 -- (-1477.276) [-1468.158] (-1489.369) (-1476.836) * [-1480.217] (-1469.886) (-1478.833) (-1475.757) -- 0:03:40
378000 -- (-1470.174) [-1472.048] (-1475.208) (-1480.894) * (-1475.866) [-1471.301] (-1480.390) (-1469.406) -- 0:03:40
378500 -- (-1474.688) (-1476.768) [-1473.560] (-1482.949) * (-1469.726) [-1471.103] (-1480.200) (-1477.294) -- 0:03:40
379000 -- [-1472.008] (-1471.030) (-1470.848) (-1482.624) * (-1480.372) (-1471.690) [-1469.552] (-1469.324) -- 0:03:41
379500 -- (-1471.978) [-1471.446] (-1466.801) (-1477.780) * (-1470.603) (-1475.511) (-1467.746) [-1464.266] -- 0:03:40
380000 -- (-1473.631) (-1484.249) (-1468.735) [-1474.920] * (-1474.458) [-1468.295] (-1472.242) (-1476.812) -- 0:03:40
Average standard deviation of split frequencies: 0.010758
380500 -- (-1482.000) (-1476.919) [-1470.655] (-1474.293) * (-1470.574) (-1478.400) [-1473.763] (-1473.716) -- 0:03:39
381000 -- (-1471.468) [-1469.071] (-1474.575) (-1471.551) * (-1473.054) (-1471.752) (-1472.904) [-1476.159] -- 0:03:39
381500 -- [-1472.640] (-1467.382) (-1475.115) (-1467.994) * (-1473.470) (-1472.400) [-1475.076] (-1479.274) -- 0:03:40
382000 -- (-1477.218) [-1469.350] (-1469.687) (-1471.384) * (-1466.117) [-1472.278] (-1468.520) (-1467.291) -- 0:03:40
382500 -- (-1475.946) [-1474.513] (-1471.743) (-1485.868) * (-1471.942) (-1473.556) (-1479.504) [-1469.683] -- 0:03:39
383000 -- [-1472.222] (-1471.595) (-1474.265) (-1484.749) * (-1468.472) [-1475.780] (-1481.659) (-1472.255) -- 0:03:39
383500 -- (-1485.458) [-1466.508] (-1466.451) (-1472.887) * (-1467.762) (-1477.256) (-1474.819) [-1470.673] -- 0:03:38
384000 -- (-1490.368) (-1464.441) [-1474.433] (-1480.056) * (-1481.077) [-1468.311] (-1476.055) (-1470.478) -- 0:03:38
384500 -- (-1471.517) (-1485.865) [-1466.573] (-1471.890) * (-1467.132) (-1482.459) [-1469.966] (-1481.057) -- 0:03:39
385000 -- (-1472.865) [-1471.569] (-1471.723) (-1470.339) * (-1467.211) (-1469.658) (-1472.413) [-1464.024] -- 0:03:38
Average standard deviation of split frequencies: 0.010762
385500 -- [-1479.103] (-1472.248) (-1468.470) (-1471.918) * [-1466.657] (-1475.869) (-1481.752) (-1464.341) -- 0:03:38
386000 -- [-1468.724] (-1466.147) (-1480.941) (-1476.794) * (-1472.762) [-1478.257] (-1477.906) (-1478.907) -- 0:03:37
386500 -- (-1475.631) (-1472.699) (-1471.907) [-1478.671] * (-1470.484) (-1476.525) [-1476.248] (-1474.745) -- 0:03:37
387000 -- (-1473.305) (-1468.695) [-1465.243] (-1486.275) * (-1475.425) (-1478.505) [-1468.127] (-1472.051) -- 0:03:38
387500 -- (-1476.688) (-1475.349) (-1465.649) [-1468.260] * (-1475.853) [-1469.542] (-1464.668) (-1471.327) -- 0:03:38
388000 -- (-1466.374) [-1466.881] (-1468.431) (-1472.311) * (-1467.975) (-1476.842) [-1466.185] (-1467.993) -- 0:03:37
388500 -- [-1467.131] (-1469.522) (-1474.003) (-1468.469) * (-1467.795) (-1468.828) [-1465.204] (-1465.617) -- 0:03:37
389000 -- (-1470.809) [-1467.813] (-1480.240) (-1471.042) * (-1475.567) (-1476.133) (-1469.510) [-1468.249] -- 0:03:36
389500 -- (-1469.785) (-1480.838) [-1473.863] (-1468.300) * (-1471.178) (-1466.919) (-1473.839) [-1474.181] -- 0:03:36
390000 -- (-1482.831) (-1471.236) [-1475.373] (-1475.913) * [-1463.304] (-1470.503) (-1473.104) (-1473.362) -- 0:03:37
Average standard deviation of split frequencies: 0.010257
390500 -- (-1469.032) (-1473.685) (-1472.886) [-1472.155] * [-1472.789] (-1473.622) (-1465.021) (-1472.081) -- 0:03:36
391000 -- (-1466.087) (-1483.719) [-1477.275] (-1470.210) * [-1471.069] (-1469.672) (-1478.662) (-1469.719) -- 0:03:36
391500 -- (-1464.834) [-1471.756] (-1475.689) (-1466.668) * (-1466.680) (-1476.361) (-1468.591) [-1466.833] -- 0:03:36
392000 -- (-1474.075) (-1470.970) [-1468.954] (-1467.711) * [-1466.065] (-1472.769) (-1475.962) (-1469.541) -- 0:03:35
392500 -- [-1469.713] (-1469.090) (-1473.218) (-1469.446) * (-1471.001) (-1484.000) (-1475.751) [-1471.141] -- 0:03:35
393000 -- (-1477.856) (-1481.508) [-1469.156] (-1471.731) * (-1471.221) (-1475.758) (-1470.952) [-1477.310] -- 0:03:36
393500 -- (-1473.908) [-1471.958] (-1466.884) (-1480.186) * (-1482.203) (-1472.807) [-1475.009] (-1464.937) -- 0:03:35
394000 -- (-1474.243) (-1467.492) [-1473.195] (-1469.408) * (-1473.033) (-1469.166) (-1469.525) [-1478.856] -- 0:03:35
394500 -- (-1471.023) (-1476.969) (-1467.919) [-1469.819] * (-1470.120) (-1485.244) [-1470.824] (-1475.006) -- 0:03:34
395000 -- (-1468.925) [-1480.309] (-1469.385) (-1470.812) * (-1470.238) (-1479.240) [-1473.803] (-1465.834) -- 0:03:34
Average standard deviation of split frequencies: 0.009970
395500 -- [-1475.034] (-1479.253) (-1469.620) (-1474.302) * (-1484.935) (-1474.242) (-1474.791) [-1471.214] -- 0:03:35
396000 -- (-1466.907) [-1466.969] (-1482.184) (-1481.147) * (-1471.515) (-1477.741) (-1467.971) [-1469.385] -- 0:03:35
396500 -- (-1482.966) (-1482.887) [-1477.292] (-1484.838) * (-1477.034) [-1467.831] (-1473.309) (-1472.006) -- 0:03:34
397000 -- (-1473.225) (-1474.754) (-1480.176) [-1470.766] * [-1471.155] (-1475.660) (-1467.060) (-1481.743) -- 0:03:34
397500 -- (-1474.902) (-1474.238) [-1473.320] (-1468.185) * (-1477.369) [-1468.490] (-1482.662) (-1477.304) -- 0:03:33
398000 -- (-1467.567) (-1469.521) (-1477.178) [-1470.015] * (-1471.855) (-1482.025) (-1493.599) [-1471.724] -- 0:03:33
398500 -- (-1475.521) (-1463.865) (-1477.855) [-1472.813] * [-1466.913] (-1481.777) (-1478.743) (-1475.842) -- 0:03:34
399000 -- (-1474.976) [-1470.722] (-1471.781) (-1476.913) * (-1470.753) [-1471.182] (-1473.800) (-1475.242) -- 0:03:33
399500 -- (-1469.497) (-1472.491) (-1475.228) [-1484.450] * [-1471.960] (-1473.129) (-1478.860) (-1478.593) -- 0:03:33
400000 -- (-1479.191) (-1465.692) [-1468.606] (-1483.084) * [-1478.216] (-1472.651) (-1479.726) (-1480.952) -- 0:03:33
Average standard deviation of split frequencies: 0.010442
400500 -- (-1467.581) [-1465.078] (-1471.411) (-1474.595) * (-1479.064) [-1472.054] (-1470.050) (-1482.393) -- 0:03:32
401000 -- (-1479.869) (-1475.930) [-1472.376] (-1475.574) * (-1469.810) [-1471.979] (-1472.367) (-1473.227) -- 0:03:32
401500 -- (-1468.678) (-1478.219) (-1488.986) [-1469.755] * (-1473.724) (-1467.162) (-1481.224) [-1480.175] -- 0:03:33
402000 -- [-1480.677] (-1476.141) (-1493.158) (-1475.732) * (-1471.917) [-1467.846] (-1471.799) (-1476.895) -- 0:03:32
402500 -- [-1469.549] (-1475.554) (-1483.393) (-1471.656) * (-1479.919) (-1469.552) [-1468.467] (-1477.048) -- 0:03:32
403000 -- (-1472.550) (-1472.648) [-1470.237] (-1480.830) * (-1470.702) (-1473.598) (-1477.247) [-1464.383] -- 0:03:31
403500 -- [-1474.593] (-1472.923) (-1474.981) (-1477.963) * (-1472.365) [-1473.678] (-1478.947) (-1470.026) -- 0:03:31
404000 -- [-1471.549] (-1480.455) (-1473.796) (-1484.973) * [-1473.893] (-1472.731) (-1477.705) (-1467.055) -- 0:03:32
404500 -- [-1471.172] (-1471.087) (-1482.409) (-1482.111) * (-1470.092) (-1471.974) (-1477.077) [-1467.794] -- 0:03:31
405000 -- [-1473.786] (-1479.691) (-1487.143) (-1473.577) * (-1471.668) (-1465.397) (-1468.467) [-1465.982] -- 0:03:31
Average standard deviation of split frequencies: 0.010668
405500 -- (-1467.628) (-1481.448) [-1470.590] (-1476.195) * (-1471.785) [-1472.199] (-1472.717) (-1473.714) -- 0:03:31
406000 -- (-1471.131) (-1472.530) [-1468.609] (-1471.469) * (-1474.082) (-1470.213) [-1473.036] (-1478.037) -- 0:03:30
406500 -- [-1466.634] (-1473.977) (-1473.224) (-1468.159) * [-1468.201] (-1470.746) (-1484.033) (-1476.750) -- 0:03:30
407000 -- [-1475.379] (-1477.632) (-1476.964) (-1470.606) * (-1478.324) (-1471.740) (-1476.113) [-1468.756] -- 0:03:31
407500 -- [-1466.464] (-1467.758) (-1476.725) (-1471.126) * (-1478.836) [-1476.847] (-1479.286) (-1472.153) -- 0:03:30
408000 -- (-1480.354) [-1471.907] (-1465.761) (-1483.789) * [-1469.252] (-1466.207) (-1475.915) (-1471.196) -- 0:03:30
408500 -- (-1470.568) (-1464.785) (-1485.860) [-1469.276] * (-1479.789) (-1469.605) [-1471.104] (-1474.168) -- 0:03:29
409000 -- [-1468.127] (-1473.371) (-1485.704) (-1476.786) * (-1481.201) (-1464.440) [-1475.354] (-1478.296) -- 0:03:29
409500 -- (-1477.830) (-1467.761) (-1476.755) [-1475.474] * [-1475.398] (-1465.373) (-1472.650) (-1469.965) -- 0:03:30
410000 -- (-1478.910) [-1469.013] (-1472.786) (-1469.677) * [-1466.479] (-1465.836) (-1470.764) (-1470.387) -- 0:03:30
Average standard deviation of split frequencies: 0.009757
410500 -- [-1462.492] (-1470.951) (-1475.402) (-1475.012) * (-1469.800) (-1476.403) (-1471.950) [-1470.279] -- 0:03:29
411000 -- [-1473.713] (-1474.884) (-1481.084) (-1474.214) * [-1467.650] (-1465.990) (-1482.403) (-1466.639) -- 0:03:29
411500 -- (-1472.481) (-1469.043) (-1483.729) [-1473.288] * (-1484.529) (-1465.772) (-1479.974) [-1477.163] -- 0:03:28
412000 -- (-1467.731) [-1462.730] (-1472.240) (-1479.855) * (-1478.909) [-1472.360] (-1468.898) (-1472.537) -- 0:03:28
412500 -- (-1489.034) (-1468.830) [-1473.371] (-1477.244) * (-1467.429) (-1472.790) (-1465.442) [-1467.499] -- 0:03:29
413000 -- (-1487.127) (-1479.491) [-1465.148] (-1470.031) * [-1470.771] (-1474.868) (-1465.420) (-1485.302) -- 0:03:28
413500 -- (-1477.463) (-1468.372) [-1468.597] (-1471.760) * (-1469.212) [-1475.017] (-1474.193) (-1466.131) -- 0:03:28
414000 -- [-1472.145] (-1481.802) (-1472.494) (-1475.391) * (-1469.216) [-1473.657] (-1471.688) (-1467.495) -- 0:03:28
414500 -- (-1465.026) [-1473.737] (-1467.321) (-1475.314) * (-1470.304) [-1472.204] (-1471.815) (-1471.265) -- 0:03:27
415000 -- (-1471.191) (-1467.445) [-1474.828] (-1475.245) * [-1471.658] (-1470.636) (-1487.767) (-1474.830) -- 0:03:27
Average standard deviation of split frequencies: 0.008995
415500 -- [-1468.200] (-1470.053) (-1473.327) (-1478.216) * (-1474.006) (-1468.557) (-1474.599) [-1468.979] -- 0:03:28
416000 -- (-1474.786) (-1463.347) [-1471.478] (-1473.477) * (-1478.760) [-1474.497] (-1473.654) (-1465.286) -- 0:03:27
416500 -- [-1474.185] (-1476.392) (-1472.244) (-1470.039) * (-1473.412) [-1470.990] (-1469.738) (-1474.817) -- 0:03:27
417000 -- (-1479.051) (-1470.799) [-1462.127] (-1470.778) * (-1473.872) (-1482.846) [-1470.377] (-1472.488) -- 0:03:26
417500 -- (-1474.008) (-1473.412) (-1467.273) [-1474.213] * (-1481.815) (-1471.337) (-1479.026) [-1474.494] -- 0:03:26
418000 -- (-1471.276) [-1472.023] (-1466.598) (-1474.176) * (-1478.876) (-1470.861) [-1468.769] (-1491.609) -- 0:03:27
418500 -- (-1473.319) (-1468.881) [-1475.042] (-1480.130) * (-1476.224) [-1466.953] (-1465.658) (-1478.242) -- 0:03:27
419000 -- [-1470.860] (-1469.225) (-1488.658) (-1481.749) * (-1482.386) [-1469.494] (-1470.925) (-1471.883) -- 0:03:26
419500 -- (-1468.816) (-1470.942) [-1468.082] (-1475.962) * [-1477.931] (-1478.197) (-1467.571) (-1471.121) -- 0:03:26
420000 -- [-1470.608] (-1473.725) (-1482.446) (-1468.556) * (-1468.986) (-1470.113) (-1474.123) [-1469.058] -- 0:03:25
Average standard deviation of split frequencies: 0.009105
420500 -- [-1471.704] (-1476.121) (-1483.043) (-1475.802) * (-1470.661) (-1470.372) (-1477.207) [-1469.324] -- 0:03:25
421000 -- [-1470.551] (-1475.437) (-1471.614) (-1469.232) * (-1481.916) [-1469.061] (-1476.777) (-1477.032) -- 0:03:26
421500 -- (-1491.897) [-1476.273] (-1478.883) (-1465.433) * [-1470.835] (-1471.576) (-1479.151) (-1474.863) -- 0:03:25
422000 -- (-1475.557) [-1469.955] (-1481.070) (-1477.966) * (-1476.535) [-1467.365] (-1469.830) (-1481.413) -- 0:03:25
422500 -- (-1471.980) [-1473.706] (-1472.216) (-1473.760) * (-1474.963) (-1474.298) (-1475.665) [-1477.705] -- 0:03:25
423000 -- [-1472.088] (-1472.691) (-1478.834) (-1477.413) * [-1475.393] (-1470.755) (-1475.700) (-1476.297) -- 0:03:24
423500 -- (-1467.020) (-1471.040) [-1469.183] (-1479.421) * (-1486.788) (-1474.810) (-1479.908) [-1466.025] -- 0:03:24
424000 -- [-1466.961] (-1471.493) (-1470.841) (-1496.929) * (-1476.515) (-1476.657) (-1465.985) [-1471.026] -- 0:03:25
424500 -- [-1463.334] (-1471.005) (-1471.635) (-1470.154) * (-1483.097) [-1466.887] (-1462.782) (-1474.907) -- 0:03:24
425000 -- (-1470.162) (-1468.836) [-1467.805] (-1477.643) * (-1478.019) (-1473.173) (-1472.188) [-1476.765] -- 0:03:24
Average standard deviation of split frequencies: 0.009268
425500 -- (-1474.997) (-1478.520) (-1480.057) [-1473.566] * [-1466.187] (-1473.332) (-1477.120) (-1473.042) -- 0:03:23
426000 -- [-1471.858] (-1483.436) (-1487.510) (-1477.593) * [-1479.026] (-1471.784) (-1473.053) (-1480.537) -- 0:03:23
426500 -- (-1479.426) [-1477.649] (-1481.274) (-1479.630) * (-1474.166) (-1470.048) (-1475.210) [-1474.166] -- 0:03:24
427000 -- (-1477.081) (-1480.221) (-1482.897) [-1470.501] * (-1475.453) (-1473.097) [-1467.326] (-1471.695) -- 0:03:23
427500 -- (-1477.390) [-1472.659] (-1488.727) (-1485.821) * (-1469.692) (-1466.321) (-1484.146) [-1465.853] -- 0:03:23
428000 -- [-1468.052] (-1469.233) (-1476.949) (-1489.580) * (-1471.680) (-1472.014) (-1475.116) [-1464.686] -- 0:03:23
428500 -- (-1475.901) [-1471.010] (-1475.106) (-1489.751) * (-1471.073) [-1468.776] (-1475.680) (-1468.851) -- 0:03:22
429000 -- [-1474.770] (-1482.613) (-1473.165) (-1470.034) * [-1464.339] (-1468.304) (-1470.955) (-1475.650) -- 0:03:22
429500 -- (-1479.682) (-1478.574) [-1471.840] (-1473.277) * (-1474.491) (-1469.759) [-1470.565] (-1475.685) -- 0:03:23
430000 -- (-1474.556) (-1486.561) [-1469.257] (-1474.424) * (-1473.127) [-1470.424] (-1468.422) (-1475.996) -- 0:03:22
Average standard deviation of split frequencies: 0.009441
430500 -- (-1477.364) (-1473.553) (-1470.308) [-1464.523] * (-1467.771) (-1472.708) (-1481.245) [-1475.344] -- 0:03:22
431000 -- (-1471.358) (-1472.836) (-1475.701) [-1466.314] * [-1464.148] (-1472.332) (-1477.128) (-1474.372) -- 0:03:21
431500 -- (-1475.358) (-1467.443) [-1472.469] (-1474.252) * (-1473.461) (-1473.282) [-1470.270] (-1474.570) -- 0:03:21
432000 -- (-1471.875) (-1474.606) [-1468.058] (-1464.609) * (-1467.224) [-1466.601] (-1481.436) (-1496.058) -- 0:03:21
432500 -- (-1480.734) (-1472.235) [-1474.501] (-1479.704) * [-1465.508] (-1469.865) (-1473.597) (-1479.122) -- 0:03:22
433000 -- (-1479.028) (-1468.214) [-1475.749] (-1475.069) * (-1473.612) (-1478.818) (-1472.780) [-1475.914] -- 0:03:21
433500 -- [-1470.221] (-1474.976) (-1473.012) (-1469.407) * (-1481.346) [-1472.879] (-1469.696) (-1472.512) -- 0:03:21
434000 -- (-1473.636) (-1469.543) (-1473.592) [-1466.868] * (-1470.982) (-1468.178) (-1464.408) [-1471.099] -- 0:03:20
434500 -- [-1473.959] (-1473.440) (-1471.788) (-1475.749) * (-1474.655) (-1479.258) [-1466.928] (-1470.236) -- 0:03:20
435000 -- (-1483.054) [-1470.145] (-1474.088) (-1472.052) * (-1472.912) [-1468.360] (-1481.609) (-1471.179) -- 0:03:21
Average standard deviation of split frequencies: 0.009866
435500 -- (-1477.983) (-1474.076) (-1474.500) [-1470.639] * (-1480.511) (-1469.427) (-1476.577) [-1471.828] -- 0:03:20
436000 -- (-1486.643) (-1471.709) (-1471.287) [-1467.385] * (-1478.191) [-1471.798] (-1475.856) (-1467.694) -- 0:03:20
436500 -- [-1471.589] (-1470.511) (-1496.361) (-1476.363) * (-1469.969) [-1473.096] (-1471.173) (-1470.618) -- 0:03:20
437000 -- (-1480.089) [-1470.111] (-1476.327) (-1472.895) * [-1468.918] (-1477.687) (-1480.197) (-1477.847) -- 0:03:19
437500 -- (-1479.247) [-1480.238] (-1484.396) (-1471.605) * (-1468.619) (-1472.498) [-1471.340] (-1474.668) -- 0:03:19
438000 -- (-1478.908) (-1466.621) [-1466.910] (-1471.879) * (-1476.792) (-1469.077) (-1470.371) [-1476.333] -- 0:03:20
438500 -- [-1475.778] (-1471.074) (-1475.594) (-1476.455) * (-1472.445) [-1467.802] (-1482.372) (-1471.544) -- 0:03:19
439000 -- [-1475.949] (-1472.170) (-1478.883) (-1473.914) * [-1465.496] (-1473.661) (-1481.035) (-1476.121) -- 0:03:19
439500 -- (-1476.946) (-1473.296) (-1471.974) [-1481.518] * [-1468.640] (-1476.743) (-1474.717) (-1486.188) -- 0:03:18
440000 -- (-1474.982) [-1468.802] (-1471.470) (-1485.655) * [-1472.806] (-1476.357) (-1476.194) (-1480.853) -- 0:03:18
Average standard deviation of split frequencies: 0.010363
440500 -- (-1469.546) (-1468.473) [-1466.448] (-1472.028) * (-1467.851) (-1477.293) (-1475.975) [-1469.488] -- 0:03:18
441000 -- (-1479.287) (-1476.644) [-1474.001] (-1468.094) * (-1472.504) (-1470.891) (-1477.053) [-1467.175] -- 0:03:19
441500 -- [-1480.865] (-1473.043) (-1478.826) (-1473.729) * (-1479.708) [-1476.720] (-1477.239) (-1480.047) -- 0:03:18
442000 -- (-1480.967) [-1475.063] (-1464.128) (-1473.186) * (-1480.130) (-1474.014) (-1479.388) [-1473.439] -- 0:03:18
442500 -- (-1482.154) (-1481.047) [-1470.260] (-1468.933) * (-1485.245) [-1471.394] (-1480.182) (-1484.764) -- 0:03:17
443000 -- (-1481.874) [-1468.916] (-1473.986) (-1466.887) * (-1465.420) (-1470.143) [-1480.366] (-1480.843) -- 0:03:17
443500 -- [-1472.457] (-1475.167) (-1480.456) (-1467.645) * (-1476.249) (-1473.609) [-1479.893] (-1473.786) -- 0:03:18
444000 -- (-1475.813) (-1474.007) (-1481.371) [-1466.965] * [-1468.800] (-1465.091) (-1482.772) (-1469.769) -- 0:03:17
444500 -- [-1465.657] (-1467.066) (-1483.443) (-1474.184) * (-1476.383) [-1473.344] (-1471.221) (-1477.097) -- 0:03:17
445000 -- (-1476.013) [-1467.693] (-1477.097) (-1477.138) * (-1475.903) [-1476.956] (-1475.840) (-1477.036) -- 0:03:17
Average standard deviation of split frequencies: 0.009381
445500 -- (-1476.420) (-1474.289) [-1467.300] (-1466.886) * (-1475.769) (-1470.998) [-1469.425] (-1474.172) -- 0:03:16
446000 -- (-1469.171) (-1478.795) [-1478.542] (-1483.731) * (-1475.574) (-1477.936) (-1467.041) [-1469.392] -- 0:03:16
446500 -- (-1476.872) (-1476.936) (-1468.793) [-1474.353] * [-1470.299] (-1474.073) (-1476.030) (-1471.891) -- 0:03:17
447000 -- (-1483.920) (-1467.203) [-1464.576] (-1478.425) * (-1474.517) (-1473.019) [-1467.501] (-1474.447) -- 0:03:16
447500 -- (-1468.836) [-1466.317] (-1467.653) (-1472.610) * [-1471.563] (-1470.701) (-1478.006) (-1469.889) -- 0:03:16
448000 -- (-1475.273) (-1481.528) [-1468.511] (-1473.431) * [-1470.946] (-1465.915) (-1475.754) (-1481.051) -- 0:03:15
448500 -- (-1473.526) (-1471.784) [-1470.326] (-1477.994) * [-1477.012] (-1472.201) (-1472.702) (-1477.737) -- 0:03:15
449000 -- (-1475.357) [-1471.773] (-1471.944) (-1479.553) * (-1475.817) [-1465.069] (-1478.049) (-1487.214) -- 0:03:15
449500 -- (-1469.051) [-1467.445] (-1478.404) (-1476.428) * (-1469.524) [-1468.334] (-1476.189) (-1475.821) -- 0:03:15
450000 -- (-1474.605) [-1469.062] (-1470.479) (-1478.955) * [-1466.006] (-1471.990) (-1471.383) (-1468.452) -- 0:03:15
Average standard deviation of split frequencies: 0.009087
450500 -- (-1470.252) (-1468.446) [-1472.630] (-1471.144) * [-1470.891] (-1474.342) (-1472.026) (-1474.727) -- 0:03:15
451000 -- [-1472.140] (-1474.132) (-1471.255) (-1474.104) * (-1469.255) (-1476.842) (-1469.746) [-1468.274] -- 0:03:14
451500 -- (-1475.539) (-1476.858) (-1473.546) [-1471.186] * [-1470.618] (-1465.085) (-1469.968) (-1473.260) -- 0:03:14
452000 -- (-1486.610) (-1481.488) (-1467.933) [-1472.677] * (-1482.370) (-1475.352) (-1472.812) [-1468.724] -- 0:03:15
452500 -- (-1470.841) (-1474.311) [-1469.732] (-1473.996) * (-1478.576) [-1477.294] (-1471.555) (-1475.000) -- 0:03:14
453000 -- (-1477.972) (-1473.803) (-1472.956) [-1480.231] * (-1476.034) (-1473.106) [-1481.432] (-1466.736) -- 0:03:14
453500 -- (-1481.476) [-1466.622] (-1476.733) (-1470.020) * (-1474.542) [-1471.554] (-1473.294) (-1466.782) -- 0:03:14
454000 -- [-1478.973] (-1478.442) (-1473.097) (-1474.189) * (-1479.863) [-1475.146] (-1475.596) (-1477.275) -- 0:03:13
454500 -- (-1482.985) [-1469.570] (-1472.610) (-1473.095) * (-1483.541) (-1480.006) [-1470.584] (-1479.008) -- 0:03:13
455000 -- (-1466.222) (-1471.923) (-1470.215) [-1465.708] * [-1468.774] (-1479.182) (-1469.729) (-1471.737) -- 0:03:14
Average standard deviation of split frequencies: 0.008335
455500 -- (-1466.217) (-1473.129) (-1468.581) [-1471.815] * [-1464.971] (-1476.365) (-1472.662) (-1476.244) -- 0:03:13
456000 -- (-1478.226) (-1476.818) [-1469.678] (-1474.861) * (-1469.488) (-1482.576) [-1475.034] (-1470.365) -- 0:03:13
456500 -- (-1479.105) [-1474.198] (-1475.873) (-1475.513) * (-1471.117) (-1471.027) (-1471.810) [-1472.670] -- 0:03:12
457000 -- [-1471.075] (-1476.874) (-1478.635) (-1477.335) * (-1483.896) (-1465.069) [-1462.079] (-1466.428) -- 0:03:12
457500 -- (-1477.731) [-1473.133] (-1482.486) (-1478.578) * (-1484.430) (-1467.905) [-1477.234] (-1476.746) -- 0:03:13
458000 -- [-1477.126] (-1475.622) (-1477.266) (-1475.562) * (-1477.972) [-1472.988] (-1469.780) (-1477.430) -- 0:03:12
458500 -- [-1463.735] (-1475.055) (-1470.316) (-1470.372) * (-1479.601) (-1469.944) [-1472.329] (-1470.626) -- 0:03:12
459000 -- [-1479.479] (-1477.779) (-1463.672) (-1475.129) * (-1477.596) (-1468.094) (-1476.565) [-1474.619] -- 0:03:12
459500 -- (-1485.008) [-1470.113] (-1479.170) (-1472.807) * (-1472.080) (-1473.193) (-1485.599) [-1473.969] -- 0:03:11
460000 -- (-1471.193) (-1471.443) (-1471.965) [-1471.346] * (-1468.613) (-1472.369) (-1472.640) [-1473.670] -- 0:03:11
Average standard deviation of split frequencies: 0.008442
460500 -- (-1462.235) (-1476.758) [-1462.272] (-1471.941) * (-1466.044) (-1482.644) [-1471.076] (-1468.821) -- 0:03:12
461000 -- [-1466.522] (-1472.289) (-1472.285) (-1475.093) * (-1474.588) (-1474.317) [-1471.223] (-1472.582) -- 0:03:11
461500 -- [-1462.579] (-1474.147) (-1468.257) (-1472.880) * (-1478.219) (-1470.216) [-1469.788] (-1469.741) -- 0:03:11
462000 -- [-1466.492] (-1473.646) (-1465.782) (-1476.292) * [-1483.113] (-1474.626) (-1465.103) (-1472.774) -- 0:03:10
462500 -- (-1469.698) (-1473.920) [-1471.216] (-1468.700) * (-1486.638) [-1471.318] (-1465.867) (-1484.647) -- 0:03:10
463000 -- (-1484.897) (-1476.012) (-1475.259) [-1473.603] * (-1484.053) (-1476.728) [-1469.505] (-1471.993) -- 0:03:11
463500 -- [-1469.325] (-1473.310) (-1473.583) (-1473.627) * (-1483.103) (-1477.129) (-1475.304) [-1467.695] -- 0:03:10
464000 -- [-1478.903] (-1476.568) (-1471.714) (-1473.022) * (-1475.031) (-1482.446) [-1473.777] (-1481.394) -- 0:03:10
464500 -- [-1469.395] (-1475.267) (-1468.787) (-1472.131) * (-1475.317) [-1473.496] (-1479.599) (-1480.889) -- 0:03:10
465000 -- (-1464.440) (-1473.234) [-1469.937] (-1475.495) * [-1469.127] (-1475.216) (-1477.372) (-1468.616) -- 0:03:09
Average standard deviation of split frequencies: 0.008156
465500 -- [-1473.166] (-1485.035) (-1477.977) (-1479.152) * (-1467.157) [-1469.083] (-1471.412) (-1475.846) -- 0:03:09
466000 -- (-1477.862) [-1468.538] (-1472.214) (-1471.441) * (-1472.096) (-1486.308) [-1474.820] (-1476.211) -- 0:03:10
466500 -- (-1473.635) [-1473.454] (-1467.624) (-1472.178) * (-1485.149) (-1475.367) [-1468.621] (-1474.467) -- 0:03:09
467000 -- (-1481.293) (-1473.114) (-1470.979) [-1470.071] * [-1472.621] (-1473.886) (-1487.490) (-1467.431) -- 0:03:09
467500 -- [-1474.938] (-1480.311) (-1467.029) (-1478.559) * (-1472.661) (-1478.715) (-1490.852) [-1472.818] -- 0:03:09
468000 -- [-1473.290] (-1471.899) (-1475.985) (-1474.017) * (-1477.917) [-1473.166] (-1469.094) (-1469.192) -- 0:03:08
468500 -- (-1483.263) (-1472.682) (-1482.812) [-1471.235] * (-1477.516) (-1475.832) [-1470.767] (-1469.491) -- 0:03:08
469000 -- (-1468.321) (-1475.342) (-1474.008) [-1473.306] * (-1476.033) (-1476.115) (-1466.724) [-1470.010] -- 0:03:09
469500 -- (-1481.007) [-1476.891] (-1466.266) (-1471.260) * (-1480.098) (-1462.394) [-1470.642] (-1473.308) -- 0:03:08
470000 -- (-1476.055) (-1467.092) [-1471.599] (-1472.940) * (-1476.914) (-1471.722) (-1478.900) [-1480.885] -- 0:03:08
Average standard deviation of split frequencies: 0.007887
470500 -- [-1476.026] (-1474.134) (-1472.058) (-1475.950) * (-1482.568) [-1473.855] (-1472.930) (-1475.435) -- 0:03:07
471000 -- (-1470.086) (-1471.751) (-1474.274) [-1473.338] * (-1487.836) [-1474.216] (-1472.727) (-1472.270) -- 0:03:07
471500 -- (-1466.193) (-1481.075) [-1468.277] (-1472.954) * [-1475.008] (-1484.646) (-1474.367) (-1472.583) -- 0:03:08
472000 -- (-1473.132) [-1471.211] (-1476.866) (-1469.563) * (-1475.189) (-1477.113) (-1471.602) [-1474.577] -- 0:03:07
472500 -- (-1480.146) (-1481.875) (-1462.795) [-1467.976] * (-1473.641) (-1473.082) [-1470.631] (-1471.856) -- 0:03:07
473000 -- [-1473.345] (-1475.450) (-1481.274) (-1468.491) * (-1473.016) [-1473.500] (-1472.267) (-1465.671) -- 0:03:07
473500 -- (-1467.459) [-1466.819] (-1485.889) (-1466.784) * [-1472.910] (-1471.752) (-1469.939) (-1472.685) -- 0:03:06
474000 -- (-1473.883) (-1468.194) (-1476.042) [-1475.811] * (-1474.168) [-1470.983] (-1484.111) (-1471.531) -- 0:03:06
474500 -- (-1469.640) [-1467.575] (-1478.943) (-1476.912) * (-1480.040) [-1468.061] (-1468.191) (-1473.403) -- 0:03:07
475000 -- (-1467.146) (-1469.424) (-1480.540) [-1471.824] * [-1466.265] (-1478.559) (-1482.443) (-1470.752) -- 0:03:06
Average standard deviation of split frequencies: 0.007613
475500 -- [-1473.054] (-1463.700) (-1478.494) (-1471.140) * (-1471.093) [-1472.232] (-1477.157) (-1481.553) -- 0:03:06
476000 -- (-1474.576) (-1473.312) [-1469.952] (-1469.716) * (-1469.120) (-1475.622) (-1479.733) [-1474.169] -- 0:03:06
476500 -- [-1469.138] (-1479.350) (-1470.449) (-1476.283) * (-1479.691) (-1474.037) [-1469.744] (-1480.186) -- 0:03:05
477000 -- (-1474.116) (-1478.840) [-1469.211] (-1471.987) * (-1487.724) [-1481.773] (-1473.860) (-1477.117) -- 0:03:06
477500 -- (-1464.232) (-1473.092) [-1476.250] (-1476.084) * (-1473.129) [-1472.554] (-1475.157) (-1478.752) -- 0:03:06
478000 -- (-1469.418) [-1468.614] (-1470.318) (-1472.705) * (-1469.893) (-1478.940) [-1467.581] (-1486.170) -- 0:03:05
478500 -- (-1483.475) (-1471.497) (-1474.012) [-1461.423] * (-1472.114) (-1471.714) (-1477.067) [-1477.548] -- 0:03:05
479000 -- [-1478.482] (-1481.866) (-1474.066) (-1470.946) * (-1472.877) (-1473.031) (-1470.019) [-1474.502] -- 0:03:04
479500 -- (-1474.878) [-1468.236] (-1477.700) (-1473.483) * (-1472.884) (-1470.374) (-1474.895) [-1469.526] -- 0:03:04
480000 -- (-1474.295) [-1468.154] (-1485.277) (-1472.983) * (-1476.790) [-1476.741] (-1470.621) (-1476.898) -- 0:03:05
Average standard deviation of split frequencies: 0.007723
480500 -- (-1472.374) [-1465.650] (-1465.085) (-1472.563) * (-1468.089) (-1471.466) (-1474.576) [-1471.106] -- 0:03:04
481000 -- (-1471.282) [-1483.793] (-1473.162) (-1470.762) * (-1474.657) (-1471.892) [-1468.534] (-1475.896) -- 0:03:04
481500 -- (-1480.339) (-1474.108) (-1470.938) [-1469.216] * (-1474.437) [-1468.326] (-1472.856) (-1473.429) -- 0:03:04
482000 -- (-1474.650) (-1469.859) [-1467.417] (-1469.440) * [-1470.903] (-1471.867) (-1474.209) (-1466.135) -- 0:03:03
482500 -- (-1479.043) (-1470.054) [-1477.363] (-1479.904) * (-1473.530) (-1474.532) (-1471.103) [-1472.737] -- 0:03:03
483000 -- [-1469.802] (-1475.305) (-1477.298) (-1474.390) * [-1474.623] (-1474.119) (-1488.153) (-1469.377) -- 0:03:04
483500 -- (-1479.220) (-1469.931) (-1477.234) [-1473.305] * (-1470.041) [-1476.026] (-1482.517) (-1462.823) -- 0:03:03
484000 -- (-1473.636) (-1489.301) (-1472.231) [-1470.840] * (-1475.891) (-1473.395) (-1483.707) [-1469.100] -- 0:03:03
484500 -- (-1463.280) (-1470.086) (-1468.643) [-1473.949] * (-1478.118) (-1470.172) (-1471.715) [-1477.784] -- 0:03:03
485000 -- (-1462.145) [-1477.140] (-1475.738) (-1477.435) * (-1475.526) (-1465.344) (-1473.843) [-1468.675] -- 0:03:02
Average standard deviation of split frequencies: 0.008851
485500 -- [-1465.208] (-1477.063) (-1478.556) (-1472.383) * (-1472.098) (-1470.203) (-1475.330) [-1468.944] -- 0:03:03
486000 -- (-1465.114) (-1467.650) (-1474.048) [-1472.797] * (-1478.800) (-1472.379) (-1473.395) [-1466.387] -- 0:03:02
486500 -- (-1479.003) (-1472.358) [-1473.192] (-1476.371) * (-1476.182) [-1471.282] (-1474.420) (-1471.842) -- 0:03:02
487000 -- (-1468.699) (-1475.367) [-1469.296] (-1468.862) * [-1470.662] (-1477.294) (-1479.973) (-1477.870) -- 0:03:02
487500 -- [-1475.169] (-1486.582) (-1475.267) (-1474.615) * [-1466.442] (-1477.449) (-1480.066) (-1472.941) -- 0:03:01
488000 -- [-1470.748] (-1475.179) (-1478.673) (-1475.353) * (-1470.100) (-1479.489) (-1481.796) [-1478.796] -- 0:03:01
488500 -- (-1484.489) (-1475.731) [-1474.050] (-1473.431) * (-1478.901) (-1473.146) (-1497.578) [-1467.092] -- 0:03:02
489000 -- [-1469.807] (-1464.418) (-1489.918) (-1465.717) * (-1478.298) [-1466.854] (-1473.234) (-1467.434) -- 0:03:01
489500 -- (-1473.328) [-1474.222] (-1484.651) (-1479.442) * (-1471.957) [-1469.077] (-1470.722) (-1473.510) -- 0:03:01
490000 -- (-1471.084) (-1480.864) [-1472.229] (-1471.789) * [-1471.695] (-1469.480) (-1480.360) (-1474.533) -- 0:03:01
Average standard deviation of split frequencies: 0.008527
490500 -- [-1471.946] (-1474.014) (-1475.828) (-1475.794) * (-1474.060) [-1468.960] (-1471.827) (-1467.983) -- 0:03:00
491000 -- (-1477.877) (-1479.640) [-1467.867] (-1465.982) * [-1472.996] (-1476.189) (-1471.841) (-1473.221) -- 0:03:00
491500 -- [-1468.623] (-1475.913) (-1468.649) (-1471.503) * [-1472.269] (-1465.290) (-1469.719) (-1485.888) -- 0:03:01
492000 -- [-1464.822] (-1472.096) (-1473.443) (-1467.473) * [-1470.797] (-1470.196) (-1471.586) (-1470.799) -- 0:03:00
492500 -- (-1471.870) (-1475.324) (-1480.549) [-1471.932] * (-1469.047) (-1471.787) (-1477.645) [-1469.131] -- 0:03:00
493000 -- (-1476.668) (-1473.030) [-1466.397] (-1482.365) * (-1476.282) (-1463.366) (-1472.215) [-1475.317] -- 0:02:59
493500 -- (-1481.775) [-1469.640] (-1474.329) (-1482.473) * (-1477.906) [-1463.478] (-1473.605) (-1484.067) -- 0:02:59
494000 -- (-1471.871) [-1473.449] (-1471.613) (-1470.659) * [-1480.337] (-1466.089) (-1476.220) (-1487.215) -- 0:03:00
494500 -- [-1473.291] (-1486.767) (-1473.784) (-1487.463) * (-1478.904) (-1472.060) (-1475.089) [-1472.377] -- 0:02:59
495000 -- (-1472.334) (-1485.954) [-1469.154] (-1473.640) * [-1474.403] (-1469.184) (-1468.687) (-1479.066) -- 0:02:59
Average standard deviation of split frequencies: 0.008970
495500 -- (-1476.246) (-1476.140) (-1466.476) [-1466.799] * (-1479.509) (-1474.998) [-1469.695] (-1466.921) -- 0:02:59
496000 -- (-1471.960) (-1469.488) (-1469.943) [-1464.813] * [-1468.227] (-1473.061) (-1473.209) (-1468.071) -- 0:02:58
496500 -- [-1480.100] (-1473.222) (-1474.991) (-1479.693) * [-1471.203] (-1471.465) (-1470.336) (-1470.107) -- 0:02:58
497000 -- (-1474.518) (-1470.761) [-1472.907] (-1470.891) * (-1474.363) (-1476.158) [-1470.125] (-1480.276) -- 0:02:59
497500 -- (-1475.508) (-1478.468) (-1472.002) [-1465.903] * (-1465.204) (-1474.877) [-1467.484] (-1476.756) -- 0:02:58
498000 -- (-1468.220) (-1472.132) (-1469.650) [-1468.863] * (-1473.619) (-1479.549) [-1479.160] (-1487.732) -- 0:02:58
498500 -- (-1471.230) (-1476.225) (-1472.980) [-1465.086] * (-1481.044) (-1471.587) [-1470.386] (-1475.418) -- 0:02:58
499000 -- (-1473.076) (-1481.704) (-1471.650) [-1477.295] * (-1481.845) [-1465.707] (-1476.050) (-1477.536) -- 0:02:57
499500 -- [-1477.250] (-1478.310) (-1483.412) (-1476.902) * (-1472.689) (-1469.106) [-1471.606] (-1483.005) -- 0:02:58
500000 -- (-1480.656) [-1471.718] (-1479.636) (-1474.807) * (-1476.789) [-1466.573] (-1476.539) (-1470.766) -- 0:02:58
Average standard deviation of split frequencies: 0.009121
500500 -- (-1489.058) (-1469.551) [-1478.684] (-1468.997) * (-1477.914) [-1463.982] (-1475.075) (-1479.588) -- 0:02:57
501000 -- (-1470.401) (-1475.824) [-1477.564] (-1470.452) * (-1469.519) [-1473.291] (-1470.137) (-1479.937) -- 0:02:57
501500 -- [-1468.650] (-1479.785) (-1467.946) (-1471.379) * (-1467.901) [-1472.128] (-1478.254) (-1474.877) -- 0:02:56
502000 -- (-1480.090) (-1477.961) (-1471.619) [-1475.112] * (-1470.851) (-1466.845) [-1472.248] (-1472.133) -- 0:02:56
502500 -- (-1470.326) (-1473.377) [-1470.759] (-1471.055) * [-1470.438] (-1465.350) (-1475.958) (-1472.401) -- 0:02:57
503000 -- (-1470.797) (-1467.044) (-1478.813) [-1475.747] * (-1477.366) (-1473.803) (-1469.101) [-1471.933] -- 0:02:56
503500 -- [-1470.794] (-1478.479) (-1475.228) (-1469.922) * (-1483.939) (-1470.491) [-1477.980] (-1479.905) -- 0:02:56
504000 -- [-1472.080] (-1474.734) (-1478.903) (-1471.685) * (-1476.015) (-1476.936) [-1476.483] (-1477.100) -- 0:02:56
504500 -- (-1475.316) (-1477.379) [-1471.714] (-1470.479) * (-1465.785) (-1478.149) [-1476.641] (-1476.544) -- 0:02:55
505000 -- (-1478.717) [-1470.120] (-1477.601) (-1473.469) * (-1474.673) (-1473.482) (-1471.969) [-1465.762] -- 0:02:55
Average standard deviation of split frequencies: 0.009258
505500 -- (-1468.595) (-1481.212) [-1474.448] (-1470.035) * (-1479.066) (-1488.892) [-1467.649] (-1474.512) -- 0:02:56
506000 -- (-1474.771) (-1475.703) (-1473.805) [-1464.803] * (-1477.210) (-1473.009) (-1469.111) [-1472.705] -- 0:02:55
506500 -- (-1475.854) (-1480.816) (-1480.208) [-1475.653] * (-1472.820) (-1469.683) (-1469.572) [-1468.086] -- 0:02:55
507000 -- (-1482.280) (-1477.225) [-1466.516] (-1475.643) * [-1468.962] (-1481.980) (-1478.186) (-1473.326) -- 0:02:55
507500 -- [-1468.829] (-1469.834) (-1479.583) (-1478.184) * (-1468.061) [-1481.032] (-1474.966) (-1472.685) -- 0:02:54
508000 -- (-1468.836) (-1474.777) (-1479.037) [-1474.158] * (-1471.661) (-1476.737) [-1464.104] (-1476.063) -- 0:02:55
508500 -- (-1480.313) (-1471.534) (-1475.289) [-1476.902] * [-1471.638] (-1476.674) (-1473.201) (-1477.571) -- 0:02:54
509000 -- (-1483.309) (-1462.401) [-1475.726] (-1467.337) * [-1466.419] (-1463.524) (-1474.586) (-1480.058) -- 0:02:54
509500 -- (-1472.643) (-1474.339) [-1476.927] (-1471.809) * (-1483.159) [-1467.395] (-1484.443) (-1485.658) -- 0:02:54
510000 -- [-1468.210] (-1477.083) (-1470.207) (-1474.568) * [-1472.887] (-1472.691) (-1479.701) (-1470.144) -- 0:02:53
Average standard deviation of split frequencies: 0.010443
510500 -- (-1484.145) [-1474.771] (-1475.164) (-1478.126) * [-1471.785] (-1475.235) (-1474.343) (-1487.511) -- 0:02:53
511000 -- (-1477.449) (-1469.587) (-1471.387) [-1466.795] * (-1472.422) [-1466.818] (-1476.681) (-1480.548) -- 0:02:54
511500 -- (-1475.889) (-1470.738) [-1463.870] (-1474.929) * (-1478.995) (-1471.587) [-1476.347] (-1479.036) -- 0:02:53
512000 -- (-1480.192) (-1465.493) [-1478.883] (-1478.015) * [-1468.432] (-1466.992) (-1472.982) (-1476.260) -- 0:02:53
512500 -- (-1479.467) (-1470.473) [-1482.253] (-1480.051) * (-1479.775) (-1464.955) [-1474.600] (-1474.530) -- 0:02:53
513000 -- (-1470.589) (-1482.538) (-1474.059) [-1471.260] * (-1475.485) (-1469.197) (-1489.719) [-1468.581] -- 0:02:52
513500 -- (-1475.475) [-1474.510] (-1467.876) (-1474.326) * (-1480.824) [-1470.500] (-1472.958) (-1474.344) -- 0:02:52
514000 -- (-1472.395) [-1470.256] (-1468.736) (-1471.842) * (-1474.420) [-1465.312] (-1482.059) (-1480.136) -- 0:02:53
514500 -- [-1472.084] (-1476.074) (-1474.423) (-1479.499) * (-1471.821) [-1472.979] (-1479.060) (-1473.540) -- 0:02:52
515000 -- (-1473.491) [-1474.841] (-1472.803) (-1465.509) * (-1475.439) (-1468.252) [-1471.711] (-1470.368) -- 0:02:52
Average standard deviation of split frequencies: 0.010735
515500 -- (-1477.742) [-1475.162] (-1469.745) (-1466.131) * [-1468.561] (-1465.866) (-1472.766) (-1472.377) -- 0:02:51
516000 -- (-1480.852) (-1471.854) [-1470.944] (-1468.305) * (-1479.400) (-1474.514) [-1474.993] (-1475.078) -- 0:02:51
516500 -- (-1473.194) [-1469.462] (-1472.366) (-1479.640) * (-1471.145) (-1472.820) (-1469.302) [-1463.285] -- 0:02:52
517000 -- (-1472.930) (-1471.054) (-1475.492) [-1467.375] * (-1472.788) (-1471.252) (-1475.275) [-1469.018] -- 0:02:51
517500 -- (-1478.510) (-1477.049) [-1470.788] (-1477.358) * (-1470.968) (-1471.783) (-1474.955) [-1468.606] -- 0:02:51
518000 -- (-1474.561) [-1466.970] (-1470.995) (-1467.763) * [-1470.218] (-1470.264) (-1484.554) (-1483.215) -- 0:02:51
518500 -- (-1472.677) [-1467.126] (-1490.411) (-1467.487) * [-1466.921] (-1468.810) (-1477.926) (-1490.378) -- 0:02:50
519000 -- (-1468.649) (-1466.513) (-1478.230) [-1469.380] * (-1474.617) (-1475.686) (-1482.373) [-1470.632] -- 0:02:50
519500 -- (-1476.767) (-1473.729) (-1475.782) [-1473.132] * (-1471.855) (-1478.411) (-1481.385) [-1472.615] -- 0:02:51
520000 -- (-1480.841) [-1473.020] (-1479.118) (-1475.450) * (-1466.927) (-1474.182) [-1466.879] (-1474.145) -- 0:02:50
Average standard deviation of split frequencies: 0.011374
520500 -- (-1482.083) (-1476.410) (-1473.386) [-1469.225] * [-1466.755] (-1480.699) (-1479.581) (-1470.911) -- 0:02:50
521000 -- [-1465.932] (-1473.355) (-1470.460) (-1473.244) * (-1468.389) (-1477.293) (-1470.655) [-1468.149] -- 0:02:50
521500 -- (-1470.985) [-1468.855] (-1474.175) (-1473.394) * (-1479.780) [-1476.640] (-1478.154) (-1472.253) -- 0:02:49
522000 -- (-1472.867) (-1474.700) (-1475.934) [-1473.903] * [-1475.766] (-1476.453) (-1471.052) (-1468.113) -- 0:02:49
522500 -- (-1468.907) [-1465.460] (-1482.874) (-1478.817) * [-1468.182] (-1482.662) (-1472.234) (-1478.204) -- 0:02:49
523000 -- [-1465.082] (-1471.069) (-1472.001) (-1470.635) * [-1472.283] (-1477.854) (-1477.332) (-1467.785) -- 0:02:49
523500 -- (-1475.171) [-1468.550] (-1480.859) (-1479.065) * (-1473.205) (-1471.696) (-1472.310) [-1476.772] -- 0:02:49
524000 -- [-1473.258] (-1472.782) (-1468.902) (-1475.824) * (-1470.849) (-1473.909) (-1472.735) [-1462.631] -- 0:02:48
524500 -- (-1466.665) [-1466.914] (-1478.844) (-1474.403) * (-1469.368) (-1469.397) (-1470.874) [-1468.438] -- 0:02:48
525000 -- (-1472.005) [-1465.308] (-1469.843) (-1470.440) * (-1475.899) (-1471.311) [-1472.992] (-1481.988) -- 0:02:49
Average standard deviation of split frequencies: 0.011315
525500 -- (-1467.426) (-1482.380) (-1474.725) [-1471.975] * (-1480.778) [-1469.301] (-1472.676) (-1475.239) -- 0:02:48
526000 -- (-1477.699) [-1474.831] (-1465.554) (-1465.998) * (-1481.413) [-1471.794] (-1468.518) (-1477.175) -- 0:02:48
526500 -- (-1469.475) (-1472.222) (-1472.036) [-1474.605] * (-1478.992) (-1466.504) (-1469.765) [-1467.466] -- 0:02:48
527000 -- [-1467.688] (-1470.796) (-1467.883) (-1472.636) * (-1475.166) (-1481.242) (-1470.958) [-1473.601] -- 0:02:47
527500 -- (-1479.866) [-1470.360] (-1475.994) (-1480.858) * [-1475.042] (-1478.084) (-1471.202) (-1482.345) -- 0:02:47
528000 -- (-1469.956) (-1470.216) (-1479.445) [-1472.038] * [-1471.432] (-1478.701) (-1481.816) (-1485.281) -- 0:02:48
528500 -- (-1469.344) [-1468.046] (-1470.599) (-1475.755) * (-1470.366) (-1474.046) (-1472.085) [-1482.358] -- 0:02:47
529000 -- [-1477.991] (-1474.580) (-1476.437) (-1482.555) * (-1470.585) [-1482.500] (-1476.100) (-1482.500) -- 0:02:47
529500 -- (-1480.996) [-1463.802] (-1475.752) (-1468.330) * (-1477.706) (-1472.456) (-1476.440) [-1472.930] -- 0:02:47
530000 -- (-1481.058) (-1469.197) [-1472.090] (-1475.024) * (-1468.088) [-1466.401] (-1476.553) (-1468.987) -- 0:02:46
Average standard deviation of split frequencies: 0.011104
530500 -- [-1471.672] (-1469.405) (-1474.260) (-1467.213) * (-1472.856) (-1465.837) [-1465.041] (-1466.028) -- 0:02:46
531000 -- (-1473.459) [-1473.547] (-1475.703) (-1476.209) * (-1481.229) [-1466.317] (-1474.752) (-1477.169) -- 0:02:46
531500 -- (-1472.812) (-1476.085) (-1478.506) [-1465.672] * (-1477.256) (-1467.879) (-1476.701) [-1473.672] -- 0:02:46
532000 -- (-1478.767) (-1485.487) [-1475.083] (-1470.671) * (-1478.427) (-1477.336) (-1475.054) [-1468.211] -- 0:02:46
532500 -- [-1466.363] (-1474.456) (-1470.089) (-1472.056) * [-1472.500] (-1469.718) (-1464.547) (-1478.919) -- 0:02:45
533000 -- (-1470.071) (-1477.333) [-1469.828] (-1475.995) * (-1466.502) (-1473.552) [-1474.058] (-1481.181) -- 0:02:45
533500 -- (-1477.890) (-1482.272) [-1474.214] (-1475.404) * (-1475.648) (-1472.379) [-1482.332] (-1473.982) -- 0:02:46
534000 -- (-1479.039) (-1471.984) [-1474.291] (-1471.933) * (-1472.495) (-1477.995) [-1467.110] (-1481.295) -- 0:02:45
534500 -- (-1473.228) [-1472.327] (-1477.858) (-1468.777) * [-1472.205] (-1474.300) (-1468.908) (-1473.596) -- 0:02:45
535000 -- (-1475.387) (-1484.151) [-1474.011] (-1468.042) * (-1472.379) (-1466.789) (-1465.712) [-1469.619] -- 0:02:45
Average standard deviation of split frequencies: 0.010554
535500 -- (-1473.352) (-1474.225) (-1482.398) [-1472.153] * (-1479.942) [-1473.913] (-1473.974) (-1471.969) -- 0:02:44
536000 -- (-1471.302) (-1479.856) [-1477.948] (-1481.212) * (-1480.810) [-1470.989] (-1476.470) (-1468.760) -- 0:02:44
536500 -- (-1471.595) [-1471.065] (-1472.435) (-1476.566) * (-1478.601) [-1466.973] (-1475.814) (-1474.708) -- 0:02:45
537000 -- (-1476.080) (-1476.333) [-1476.480] (-1488.075) * (-1478.369) [-1468.449] (-1473.130) (-1480.120) -- 0:02:44
537500 -- [-1470.857] (-1474.348) (-1477.071) (-1478.716) * (-1476.436) (-1473.973) [-1469.401] (-1474.467) -- 0:02:44
538000 -- [-1468.239] (-1476.493) (-1473.819) (-1477.910) * (-1472.791) [-1465.256] (-1479.845) (-1470.030) -- 0:02:44
538500 -- (-1470.519) (-1473.324) [-1464.151] (-1465.519) * (-1468.166) (-1463.672) [-1472.638] (-1474.029) -- 0:02:43
539000 -- (-1477.772) [-1476.762] (-1471.001) (-1471.229) * (-1479.901) (-1468.486) [-1469.645] (-1478.213) -- 0:02:44
539500 -- [-1472.446] (-1479.817) (-1478.016) (-1469.092) * (-1470.546) [-1478.308] (-1485.041) (-1481.811) -- 0:02:43
540000 -- (-1474.726) [-1476.554] (-1477.877) (-1470.311) * (-1471.047) [-1470.019] (-1465.361) (-1472.352) -- 0:02:43
Average standard deviation of split frequencies: 0.010299
540500 -- (-1476.600) [-1466.214] (-1469.282) (-1473.875) * (-1478.636) (-1471.147) (-1474.687) [-1476.598] -- 0:02:43
541000 -- (-1474.514) [-1471.175] (-1469.203) (-1477.749) * [-1470.811] (-1470.868) (-1483.109) (-1467.439) -- 0:02:42
541500 -- (-1469.344) [-1468.667] (-1475.312) (-1477.365) * [-1477.476] (-1470.225) (-1469.618) (-1474.547) -- 0:02:42
542000 -- [-1471.307] (-1471.009) (-1480.372) (-1472.847) * (-1478.314) (-1468.931) [-1476.136] (-1473.041) -- 0:02:43
542500 -- [-1471.371] (-1476.670) (-1480.670) (-1466.160) * (-1469.175) [-1468.941] (-1470.157) (-1470.703) -- 0:02:42
543000 -- (-1471.134) [-1470.476] (-1483.898) (-1473.240) * (-1467.166) [-1463.872] (-1476.516) (-1483.414) -- 0:02:42
543500 -- (-1464.331) [-1472.031] (-1472.492) (-1475.414) * (-1478.504) [-1464.280] (-1471.771) (-1478.829) -- 0:02:42
544000 -- (-1467.610) [-1479.145] (-1486.102) (-1477.834) * (-1472.817) (-1469.736) [-1468.521] (-1477.600) -- 0:02:41
544500 -- [-1473.732] (-1476.639) (-1475.656) (-1482.297) * (-1467.674) (-1475.832) [-1482.887] (-1479.040) -- 0:02:41
545000 -- (-1474.152) (-1476.870) (-1464.336) [-1473.179] * (-1467.515) (-1474.236) [-1469.900] (-1480.832) -- 0:02:41
Average standard deviation of split frequencies: 0.009983
545500 -- (-1474.649) (-1476.925) [-1469.806] (-1473.723) * (-1477.285) (-1476.296) [-1474.547] (-1485.415) -- 0:02:41
546000 -- (-1469.528) (-1472.457) [-1472.603] (-1476.197) * (-1471.807) [-1466.767] (-1477.552) (-1489.793) -- 0:02:41
546500 -- (-1476.009) [-1470.404] (-1467.403) (-1471.010) * (-1469.769) (-1466.013) [-1467.886] (-1477.026) -- 0:02:40
547000 -- [-1468.957] (-1481.344) (-1474.401) (-1469.152) * (-1468.899) [-1466.797] (-1471.819) (-1485.092) -- 0:02:40
547500 -- [-1465.875] (-1478.801) (-1474.711) (-1483.846) * (-1478.128) [-1467.679] (-1482.438) (-1474.509) -- 0:02:41
548000 -- (-1462.819) (-1477.284) (-1482.842) [-1477.695] * [-1465.459] (-1469.918) (-1482.166) (-1489.152) -- 0:02:40
548500 -- [-1465.144] (-1479.967) (-1468.884) (-1478.827) * (-1467.877) [-1465.398] (-1470.674) (-1477.679) -- 0:02:40
549000 -- [-1474.765] (-1473.007) (-1479.773) (-1470.143) * (-1472.471) [-1465.636] (-1469.986) (-1484.804) -- 0:02:40
549500 -- (-1479.800) (-1472.426) (-1480.464) [-1468.387] * [-1472.318] (-1473.527) (-1476.458) (-1478.642) -- 0:02:39
550000 -- (-1470.781) (-1465.061) (-1474.626) [-1473.087] * (-1478.854) [-1469.554] (-1474.757) (-1476.021) -- 0:02:39
Average standard deviation of split frequencies: 0.010219
550500 -- (-1471.241) [-1469.585] (-1471.487) (-1475.370) * (-1470.621) (-1478.614) [-1473.528] (-1475.598) -- 0:02:40
551000 -- [-1472.010] (-1474.540) (-1471.931) (-1476.885) * (-1477.978) (-1474.738) [-1470.645] (-1475.072) -- 0:02:39
551500 -- (-1473.331) [-1464.155] (-1473.408) (-1473.971) * (-1479.331) (-1468.888) (-1483.181) [-1470.542] -- 0:02:39
552000 -- (-1470.035) [-1469.594] (-1473.567) (-1476.784) * (-1475.065) (-1475.460) (-1476.613) [-1467.489] -- 0:02:39
552500 -- (-1473.373) [-1466.749] (-1483.901) (-1470.664) * [-1467.605] (-1474.516) (-1476.245) (-1472.403) -- 0:02:38
553000 -- [-1472.969] (-1473.700) (-1478.029) (-1476.163) * [-1476.024] (-1474.215) (-1471.236) (-1465.558) -- 0:02:39
553500 -- (-1469.180) [-1468.966] (-1482.608) (-1471.483) * (-1473.448) (-1476.821) (-1469.952) [-1474.035] -- 0:02:38
554000 -- (-1471.823) (-1471.970) [-1473.296] (-1479.225) * (-1483.609) (-1471.635) [-1462.976] (-1480.631) -- 0:02:38
554500 -- (-1469.589) (-1468.524) [-1472.183] (-1473.873) * (-1473.816) (-1475.087) [-1464.930] (-1466.182) -- 0:02:38
555000 -- (-1474.321) (-1478.602) (-1472.647) [-1468.159] * (-1476.598) (-1471.751) (-1465.941) [-1477.136] -- 0:02:37
Average standard deviation of split frequencies: 0.010068
555500 -- (-1469.389) (-1480.648) [-1468.748] (-1475.418) * [-1471.698] (-1476.768) (-1479.084) (-1479.599) -- 0:02:37
556000 -- (-1471.210) [-1471.253] (-1469.290) (-1475.519) * (-1471.093) (-1468.521) (-1471.545) [-1481.175] -- 0:02:38
556500 -- (-1472.870) (-1469.612) (-1470.805) [-1470.728] * (-1476.360) [-1472.466] (-1473.645) (-1479.486) -- 0:02:37
557000 -- (-1479.054) (-1472.104) (-1466.524) [-1472.154] * (-1469.508) [-1465.731] (-1472.560) (-1480.834) -- 0:02:37
557500 -- (-1477.018) [-1477.798] (-1475.998) (-1473.102) * (-1475.010) [-1471.438] (-1475.085) (-1476.353) -- 0:02:37
558000 -- (-1476.855) (-1478.277) [-1469.871] (-1470.336) * (-1474.624) (-1486.206) (-1474.584) [-1473.262] -- 0:02:36
558500 -- (-1473.216) (-1476.270) [-1470.055] (-1466.591) * [-1467.103] (-1474.038) (-1466.098) (-1482.917) -- 0:02:36
559000 -- (-1472.942) (-1468.841) [-1467.688] (-1472.166) * (-1466.148) [-1472.590] (-1477.725) (-1472.895) -- 0:02:36
559500 -- (-1476.212) (-1475.545) [-1471.528] (-1472.137) * (-1474.060) [-1476.911] (-1479.824) (-1478.625) -- 0:02:36
560000 -- (-1472.125) (-1474.122) (-1469.778) [-1473.786] * (-1476.615) [-1473.781] (-1474.268) (-1470.469) -- 0:02:36
Average standard deviation of split frequencies: 0.010195
560500 -- (-1475.086) [-1462.430] (-1465.159) (-1479.669) * [-1470.110] (-1476.988) (-1478.303) (-1474.331) -- 0:02:36
561000 -- (-1475.637) (-1478.321) [-1472.244] (-1480.312) * (-1470.979) [-1478.054] (-1471.289) (-1479.668) -- 0:02:35
561500 -- (-1472.056) (-1475.863) [-1469.714] (-1477.457) * (-1482.716) (-1470.591) [-1468.444] (-1468.478) -- 0:02:36
562000 -- (-1478.599) (-1475.026) [-1479.876] (-1469.724) * [-1472.463] (-1474.295) (-1481.828) (-1474.540) -- 0:02:35
562500 -- (-1467.242) (-1468.733) [-1470.531] (-1473.406) * [-1475.917] (-1474.512) (-1483.280) (-1478.420) -- 0:02:35
563000 -- [-1469.316] (-1472.702) (-1471.917) (-1480.244) * (-1473.262) [-1467.278] (-1476.965) (-1478.369) -- 0:02:35
563500 -- (-1471.383) (-1468.680) [-1468.983] (-1484.122) * [-1467.360] (-1475.702) (-1474.385) (-1485.392) -- 0:02:34
564000 -- (-1475.432) [-1466.562] (-1474.536) (-1465.725) * [-1473.645] (-1474.658) (-1482.824) (-1481.955) -- 0:02:34
564500 -- [-1469.671] (-1468.211) (-1478.112) (-1466.739) * (-1474.584) [-1476.373] (-1474.080) (-1476.021) -- 0:02:35
565000 -- [-1470.007] (-1472.578) (-1466.885) (-1473.925) * (-1468.948) [-1471.350] (-1479.619) (-1468.299) -- 0:02:34
Average standard deviation of split frequencies: 0.010203
565500 -- [-1465.221] (-1479.107) (-1482.611) (-1472.417) * (-1468.194) [-1475.416] (-1476.138) (-1473.853) -- 0:02:34
566000 -- (-1477.497) (-1478.069) (-1485.908) [-1463.705] * [-1473.646] (-1476.583) (-1478.850) (-1479.729) -- 0:02:34
566500 -- (-1482.033) [-1467.817] (-1478.907) (-1471.297) * [-1471.364] (-1473.488) (-1481.978) (-1468.439) -- 0:02:33
567000 -- (-1469.284) (-1467.705) (-1479.433) [-1465.007] * (-1473.580) (-1466.537) (-1482.423) [-1478.135] -- 0:02:33
567500 -- (-1483.417) [-1467.750] (-1475.187) (-1486.918) * (-1484.448) (-1470.737) (-1469.336) [-1470.782] -- 0:02:33
568000 -- (-1471.630) [-1469.480] (-1475.449) (-1477.524) * [-1474.829] (-1479.105) (-1468.554) (-1474.403) -- 0:02:33
568500 -- (-1470.665) [-1472.045] (-1474.292) (-1475.953) * [-1469.832] (-1477.694) (-1475.793) (-1482.617) -- 0:02:33
569000 -- [-1468.825] (-1470.469) (-1476.114) (-1478.008) * (-1477.004) [-1467.236] (-1478.662) (-1483.868) -- 0:02:33
569500 -- (-1482.301) (-1470.362) (-1479.659) [-1480.335] * (-1472.602) [-1464.309] (-1481.139) (-1478.564) -- 0:02:32
570000 -- (-1481.227) (-1473.271) (-1477.348) [-1472.020] * (-1477.154) (-1472.931) [-1473.562] (-1469.572) -- 0:02:33
Average standard deviation of split frequencies: 0.009242
570500 -- (-1480.699) [-1473.434] (-1479.207) (-1485.533) * (-1479.891) (-1473.581) [-1475.468] (-1475.975) -- 0:02:32
571000 -- (-1477.807) (-1468.461) [-1470.773] (-1470.398) * (-1476.754) [-1467.145] (-1473.775) (-1483.700) -- 0:02:32
571500 -- [-1471.076] (-1467.819) (-1481.479) (-1476.666) * [-1471.409] (-1471.089) (-1476.489) (-1481.232) -- 0:02:32
572000 -- (-1475.685) (-1474.368) [-1471.967] (-1465.352) * (-1469.112) (-1481.134) (-1479.789) [-1467.247] -- 0:02:31
572500 -- (-1468.166) (-1473.463) [-1473.176] (-1478.273) * (-1472.668) [-1474.855] (-1477.863) (-1472.985) -- 0:02:31
573000 -- (-1472.898) (-1480.603) (-1477.375) [-1473.693] * [-1482.695] (-1475.821) (-1475.778) (-1475.977) -- 0:02:32
573500 -- (-1471.445) (-1473.754) (-1465.599) [-1476.611] * (-1474.673) (-1468.795) (-1471.820) [-1469.977] -- 0:02:31
574000 -- (-1486.315) (-1476.624) (-1466.130) [-1472.890] * (-1472.021) (-1480.565) [-1476.576] (-1470.806) -- 0:02:31
574500 -- [-1461.987] (-1477.230) (-1465.859) (-1472.304) * (-1472.103) (-1486.564) [-1473.040] (-1486.106) -- 0:02:31
575000 -- (-1472.122) (-1469.130) (-1481.910) [-1477.905] * [-1475.564] (-1469.139) (-1472.493) (-1473.340) -- 0:02:30
Average standard deviation of split frequencies: 0.009565
575500 -- (-1466.639) [-1471.801] (-1476.507) (-1472.074) * (-1473.968) (-1471.474) [-1470.661] (-1480.490) -- 0:02:31
576000 -- (-1475.771) [-1468.985] (-1478.493) (-1476.715) * (-1472.935) (-1481.247) (-1477.279) [-1474.689] -- 0:02:30
576500 -- (-1478.131) [-1468.581] (-1471.187) (-1476.649) * (-1490.459) (-1482.158) (-1475.822) [-1467.690] -- 0:02:30
577000 -- (-1471.141) [-1470.543] (-1475.006) (-1487.464) * (-1482.918) [-1482.881] (-1473.173) (-1472.818) -- 0:02:30
577500 -- (-1478.290) (-1479.360) [-1475.386] (-1471.708) * (-1469.803) (-1475.402) (-1471.317) [-1471.199] -- 0:02:29
578000 -- [-1471.080] (-1487.533) (-1476.918) (-1471.710) * [-1471.169] (-1470.249) (-1477.087) (-1465.175) -- 0:02:29
578500 -- (-1474.113) (-1472.098) [-1476.154] (-1477.129) * (-1471.738) [-1474.913] (-1472.378) (-1469.145) -- 0:02:30
579000 -- (-1471.063) [-1470.900] (-1477.976) (-1475.795) * (-1474.240) [-1475.147] (-1472.904) (-1471.265) -- 0:02:29
579500 -- (-1475.310) (-1474.287) [-1468.192] (-1479.501) * [-1466.949] (-1474.379) (-1484.761) (-1469.923) -- 0:02:29
580000 -- (-1469.260) (-1471.990) [-1477.375] (-1476.954) * [-1478.593] (-1472.708) (-1472.400) (-1473.993) -- 0:02:29
Average standard deviation of split frequencies: 0.008879
580500 -- [-1469.253] (-1472.163) (-1473.392) (-1472.041) * (-1467.897) (-1472.121) (-1480.492) [-1467.086] -- 0:02:28
581000 -- (-1466.672) (-1476.502) [-1470.841] (-1477.227) * (-1467.158) [-1472.021] (-1473.407) (-1469.683) -- 0:02:28
581500 -- [-1468.326] (-1479.486) (-1466.764) (-1475.300) * (-1470.747) (-1472.697) (-1472.052) [-1476.794] -- 0:02:28
582000 -- (-1471.752) [-1471.967] (-1470.504) (-1479.554) * [-1478.204] (-1476.531) (-1477.102) (-1469.802) -- 0:02:28
582500 -- (-1464.591) (-1471.375) [-1471.200] (-1479.240) * (-1473.868) (-1474.553) [-1472.019] (-1469.325) -- 0:02:28
583000 -- [-1467.214] (-1469.298) (-1472.534) (-1477.345) * [-1477.409] (-1474.973) (-1474.184) (-1473.034) -- 0:02:28
583500 -- (-1466.891) (-1469.769) [-1469.145] (-1479.381) * (-1475.724) (-1468.027) (-1468.101) [-1471.453] -- 0:02:27
584000 -- [-1464.296] (-1474.153) (-1464.550) (-1478.709) * (-1475.542) [-1476.407] (-1469.215) (-1476.592) -- 0:02:28
584500 -- [-1473.301] (-1469.017) (-1476.424) (-1467.680) * (-1474.799) (-1476.458) (-1472.756) [-1472.752] -- 0:02:27
585000 -- [-1471.495] (-1477.911) (-1473.064) (-1469.428) * (-1472.490) [-1471.108] (-1475.263) (-1471.900) -- 0:02:27
Average standard deviation of split frequencies: 0.008799
585500 -- (-1472.780) (-1468.242) (-1476.045) [-1473.228] * (-1474.356) (-1475.974) [-1470.932] (-1472.117) -- 0:02:27
586000 -- [-1468.708] (-1472.480) (-1474.299) (-1482.738) * (-1477.997) (-1471.780) (-1473.197) [-1466.699] -- 0:02:26
586500 -- (-1486.733) (-1476.057) [-1465.952] (-1483.318) * (-1484.457) (-1476.444) [-1471.403] (-1472.150) -- 0:02:26
587000 -- (-1479.106) [-1478.079] (-1474.833) (-1475.176) * (-1488.399) [-1471.404] (-1475.399) (-1470.668) -- 0:02:27
587500 -- [-1473.565] (-1470.686) (-1471.782) (-1472.995) * (-1476.266) [-1475.518] (-1469.978) (-1488.441) -- 0:02:26
588000 -- (-1483.088) [-1474.140] (-1469.198) (-1474.374) * (-1476.120) (-1478.116) [-1468.908] (-1477.532) -- 0:02:26
588500 -- [-1475.738] (-1474.064) (-1473.198) (-1478.013) * (-1474.097) (-1475.286) [-1477.695] (-1477.970) -- 0:02:26
589000 -- [-1472.861] (-1474.172) (-1470.532) (-1478.000) * [-1467.872] (-1480.752) (-1468.870) (-1479.708) -- 0:02:25
589500 -- (-1470.936) [-1476.403] (-1479.527) (-1476.961) * (-1476.487) (-1477.493) (-1473.205) [-1473.744] -- 0:02:26
590000 -- (-1478.042) [-1473.737] (-1480.440) (-1467.937) * (-1474.766) [-1465.286] (-1471.528) (-1479.479) -- 0:02:25
Average standard deviation of split frequencies: 0.009128
590500 -- (-1474.649) [-1475.767] (-1472.626) (-1467.792) * [-1467.584] (-1470.717) (-1473.690) (-1468.664) -- 0:02:25
591000 -- (-1472.731) (-1476.993) [-1467.890] (-1471.878) * (-1475.549) [-1474.362] (-1489.808) (-1467.122) -- 0:02:25
591500 -- [-1475.589] (-1479.706) (-1476.527) (-1475.957) * (-1466.742) (-1476.671) (-1487.078) [-1471.372] -- 0:02:25
592000 -- [-1479.135] (-1470.949) (-1470.469) (-1472.850) * [-1473.780] (-1469.581) (-1477.909) (-1475.781) -- 0:02:24
592500 -- [-1466.418] (-1481.490) (-1473.329) (-1472.020) * (-1474.374) [-1473.548] (-1482.474) (-1468.063) -- 0:02:25
593000 -- (-1472.945) (-1477.570) (-1483.519) [-1477.613] * (-1472.398) [-1469.469] (-1480.628) (-1481.923) -- 0:02:24
593500 -- [-1477.882] (-1480.173) (-1480.702) (-1471.160) * (-1479.227) [-1471.904] (-1491.854) (-1482.644) -- 0:02:24
594000 -- (-1481.960) (-1480.504) [-1473.892] (-1475.076) * (-1474.051) [-1469.900] (-1481.013) (-1470.336) -- 0:02:24
594500 -- (-1478.126) (-1481.009) (-1473.947) [-1473.462] * [-1479.985] (-1469.241) (-1473.303) (-1474.832) -- 0:02:23
595000 -- (-1480.348) [-1477.402] (-1478.418) (-1474.375) * (-1467.177) (-1477.221) (-1471.588) [-1469.981] -- 0:02:23
Average standard deviation of split frequencies: 0.009392
595500 -- (-1477.127) (-1466.613) [-1474.858] (-1473.162) * (-1479.355) (-1481.940) (-1478.263) [-1465.456] -- 0:02:24
596000 -- (-1474.420) [-1474.509] (-1467.339) (-1479.233) * (-1466.435) [-1467.885] (-1479.029) (-1471.326) -- 0:02:23
596500 -- (-1471.162) (-1475.950) (-1473.911) [-1467.290] * (-1479.480) [-1473.113] (-1469.946) (-1472.455) -- 0:02:23
597000 -- (-1471.823) (-1470.022) [-1469.586] (-1482.949) * [-1479.463] (-1470.857) (-1477.622) (-1474.195) -- 0:02:23
597500 -- [-1468.541] (-1483.795) (-1469.726) (-1466.926) * (-1483.609) (-1467.161) [-1468.972] (-1471.660) -- 0:02:22
598000 -- (-1471.606) (-1466.531) (-1481.799) [-1471.829] * (-1477.885) (-1481.509) [-1464.974] (-1476.772) -- 0:02:23
598500 -- [-1477.861] (-1475.280) (-1464.545) (-1466.782) * (-1474.938) (-1476.140) [-1474.452] (-1477.358) -- 0:02:22
599000 -- [-1465.242] (-1481.178) (-1473.382) (-1473.431) * (-1480.875) (-1476.077) (-1474.490) [-1469.135] -- 0:02:22
599500 -- (-1474.963) [-1472.114] (-1468.155) (-1477.312) * (-1470.104) (-1480.460) [-1463.279] (-1471.388) -- 0:02:22
600000 -- [-1474.119] (-1472.193) (-1472.315) (-1475.427) * (-1475.658) (-1483.597) (-1477.785) [-1467.565] -- 0:02:22
Average standard deviation of split frequencies: 0.010399
600500 -- (-1474.707) (-1470.760) (-1474.028) [-1474.342] * (-1473.981) (-1482.699) [-1478.203] (-1471.376) -- 0:02:21
601000 -- (-1477.118) [-1475.447] (-1472.879) (-1477.184) * (-1476.472) [-1475.039] (-1481.670) (-1476.372) -- 0:02:22
601500 -- (-1475.840) [-1473.441] (-1478.616) (-1477.145) * (-1480.567) [-1473.324] (-1475.830) (-1472.828) -- 0:02:21
602000 -- [-1476.917] (-1473.461) (-1477.198) (-1481.358) * (-1472.724) [-1475.958] (-1477.515) (-1473.228) -- 0:02:21
602500 -- [-1466.559] (-1468.071) (-1464.304) (-1479.653) * (-1471.195) (-1478.704) (-1471.616) [-1469.399] -- 0:02:21
603000 -- [-1476.346] (-1483.074) (-1481.430) (-1479.417) * (-1475.147) (-1480.876) [-1467.882] (-1476.932) -- 0:02:20
603500 -- [-1468.075] (-1470.608) (-1474.252) (-1468.758) * [-1472.833] (-1477.051) (-1470.189) (-1468.568) -- 0:02:20
604000 -- (-1488.659) (-1465.385) [-1476.974] (-1471.888) * (-1471.197) [-1485.433] (-1474.220) (-1482.851) -- 0:02:20
604500 -- [-1472.597] (-1466.002) (-1481.490) (-1485.004) * (-1464.187) (-1471.887) (-1480.965) [-1481.390] -- 0:02:20
605000 -- [-1470.288] (-1480.564) (-1465.574) (-1480.601) * [-1466.274] (-1482.782) (-1469.834) (-1475.035) -- 0:02:20
Average standard deviation of split frequencies: 0.010599
605500 -- [-1476.483] (-1470.954) (-1470.868) (-1477.187) * (-1473.622) [-1466.946] (-1479.954) (-1467.398) -- 0:02:20
606000 -- (-1481.809) (-1469.081) [-1474.067] (-1485.930) * [-1468.189] (-1468.712) (-1478.608) (-1470.011) -- 0:02:19
606500 -- [-1478.242] (-1469.495) (-1471.544) (-1473.919) * (-1474.433) (-1479.675) (-1487.294) [-1471.304] -- 0:02:20
607000 -- [-1480.350] (-1476.746) (-1469.979) (-1473.493) * (-1465.919) (-1489.048) [-1480.362] (-1478.237) -- 0:02:19
607500 -- (-1478.738) [-1472.071] (-1482.175) (-1470.953) * (-1473.629) [-1468.715] (-1474.179) (-1474.186) -- 0:02:19
608000 -- (-1473.883) (-1476.489) (-1468.892) [-1468.985] * (-1473.331) (-1472.125) (-1476.020) [-1471.449] -- 0:02:19
608500 -- (-1479.468) (-1471.975) [-1472.508] (-1469.012) * (-1467.324) (-1473.593) (-1484.946) [-1463.900] -- 0:02:18
609000 -- (-1479.600) [-1477.450] (-1472.619) (-1477.808) * (-1476.657) (-1477.530) (-1481.402) [-1477.343] -- 0:02:18
609500 -- (-1476.006) (-1483.649) (-1469.023) [-1471.403] * [-1469.473] (-1473.754) (-1490.203) (-1482.473) -- 0:02:19
610000 -- (-1473.144) (-1474.240) (-1477.444) [-1471.835] * (-1473.797) [-1472.989] (-1480.131) (-1484.243) -- 0:02:18
Average standard deviation of split frequencies: 0.010470
610500 -- [-1475.572] (-1463.033) (-1474.436) (-1482.116) * (-1477.355) [-1473.970] (-1471.887) (-1470.961) -- 0:02:18
611000 -- (-1480.879) (-1469.232) (-1477.343) [-1473.740] * [-1473.535] (-1472.813) (-1479.760) (-1482.475) -- 0:02:18
611500 -- (-1471.234) (-1470.130) [-1466.798] (-1469.554) * (-1470.710) (-1477.476) (-1473.847) [-1469.248] -- 0:02:17
612000 -- (-1468.083) [-1470.603] (-1472.472) (-1467.529) * (-1479.309) (-1472.748) [-1473.557] (-1466.119) -- 0:02:17
612500 -- (-1471.444) [-1467.671] (-1469.694) (-1469.939) * [-1473.754] (-1473.911) (-1468.255) (-1471.071) -- 0:02:17
613000 -- (-1484.682) (-1465.411) [-1471.556] (-1473.312) * (-1472.463) (-1478.971) (-1480.675) [-1469.751] -- 0:02:17
613500 -- (-1476.148) (-1467.848) (-1481.577) [-1474.369] * (-1470.924) (-1471.666) (-1476.035) [-1472.835] -- 0:02:17
614000 -- [-1479.728] (-1475.399) (-1474.618) (-1481.726) * (-1468.126) [-1478.560] (-1480.566) (-1467.291) -- 0:02:17
614500 -- (-1473.291) (-1474.352) [-1466.592] (-1478.872) * [-1470.000] (-1479.543) (-1472.252) (-1463.454) -- 0:02:16
615000 -- [-1474.291] (-1474.811) (-1467.751) (-1479.421) * (-1472.767) (-1486.904) (-1470.408) [-1463.134] -- 0:02:17
Average standard deviation of split frequencies: 0.011144
615500 -- (-1466.425) (-1480.736) (-1473.998) [-1469.296] * (-1480.375) (-1482.361) (-1478.138) [-1465.379] -- 0:02:16
616000 -- (-1464.624) [-1463.998] (-1470.620) (-1483.026) * [-1469.153] (-1472.715) (-1476.751) (-1471.994) -- 0:02:16
616500 -- (-1475.219) (-1477.234) [-1465.942] (-1477.776) * (-1474.250) (-1478.415) [-1469.611] (-1469.632) -- 0:02:16
617000 -- (-1472.038) (-1469.246) (-1474.955) [-1473.983] * (-1479.449) (-1474.473) [-1470.951] (-1480.931) -- 0:02:15
617500 -- (-1472.912) (-1470.652) [-1472.340] (-1472.043) * (-1473.177) (-1475.523) [-1469.331] (-1472.407) -- 0:02:15
618000 -- (-1470.703) (-1467.772) (-1475.993) [-1479.211] * (-1476.239) (-1472.863) [-1469.817] (-1479.547) -- 0:02:15
618500 -- (-1471.581) (-1471.752) [-1468.739] (-1473.311) * (-1478.194) (-1469.129) [-1469.047] (-1473.028) -- 0:02:15
619000 -- [-1469.128] (-1469.342) (-1472.655) (-1479.271) * [-1475.241] (-1482.556) (-1476.105) (-1471.773) -- 0:02:15
619500 -- [-1468.591] (-1483.511) (-1465.818) (-1469.322) * (-1470.623) (-1473.083) [-1478.929] (-1477.143) -- 0:02:15
620000 -- [-1469.240] (-1466.971) (-1481.317) (-1477.285) * [-1478.084] (-1474.734) (-1469.758) (-1468.142) -- 0:02:14
Average standard deviation of split frequencies: 0.011250
620500 -- (-1464.986) (-1469.597) (-1472.393) [-1472.551] * (-1478.624) (-1474.761) [-1474.294] (-1469.299) -- 0:02:15
621000 -- (-1478.711) (-1480.208) (-1480.845) [-1468.232] * (-1475.274) (-1468.620) [-1468.608] (-1472.291) -- 0:02:14
621500 -- (-1472.474) (-1491.241) [-1471.336] (-1472.732) * (-1475.310) [-1472.903] (-1471.858) (-1472.411) -- 0:02:14
622000 -- (-1467.135) (-1483.420) [-1469.584] (-1470.864) * (-1480.929) [-1466.605] (-1469.222) (-1466.775) -- 0:02:14
622500 -- (-1466.944) (-1486.036) [-1466.668] (-1470.198) * [-1464.128] (-1469.010) (-1471.704) (-1477.070) -- 0:02:14
623000 -- (-1470.335) (-1477.732) (-1478.020) [-1472.621] * (-1476.320) [-1473.896] (-1470.202) (-1476.626) -- 0:02:13
623500 -- (-1486.042) (-1478.621) (-1466.978) [-1468.518] * (-1472.088) [-1486.245] (-1474.915) (-1477.081) -- 0:02:14
624000 -- (-1481.978) (-1487.910) [-1472.052] (-1471.645) * [-1474.181] (-1478.787) (-1480.924) (-1481.018) -- 0:02:13
624500 -- (-1481.936) (-1476.804) [-1474.959] (-1477.493) * [-1467.575] (-1474.242) (-1468.182) (-1472.665) -- 0:02:13
625000 -- (-1476.482) (-1476.273) [-1471.326] (-1477.579) * (-1472.273) [-1465.048] (-1478.072) (-1470.564) -- 0:02:13
Average standard deviation of split frequencies: 0.010778
625500 -- [-1472.392] (-1475.445) (-1469.644) (-1470.375) * (-1470.520) [-1467.377] (-1471.765) (-1474.375) -- 0:02:12
626000 -- (-1478.894) (-1472.981) [-1475.566] (-1478.343) * [-1474.547] (-1475.913) (-1476.611) (-1471.395) -- 0:02:12
626500 -- (-1473.855) (-1470.497) [-1468.181] (-1479.341) * (-1467.306) [-1468.834] (-1469.393) (-1466.387) -- 0:02:12
627000 -- (-1467.075) (-1479.567) (-1474.151) [-1474.905] * (-1468.308) (-1484.866) [-1467.761] (-1483.083) -- 0:02:12
627500 -- (-1468.144) (-1473.355) (-1469.686) [-1470.238] * (-1474.557) (-1479.979) (-1470.985) [-1471.551] -- 0:02:12
628000 -- [-1469.387] (-1475.070) (-1463.781) (-1481.471) * [-1465.714] (-1478.588) (-1479.553) (-1470.690) -- 0:02:12
628500 -- [-1475.524] (-1468.670) (-1472.180) (-1480.772) * [-1468.406] (-1479.172) (-1478.300) (-1464.569) -- 0:02:11
629000 -- (-1471.360) (-1477.512) (-1471.773) [-1472.948] * [-1475.489] (-1472.263) (-1476.739) (-1483.513) -- 0:02:12
629500 -- [-1468.912] (-1470.413) (-1475.076) (-1469.467) * (-1471.152) (-1473.443) [-1472.788] (-1468.824) -- 0:02:11
630000 -- (-1466.422) (-1474.658) (-1475.443) [-1471.795] * (-1476.399) (-1484.558) [-1469.746] (-1475.884) -- 0:02:11
Average standard deviation of split frequencies: 0.010511
630500 -- (-1470.707) (-1470.409) [-1471.567] (-1473.191) * (-1474.016) (-1481.652) [-1471.615] (-1487.560) -- 0:02:11
631000 -- (-1474.533) (-1471.827) [-1467.575] (-1477.259) * (-1469.515) (-1471.486) [-1474.979] (-1481.114) -- 0:02:10
631500 -- (-1472.932) (-1471.737) [-1465.552] (-1478.593) * (-1472.691) [-1468.428] (-1472.847) (-1473.795) -- 0:02:10
632000 -- (-1475.487) (-1464.714) (-1475.939) [-1478.442] * (-1476.321) [-1470.668] (-1477.667) (-1469.107) -- 0:02:11
632500 -- [-1473.453] (-1482.403) (-1480.792) (-1480.859) * (-1472.498) [-1469.895] (-1484.278) (-1468.213) -- 0:02:10
633000 -- (-1468.315) [-1470.822] (-1475.269) (-1486.617) * [-1474.559] (-1469.959) (-1473.121) (-1466.281) -- 0:02:10
633500 -- (-1475.966) [-1475.526] (-1472.338) (-1474.225) * [-1469.942] (-1474.643) (-1470.212) (-1473.544) -- 0:02:10
634000 -- (-1480.080) [-1472.464] (-1471.380) (-1471.063) * [-1467.255] (-1471.971) (-1477.616) (-1479.307) -- 0:02:09
634500 -- (-1482.847) (-1477.572) (-1473.399) [-1472.011] * (-1470.931) (-1468.508) [-1465.235] (-1472.533) -- 0:02:10
635000 -- (-1489.423) (-1470.776) (-1481.776) [-1476.038] * (-1476.915) (-1473.416) [-1474.778] (-1468.640) -- 0:02:09
Average standard deviation of split frequencies: 0.010053
635500 -- (-1479.401) (-1471.538) [-1472.436] (-1466.645) * [-1469.782] (-1471.309) (-1473.223) (-1481.254) -- 0:02:09
636000 -- (-1477.862) [-1469.675] (-1466.165) (-1469.026) * (-1472.992) [-1473.165] (-1473.382) (-1474.180) -- 0:02:09
636500 -- (-1482.221) (-1475.930) (-1473.188) [-1471.355] * (-1469.286) [-1471.574] (-1480.751) (-1472.304) -- 0:02:09
637000 -- (-1487.022) [-1466.724] (-1470.297) (-1477.717) * [-1473.179] (-1468.994) (-1476.281) (-1471.982) -- 0:02:08
637500 -- (-1481.201) (-1476.131) [-1469.191] (-1465.009) * (-1484.707) (-1481.466) [-1477.483] (-1467.931) -- 0:02:09
638000 -- (-1488.343) (-1477.205) (-1472.527) [-1467.793] * [-1467.329] (-1467.846) (-1482.835) (-1476.300) -- 0:02:08
638500 -- (-1470.604) [-1470.509] (-1472.111) (-1476.413) * [-1475.481] (-1475.522) (-1474.959) (-1476.789) -- 0:02:08
639000 -- (-1467.947) (-1476.257) [-1464.148] (-1474.183) * [-1472.896] (-1466.636) (-1471.790) (-1481.347) -- 0:02:08
639500 -- (-1482.001) (-1470.836) (-1467.602) [-1470.677] * [-1466.966] (-1473.435) (-1475.667) (-1471.802) -- 0:02:07
640000 -- (-1474.915) (-1483.177) [-1465.116] (-1470.155) * (-1478.470) [-1474.656] (-1466.915) (-1469.942) -- 0:02:07
Average standard deviation of split frequencies: 0.010255
640500 -- [-1467.805] (-1473.074) (-1463.532) (-1478.118) * (-1476.923) [-1464.685] (-1473.512) (-1467.928) -- 0:02:07
641000 -- (-1473.052) [-1469.834] (-1476.189) (-1466.019) * (-1475.880) (-1467.396) [-1473.700] (-1473.796) -- 0:02:07
641500 -- (-1476.898) (-1475.754) [-1475.459] (-1473.391) * (-1471.918) [-1469.230] (-1485.658) (-1478.660) -- 0:02:07
642000 -- [-1478.598] (-1471.104) (-1473.325) (-1471.401) * [-1469.575] (-1471.609) (-1476.661) (-1476.338) -- 0:02:07
642500 -- (-1473.932) (-1471.862) (-1484.599) [-1475.440] * (-1469.808) (-1473.448) [-1470.596] (-1478.737) -- 0:02:06
643000 -- (-1472.447) (-1473.739) (-1480.108) [-1471.794] * (-1460.479) [-1471.537] (-1469.496) (-1470.395) -- 0:02:07
643500 -- (-1474.053) (-1475.728) (-1469.405) [-1476.114] * (-1471.841) [-1472.078] (-1474.772) (-1475.147) -- 0:02:06
644000 -- (-1477.760) [-1470.185] (-1472.105) (-1475.236) * (-1478.827) [-1470.729] (-1477.298) (-1480.098) -- 0:02:06
644500 -- [-1464.673] (-1481.594) (-1473.121) (-1467.603) * (-1473.217) (-1473.382) [-1473.095] (-1477.130) -- 0:02:06
645000 -- (-1478.427) (-1475.625) [-1466.228] (-1478.107) * (-1479.682) (-1480.586) (-1476.974) [-1472.035] -- 0:02:06
Average standard deviation of split frequencies: 0.009715
645500 -- (-1468.578) (-1480.082) [-1470.252] (-1473.292) * (-1475.235) [-1475.972] (-1475.816) (-1468.977) -- 0:02:05
646000 -- [-1467.844] (-1466.726) (-1477.071) (-1471.096) * (-1469.247) (-1469.391) [-1480.127] (-1473.487) -- 0:02:06
646500 -- (-1472.338) (-1484.232) (-1471.221) [-1472.758] * (-1477.596) (-1469.210) [-1480.199] (-1470.192) -- 0:02:05
647000 -- [-1468.002] (-1474.888) (-1465.348) (-1478.327) * (-1476.755) (-1475.111) (-1475.982) [-1463.876] -- 0:02:05
647500 -- (-1477.959) (-1482.445) (-1472.809) [-1477.657] * (-1470.451) [-1465.575] (-1478.100) (-1471.119) -- 0:02:05
648000 -- (-1476.681) (-1481.205) [-1470.012] (-1474.142) * (-1478.483) (-1480.415) [-1469.268] (-1477.609) -- 0:02:04
648500 -- (-1479.004) (-1474.548) (-1476.867) [-1475.799] * [-1473.086] (-1479.732) (-1470.402) (-1477.859) -- 0:02:04
649000 -- (-1467.470) (-1472.230) (-1474.649) [-1470.363] * (-1480.373) [-1473.643] (-1470.335) (-1472.922) -- 0:02:04
649500 -- (-1470.107) (-1478.817) [-1466.781] (-1467.818) * (-1482.836) (-1477.573) [-1471.994] (-1472.360) -- 0:02:04
650000 -- (-1472.478) (-1472.498) [-1474.877] (-1469.295) * (-1475.766) (-1480.311) [-1471.464] (-1476.554) -- 0:02:04
Average standard deviation of split frequencies: 0.009962
650500 -- [-1470.317] (-1471.071) (-1477.567) (-1472.154) * (-1473.083) (-1474.157) (-1470.459) [-1465.252] -- 0:02:04
651000 -- (-1476.809) [-1473.645] (-1479.272) (-1471.716) * (-1473.908) [-1462.718] (-1473.269) (-1470.253) -- 0:02:03
651500 -- (-1480.236) [-1471.332] (-1467.305) (-1480.829) * (-1483.302) [-1475.616] (-1477.898) (-1481.751) -- 0:02:04
652000 -- (-1468.844) (-1480.316) [-1468.655] (-1466.562) * (-1469.795) (-1471.900) [-1483.570] (-1475.142) -- 0:02:03
652500 -- (-1471.386) (-1471.897) [-1466.434] (-1475.491) * [-1477.476] (-1471.438) (-1479.624) (-1485.932) -- 0:02:03
653000 -- [-1478.196] (-1469.696) (-1469.059) (-1466.388) * [-1476.379] (-1470.625) (-1477.465) (-1469.031) -- 0:02:03
653500 -- [-1471.958] (-1473.571) (-1468.717) (-1467.833) * (-1471.360) (-1482.147) (-1477.556) [-1474.064] -- 0:02:03
654000 -- (-1477.069) (-1474.726) (-1470.996) [-1468.868] * (-1475.995) [-1470.622] (-1476.827) (-1479.613) -- 0:02:02
654500 -- (-1472.876) (-1466.126) (-1480.045) [-1464.736] * (-1475.602) [-1473.552] (-1477.985) (-1478.361) -- 0:02:02
655000 -- (-1478.990) (-1471.956) (-1474.000) [-1472.837] * (-1471.798) (-1473.202) [-1471.848] (-1475.725) -- 0:02:02
Average standard deviation of split frequencies: 0.009881
655500 -- (-1474.958) (-1483.593) (-1474.213) [-1476.170] * (-1481.166) (-1485.085) [-1470.990] (-1469.386) -- 0:02:02
656000 -- (-1474.542) [-1472.534] (-1485.211) (-1467.510) * (-1465.813) (-1473.514) (-1481.214) [-1467.202] -- 0:02:02
656500 -- (-1476.122) (-1474.410) (-1472.503) [-1468.130] * (-1478.976) [-1475.124] (-1483.358) (-1472.344) -- 0:02:01
657000 -- (-1478.409) (-1476.095) (-1479.928) [-1466.063] * (-1474.911) [-1472.153] (-1471.864) (-1473.798) -- 0:02:02
657500 -- (-1476.633) (-1479.291) [-1465.538] (-1472.370) * (-1473.689) (-1470.373) (-1469.317) [-1487.728] -- 0:02:01
658000 -- (-1476.317) [-1473.700] (-1482.038) (-1485.566) * (-1478.835) (-1472.399) (-1478.818) [-1474.356] -- 0:02:01
658500 -- (-1470.843) (-1485.740) [-1465.191] (-1482.035) * [-1465.736] (-1474.554) (-1466.274) (-1472.908) -- 0:02:01
659000 -- [-1476.370] (-1473.819) (-1474.877) (-1469.488) * (-1478.865) [-1472.491] (-1467.391) (-1471.271) -- 0:02:01
659500 -- [-1464.615] (-1478.196) (-1480.029) (-1476.272) * (-1473.786) (-1473.457) [-1466.636] (-1472.137) -- 0:02:00
660000 -- [-1471.707] (-1475.666) (-1473.570) (-1480.692) * [-1470.906] (-1473.100) (-1470.127) (-1481.277) -- 0:02:01
Average standard deviation of split frequencies: 0.009811
660500 -- (-1477.216) (-1481.279) (-1470.782) [-1465.699] * [-1466.518] (-1474.921) (-1475.900) (-1470.373) -- 0:02:00
661000 -- (-1464.413) [-1465.701] (-1474.040) (-1475.650) * (-1471.223) (-1471.591) [-1469.074] (-1473.136) -- 0:02:00
661500 -- (-1472.298) (-1479.551) (-1470.480) [-1476.843] * (-1471.974) (-1475.667) (-1464.829) [-1469.061] -- 0:02:00
662000 -- (-1464.395) (-1479.913) (-1480.842) [-1470.737] * (-1467.812) [-1474.195] (-1469.685) (-1474.248) -- 0:01:59
662500 -- (-1468.004) (-1475.302) [-1475.481] (-1474.929) * [-1472.874] (-1467.396) (-1476.018) (-1471.102) -- 0:01:59
663000 -- [-1472.385] (-1475.367) (-1471.387) (-1467.557) * (-1468.105) (-1474.902) [-1476.095] (-1484.179) -- 0:01:59
663500 -- (-1479.258) (-1476.358) [-1468.703] (-1474.876) * (-1472.480) [-1465.320] (-1467.872) (-1476.293) -- 0:01:59
664000 -- (-1473.917) (-1473.908) [-1476.966] (-1471.464) * (-1479.779) (-1469.345) (-1477.556) [-1468.529] -- 0:01:59
664500 -- (-1483.298) [-1468.782] (-1472.572) (-1473.201) * (-1473.844) [-1473.107] (-1471.402) (-1469.424) -- 0:01:59
665000 -- [-1471.851] (-1474.919) (-1470.574) (-1472.484) * (-1482.446) [-1472.179] (-1471.568) (-1471.473) -- 0:01:58
Average standard deviation of split frequencies: 0.010042
665500 -- (-1473.789) (-1474.275) [-1472.121] (-1479.433) * (-1472.146) (-1469.084) [-1470.242] (-1480.359) -- 0:01:59
666000 -- [-1474.906] (-1481.374) (-1468.718) (-1471.576) * (-1485.499) [-1472.262] (-1473.425) (-1472.805) -- 0:01:58
666500 -- (-1471.490) (-1469.381) (-1468.194) [-1468.339] * (-1474.946) (-1480.329) (-1479.836) [-1473.063] -- 0:01:58
667000 -- (-1471.794) [-1462.712] (-1481.082) (-1473.913) * (-1470.222) [-1471.007] (-1469.337) (-1473.246) -- 0:01:58
667500 -- (-1468.303) [-1463.748] (-1467.803) (-1479.094) * (-1480.407) [-1467.188] (-1485.551) (-1472.090) -- 0:01:58
668000 -- (-1473.458) (-1473.975) (-1469.883) [-1482.049] * (-1480.809) (-1472.664) [-1479.276] (-1471.522) -- 0:01:57
668500 -- (-1469.126) [-1471.582] (-1472.299) (-1470.934) * [-1467.535] (-1482.215) (-1474.102) (-1474.210) -- 0:01:58
669000 -- [-1466.664] (-1479.127) (-1468.042) (-1476.206) * [-1470.402] (-1478.515) (-1479.669) (-1469.600) -- 0:01:57
669500 -- [-1470.701] (-1472.429) (-1471.337) (-1471.074) * (-1478.622) [-1470.526] (-1468.037) (-1473.059) -- 0:01:57
670000 -- [-1473.892] (-1485.085) (-1476.092) (-1472.451) * (-1467.230) (-1479.617) [-1476.924] (-1473.762) -- 0:01:57
Average standard deviation of split frequencies: 0.010368
670500 -- (-1475.833) (-1478.672) (-1469.242) [-1466.868] * (-1478.815) [-1468.369] (-1479.732) (-1474.669) -- 0:01:56
671000 -- (-1480.381) [-1475.442] (-1478.141) (-1471.044) * [-1468.632] (-1469.288) (-1472.624) (-1477.796) -- 0:01:57
671500 -- [-1468.560] (-1479.486) (-1469.487) (-1474.381) * [-1466.328] (-1471.853) (-1471.780) (-1480.860) -- 0:01:56
672000 -- (-1483.537) (-1485.603) (-1488.007) [-1467.869] * (-1489.004) (-1466.691) (-1477.758) [-1469.013] -- 0:01:56
672500 -- [-1476.626] (-1475.802) (-1472.286) (-1483.411) * (-1467.402) [-1469.191] (-1479.529) (-1468.942) -- 0:01:56
673000 -- (-1472.516) (-1479.196) (-1479.727) [-1469.379] * [-1469.456] (-1470.331) (-1477.803) (-1466.662) -- 0:01:56
673500 -- (-1468.490) (-1471.388) [-1473.560] (-1488.364) * [-1469.973] (-1469.261) (-1477.821) (-1472.325) -- 0:01:55
674000 -- (-1478.377) (-1472.831) [-1476.062] (-1471.494) * (-1473.189) [-1475.347] (-1477.420) (-1471.469) -- 0:01:56
674500 -- [-1467.177] (-1470.654) (-1481.699) (-1471.047) * [-1470.736] (-1483.162) (-1471.796) (-1471.766) -- 0:01:55
675000 -- [-1464.386] (-1478.861) (-1477.478) (-1479.708) * (-1476.794) (-1468.510) (-1474.902) [-1471.543] -- 0:01:55
Average standard deviation of split frequencies: 0.009894
675500 -- [-1459.574] (-1478.879) (-1472.699) (-1471.798) * (-1474.832) (-1477.724) (-1478.558) [-1469.545] -- 0:01:55
676000 -- (-1463.235) (-1477.750) (-1470.116) [-1468.376] * [-1469.868] (-1475.595) (-1477.989) (-1469.382) -- 0:01:55
676500 -- (-1461.445) (-1473.843) [-1469.650] (-1473.851) * (-1478.827) [-1483.861] (-1481.399) (-1480.327) -- 0:01:54
677000 -- [-1474.420] (-1468.677) (-1467.805) (-1477.345) * [-1477.352] (-1483.429) (-1485.343) (-1484.036) -- 0:01:54
677500 -- (-1472.279) (-1473.781) (-1483.085) [-1466.992] * (-1468.217) (-1471.033) [-1476.148] (-1481.535) -- 0:01:54
678000 -- (-1477.613) (-1470.077) [-1482.797] (-1479.628) * (-1471.495) [-1469.904] (-1471.903) (-1477.552) -- 0:01:54
678500 -- (-1479.308) [-1470.987] (-1476.024) (-1471.200) * (-1480.099) [-1465.259] (-1480.464) (-1474.595) -- 0:01:54
679000 -- (-1473.015) [-1475.045] (-1468.379) (-1471.369) * (-1475.788) [-1473.180] (-1477.741) (-1471.339) -- 0:01:53
679500 -- (-1473.736) [-1465.855] (-1483.437) (-1472.925) * (-1475.202) (-1486.071) [-1476.551] (-1474.709) -- 0:01:54
680000 -- (-1474.987) (-1468.452) [-1470.580] (-1474.904) * [-1470.720] (-1473.465) (-1472.118) (-1480.296) -- 0:01:53
Average standard deviation of split frequencies: 0.009826
680500 -- [-1483.503] (-1479.292) (-1484.699) (-1488.267) * (-1472.510) [-1464.749] (-1472.575) (-1470.136) -- 0:01:53
681000 -- (-1477.141) (-1474.775) [-1469.577] (-1470.310) * (-1469.058) (-1480.545) [-1474.115] (-1476.937) -- 0:01:53
681500 -- (-1479.966) [-1476.319] (-1467.565) (-1471.025) * (-1477.362) (-1474.228) (-1478.182) [-1470.886] -- 0:01:53
682000 -- (-1477.347) [-1471.466] (-1478.118) (-1469.832) * (-1472.438) [-1470.044] (-1472.760) (-1480.849) -- 0:01:52
682500 -- (-1482.110) (-1472.853) (-1469.239) [-1470.414] * (-1469.324) (-1474.945) [-1469.565] (-1476.398) -- 0:01:53
683000 -- (-1466.903) (-1488.474) (-1471.207) [-1473.231] * (-1473.422) (-1471.606) [-1470.700] (-1470.834) -- 0:01:52
683500 -- (-1474.877) [-1473.206] (-1478.511) (-1475.332) * (-1473.237) [-1474.639] (-1469.185) (-1472.005) -- 0:01:52
684000 -- (-1467.908) [-1471.248] (-1478.156) (-1474.455) * (-1483.893) [-1468.337] (-1473.510) (-1471.729) -- 0:01:52
684500 -- [-1468.056] (-1473.279) (-1464.653) (-1473.167) * (-1465.300) (-1470.872) (-1469.033) [-1468.335] -- 0:01:52
685000 -- (-1477.581) (-1479.501) [-1472.186] (-1468.955) * (-1471.075) [-1474.253] (-1481.581) (-1471.706) -- 0:01:52
Average standard deviation of split frequencies: 0.008976
685500 -- (-1477.245) (-1475.758) (-1476.381) [-1473.297] * [-1466.486] (-1474.784) (-1473.872) (-1469.217) -- 0:01:51
686000 -- (-1468.030) (-1470.160) (-1474.605) [-1469.731] * (-1475.102) (-1473.940) [-1469.822] (-1473.907) -- 0:01:51
686500 -- (-1477.754) (-1472.202) [-1469.313] (-1477.450) * (-1473.983) (-1472.142) [-1465.794] (-1488.776) -- 0:01:51
687000 -- (-1481.043) [-1471.117] (-1473.093) (-1487.351) * (-1472.875) (-1472.006) [-1468.766] (-1471.531) -- 0:01:51
687500 -- (-1472.542) (-1471.211) [-1470.157] (-1480.573) * (-1472.913) (-1483.602) [-1463.917] (-1477.303) -- 0:01:51
688000 -- (-1469.093) [-1466.772] (-1470.248) (-1478.796) * (-1475.189) (-1483.854) [-1469.299] (-1476.038) -- 0:01:51
688500 -- (-1477.756) [-1472.040] (-1478.153) (-1472.926) * (-1481.501) (-1485.404) (-1475.421) [-1469.696] -- 0:01:50
689000 -- [-1471.097] (-1486.984) (-1477.958) (-1481.268) * (-1472.550) (-1471.003) (-1471.410) [-1468.028] -- 0:01:50
689500 -- (-1473.263) (-1470.862) (-1478.434) [-1464.718] * [-1466.679] (-1475.653) (-1478.994) (-1472.701) -- 0:01:50
690000 -- [-1482.229] (-1472.449) (-1467.549) (-1466.988) * (-1466.989) (-1465.111) [-1469.159] (-1488.093) -- 0:01:50
Average standard deviation of split frequencies: 0.008446
690500 -- (-1481.694) [-1468.973] (-1466.668) (-1481.710) * (-1479.413) (-1464.372) [-1467.221] (-1470.043) -- 0:01:50
691000 -- (-1474.232) [-1470.355] (-1475.753) (-1477.723) * (-1484.516) [-1470.034] (-1475.714) (-1474.097) -- 0:01:50
691500 -- (-1466.920) (-1474.991) [-1471.250] (-1478.177) * (-1485.958) (-1478.380) [-1468.138] (-1473.572) -- 0:01:49
692000 -- [-1479.371] (-1474.622) (-1477.113) (-1475.629) * (-1467.055) (-1485.739) [-1467.220] (-1469.530) -- 0:01:49
692500 -- [-1467.724] (-1469.779) (-1470.658) (-1472.646) * [-1471.379] (-1480.253) (-1472.301) (-1466.116) -- 0:01:49
693000 -- (-1482.622) (-1486.087) [-1483.999] (-1476.431) * (-1463.887) (-1472.821) (-1480.386) [-1466.891] -- 0:01:48
693500 -- (-1486.171) (-1476.789) [-1473.026] (-1475.845) * [-1481.841] (-1473.516) (-1474.063) (-1479.488) -- 0:01:49
694000 -- (-1482.986) (-1474.136) (-1473.404) [-1474.950] * [-1473.663] (-1472.403) (-1472.540) (-1478.739) -- 0:01:48
694500 -- (-1473.844) (-1474.714) [-1463.771] (-1469.820) * [-1470.942] (-1469.061) (-1470.915) (-1479.100) -- 0:01:48
695000 -- (-1477.712) [-1469.092] (-1474.596) (-1473.029) * (-1474.734) (-1476.528) (-1472.273) [-1474.255] -- 0:01:48
Average standard deviation of split frequencies: 0.008720
695500 -- (-1476.202) (-1474.787) [-1471.541] (-1469.509) * (-1465.987) [-1467.321] (-1472.819) (-1477.567) -- 0:01:48
696000 -- [-1466.809] (-1481.508) (-1476.142) (-1469.226) * (-1471.259) [-1470.907] (-1465.447) (-1479.940) -- 0:01:48
696500 -- (-1472.709) (-1475.315) (-1478.846) [-1471.455] * (-1475.063) (-1473.154) (-1485.763) [-1474.018] -- 0:01:48
697000 -- (-1470.226) [-1473.661] (-1473.366) (-1477.163) * [-1468.564] (-1481.831) (-1475.108) (-1478.357) -- 0:01:47
697500 -- (-1473.515) [-1473.533] (-1480.711) (-1484.662) * [-1468.632] (-1476.069) (-1473.985) (-1469.503) -- 0:01:47
698000 -- [-1473.693] (-1464.989) (-1474.583) (-1478.764) * (-1475.162) [-1472.202] (-1467.795) (-1475.140) -- 0:01:47
698500 -- (-1468.776) (-1471.127) (-1473.992) [-1471.150] * (-1478.488) (-1473.659) (-1474.483) [-1467.766] -- 0:01:47
699000 -- (-1472.900) (-1479.259) (-1473.213) [-1474.784] * (-1488.504) (-1471.351) [-1480.819] (-1481.102) -- 0:01:47
699500 -- (-1477.256) (-1470.932) [-1477.333] (-1476.566) * (-1463.133) (-1477.959) (-1477.873) [-1469.320] -- 0:01:46
700000 -- (-1485.463) [-1472.893] (-1475.112) (-1475.380) * (-1475.078) (-1471.240) (-1473.088) [-1467.338] -- 0:01:46
Average standard deviation of split frequencies: 0.008284
700500 -- (-1467.048) (-1472.216) [-1476.051] (-1476.081) * [-1468.081] (-1471.952) (-1469.296) (-1472.207) -- 0:01:46
701000 -- (-1475.737) [-1475.149] (-1471.200) (-1470.494) * (-1477.656) [-1471.309] (-1476.154) (-1472.166) -- 0:01:46
701500 -- (-1471.502) [-1469.448] (-1471.751) (-1480.031) * (-1473.799) [-1473.541] (-1480.052) (-1475.841) -- 0:01:46
702000 -- [-1473.639] (-1469.253) (-1489.904) (-1475.735) * (-1473.975) (-1476.625) (-1479.931) [-1468.872] -- 0:01:46
702500 -- (-1474.334) [-1473.628] (-1470.349) (-1483.340) * [-1471.984] (-1472.508) (-1477.151) (-1472.082) -- 0:01:45
703000 -- (-1479.952) (-1479.564) (-1474.641) [-1472.480] * (-1472.217) (-1481.081) [-1469.332] (-1471.582) -- 0:01:45
703500 -- (-1480.870) (-1475.872) [-1478.632] (-1475.676) * (-1471.073) (-1490.957) (-1475.957) [-1468.238] -- 0:01:45
704000 -- (-1476.619) [-1472.067] (-1465.716) (-1469.362) * [-1474.263] (-1471.847) (-1477.124) (-1481.099) -- 0:01:45
704500 -- (-1476.904) [-1476.839] (-1471.347) (-1477.217) * (-1475.375) (-1474.792) [-1471.710] (-1480.552) -- 0:01:45
705000 -- (-1485.046) (-1476.780) (-1463.984) [-1475.422] * [-1470.528] (-1474.301) (-1471.830) (-1478.878) -- 0:01:45
Average standard deviation of split frequencies: 0.008013
705500 -- (-1478.971) (-1467.177) (-1466.740) [-1471.749] * (-1481.201) [-1473.130] (-1467.993) (-1475.418) -- 0:01:44
706000 -- (-1473.524) (-1473.290) (-1468.688) [-1470.613] * (-1472.663) (-1480.985) (-1468.711) [-1469.563] -- 0:01:44
706500 -- (-1473.698) [-1468.477] (-1474.612) (-1473.321) * [-1465.881] (-1470.359) (-1468.421) (-1465.653) -- 0:01:44
707000 -- (-1476.507) (-1473.223) [-1466.252] (-1477.170) * (-1470.764) (-1467.260) (-1475.777) [-1472.460] -- 0:01:44
707500 -- (-1468.698) [-1474.322] (-1469.765) (-1475.309) * (-1481.391) (-1471.473) [-1468.476] (-1476.572) -- 0:01:44
708000 -- (-1478.006) [-1469.645] (-1477.151) (-1480.478) * (-1468.314) (-1472.479) [-1475.193] (-1478.914) -- 0:01:43
708500 -- (-1474.357) [-1480.436] (-1468.022) (-1478.529) * [-1468.968] (-1472.904) (-1469.054) (-1476.069) -- 0:01:43
709000 -- (-1476.762) (-1478.958) [-1476.144] (-1474.510) * (-1487.539) (-1475.584) [-1471.631] (-1478.185) -- 0:01:43
709500 -- (-1472.816) [-1480.225] (-1468.115) (-1479.337) * (-1469.882) (-1474.026) (-1472.521) [-1479.379] -- 0:01:43
710000 -- (-1485.490) (-1472.251) (-1472.194) [-1468.989] * [-1467.875] (-1487.656) (-1477.875) (-1471.572) -- 0:01:43
Average standard deviation of split frequencies: 0.008084
710500 -- (-1469.820) (-1475.281) [-1470.246] (-1470.544) * [-1469.226] (-1471.314) (-1483.149) (-1472.307) -- 0:01:43
711000 -- [-1471.692] (-1477.331) (-1470.432) (-1484.978) * (-1474.510) [-1471.282] (-1480.347) (-1486.058) -- 0:01:42
711500 -- (-1482.598) [-1463.623] (-1475.796) (-1475.644) * (-1474.289) (-1475.633) (-1480.857) [-1475.803] -- 0:01:42
712000 -- (-1479.512) (-1473.139) (-1479.495) [-1468.360] * [-1475.657] (-1476.136) (-1475.246) (-1478.318) -- 0:01:42
712500 -- (-1483.852) [-1476.109] (-1477.932) (-1476.470) * (-1482.638) (-1476.064) (-1470.562) [-1470.946] -- 0:01:42
713000 -- (-1479.937) (-1478.400) (-1482.711) [-1477.830] * (-1482.869) (-1476.785) (-1474.144) [-1472.181] -- 0:01:42
713500 -- [-1469.071] (-1477.222) (-1470.902) (-1470.031) * (-1485.984) (-1473.626) (-1478.028) [-1475.306] -- 0:01:41
714000 -- [-1468.624] (-1475.467) (-1478.892) (-1481.393) * (-1472.350) (-1488.816) (-1473.130) [-1474.028] -- 0:01:41
714500 -- (-1474.985) (-1473.350) (-1474.490) [-1475.505] * (-1478.198) (-1487.522) (-1479.752) [-1474.698] -- 0:01:41
715000 -- (-1482.681) (-1473.560) (-1480.467) [-1466.820] * (-1474.353) (-1471.237) [-1473.142] (-1480.616) -- 0:01:41
Average standard deviation of split frequencies: 0.008353
715500 -- (-1467.868) [-1473.453] (-1469.498) (-1467.355) * (-1479.038) (-1476.532) (-1475.474) [-1469.278] -- 0:01:41
716000 -- (-1468.250) (-1469.901) (-1480.543) [-1468.099] * (-1472.094) (-1478.172) (-1474.580) [-1477.961] -- 0:01:41
716500 -- (-1466.515) [-1474.326] (-1478.734) (-1468.649) * (-1473.540) (-1469.907) [-1478.795] (-1476.133) -- 0:01:40
717000 -- [-1474.821] (-1469.995) (-1477.325) (-1476.697) * (-1468.336) (-1468.708) [-1471.308] (-1477.454) -- 0:01:41
717500 -- (-1474.919) [-1473.796] (-1473.368) (-1482.672) * (-1469.819) [-1470.002] (-1470.727) (-1478.738) -- 0:01:40
718000 -- (-1480.009) [-1475.725] (-1476.005) (-1474.908) * (-1478.858) (-1480.587) (-1469.945) [-1468.873] -- 0:01:40
718500 -- (-1470.580) (-1478.614) [-1470.990] (-1481.619) * (-1473.408) [-1472.965] (-1473.869) (-1471.701) -- 0:01:40
719000 -- (-1473.577) (-1475.772) [-1471.953] (-1478.415) * (-1470.161) (-1473.005) [-1481.413] (-1474.425) -- 0:01:40
719500 -- (-1469.192) [-1473.758] (-1477.753) (-1469.807) * [-1471.027] (-1469.357) (-1472.774) (-1472.595) -- 0:01:39
720000 -- [-1466.818] (-1489.203) (-1470.668) (-1481.990) * [-1467.761] (-1474.779) (-1475.350) (-1480.576) -- 0:01:39
Average standard deviation of split frequencies: 0.008299
720500 -- (-1473.030) (-1470.403) (-1472.166) [-1475.400] * (-1472.502) [-1473.035] (-1476.317) (-1473.050) -- 0:01:39
721000 -- [-1469.219] (-1476.655) (-1468.671) (-1482.491) * (-1471.355) (-1463.679) [-1479.501] (-1477.286) -- 0:01:39
721500 -- (-1465.814) [-1469.327] (-1473.085) (-1475.728) * (-1475.229) (-1473.525) (-1469.762) [-1470.565] -- 0:01:39
722000 -- (-1469.359) (-1475.802) (-1463.150) [-1474.824] * [-1471.971] (-1470.232) (-1466.219) (-1475.805) -- 0:01:38
722500 -- (-1469.389) (-1483.517) [-1468.932] (-1481.711) * (-1476.429) (-1476.715) [-1473.837] (-1475.475) -- 0:01:39
723000 -- [-1464.288] (-1469.438) (-1468.659) (-1473.629) * [-1479.227] (-1470.117) (-1470.993) (-1471.496) -- 0:01:38
723500 -- (-1473.051) [-1472.282] (-1469.713) (-1467.295) * [-1474.198] (-1472.594) (-1473.086) (-1485.252) -- 0:01:38
724000 -- (-1472.778) (-1469.696) (-1469.205) [-1473.498] * [-1471.534] (-1476.397) (-1469.290) (-1477.521) -- 0:01:38
724500 -- (-1475.546) (-1472.944) [-1469.263] (-1474.594) * [-1476.315] (-1473.260) (-1475.434) (-1473.344) -- 0:01:38
725000 -- (-1472.784) [-1474.491] (-1472.110) (-1483.916) * [-1477.095] (-1470.672) (-1466.994) (-1474.027) -- 0:01:37
Average standard deviation of split frequencies: 0.008766
725500 -- (-1476.193) (-1479.703) [-1466.250] (-1480.698) * (-1471.727) [-1469.351] (-1474.281) (-1471.609) -- 0:01:37
726000 -- [-1466.839] (-1491.152) (-1471.033) (-1482.439) * (-1470.832) (-1470.809) [-1470.368] (-1470.636) -- 0:01:37
726500 -- (-1470.107) (-1477.506) [-1470.662] (-1476.091) * (-1475.604) (-1484.021) [-1471.971] (-1488.787) -- 0:01:37
727000 -- (-1474.156) (-1477.565) (-1477.520) [-1468.424] * (-1477.009) (-1480.257) (-1477.951) [-1472.685] -- 0:01:37
727500 -- (-1481.532) (-1472.641) (-1474.080) [-1477.002] * [-1469.168] (-1466.568) (-1477.330) (-1472.767) -- 0:01:37
728000 -- [-1475.831] (-1474.244) (-1469.177) (-1484.059) * (-1471.061) [-1470.407] (-1476.538) (-1476.403) -- 0:01:37
728500 -- (-1480.294) [-1479.150] (-1479.522) (-1471.215) * (-1479.257) (-1473.485) [-1478.101] (-1476.942) -- 0:01:36
729000 -- (-1478.706) (-1481.875) (-1477.762) [-1473.750] * [-1482.275] (-1475.867) (-1480.535) (-1471.505) -- 0:01:36
729500 -- (-1479.387) (-1468.420) (-1478.791) [-1471.959] * [-1470.158] (-1488.728) (-1475.147) (-1481.841) -- 0:01:36
730000 -- (-1476.234) (-1475.948) (-1469.174) [-1473.159] * [-1473.152] (-1487.019) (-1473.771) (-1470.108) -- 0:01:36
Average standard deviation of split frequencies: 0.008266
730500 -- (-1476.751) [-1471.871] (-1473.570) (-1479.925) * [-1469.460] (-1472.544) (-1469.234) (-1472.276) -- 0:01:35
731000 -- [-1472.931] (-1466.349) (-1475.696) (-1475.451) * (-1478.577) (-1473.342) (-1470.827) [-1473.161] -- 0:01:36
731500 -- (-1475.968) (-1471.914) (-1471.522) [-1473.867] * (-1470.462) [-1480.279] (-1470.104) (-1478.617) -- 0:01:35
732000 -- (-1469.694) [-1472.643] (-1478.499) (-1473.361) * (-1471.559) (-1477.130) [-1472.926] (-1477.617) -- 0:01:35
732500 -- (-1476.434) (-1472.237) [-1467.366] (-1480.943) * (-1478.391) [-1472.389] (-1473.638) (-1477.717) -- 0:01:35
733000 -- (-1465.001) (-1474.939) [-1466.969] (-1466.197) * (-1481.076) (-1479.323) [-1470.283] (-1470.389) -- 0:01:35
733500 -- [-1478.727] (-1477.076) (-1469.216) (-1474.888) * (-1477.358) (-1475.207) (-1468.644) [-1471.981] -- 0:01:35
734000 -- (-1469.867) [-1465.139] (-1465.758) (-1476.517) * (-1474.295) (-1474.683) (-1472.638) [-1473.863] -- 0:01:34
734500 -- [-1470.666] (-1475.389) (-1467.293) (-1471.348) * [-1474.000] (-1471.546) (-1474.676) (-1468.519) -- 0:01:34
735000 -- [-1468.128] (-1473.609) (-1472.585) (-1480.324) * (-1486.883) (-1469.477) (-1471.695) [-1467.147] -- 0:01:34
Average standard deviation of split frequencies: 0.007566
735500 -- (-1471.735) [-1473.718] (-1467.815) (-1485.127) * [-1476.943] (-1483.352) (-1473.142) (-1476.770) -- 0:01:34
736000 -- (-1480.476) (-1466.477) (-1474.816) [-1477.754] * (-1478.645) (-1477.975) (-1474.156) [-1471.537] -- 0:01:34
736500 -- (-1475.197) (-1469.751) [-1472.106] (-1475.281) * [-1476.286] (-1481.914) (-1464.009) (-1476.117) -- 0:01:34
737000 -- (-1474.075) (-1472.383) [-1462.527] (-1480.890) * (-1476.320) (-1479.461) [-1467.739] (-1472.340) -- 0:01:33
737500 -- [-1468.263] (-1475.349) (-1480.431) (-1483.380) * (-1482.347) (-1489.396) [-1467.431] (-1472.324) -- 0:01:33
738000 -- [-1470.635] (-1473.907) (-1471.529) (-1468.944) * [-1472.901] (-1475.170) (-1483.181) (-1473.316) -- 0:01:33
738500 -- (-1474.951) (-1482.119) (-1474.933) [-1480.527] * (-1466.495) (-1477.425) [-1473.155] (-1472.993) -- 0:01:33
739000 -- (-1474.260) [-1471.052] (-1478.934) (-1482.926) * [-1470.924] (-1474.594) (-1470.272) (-1473.431) -- 0:01:33
739500 -- (-1476.929) (-1470.425) [-1468.257] (-1474.072) * [-1466.424] (-1466.354) (-1477.473) (-1477.804) -- 0:01:32
740000 -- (-1481.626) (-1478.378) (-1470.095) [-1470.021] * (-1467.475) (-1472.872) (-1472.403) [-1472.293] -- 0:01:32
Average standard deviation of split frequencies: 0.007598
740500 -- (-1479.830) (-1469.049) (-1469.973) [-1471.325] * (-1478.086) [-1463.658] (-1480.676) (-1471.797) -- 0:01:32
741000 -- (-1470.269) [-1468.898] (-1475.249) (-1472.558) * [-1472.336] (-1466.769) (-1471.401) (-1476.474) -- 0:01:32
741500 -- (-1478.827) [-1469.815] (-1478.985) (-1485.025) * (-1475.969) (-1468.641) (-1470.686) [-1471.300] -- 0:01:32
742000 -- [-1470.501] (-1469.333) (-1480.270) (-1483.512) * (-1468.733) (-1467.672) [-1468.564] (-1483.577) -- 0:01:32
742500 -- [-1480.514] (-1470.492) (-1482.566) (-1468.460) * [-1468.515] (-1475.872) (-1476.817) (-1477.427) -- 0:01:31
743000 -- (-1478.086) [-1469.871] (-1474.311) (-1469.092) * [-1470.723] (-1472.455) (-1478.732) (-1485.254) -- 0:01:31
743500 -- (-1479.090) [-1470.292] (-1464.049) (-1477.879) * (-1467.829) [-1470.754] (-1475.249) (-1473.759) -- 0:01:31
744000 -- (-1478.896) (-1468.604) (-1477.825) [-1472.714] * [-1468.567] (-1475.622) (-1472.538) (-1486.680) -- 0:01:31
744500 -- (-1477.465) (-1473.253) [-1469.238] (-1477.448) * (-1466.960) (-1467.088) [-1469.413] (-1470.022) -- 0:01:31
745000 -- [-1468.134] (-1471.415) (-1468.790) (-1471.063) * [-1466.607] (-1466.912) (-1469.727) (-1483.170) -- 0:01:31
Average standard deviation of split frequencies: 0.007425
745500 -- (-1466.953) (-1469.869) (-1463.939) [-1474.589] * (-1474.647) [-1464.602] (-1473.899) (-1484.736) -- 0:01:30
746000 -- (-1470.614) [-1466.646] (-1468.622) (-1469.680) * [-1468.637] (-1469.832) (-1476.808) (-1477.246) -- 0:01:30
746500 -- (-1466.815) [-1476.650] (-1474.174) (-1479.177) * [-1469.216] (-1483.041) (-1475.813) (-1477.582) -- 0:01:30
747000 -- [-1468.102] (-1467.886) (-1471.713) (-1482.124) * (-1475.017) [-1472.255] (-1469.447) (-1479.396) -- 0:01:30
747500 -- (-1475.499) [-1470.273] (-1470.072) (-1483.443) * (-1480.639) (-1476.162) [-1471.479] (-1464.099) -- 0:01:30
748000 -- (-1478.910) [-1467.532] (-1498.337) (-1477.996) * (-1475.959) (-1473.641) (-1473.041) [-1473.746] -- 0:01:29
748500 -- [-1466.056] (-1475.812) (-1489.261) (-1473.414) * (-1475.785) [-1472.218] (-1473.439) (-1471.592) -- 0:01:29
749000 -- (-1479.826) (-1487.496) (-1472.243) [-1469.159] * (-1475.469) (-1477.810) [-1470.597] (-1472.115) -- 0:01:29
749500 -- (-1480.777) (-1484.215) (-1474.392) [-1466.005] * (-1474.110) [-1472.074] (-1474.630) (-1470.531) -- 0:01:29
750000 -- [-1471.312] (-1472.079) (-1473.982) (-1468.645) * (-1471.958) [-1473.826] (-1474.128) (-1465.398) -- 0:01:29
Average standard deviation of split frequencies: 0.006829
750500 -- (-1477.617) (-1470.748) (-1475.125) [-1472.479] * (-1474.394) (-1470.346) (-1481.886) [-1470.186] -- 0:01:29
751000 -- (-1470.504) (-1472.630) [-1464.451] (-1470.688) * [-1477.135] (-1475.045) (-1473.239) (-1469.508) -- 0:01:28
751500 -- (-1473.840) (-1476.943) (-1472.116) [-1470.829] * (-1475.745) (-1477.168) [-1470.506] (-1465.516) -- 0:01:28
752000 -- (-1470.330) (-1477.899) [-1467.184] (-1472.937) * [-1473.030] (-1478.555) (-1481.284) (-1465.194) -- 0:01:28
752500 -- (-1473.009) [-1477.115] (-1478.688) (-1486.224) * (-1471.264) [-1468.820] (-1476.539) (-1467.680) -- 0:01:28
753000 -- (-1476.249) (-1471.113) [-1468.556] (-1464.969) * (-1475.551) (-1475.005) (-1465.232) [-1470.095] -- 0:01:28
753500 -- (-1483.988) (-1477.672) [-1468.176] (-1472.489) * (-1476.002) (-1477.385) (-1466.544) [-1463.327] -- 0:01:28
754000 -- (-1485.974) (-1470.297) (-1468.306) [-1470.216] * (-1467.083) (-1472.717) [-1471.396] (-1473.905) -- 0:01:27
754500 -- (-1476.746) (-1481.728) (-1479.633) [-1468.579] * [-1472.782] (-1481.960) (-1469.170) (-1478.177) -- 0:01:27
755000 -- (-1473.772) (-1480.276) (-1475.660) [-1481.196] * (-1480.058) (-1474.532) [-1470.738] (-1471.684) -- 0:01:27
Average standard deviation of split frequencies: 0.006781
755500 -- (-1472.092) (-1481.131) (-1473.589) [-1466.112] * (-1474.885) (-1474.437) [-1475.000] (-1472.776) -- 0:01:27
756000 -- (-1476.775) [-1475.580] (-1474.864) (-1473.688) * [-1476.891] (-1472.498) (-1481.544) (-1472.971) -- 0:01:27
756500 -- (-1478.931) (-1493.519) (-1472.323) [-1478.887] * (-1474.211) (-1479.194) [-1477.448] (-1473.223) -- 0:01:26
757000 -- (-1480.843) (-1476.659) [-1474.302] (-1477.983) * (-1465.682) [-1469.075] (-1478.335) (-1468.049) -- 0:01:26
757500 -- (-1470.970) (-1473.265) [-1467.548] (-1470.667) * (-1472.923) (-1478.612) (-1480.259) [-1470.509] -- 0:01:26
758000 -- [-1468.551] (-1474.795) (-1471.754) (-1479.230) * (-1474.558) (-1489.202) (-1465.927) [-1467.026] -- 0:01:26
758500 -- (-1476.074) (-1465.574) (-1475.721) [-1473.149] * [-1468.228] (-1475.626) (-1475.772) (-1471.807) -- 0:01:26
759000 -- (-1473.132) [-1471.723] (-1475.835) (-1467.726) * (-1469.659) (-1467.472) (-1480.071) [-1479.751] -- 0:01:26
759500 -- (-1473.917) (-1476.593) (-1474.927) [-1466.672] * (-1472.069) (-1478.446) (-1488.670) [-1464.283] -- 0:01:25
760000 -- [-1474.693] (-1476.744) (-1479.485) (-1466.101) * (-1471.849) (-1480.530) [-1471.097] (-1468.843) -- 0:01:25
Average standard deviation of split frequencies: 0.006894
760500 -- (-1481.278) (-1488.442) (-1483.469) [-1465.800] * (-1475.402) (-1472.976) (-1466.930) [-1468.764] -- 0:01:25
761000 -- (-1479.311) (-1476.687) [-1468.242] (-1478.171) * (-1470.380) (-1466.504) (-1468.215) [-1465.218] -- 0:01:25
761500 -- (-1481.405) (-1475.111) [-1463.261] (-1469.423) * (-1469.525) (-1467.984) [-1471.425] (-1469.240) -- 0:01:25
762000 -- (-1483.090) (-1469.931) [-1465.979] (-1474.440) * (-1474.664) [-1467.759] (-1471.095) (-1465.431) -- 0:01:24
762500 -- (-1471.825) (-1478.336) (-1469.614) [-1467.542] * (-1475.798) (-1490.595) [-1468.426] (-1478.275) -- 0:01:24
763000 -- [-1478.023] (-1472.216) (-1471.865) (-1478.389) * (-1473.316) [-1472.502] (-1473.004) (-1467.262) -- 0:01:24
763500 -- (-1480.457) [-1467.593] (-1472.693) (-1471.697) * (-1483.061) [-1471.349] (-1471.939) (-1475.086) -- 0:01:24
764000 -- (-1484.843) (-1473.023) [-1468.313] (-1471.124) * (-1486.944) (-1473.803) (-1474.077) [-1468.929] -- 0:01:24
764500 -- (-1474.935) (-1479.413) (-1470.465) [-1470.685] * (-1481.358) [-1478.309] (-1471.979) (-1471.130) -- 0:01:24
765000 -- (-1482.019) [-1473.597] (-1473.622) (-1480.165) * (-1490.118) [-1472.921] (-1476.705) (-1471.090) -- 0:01:23
Average standard deviation of split frequencies: 0.007270
765500 -- (-1469.805) [-1466.961] (-1473.905) (-1473.799) * (-1470.491) (-1469.527) (-1478.322) [-1475.873] -- 0:01:23
766000 -- (-1480.624) [-1468.727] (-1477.620) (-1472.961) * [-1473.416] (-1480.400) (-1472.446) (-1476.652) -- 0:01:23
766500 -- (-1480.320) [-1478.517] (-1481.817) (-1474.769) * (-1467.303) [-1469.657] (-1475.494) (-1481.161) -- 0:01:23
767000 -- (-1483.883) (-1480.476) [-1471.837] (-1468.989) * (-1470.550) (-1473.629) [-1471.736] (-1479.491) -- 0:01:23
767500 -- (-1472.563) (-1471.502) [-1477.331] (-1475.304) * (-1478.892) [-1470.211] (-1475.158) (-1468.056) -- 0:01:23
768000 -- [-1470.485] (-1471.160) (-1482.615) (-1473.771) * [-1472.642] (-1475.875) (-1475.947) (-1482.241) -- 0:01:22
768500 -- [-1472.757] (-1468.224) (-1476.441) (-1470.621) * (-1474.656) (-1477.144) (-1469.205) [-1480.383] -- 0:01:22
769000 -- (-1466.604) (-1473.544) (-1479.634) [-1468.001] * (-1480.127) (-1485.677) [-1480.457] (-1473.057) -- 0:01:22
769500 -- [-1464.993] (-1473.472) (-1473.912) (-1478.665) * (-1482.016) [-1468.682] (-1487.656) (-1473.086) -- 0:01:22
770000 -- (-1470.944) (-1479.808) [-1473.280] (-1479.286) * (-1467.776) (-1475.750) (-1486.847) [-1468.520] -- 0:01:22
Average standard deviation of split frequencies: 0.006767
770500 -- [-1471.072] (-1473.113) (-1474.155) (-1483.006) * (-1475.753) [-1469.661] (-1475.984) (-1469.014) -- 0:01:21
771000 -- (-1472.906) [-1473.106] (-1467.498) (-1478.334) * (-1477.158) (-1474.279) (-1483.840) [-1471.047] -- 0:01:21
771500 -- (-1482.317) [-1475.471] (-1474.839) (-1473.034) * (-1474.338) (-1480.871) (-1473.330) [-1471.249] -- 0:01:21
772000 -- (-1471.493) (-1471.502) [-1470.719] (-1473.837) * (-1480.231) (-1470.269) [-1470.905] (-1467.679) -- 0:01:21
772500 -- [-1470.973] (-1480.156) (-1469.386) (-1477.578) * (-1484.520) [-1468.052] (-1475.368) (-1463.713) -- 0:01:21
773000 -- (-1477.935) [-1467.803] (-1470.933) (-1474.591) * (-1473.587) (-1478.602) [-1470.199] (-1477.038) -- 0:01:21
773500 -- (-1473.857) [-1474.438] (-1471.631) (-1471.825) * (-1473.707) (-1480.334) [-1466.993] (-1472.695) -- 0:01:20
774000 -- [-1467.233] (-1466.977) (-1467.133) (-1473.600) * (-1476.427) (-1471.035) [-1472.245] (-1480.252) -- 0:01:20
774500 -- (-1480.227) [-1465.477] (-1466.021) (-1471.960) * (-1467.392) (-1477.489) [-1467.307] (-1473.529) -- 0:01:20
775000 -- (-1472.733) (-1469.421) [-1481.959] (-1473.927) * (-1481.095) [-1472.612] (-1465.676) (-1470.886) -- 0:01:20
Average standard deviation of split frequencies: 0.007366
775500 -- (-1470.024) [-1472.090] (-1476.221) (-1471.087) * (-1476.465) (-1470.186) (-1469.672) [-1468.507] -- 0:01:20
776000 -- (-1475.669) (-1474.004) (-1475.827) [-1471.637] * [-1466.672] (-1468.453) (-1476.246) (-1475.305) -- 0:01:19
776500 -- (-1467.448) (-1473.123) [-1476.962] (-1472.660) * (-1471.430) (-1473.542) [-1473.358] (-1473.254) -- 0:01:20
777000 -- (-1476.458) (-1476.591) [-1472.586] (-1476.097) * (-1469.118) (-1473.585) [-1467.961] (-1490.243) -- 0:01:19
777500 -- (-1477.834) (-1482.074) (-1475.035) [-1473.678] * (-1468.394) (-1481.205) [-1472.820] (-1475.123) -- 0:01:19
778000 -- (-1475.897) (-1489.329) [-1463.766] (-1477.557) * (-1481.527) (-1473.837) (-1482.583) [-1467.586] -- 0:01:19
778500 -- (-1476.021) (-1470.600) [-1469.832] (-1480.965) * (-1477.512) (-1476.005) [-1475.088] (-1475.372) -- 0:01:19
779000 -- [-1473.666] (-1477.477) (-1471.323) (-1479.138) * [-1473.310] (-1472.261) (-1473.594) (-1472.261) -- 0:01:18
779500 -- (-1475.285) (-1471.313) (-1470.529) [-1476.912] * (-1470.775) [-1465.269] (-1472.446) (-1475.738) -- 0:01:18
780000 -- (-1467.843) (-1469.718) (-1479.845) [-1480.013] * (-1474.359) [-1469.833] (-1481.369) (-1476.116) -- 0:01:18
Average standard deviation of split frequencies: 0.007359
780500 -- (-1477.554) (-1471.825) (-1477.088) [-1473.050] * [-1469.275] (-1468.455) (-1483.644) (-1474.698) -- 0:01:18
781000 -- (-1474.144) (-1473.303) (-1473.993) [-1467.495] * (-1483.788) (-1483.882) (-1481.859) [-1467.391] -- 0:01:18
781500 -- [-1467.637] (-1478.318) (-1470.615) (-1475.822) * [-1473.824] (-1477.197) (-1467.270) (-1473.668) -- 0:01:18
782000 -- (-1475.079) (-1473.493) [-1472.279] (-1472.911) * (-1470.294) (-1477.301) (-1474.286) [-1478.720] -- 0:01:18
782500 -- (-1482.122) (-1471.254) (-1479.058) [-1468.616] * [-1471.305] (-1482.321) (-1476.367) (-1477.583) -- 0:01:17
783000 -- [-1474.587] (-1472.694) (-1464.507) (-1472.244) * (-1472.559) (-1466.243) (-1475.886) [-1479.736] -- 0:01:17
783500 -- (-1485.175) (-1476.746) (-1480.823) [-1475.612] * (-1469.393) [-1469.202] (-1470.285) (-1476.620) -- 0:01:17
784000 -- (-1481.103) (-1477.041) [-1468.928] (-1477.083) * (-1474.366) [-1475.572] (-1481.418) (-1479.306) -- 0:01:17
784500 -- [-1472.957] (-1482.317) (-1471.195) (-1471.535) * (-1478.015) [-1470.561] (-1478.226) (-1469.702) -- 0:01:16
785000 -- (-1483.438) [-1472.464] (-1473.983) (-1477.162) * (-1477.182) [-1472.650] (-1478.407) (-1477.684) -- 0:01:16
Average standard deviation of split frequencies: 0.007122
785500 -- (-1478.252) [-1465.893] (-1470.909) (-1472.621) * [-1473.008] (-1473.283) (-1483.195) (-1472.508) -- 0:01:16
786000 -- (-1470.328) [-1471.868] (-1478.932) (-1475.204) * (-1470.893) (-1469.072) [-1471.990] (-1478.126) -- 0:01:16
786500 -- (-1468.222) (-1483.423) (-1478.718) [-1475.054] * (-1470.897) (-1471.188) (-1471.356) [-1472.992] -- 0:01:16
787000 -- (-1471.562) [-1474.136] (-1475.989) (-1478.392) * (-1474.561) (-1471.194) (-1480.952) [-1469.067] -- 0:01:16
787500 -- (-1471.849) (-1477.003) [-1469.302] (-1484.879) * (-1482.485) [-1471.208] (-1474.355) (-1472.956) -- 0:01:16
788000 -- (-1476.787) (-1470.512) [-1464.434] (-1474.145) * (-1471.522) (-1482.298) (-1473.120) [-1475.634] -- 0:01:15
788500 -- (-1482.665) (-1471.084) (-1470.523) [-1467.135] * (-1467.704) (-1465.588) (-1469.635) [-1474.085] -- 0:01:15
789000 -- (-1472.378) (-1475.583) [-1471.136] (-1474.828) * (-1484.193) [-1468.843] (-1488.933) (-1473.335) -- 0:01:15
789500 -- [-1470.534] (-1468.822) (-1473.107) (-1478.794) * (-1471.589) (-1475.851) [-1478.269] (-1483.929) -- 0:01:15
790000 -- [-1464.706] (-1483.992) (-1475.187) (-1479.561) * (-1478.014) (-1474.658) (-1473.343) [-1476.429] -- 0:01:14
Average standard deviation of split frequencies: 0.007266
790500 -- (-1466.460) [-1478.990] (-1475.299) (-1479.270) * (-1468.198) (-1474.916) [-1470.415] (-1473.926) -- 0:01:15
791000 -- (-1467.742) (-1482.373) (-1476.087) [-1467.370] * (-1475.350) [-1466.412] (-1476.036) (-1469.336) -- 0:01:14
791500 -- (-1472.344) (-1469.058) [-1477.713] (-1488.601) * (-1484.160) (-1479.917) (-1467.515) [-1475.100] -- 0:01:14
792000 -- (-1473.596) (-1476.972) [-1475.557] (-1471.269) * (-1475.001) (-1477.443) [-1468.897] (-1472.982) -- 0:01:14
792500 -- (-1475.626) (-1470.208) (-1476.519) [-1465.633] * (-1474.507) (-1479.454) [-1469.476] (-1476.924) -- 0:01:14
793000 -- (-1477.018) (-1474.886) (-1480.160) [-1473.164] * (-1473.609) [-1473.048] (-1475.104) (-1479.918) -- 0:01:14
793500 -- (-1475.280) [-1474.643] (-1476.772) (-1474.299) * (-1467.318) [-1467.752] (-1477.341) (-1483.505) -- 0:01:13
794000 -- (-1474.412) [-1472.604] (-1467.991) (-1474.215) * (-1476.783) [-1471.519] (-1485.176) (-1478.275) -- 0:01:13
794500 -- (-1470.094) [-1470.133] (-1468.972) (-1477.866) * [-1471.078] (-1471.713) (-1474.651) (-1475.086) -- 0:01:13
795000 -- (-1476.342) (-1481.788) [-1479.881] (-1476.461) * (-1474.301) (-1470.683) (-1469.723) [-1471.047] -- 0:01:13
Average standard deviation of split frequencies: 0.007329
795500 -- (-1474.835) [-1471.714] (-1481.884) (-1475.077) * (-1478.144) (-1468.644) [-1477.583] (-1471.760) -- 0:01:13
796000 -- (-1487.015) [-1472.141] (-1471.866) (-1471.072) * (-1471.584) (-1473.441) (-1482.229) [-1470.573] -- 0:01:13
796500 -- (-1473.613) (-1465.557) (-1479.836) [-1478.812] * (-1472.401) [-1466.165] (-1476.599) (-1477.761) -- 0:01:12
797000 -- (-1479.675) (-1470.945) [-1473.617] (-1476.923) * [-1468.343] (-1475.959) (-1478.475) (-1471.479) -- 0:01:12
797500 -- (-1477.032) [-1477.035] (-1484.275) (-1478.457) * [-1468.897] (-1474.013) (-1474.918) (-1471.517) -- 0:01:12
798000 -- [-1470.204] (-1475.463) (-1466.050) (-1471.267) * (-1476.407) (-1475.757) (-1484.987) [-1474.154] -- 0:01:12
798500 -- [-1466.610] (-1476.603) (-1478.118) (-1472.698) * (-1471.271) (-1472.307) (-1496.100) [-1472.614] -- 0:01:12
799000 -- (-1476.630) [-1467.271] (-1472.536) (-1469.996) * (-1471.097) [-1477.526] (-1481.775) (-1472.557) -- 0:01:11
799500 -- (-1473.359) [-1472.265] (-1471.108) (-1464.767) * (-1470.804) (-1477.037) (-1465.837) [-1473.101] -- 0:01:11
800000 -- (-1472.094) [-1467.516] (-1487.027) (-1474.482) * (-1475.132) (-1477.584) [-1474.343] (-1480.560) -- 0:01:11
Average standard deviation of split frequencies: 0.007764
800500 -- (-1476.962) (-1473.649) (-1474.453) [-1468.460] * [-1469.341] (-1478.503) (-1476.679) (-1466.859) -- 0:01:11
801000 -- [-1485.738] (-1472.624) (-1476.285) (-1475.382) * (-1475.044) [-1477.213] (-1469.408) (-1470.050) -- 0:01:11
801500 -- [-1470.339] (-1477.072) (-1477.555) (-1476.141) * (-1473.817) [-1479.056] (-1467.568) (-1478.549) -- 0:01:11
802000 -- [-1475.814] (-1477.446) (-1467.290) (-1475.356) * [-1468.488] (-1471.047) (-1472.368) (-1478.044) -- 0:01:10
802500 -- [-1475.684] (-1478.335) (-1464.822) (-1486.243) * [-1467.481] (-1474.228) (-1478.711) (-1476.709) -- 0:01:10
803000 -- (-1465.014) (-1473.932) (-1478.307) [-1469.407] * (-1470.965) (-1479.987) (-1470.783) [-1468.838] -- 0:01:10
803500 -- [-1466.364] (-1480.282) (-1477.362) (-1477.600) * (-1480.224) (-1473.378) (-1472.024) [-1466.606] -- 0:01:10
804000 -- (-1470.789) (-1473.171) (-1478.016) [-1477.372] * (-1471.479) (-1474.666) [-1468.124] (-1471.714) -- 0:01:10
804500 -- (-1476.844) (-1473.027) [-1469.284] (-1472.423) * [-1467.000] (-1474.314) (-1467.815) (-1474.752) -- 0:01:09
805000 -- (-1471.170) (-1475.812) [-1470.366] (-1472.565) * (-1467.466) [-1471.131] (-1478.836) (-1472.530) -- 0:01:09
Average standard deviation of split frequencies: 0.008115
805500 -- (-1476.808) (-1467.952) [-1468.802] (-1469.104) * (-1481.843) (-1474.356) (-1475.380) [-1469.077] -- 0:01:09
806000 -- (-1473.156) (-1468.430) [-1471.941] (-1475.668) * (-1479.141) (-1469.059) [-1473.481] (-1471.497) -- 0:01:09
806500 -- (-1470.251) [-1464.323] (-1473.190) (-1476.124) * (-1478.471) (-1469.193) [-1478.713] (-1473.916) -- 0:01:09
807000 -- [-1473.442] (-1471.468) (-1482.392) (-1473.348) * (-1476.987) [-1470.475] (-1468.995) (-1474.939) -- 0:01:09
807500 -- (-1476.534) (-1474.813) [-1466.856] (-1480.207) * (-1469.397) (-1470.038) (-1477.143) [-1468.405] -- 0:01:08
808000 -- (-1473.061) (-1479.436) (-1478.214) [-1468.454] * (-1471.955) (-1471.974) (-1479.339) [-1475.786] -- 0:01:08
808500 -- [-1469.223] (-1472.172) (-1477.804) (-1472.469) * [-1471.348] (-1473.042) (-1477.924) (-1471.755) -- 0:01:08
809000 -- (-1478.253) (-1466.948) (-1467.157) [-1479.529] * (-1482.726) (-1471.283) (-1484.857) [-1467.639] -- 0:01:08
809500 -- (-1487.183) [-1472.647] (-1473.411) (-1474.078) * (-1470.045) (-1468.325) (-1473.799) [-1473.164] -- 0:01:08
810000 -- (-1477.305) (-1468.977) (-1470.745) [-1470.264] * [-1474.038] (-1471.328) (-1477.359) (-1480.730) -- 0:01:08
Average standard deviation of split frequencies: 0.007850
810500 -- (-1479.699) (-1473.317) [-1465.778] (-1472.964) * (-1480.505) [-1474.794] (-1470.183) (-1486.045) -- 0:01:07
811000 -- (-1472.637) (-1465.577) [-1469.943] (-1472.430) * (-1479.789) (-1481.769) (-1473.008) [-1477.281] -- 0:01:07
811500 -- [-1468.853] (-1470.503) (-1474.459) (-1472.889) * (-1475.198) [-1466.349] (-1468.318) (-1474.415) -- 0:01:07
812000 -- (-1467.081) [-1473.482] (-1471.832) (-1472.849) * (-1469.422) (-1469.282) (-1469.877) [-1474.246] -- 0:01:07
812500 -- [-1471.905] (-1472.218) (-1475.205) (-1476.194) * (-1474.718) (-1478.428) (-1466.803) [-1468.804] -- 0:01:07
813000 -- (-1464.371) (-1473.063) [-1467.859] (-1479.213) * (-1474.237) [-1471.580] (-1481.347) (-1469.869) -- 0:01:06
813500 -- (-1474.077) [-1467.635] (-1472.564) (-1478.433) * [-1467.833] (-1482.818) (-1472.915) (-1474.115) -- 0:01:06
814000 -- (-1471.972) [-1477.753] (-1478.039) (-1476.868) * (-1471.054) (-1472.289) (-1474.638) [-1470.436] -- 0:01:06
814500 -- (-1468.751) [-1480.729] (-1470.424) (-1474.485) * (-1480.463) [-1468.569] (-1468.800) (-1474.450) -- 0:01:06
815000 -- [-1478.272] (-1477.070) (-1473.486) (-1478.013) * (-1478.399) (-1480.959) [-1471.509] (-1478.143) -- 0:01:06
Average standard deviation of split frequencies: 0.008052
815500 -- (-1477.200) [-1470.685] (-1473.261) (-1476.476) * (-1469.541) (-1475.039) (-1471.850) [-1472.550] -- 0:01:06
816000 -- (-1472.357) (-1478.811) [-1463.821] (-1472.398) * (-1466.795) (-1471.203) [-1468.481] (-1465.654) -- 0:01:05
816500 -- (-1467.300) [-1468.349] (-1473.911) (-1472.474) * (-1478.617) (-1481.380) (-1474.584) [-1474.856] -- 0:01:05
817000 -- (-1472.839) (-1476.249) [-1473.702] (-1466.409) * [-1461.526] (-1474.706) (-1476.605) (-1468.625) -- 0:01:05
817500 -- (-1488.033) [-1475.831] (-1471.176) (-1476.814) * (-1477.096) (-1473.779) (-1476.413) [-1469.257] -- 0:01:05
818000 -- [-1471.631] (-1471.544) (-1467.516) (-1470.308) * (-1478.777) (-1470.706) (-1474.158) [-1473.678] -- 0:01:05
818500 -- (-1477.618) [-1475.067] (-1472.489) (-1476.570) * (-1470.494) (-1473.764) (-1472.917) [-1468.382] -- 0:01:04
819000 -- (-1468.376) (-1483.824) (-1472.344) [-1471.079] * [-1472.274] (-1473.744) (-1475.339) (-1480.308) -- 0:01:04
819500 -- (-1479.629) (-1482.729) [-1476.093] (-1473.219) * (-1472.651) (-1475.541) [-1480.296] (-1469.599) -- 0:01:04
820000 -- (-1477.206) (-1485.592) (-1474.466) [-1476.200] * (-1479.345) (-1482.626) [-1473.039] (-1471.906) -- 0:01:04
Average standard deviation of split frequencies: 0.008042
820500 -- (-1475.296) (-1473.207) (-1478.176) [-1461.794] * (-1473.558) [-1470.097] (-1475.852) (-1476.111) -- 0:01:04
821000 -- (-1471.725) (-1475.445) (-1478.613) [-1472.401] * (-1482.248) (-1469.150) (-1474.581) [-1470.036] -- 0:01:04
821500 -- (-1471.880) (-1476.094) (-1471.502) [-1473.141] * (-1475.938) (-1479.864) [-1471.980] (-1472.128) -- 0:01:03
822000 -- (-1465.642) (-1465.057) (-1476.476) [-1476.518] * [-1474.233] (-1479.038) (-1478.729) (-1478.434) -- 0:01:03
822500 -- (-1466.266) [-1469.812] (-1477.732) (-1467.272) * (-1473.369) [-1474.040] (-1480.713) (-1475.843) -- 0:01:03
823000 -- [-1464.548] (-1476.529) (-1465.354) (-1479.915) * (-1473.714) (-1483.439) [-1479.823] (-1476.316) -- 0:01:03
823500 -- [-1470.198] (-1465.785) (-1477.085) (-1474.108) * [-1479.852] (-1473.568) (-1482.220) (-1471.098) -- 0:01:03
824000 -- [-1470.464] (-1469.216) (-1473.664) (-1472.645) * [-1479.809] (-1474.686) (-1470.909) (-1470.578) -- 0:01:03
824500 -- (-1470.979) (-1473.371) (-1473.423) [-1475.374] * (-1477.856) (-1471.366) [-1476.522] (-1477.214) -- 0:01:02
825000 -- [-1470.305] (-1477.058) (-1473.599) (-1475.282) * (-1482.951) (-1476.871) [-1475.121] (-1474.558) -- 0:01:02
Average standard deviation of split frequencies: 0.008240
825500 -- (-1469.556) (-1474.603) [-1473.542] (-1480.448) * (-1478.575) (-1472.573) [-1471.010] (-1472.284) -- 0:01:02
826000 -- (-1473.107) [-1478.772] (-1466.918) (-1480.493) * (-1478.745) (-1470.512) (-1476.455) [-1476.255] -- 0:01:02
826500 -- [-1473.136] (-1480.466) (-1467.970) (-1475.109) * (-1470.020) (-1471.778) [-1475.211] (-1476.820) -- 0:01:02
827000 -- (-1469.583) (-1479.253) (-1473.184) [-1469.907] * (-1475.949) (-1472.732) [-1474.816] (-1478.399) -- 0:01:01
827500 -- [-1475.062] (-1473.797) (-1483.527) (-1473.289) * [-1470.322] (-1477.587) (-1480.826) (-1478.379) -- 0:01:01
828000 -- (-1467.932) (-1476.307) [-1478.207] (-1470.286) * (-1478.294) (-1485.505) (-1478.480) [-1469.553] -- 0:01:01
828500 -- (-1472.679) (-1469.373) [-1472.564] (-1468.044) * (-1467.032) [-1469.845] (-1487.822) (-1477.886) -- 0:01:01
829000 -- (-1472.014) (-1474.181) (-1483.260) [-1473.866] * [-1465.339] (-1480.808) (-1487.885) (-1468.672) -- 0:01:01
829500 -- (-1472.710) (-1471.883) [-1467.307] (-1475.188) * [-1466.003] (-1475.187) (-1476.813) (-1466.401) -- 0:01:01
830000 -- (-1472.400) [-1471.548] (-1478.552) (-1474.938) * [-1470.102] (-1469.704) (-1473.867) (-1472.022) -- 0:01:00
Average standard deviation of split frequencies: 0.008300
830500 -- (-1476.053) [-1468.337] (-1477.474) (-1479.461) * (-1487.561) (-1476.668) [-1467.798] (-1466.474) -- 0:01:00
831000 -- (-1473.147) (-1484.646) [-1466.177] (-1471.048) * [-1472.397] (-1470.085) (-1476.381) (-1474.620) -- 0:01:00
831500 -- (-1479.526) (-1485.576) [-1468.409] (-1473.626) * (-1488.839) [-1463.941] (-1473.935) (-1470.869) -- 0:01:00
832000 -- (-1473.368) (-1475.780) (-1472.948) [-1470.483] * [-1466.516] (-1484.001) (-1477.640) (-1479.216) -- 0:01:00
832500 -- (-1469.761) (-1475.298) (-1472.182) [-1471.078] * (-1470.447) (-1474.047) (-1471.129) [-1470.926] -- 0:00:59
833000 -- (-1483.899) (-1466.649) (-1471.180) [-1467.099] * (-1478.308) (-1477.393) [-1465.532] (-1473.535) -- 0:00:59
833500 -- (-1488.962) (-1474.146) [-1478.471] (-1472.569) * (-1479.076) [-1469.213] (-1469.830) (-1471.503) -- 0:00:59
834000 -- (-1481.218) (-1471.765) [-1472.042] (-1469.962) * (-1486.539) (-1466.912) (-1472.371) [-1478.156] -- 0:00:59
834500 -- [-1467.827] (-1473.145) (-1479.515) (-1480.733) * (-1464.479) (-1475.769) [-1472.588] (-1471.990) -- 0:00:59
835000 -- [-1475.152] (-1474.460) (-1466.507) (-1469.372) * (-1474.618) (-1479.228) (-1471.122) [-1470.572] -- 0:00:59
Average standard deviation of split frequencies: 0.008071
835500 -- (-1480.657) (-1477.724) [-1471.307] (-1472.536) * (-1473.479) [-1467.555] (-1467.558) (-1470.563) -- 0:00:58
836000 -- (-1484.490) (-1483.035) (-1473.698) [-1465.560] * (-1477.733) (-1474.111) (-1475.953) [-1470.933] -- 0:00:58
836500 -- (-1473.172) (-1481.649) [-1469.043] (-1465.314) * (-1467.185) (-1480.210) (-1480.167) [-1476.316] -- 0:00:58
837000 -- (-1473.084) (-1476.171) [-1474.225] (-1473.886) * [-1469.589] (-1475.636) (-1487.385) (-1481.828) -- 0:00:58
837500 -- (-1472.420) (-1475.478) (-1467.125) [-1473.665] * (-1476.695) (-1473.011) (-1473.853) [-1472.104] -- 0:00:58
838000 -- (-1481.915) (-1473.780) [-1464.189] (-1471.695) * (-1470.494) (-1475.920) [-1469.321] (-1476.517) -- 0:00:57
838500 -- (-1469.870) [-1472.703] (-1468.505) (-1479.778) * (-1488.666) (-1486.456) [-1473.166] (-1471.733) -- 0:00:57
839000 -- (-1475.480) (-1467.743) (-1472.833) [-1473.496] * [-1478.267] (-1482.914) (-1469.704) (-1475.730) -- 0:00:57
839500 -- (-1478.099) (-1479.700) [-1472.979] (-1484.722) * (-1481.855) [-1472.967] (-1477.906) (-1473.809) -- 0:00:57
840000 -- (-1472.316) (-1480.084) (-1469.131) [-1468.645] * (-1471.842) (-1474.134) (-1476.717) [-1472.883] -- 0:00:57
Average standard deviation of split frequencies: 0.008131
840500 -- [-1474.695] (-1472.845) (-1478.530) (-1469.553) * (-1469.460) [-1466.125] (-1469.094) (-1474.026) -- 0:00:57
841000 -- (-1471.219) [-1467.223] (-1476.547) (-1472.107) * (-1474.399) (-1476.701) [-1470.503] (-1484.021) -- 0:00:56
841500 -- (-1465.807) [-1468.199] (-1471.669) (-1473.699) * (-1471.026) (-1471.169) [-1465.889] (-1479.602) -- 0:00:56
842000 -- [-1480.146] (-1475.061) (-1483.245) (-1472.867) * (-1478.276) (-1469.325) [-1471.631] (-1485.819) -- 0:00:56
842500 -- (-1471.574) [-1466.981] (-1480.426) (-1475.118) * (-1470.418) [-1471.395] (-1479.338) (-1478.307) -- 0:00:56
843000 -- (-1470.343) (-1473.306) (-1481.765) [-1470.863] * [-1470.389] (-1472.221) (-1470.664) (-1486.308) -- 0:00:56
843500 -- [-1476.629] (-1467.689) (-1467.443) (-1473.314) * (-1476.129) [-1466.185] (-1472.318) (-1478.352) -- 0:00:56
844000 -- (-1482.869) (-1473.599) [-1470.247] (-1478.033) * (-1476.552) [-1472.652] (-1481.883) (-1469.932) -- 0:00:55
844500 -- (-1475.628) (-1470.336) [-1472.626] (-1482.425) * [-1471.257] (-1473.769) (-1484.652) (-1472.108) -- 0:00:55
845000 -- (-1470.832) (-1472.792) [-1475.635] (-1480.408) * (-1485.093) (-1474.489) (-1472.133) [-1472.917] -- 0:00:55
Average standard deviation of split frequencies: 0.007139
845500 -- (-1476.772) [-1478.012] (-1468.999) (-1481.948) * (-1485.589) [-1467.206] (-1470.195) (-1475.935) -- 0:00:55
846000 -- (-1481.286) (-1484.460) (-1473.600) [-1473.655] * [-1471.118] (-1472.731) (-1467.807) (-1477.152) -- 0:00:55
846500 -- (-1470.105) (-1486.214) (-1465.904) [-1468.060] * (-1476.649) (-1471.248) [-1465.192] (-1476.551) -- 0:00:54
847000 -- [-1468.628] (-1469.167) (-1472.505) (-1470.709) * (-1476.112) (-1477.837) (-1470.021) [-1474.372] -- 0:00:54
847500 -- (-1469.894) (-1470.900) (-1476.266) [-1471.133] * (-1483.944) (-1465.697) (-1463.775) [-1473.662] -- 0:00:54
848000 -- (-1472.900) (-1472.780) (-1477.575) [-1469.548] * (-1471.223) [-1470.980] (-1468.079) (-1467.646) -- 0:00:54
848500 -- (-1471.362) [-1471.149] (-1474.457) (-1470.909) * (-1470.792) [-1466.887] (-1483.247) (-1469.836) -- 0:00:54
849000 -- (-1467.683) (-1471.802) [-1469.196] (-1470.398) * (-1479.220) [-1465.908] (-1473.230) (-1480.092) -- 0:00:54
849500 -- (-1471.882) (-1470.010) (-1480.244) [-1477.106] * (-1484.730) (-1468.934) (-1469.526) [-1472.325] -- 0:00:53
850000 -- (-1473.685) (-1471.932) (-1474.961) [-1479.112] * [-1471.195] (-1475.294) (-1471.401) (-1478.306) -- 0:00:53
Average standard deviation of split frequencies: 0.007620
850500 -- [-1472.651] (-1481.566) (-1473.097) (-1469.647) * (-1472.199) (-1477.208) [-1466.802] (-1480.669) -- 0:00:53
851000 -- (-1478.254) (-1472.551) [-1471.355] (-1474.687) * [-1465.261] (-1471.861) (-1473.718) (-1467.779) -- 0:00:53
851500 -- (-1476.494) (-1477.645) [-1475.887] (-1480.903) * (-1467.753) (-1470.873) [-1470.276] (-1480.493) -- 0:00:53
852000 -- (-1466.086) (-1475.033) [-1476.566] (-1481.266) * [-1473.110] (-1473.762) (-1482.244) (-1467.853) -- 0:00:52
852500 -- (-1476.135) [-1470.518] (-1477.372) (-1482.999) * (-1471.803) (-1482.256) [-1466.885] (-1477.636) -- 0:00:52
853000 -- (-1473.677) [-1472.712] (-1468.579) (-1472.353) * (-1482.341) [-1471.862] (-1475.081) (-1477.409) -- 0:00:52
853500 -- (-1471.301) (-1483.498) [-1470.343] (-1471.474) * (-1477.796) (-1470.722) (-1471.931) [-1467.276] -- 0:00:52
854000 -- (-1477.754) [-1472.261] (-1477.397) (-1477.965) * (-1477.078) (-1472.039) (-1480.675) [-1464.898] -- 0:00:52
854500 -- (-1476.785) (-1464.900) (-1471.208) [-1479.100] * (-1468.747) (-1470.377) (-1481.116) [-1475.351] -- 0:00:52
855000 -- [-1472.532] (-1476.020) (-1478.007) (-1475.119) * [-1467.975] (-1472.130) (-1482.969) (-1489.387) -- 0:00:51
Average standard deviation of split frequencies: 0.007675
855500 -- (-1475.868) [-1474.413] (-1474.522) (-1478.455) * (-1476.699) [-1467.230] (-1485.092) (-1484.085) -- 0:00:51
856000 -- (-1470.112) (-1471.355) [-1470.069] (-1478.056) * (-1478.503) [-1471.290] (-1480.743) (-1472.827) -- 0:00:51
856500 -- (-1476.272) [-1468.269] (-1477.072) (-1474.339) * (-1474.967) [-1471.107] (-1475.161) (-1474.420) -- 0:00:51
857000 -- [-1472.526] (-1476.293) (-1473.229) (-1475.693) * (-1477.381) (-1478.571) (-1471.215) [-1467.252] -- 0:00:51
857500 -- (-1474.584) (-1479.833) [-1468.335] (-1486.481) * (-1480.982) [-1468.139] (-1481.345) (-1478.508) -- 0:00:51
858000 -- [-1468.604] (-1471.741) (-1472.440) (-1480.400) * (-1476.163) [-1473.819] (-1478.863) (-1482.591) -- 0:00:50
858500 -- (-1473.822) (-1478.408) [-1469.699] (-1480.153) * [-1477.641] (-1465.543) (-1478.158) (-1477.442) -- 0:00:50
859000 -- (-1477.096) (-1478.406) [-1470.865] (-1479.013) * (-1479.536) (-1470.322) (-1477.165) [-1469.334] -- 0:00:50
859500 -- (-1475.293) (-1467.752) (-1471.308) [-1476.419] * [-1467.113] (-1473.169) (-1471.060) (-1473.642) -- 0:00:50
860000 -- [-1474.320] (-1472.571) (-1472.281) (-1478.357) * (-1471.565) (-1477.131) [-1474.287] (-1475.622) -- 0:00:50
Average standard deviation of split frequencies: 0.007976
860500 -- (-1475.400) (-1472.093) (-1476.957) [-1472.404] * (-1473.183) (-1465.114) (-1481.329) [-1470.266] -- 0:00:49
861000 -- (-1469.398) [-1468.572] (-1473.683) (-1475.096) * [-1477.097] (-1469.046) (-1472.214) (-1469.068) -- 0:00:49
861500 -- (-1474.160) (-1476.857) (-1470.994) [-1467.810] * (-1471.286) (-1473.499) (-1475.163) [-1472.541] -- 0:00:49
862000 -- (-1468.987) (-1471.690) (-1477.146) [-1470.385] * (-1473.029) (-1474.658) (-1476.543) [-1475.338] -- 0:00:49
862500 -- [-1481.569] (-1471.019) (-1470.342) (-1471.476) * (-1468.272) [-1468.727] (-1480.216) (-1475.508) -- 0:00:49
863000 -- (-1471.289) (-1477.005) [-1468.044] (-1481.955) * (-1467.329) (-1473.855) (-1470.074) [-1470.233] -- 0:00:49
863500 -- (-1470.670) (-1483.702) [-1471.653] (-1482.433) * (-1479.429) (-1472.969) (-1470.836) [-1468.566] -- 0:00:48
864000 -- (-1482.757) (-1470.384) [-1465.223] (-1472.417) * [-1468.927] (-1473.482) (-1469.821) (-1471.547) -- 0:00:48
864500 -- (-1484.505) (-1479.839) (-1474.782) [-1468.176] * (-1483.367) [-1466.506] (-1475.529) (-1482.869) -- 0:00:48
865000 -- (-1474.234) (-1479.095) [-1471.395] (-1479.311) * (-1478.782) (-1482.091) [-1476.440] (-1490.146) -- 0:00:48
Average standard deviation of split frequencies: 0.007621
865500 -- (-1472.666) [-1466.717] (-1465.581) (-1470.986) * (-1467.386) [-1480.013] (-1470.629) (-1471.907) -- 0:00:48
866000 -- (-1474.352) [-1463.550] (-1473.442) (-1476.467) * [-1465.227] (-1479.412) (-1489.850) (-1469.715) -- 0:00:47
866500 -- [-1466.344] (-1472.612) (-1471.375) (-1478.072) * [-1469.180] (-1475.128) (-1473.680) (-1476.212) -- 0:00:47
867000 -- (-1468.097) (-1475.022) (-1470.411) [-1465.809] * (-1469.880) (-1470.601) [-1473.053] (-1482.185) -- 0:00:47
867500 -- (-1476.064) (-1470.064) (-1473.064) [-1472.400] * (-1466.568) (-1472.546) (-1470.179) [-1471.777] -- 0:00:47
868000 -- (-1473.303) [-1465.245] (-1471.599) (-1474.052) * (-1466.785) (-1477.456) [-1469.152] (-1470.460) -- 0:00:47
868500 -- (-1471.487) (-1471.160) (-1469.618) [-1473.233] * (-1474.224) [-1465.474] (-1473.827) (-1468.283) -- 0:00:47
869000 -- (-1469.569) [-1473.995] (-1480.026) (-1471.694) * (-1483.643) (-1468.975) [-1479.874] (-1473.489) -- 0:00:46
869500 -- [-1468.532] (-1474.792) (-1473.834) (-1475.365) * (-1468.985) [-1471.366] (-1476.142) (-1468.166) -- 0:00:46
870000 -- [-1475.396] (-1473.617) (-1475.357) (-1479.632) * [-1474.228] (-1472.662) (-1476.612) (-1477.018) -- 0:00:46
Average standard deviation of split frequencies: 0.007682
870500 -- (-1480.192) (-1476.577) [-1468.549] (-1483.129) * (-1468.821) (-1470.469) (-1473.025) [-1472.518] -- 0:00:46
871000 -- (-1469.604) [-1470.688] (-1468.468) (-1479.602) * (-1480.767) (-1472.919) [-1474.757] (-1483.473) -- 0:00:46
871500 -- [-1474.115] (-1471.216) (-1464.732) (-1471.926) * (-1474.236) (-1472.971) (-1471.249) [-1481.313] -- 0:00:46
872000 -- [-1469.871] (-1478.405) (-1472.253) (-1487.649) * [-1474.018] (-1473.585) (-1473.085) (-1476.770) -- 0:00:45
872500 -- (-1473.940) (-1474.252) [-1472.670] (-1472.111) * (-1472.719) [-1466.561] (-1476.298) (-1473.074) -- 0:00:45
873000 -- (-1470.030) [-1469.241] (-1472.872) (-1471.099) * (-1472.647) (-1469.802) (-1479.251) [-1469.256] -- 0:00:45
873500 -- [-1466.429] (-1478.417) (-1465.868) (-1470.101) * [-1468.355] (-1474.473) (-1477.852) (-1471.070) -- 0:00:45
874000 -- (-1472.999) [-1468.616] (-1469.511) (-1473.721) * (-1475.164) (-1478.858) [-1471.479] (-1471.204) -- 0:00:45
874500 -- [-1472.746] (-1475.837) (-1474.096) (-1474.408) * (-1473.283) [-1474.075] (-1470.915) (-1473.899) -- 0:00:44
875000 -- (-1475.709) (-1471.223) [-1474.910] (-1478.148) * (-1475.450) [-1472.479] (-1475.118) (-1468.038) -- 0:00:44
Average standard deviation of split frequencies: 0.007433
875500 -- (-1476.908) (-1473.507) [-1478.158] (-1473.219) * [-1471.284] (-1472.699) (-1471.338) (-1467.073) -- 0:00:44
876000 -- [-1472.246] (-1475.172) (-1475.670) (-1474.036) * (-1480.208) (-1475.886) (-1476.830) [-1477.521] -- 0:00:44
876500 -- [-1474.161] (-1472.899) (-1472.607) (-1476.523) * (-1475.417) (-1467.150) (-1467.226) [-1467.903] -- 0:00:44
877000 -- (-1467.058) (-1472.449) [-1471.009] (-1471.110) * (-1472.035) (-1472.100) [-1470.331] (-1474.472) -- 0:00:44
877500 -- [-1470.544] (-1473.068) (-1481.304) (-1477.327) * (-1478.134) [-1466.224] (-1472.501) (-1487.021) -- 0:00:43
878000 -- (-1473.927) (-1471.110) [-1477.430] (-1473.153) * (-1476.198) (-1466.931) (-1478.415) [-1462.746] -- 0:00:43
878500 -- [-1476.480] (-1488.327) (-1474.014) (-1466.450) * (-1485.408) (-1473.309) (-1484.889) [-1477.209] -- 0:00:43
879000 -- (-1475.877) (-1471.044) [-1467.290] (-1470.539) * (-1482.339) (-1475.115) [-1474.796] (-1470.821) -- 0:00:43
879500 -- (-1482.038) (-1469.712) [-1476.113] (-1479.302) * (-1478.098) (-1475.022) (-1470.347) [-1469.624] -- 0:00:43
880000 -- (-1476.741) (-1473.546) [-1472.406] (-1483.809) * [-1472.292] (-1473.519) (-1479.612) (-1472.634) -- 0:00:42
Average standard deviation of split frequencies: 0.007427
880500 -- [-1472.094] (-1487.548) (-1475.951) (-1469.219) * [-1473.218] (-1467.990) (-1482.666) (-1476.674) -- 0:00:42
881000 -- (-1468.519) (-1479.890) [-1467.783] (-1473.582) * (-1467.748) (-1469.904) [-1472.637] (-1475.489) -- 0:00:42
881500 -- (-1478.352) (-1475.851) (-1471.422) [-1469.522] * (-1472.770) (-1474.166) [-1468.692] (-1471.568) -- 0:00:42
882000 -- [-1466.714] (-1474.966) (-1472.689) (-1479.043) * (-1473.691) (-1476.023) [-1475.375] (-1470.149) -- 0:00:42
882500 -- (-1480.296) (-1479.045) [-1472.393] (-1474.388) * (-1479.669) (-1470.487) [-1483.348] (-1475.760) -- 0:00:42
883000 -- (-1471.109) (-1470.922) [-1472.577] (-1473.215) * (-1481.012) [-1470.805] (-1473.975) (-1477.159) -- 0:00:41
883500 -- (-1476.510) [-1474.077] (-1480.911) (-1467.109) * [-1470.997] (-1466.120) (-1467.427) (-1471.698) -- 0:00:41
884000 -- (-1464.074) [-1467.379] (-1475.405) (-1470.862) * (-1473.596) [-1470.038] (-1473.384) (-1476.580) -- 0:00:41
884500 -- (-1482.404) (-1474.383) [-1470.431] (-1467.220) * (-1470.833) (-1469.626) [-1485.178] (-1479.876) -- 0:00:41
885000 -- (-1473.518) (-1472.971) [-1472.080] (-1478.096) * (-1470.490) [-1471.806] (-1473.652) (-1470.012) -- 0:00:41
Average standard deviation of split frequencies: 0.007848
885500 -- (-1478.348) (-1483.172) (-1469.412) [-1466.382] * [-1475.822] (-1467.723) (-1472.120) (-1465.272) -- 0:00:40
886000 -- (-1485.808) [-1474.023] (-1480.909) (-1464.694) * (-1470.195) (-1470.838) [-1466.508] (-1469.362) -- 0:00:40
886500 -- (-1471.537) [-1472.423] (-1469.110) (-1474.980) * (-1469.601) [-1474.148] (-1471.265) (-1470.399) -- 0:00:40
887000 -- (-1474.553) (-1469.573) [-1473.569] (-1482.251) * [-1464.530] (-1473.443) (-1474.465) (-1468.569) -- 0:00:40
887500 -- (-1471.441) (-1470.290) (-1476.844) [-1475.231] * [-1472.948] (-1473.438) (-1477.697) (-1477.608) -- 0:00:40
888000 -- (-1473.688) (-1475.878) [-1472.021] (-1479.303) * (-1478.098) (-1477.560) [-1470.583] (-1466.511) -- 0:00:40
888500 -- (-1480.653) (-1469.257) [-1467.737] (-1472.237) * [-1472.769] (-1467.719) (-1473.531) (-1467.081) -- 0:00:39
889000 -- (-1474.094) [-1469.991] (-1469.334) (-1479.036) * (-1473.193) (-1471.879) (-1479.658) [-1477.882] -- 0:00:39
889500 -- (-1479.295) [-1475.784] (-1469.133) (-1472.009) * (-1472.597) (-1480.982) (-1474.531) [-1470.862] -- 0:00:39
890000 -- (-1474.966) (-1474.616) (-1471.887) [-1473.997] * (-1470.187) (-1493.183) [-1469.795] (-1481.631) -- 0:00:39
Average standard deviation of split frequencies: 0.007840
890500 -- (-1472.479) (-1484.669) [-1474.995] (-1469.428) * (-1467.510) (-1476.732) [-1475.418] (-1472.046) -- 0:00:39
891000 -- (-1471.245) (-1477.914) [-1467.377] (-1471.283) * (-1464.176) (-1476.294) (-1470.519) [-1463.878] -- 0:00:39
891500 -- [-1475.068] (-1474.352) (-1468.839) (-1477.454) * (-1476.793) [-1481.886] (-1463.333) (-1463.896) -- 0:00:38
892000 -- (-1471.794) [-1468.188] (-1472.588) (-1479.764) * (-1479.080) (-1481.525) [-1466.575] (-1473.220) -- 0:00:38
892500 -- (-1472.392) [-1482.631] (-1473.614) (-1481.390) * (-1463.094) (-1471.950) [-1476.827] (-1472.514) -- 0:00:38
893000 -- (-1473.262) (-1481.564) (-1475.898) [-1472.705] * (-1476.273) (-1465.378) [-1472.882] (-1480.924) -- 0:00:38
893500 -- (-1476.470) [-1476.401] (-1479.619) (-1472.860) * (-1473.688) [-1470.264] (-1474.080) (-1474.333) -- 0:00:38
894000 -- (-1470.559) (-1483.075) (-1480.821) [-1475.436] * [-1474.799] (-1487.719) (-1467.904) (-1469.787) -- 0:00:37
894500 -- (-1463.396) (-1474.951) (-1474.923) [-1470.977] * (-1474.058) (-1472.283) [-1469.218] (-1476.815) -- 0:00:37
895000 -- (-1470.912) (-1483.012) [-1474.948] (-1470.979) * (-1483.392) (-1470.220) (-1475.983) [-1474.480] -- 0:00:37
Average standard deviation of split frequencies: 0.007399
895500 -- (-1486.331) (-1480.233) [-1471.002] (-1473.395) * (-1482.905) (-1476.650) (-1472.350) [-1475.658] -- 0:00:37
896000 -- [-1474.036] (-1474.325) (-1467.565) (-1475.031) * (-1481.910) (-1474.136) [-1477.799] (-1480.254) -- 0:00:37
896500 -- (-1470.402) [-1473.361] (-1479.736) (-1469.321) * (-1472.014) [-1475.208] (-1472.407) (-1465.789) -- 0:00:37
897000 -- (-1469.867) (-1471.990) [-1466.570] (-1474.691) * [-1476.233] (-1481.876) (-1471.064) (-1474.881) -- 0:00:36
897500 -- [-1469.000] (-1484.062) (-1470.986) (-1472.835) * [-1475.950] (-1472.909) (-1476.482) (-1481.913) -- 0:00:36
898000 -- (-1476.781) (-1465.268) [-1469.648] (-1473.170) * (-1466.033) (-1484.786) [-1468.631] (-1484.413) -- 0:00:36
898500 -- (-1476.935) (-1471.217) (-1480.740) [-1475.387] * [-1467.325] (-1477.462) (-1472.871) (-1487.987) -- 0:00:36
899000 -- (-1474.725) (-1476.857) [-1472.870] (-1475.701) * (-1469.077) (-1468.388) (-1467.393) [-1463.828] -- 0:00:36
899500 -- (-1470.664) (-1474.534) [-1474.318] (-1476.236) * (-1472.734) (-1475.508) [-1464.827] (-1489.446) -- 0:00:35
900000 -- (-1473.636) (-1475.155) [-1474.899] (-1471.065) * (-1477.439) [-1471.727] (-1476.346) (-1474.144) -- 0:00:35
Average standard deviation of split frequencies: 0.007164
900500 -- [-1469.273] (-1474.202) (-1477.854) (-1469.947) * (-1476.348) [-1468.283] (-1471.809) (-1473.392) -- 0:00:35
901000 -- (-1466.621) (-1482.564) [-1469.044] (-1473.014) * (-1475.181) [-1466.841] (-1475.701) (-1476.023) -- 0:00:35
901500 -- (-1474.713) (-1478.983) (-1470.254) [-1464.949] * (-1472.228) (-1477.227) (-1465.269) [-1476.527] -- 0:00:35
902000 -- [-1470.538] (-1480.138) (-1469.996) (-1474.338) * (-1466.361) (-1475.565) (-1487.101) [-1476.283] -- 0:00:35
902500 -- [-1483.727] (-1481.134) (-1470.072) (-1466.344) * (-1468.320) (-1469.327) [-1469.072] (-1473.266) -- 0:00:34
903000 -- [-1476.827] (-1481.566) (-1465.965) (-1473.145) * (-1478.918) [-1465.783] (-1481.919) (-1484.498) -- 0:00:34
903500 -- (-1474.158) (-1478.221) (-1475.026) [-1470.418] * [-1467.227] (-1477.371) (-1471.257) (-1471.212) -- 0:00:34
904000 -- (-1473.394) [-1478.477] (-1468.457) (-1480.692) * [-1470.405] (-1472.900) (-1467.888) (-1484.883) -- 0:00:34
904500 -- (-1474.007) [-1473.897] (-1477.798) (-1483.783) * (-1483.383) [-1472.621] (-1475.210) (-1472.640) -- 0:00:34
905000 -- (-1480.342) (-1481.122) [-1468.748] (-1491.656) * (-1478.173) [-1470.456] (-1472.986) (-1466.477) -- 0:00:34
Average standard deviation of split frequencies: 0.006862
905500 -- (-1473.265) [-1474.279] (-1470.904) (-1470.295) * (-1478.284) [-1469.519] (-1470.038) (-1476.143) -- 0:00:33
906000 -- (-1480.489) (-1471.796) (-1473.526) [-1470.538] * [-1478.807] (-1481.907) (-1476.258) (-1469.276) -- 0:00:33
906500 -- (-1475.882) (-1469.949) [-1465.977] (-1470.771) * (-1479.849) (-1474.004) (-1468.550) [-1468.178] -- 0:00:33
907000 -- (-1473.712) (-1476.845) (-1485.054) [-1472.048] * [-1470.025] (-1477.610) (-1474.398) (-1467.778) -- 0:00:33
907500 -- (-1468.391) (-1465.934) (-1472.791) [-1471.990] * (-1471.803) (-1474.661) [-1471.483] (-1473.682) -- 0:00:33
908000 -- (-1464.075) [-1471.023] (-1474.334) (-1474.123) * [-1471.582] (-1475.313) (-1467.809) (-1466.900) -- 0:00:32
908500 -- (-1477.720) (-1476.655) (-1481.247) [-1472.925] * (-1467.410) [-1466.108] (-1473.237) (-1474.356) -- 0:00:32
909000 -- [-1472.880] (-1479.481) (-1486.577) (-1474.942) * (-1480.250) [-1473.774] (-1480.314) (-1476.736) -- 0:00:32
909500 -- (-1473.637) (-1488.432) (-1467.830) [-1467.493] * (-1475.565) (-1478.910) [-1475.651] (-1475.315) -- 0:00:32
910000 -- (-1473.079) (-1484.058) (-1475.825) [-1463.912] * (-1470.778) (-1468.855) (-1469.546) [-1475.261] -- 0:00:32
Average standard deviation of split frequencies: 0.006762
910500 -- [-1469.760] (-1480.148) (-1466.692) (-1474.809) * [-1476.722] (-1478.342) (-1469.633) (-1472.235) -- 0:00:32
911000 -- (-1470.801) (-1469.682) (-1466.443) [-1471.282] * [-1483.054] (-1487.392) (-1473.207) (-1471.254) -- 0:00:31
911500 -- (-1482.128) (-1468.873) [-1470.462] (-1472.920) * [-1464.651] (-1474.230) (-1475.386) (-1482.081) -- 0:00:31
912000 -- (-1473.641) (-1474.173) [-1468.011] (-1468.656) * (-1472.408) (-1476.658) (-1474.600) [-1471.265] -- 0:00:31
912500 -- (-1473.743) [-1468.113] (-1467.439) (-1474.147) * [-1468.928] (-1482.050) (-1475.201) (-1479.155) -- 0:00:31
913000 -- [-1467.798] (-1487.797) (-1474.397) (-1468.712) * [-1466.770] (-1471.963) (-1479.828) (-1475.527) -- 0:00:31
913500 -- [-1468.484] (-1473.379) (-1469.503) (-1476.666) * (-1466.862) (-1482.343) (-1470.821) [-1469.976] -- 0:00:30
914000 -- [-1472.315] (-1477.604) (-1472.304) (-1471.266) * [-1468.033] (-1472.555) (-1481.627) (-1477.138) -- 0:00:30
914500 -- (-1472.612) (-1472.099) [-1471.588] (-1478.452) * (-1473.290) [-1477.921] (-1473.480) (-1474.124) -- 0:00:30
915000 -- (-1470.373) (-1471.265) [-1470.934] (-1472.814) * (-1465.401) (-1469.380) (-1483.252) [-1476.673] -- 0:00:30
Average standard deviation of split frequencies: 0.006787
915500 -- (-1481.160) (-1469.732) (-1476.785) [-1467.225] * [-1464.294] (-1483.647) (-1478.862) (-1469.011) -- 0:00:30
916000 -- (-1480.067) (-1490.723) (-1478.160) [-1480.881] * (-1468.256) (-1471.944) (-1484.538) [-1475.228] -- 0:00:30
916500 -- (-1473.077) (-1479.474) [-1472.210] (-1474.259) * (-1474.593) (-1473.003) (-1478.838) [-1470.487] -- 0:00:29
917000 -- (-1479.959) [-1469.189] (-1471.490) (-1479.400) * (-1474.299) (-1471.762) (-1478.778) [-1471.510] -- 0:00:29
917500 -- (-1468.871) [-1476.397] (-1476.108) (-1482.824) * (-1469.842) (-1473.937) (-1484.360) [-1478.401] -- 0:00:29
918000 -- (-1479.265) [-1466.891] (-1469.476) (-1474.486) * (-1470.376) [-1469.946] (-1470.127) (-1476.739) -- 0:00:29
918500 -- [-1473.936] (-1480.038) (-1473.350) (-1482.158) * (-1477.525) (-1475.426) [-1469.688] (-1474.710) -- 0:00:29
919000 -- [-1470.396] (-1472.817) (-1478.356) (-1475.488) * (-1474.734) (-1473.196) (-1477.106) [-1476.349] -- 0:00:28
919500 -- (-1473.343) [-1470.119] (-1484.665) (-1480.073) * [-1468.812] (-1474.820) (-1484.665) (-1474.066) -- 0:00:28
920000 -- (-1475.366) [-1473.489] (-1480.215) (-1488.830) * (-1472.152) [-1466.590] (-1486.091) (-1466.340) -- 0:00:28
Average standard deviation of split frequencies: 0.006560
920500 -- (-1477.759) (-1475.570) [-1476.798] (-1486.865) * (-1471.910) [-1473.763] (-1472.981) (-1477.932) -- 0:00:28
921000 -- (-1471.823) (-1480.882) [-1469.204] (-1472.830) * (-1475.780) (-1471.733) [-1465.850] (-1473.812) -- 0:00:28
921500 -- (-1484.960) (-1469.319) [-1470.930] (-1472.513) * (-1476.096) (-1468.722) [-1469.255] (-1478.801) -- 0:00:28
922000 -- (-1473.720) [-1484.924] (-1469.467) (-1481.930) * (-1479.511) (-1479.922) (-1470.498) [-1476.947] -- 0:00:27
922500 -- [-1477.171] (-1479.452) (-1472.138) (-1477.720) * (-1466.154) (-1474.613) [-1475.135] (-1474.127) -- 0:00:27
923000 -- (-1471.046) [-1469.900] (-1473.562) (-1472.082) * (-1471.996) (-1473.034) [-1467.353] (-1474.468) -- 0:00:27
923500 -- [-1472.493] (-1478.383) (-1480.975) (-1475.990) * (-1467.562) (-1474.730) [-1464.454] (-1467.827) -- 0:00:27
924000 -- (-1476.589) [-1476.476] (-1477.859) (-1467.305) * [-1468.873] (-1466.271) (-1480.631) (-1467.002) -- 0:00:27
924500 -- [-1476.522] (-1480.007) (-1472.722) (-1472.488) * (-1474.262) [-1472.098] (-1472.852) (-1474.065) -- 0:00:27
925000 -- [-1477.587] (-1479.223) (-1473.532) (-1474.325) * [-1477.448] (-1469.671) (-1465.574) (-1468.951) -- 0:00:26
Average standard deviation of split frequencies: 0.006141
925500 -- (-1472.354) (-1481.381) [-1474.238] (-1468.991) * (-1476.675) (-1480.865) (-1474.705) [-1471.281] -- 0:00:26
926000 -- (-1475.680) [-1479.859] (-1473.219) (-1473.057) * (-1474.718) (-1473.152) [-1473.440] (-1479.422) -- 0:00:26
926500 -- (-1481.163) [-1476.508] (-1481.101) (-1473.665) * (-1482.129) (-1480.222) [-1474.474] (-1472.814) -- 0:00:26
927000 -- (-1473.296) (-1473.854) [-1466.654] (-1471.655) * [-1471.086] (-1473.032) (-1468.620) (-1477.838) -- 0:00:26
927500 -- (-1483.091) [-1469.746] (-1472.034) (-1470.834) * (-1480.697) (-1472.682) [-1473.342] (-1472.139) -- 0:00:25
928000 -- (-1474.377) (-1478.646) (-1479.295) [-1467.466] * (-1478.388) (-1483.632) [-1472.863] (-1473.774) -- 0:00:25
928500 -- (-1469.586) (-1477.776) (-1466.324) [-1468.723] * [-1471.364] (-1470.697) (-1473.434) (-1476.835) -- 0:00:25
929000 -- (-1464.996) (-1472.443) (-1472.512) [-1476.817] * (-1471.298) (-1468.548) (-1471.623) [-1471.625] -- 0:00:25
929500 -- [-1466.256] (-1471.295) (-1471.401) (-1471.477) * (-1473.121) (-1483.425) (-1481.629) [-1473.457] -- 0:00:25
930000 -- [-1469.563] (-1497.515) (-1474.116) (-1468.323) * [-1472.047] (-1477.756) (-1473.819) (-1467.088) -- 0:00:25
Average standard deviation of split frequencies: 0.005983
930500 -- (-1473.793) (-1473.404) [-1469.685] (-1468.300) * [-1469.643] (-1471.220) (-1470.036) (-1467.821) -- 0:00:24
931000 -- [-1471.110] (-1471.871) (-1473.210) (-1480.397) * (-1473.720) (-1484.637) [-1479.657] (-1482.748) -- 0:00:24
931500 -- (-1466.751) [-1466.503] (-1470.600) (-1468.364) * (-1471.148) (-1471.941) [-1472.280] (-1488.433) -- 0:00:24
932000 -- (-1477.879) (-1472.910) [-1476.207] (-1470.260) * (-1475.145) (-1470.717) [-1472.897] (-1480.834) -- 0:00:24
932500 -- (-1475.415) [-1474.547] (-1473.219) (-1471.101) * (-1476.188) [-1467.166] (-1479.034) (-1488.932) -- 0:00:24
933000 -- (-1473.321) (-1477.456) [-1470.366] (-1469.293) * [-1471.556] (-1464.581) (-1471.564) (-1476.266) -- 0:00:23
933500 -- [-1482.250] (-1481.174) (-1470.404) (-1476.724) * (-1477.109) [-1470.250] (-1468.140) (-1487.045) -- 0:00:23
934000 -- (-1474.589) (-1479.917) (-1470.494) [-1468.062] * (-1468.958) [-1480.932] (-1478.154) (-1468.040) -- 0:00:23
934500 -- (-1478.206) [-1473.993] (-1468.222) (-1469.245) * (-1473.750) (-1472.145) (-1472.632) [-1468.894] -- 0:00:23
935000 -- (-1473.883) (-1473.258) [-1470.535] (-1473.547) * (-1473.100) [-1468.517] (-1477.204) (-1479.761) -- 0:00:23
Average standard deviation of split frequencies: 0.005981
935500 -- (-1475.636) [-1471.555] (-1472.551) (-1494.278) * [-1467.265] (-1470.429) (-1476.560) (-1475.503) -- 0:00:23
936000 -- (-1475.520) [-1475.452] (-1471.181) (-1486.681) * (-1483.795) [-1464.862] (-1474.433) (-1472.000) -- 0:00:22
936500 -- [-1476.917] (-1465.723) (-1472.463) (-1468.257) * [-1471.630] (-1469.282) (-1471.329) (-1470.012) -- 0:00:22
937000 -- (-1482.446) (-1480.213) (-1471.627) [-1471.273] * (-1464.324) (-1490.656) [-1470.455] (-1476.913) -- 0:00:22
937500 -- [-1475.130] (-1473.309) (-1477.322) (-1481.063) * [-1474.004] (-1477.267) (-1473.373) (-1482.604) -- 0:00:22
938000 -- [-1478.433] (-1472.807) (-1468.555) (-1470.055) * (-1467.234) [-1469.275] (-1472.463) (-1474.569) -- 0:00:22
938500 -- (-1477.701) (-1478.772) (-1473.503) [-1472.268] * (-1474.414) (-1473.625) [-1477.127] (-1485.340) -- 0:00:22
939000 -- (-1475.469) [-1467.118] (-1473.557) (-1474.319) * (-1477.696) (-1475.225) [-1475.186] (-1472.917) -- 0:00:21
939500 -- (-1475.588) (-1469.841) [-1476.588] (-1471.466) * [-1474.923] (-1479.019) (-1473.296) (-1474.124) -- 0:00:21
940000 -- [-1466.895] (-1469.089) (-1474.218) (-1470.232) * (-1473.409) [-1472.184] (-1486.711) (-1469.846) -- 0:00:21
Average standard deviation of split frequencies: 0.005826
940500 -- (-1477.986) [-1474.347] (-1468.703) (-1474.626) * (-1478.754) [-1471.144] (-1471.182) (-1483.218) -- 0:00:21
941000 -- (-1470.665) (-1469.746) [-1469.232] (-1473.509) * (-1470.091) (-1472.320) [-1467.383] (-1470.381) -- 0:00:21
941500 -- [-1474.111] (-1471.440) (-1469.484) (-1471.856) * (-1477.316) [-1475.656] (-1475.337) (-1470.640) -- 0:00:20
942000 -- (-1469.612) (-1467.773) (-1475.790) [-1471.162] * [-1471.218] (-1478.603) (-1478.137) (-1473.407) -- 0:00:20
942500 -- (-1476.953) (-1473.206) (-1476.679) [-1468.939] * [-1470.302] (-1471.849) (-1475.412) (-1470.984) -- 0:00:20
943000 -- (-1483.586) (-1474.226) [-1473.959] (-1472.721) * (-1477.240) (-1469.817) (-1471.403) [-1479.154] -- 0:00:20
943500 -- (-1476.305) (-1480.502) [-1474.931] (-1475.865) * (-1473.725) (-1472.660) [-1479.386] (-1472.444) -- 0:00:20
944000 -- (-1471.286) [-1466.907] (-1473.613) (-1473.312) * (-1469.177) (-1477.758) [-1475.846] (-1473.054) -- 0:00:20
944500 -- (-1469.051) [-1471.897] (-1467.407) (-1473.005) * [-1467.968] (-1468.886) (-1484.645) (-1469.867) -- 0:00:19
945000 -- (-1476.898) (-1477.917) [-1469.635] (-1477.022) * (-1464.924) [-1469.278] (-1479.831) (-1472.453) -- 0:00:19
Average standard deviation of split frequencies: 0.005388
945500 -- [-1469.087] (-1471.527) (-1472.865) (-1481.143) * (-1481.667) (-1472.424) [-1468.941] (-1475.487) -- 0:00:19
946000 -- (-1471.424) (-1470.392) (-1474.022) [-1472.339] * [-1479.203] (-1471.555) (-1474.269) (-1476.281) -- 0:00:19
946500 -- (-1483.620) [-1475.905] (-1479.916) (-1471.612) * (-1471.841) (-1476.400) (-1469.784) [-1477.609] -- 0:00:19
947000 -- (-1473.301) [-1473.387] (-1471.946) (-1467.864) * [-1469.764] (-1473.291) (-1480.102) (-1473.306) -- 0:00:18
947500 -- (-1473.694) (-1478.508) (-1471.127) [-1467.346] * [-1473.289] (-1470.128) (-1474.250) (-1490.767) -- 0:00:18
948000 -- (-1470.631) (-1480.262) [-1474.379] (-1470.838) * (-1472.705) (-1473.748) (-1476.216) [-1471.419] -- 0:00:18
948500 -- (-1474.121) (-1481.208) (-1477.339) [-1480.880] * [-1475.719] (-1475.131) (-1476.678) (-1470.106) -- 0:00:18
949000 -- (-1469.448) [-1469.582] (-1472.525) (-1475.929) * (-1474.394) (-1469.292) [-1469.226] (-1478.259) -- 0:00:18
949500 -- (-1478.265) (-1479.288) [-1470.548] (-1472.662) * (-1473.159) [-1473.332] (-1480.737) (-1470.346) -- 0:00:18
950000 -- [-1476.960] (-1473.943) (-1479.244) (-1476.008) * (-1473.206) (-1474.981) (-1474.814) [-1466.828] -- 0:00:17
Average standard deviation of split frequencies: 0.005702
950500 -- (-1479.272) [-1470.589] (-1478.491) (-1472.501) * [-1468.519] (-1471.857) (-1477.917) (-1468.974) -- 0:00:17
951000 -- [-1470.504] (-1469.845) (-1481.662) (-1469.551) * [-1470.554] (-1473.266) (-1476.005) (-1474.578) -- 0:00:17
951500 -- (-1469.740) (-1475.083) [-1476.724] (-1468.660) * (-1467.397) [-1467.903] (-1474.921) (-1481.575) -- 0:00:17
952000 -- [-1470.946] (-1470.289) (-1465.837) (-1475.846) * [-1463.100] (-1469.743) (-1470.531) (-1477.841) -- 0:00:17
952500 -- (-1475.228) (-1476.219) (-1475.923) [-1467.752] * (-1478.511) (-1471.142) (-1472.308) [-1473.478] -- 0:00:17
953000 -- (-1468.086) (-1477.076) (-1480.992) [-1474.567] * (-1471.650) (-1467.969) [-1470.158] (-1480.437) -- 0:00:16
953500 -- (-1471.606) (-1471.045) (-1471.562) [-1473.374] * [-1472.760] (-1473.654) (-1466.183) (-1468.532) -- 0:00:16
954000 -- (-1475.859) [-1470.622] (-1475.345) (-1473.191) * (-1473.047) [-1465.551] (-1474.497) (-1466.329) -- 0:00:16
954500 -- (-1482.715) (-1476.839) [-1472.173] (-1471.364) * (-1474.091) [-1467.480] (-1470.274) (-1474.643) -- 0:00:16
955000 -- (-1469.425) [-1466.366] (-1473.792) (-1470.109) * (-1484.163) [-1472.174] (-1476.236) (-1474.209) -- 0:00:16
Average standard deviation of split frequencies: 0.005979
955500 -- (-1475.502) [-1475.917] (-1482.179) (-1478.742) * (-1467.495) (-1470.629) [-1470.055] (-1469.312) -- 0:00:15
956000 -- [-1477.497] (-1469.036) (-1476.025) (-1481.215) * (-1473.222) (-1474.570) (-1471.044) [-1471.174] -- 0:00:15
956500 -- (-1470.425) (-1477.092) [-1473.368] (-1474.586) * [-1461.050] (-1477.429) (-1471.806) (-1462.480) -- 0:00:15
957000 -- (-1473.104) (-1474.648) [-1474.148] (-1474.996) * [-1466.886] (-1474.061) (-1470.158) (-1470.722) -- 0:00:15
957500 -- [-1474.255] (-1472.696) (-1471.092) (-1475.531) * (-1477.253) [-1474.757] (-1468.046) (-1484.932) -- 0:00:15
958000 -- [-1466.349] (-1482.698) (-1475.032) (-1469.654) * (-1472.443) (-1471.724) [-1468.357] (-1470.645) -- 0:00:15
958500 -- (-1469.436) [-1477.564] (-1475.802) (-1477.241) * (-1478.433) (-1474.962) (-1475.842) [-1470.770] -- 0:00:14
959000 -- (-1477.205) (-1473.305) (-1471.423) [-1465.270] * (-1470.315) [-1467.172] (-1478.101) (-1474.072) -- 0:00:14
959500 -- (-1480.544) (-1470.110) [-1470.532] (-1476.232) * (-1474.637) (-1475.808) (-1472.185) [-1463.666] -- 0:00:14
960000 -- (-1469.045) (-1479.467) (-1487.212) [-1468.300] * (-1479.994) (-1470.654) [-1473.353] (-1472.782) -- 0:00:14
Average standard deviation of split frequencies: 0.006164
960500 -- (-1465.865) (-1479.023) (-1475.361) [-1471.474] * (-1474.590) (-1474.815) [-1473.987] (-1480.199) -- 0:00:14
961000 -- (-1468.745) (-1486.139) [-1470.032] (-1475.825) * (-1471.275) (-1471.648) [-1479.911] (-1477.308) -- 0:00:13
961500 -- (-1478.116) (-1466.889) [-1468.642] (-1476.497) * (-1473.977) (-1467.216) (-1483.147) [-1477.383] -- 0:00:13
962000 -- (-1474.202) (-1470.161) [-1465.027] (-1478.555) * (-1473.418) (-1473.775) [-1474.508] (-1473.610) -- 0:00:13
962500 -- (-1470.913) (-1473.628) [-1469.090] (-1473.165) * (-1476.652) [-1474.387] (-1472.595) (-1470.027) -- 0:00:13
963000 -- (-1469.222) (-1472.095) (-1478.484) [-1474.631] * [-1470.597] (-1479.130) (-1477.502) (-1475.511) -- 0:00:13
963500 -- (-1477.913) (-1473.282) [-1472.792] (-1464.922) * (-1476.401) (-1478.440) [-1467.557] (-1489.405) -- 0:00:13
964000 -- (-1477.095) (-1469.840) [-1475.443] (-1482.841) * [-1464.588] (-1483.490) (-1469.442) (-1475.708) -- 0:00:12
964500 -- (-1479.723) (-1478.250) (-1470.547) [-1465.037] * [-1476.638] (-1475.101) (-1479.444) (-1477.196) -- 0:00:12
965000 -- (-1469.792) (-1481.300) (-1471.306) [-1473.938] * (-1472.957) [-1474.551] (-1476.766) (-1472.212) -- 0:00:12
Average standard deviation of split frequencies: 0.006191
965500 -- (-1478.353) (-1475.357) (-1469.833) [-1470.288] * (-1471.964) (-1471.836) (-1482.550) [-1474.031] -- 0:00:12
966000 -- (-1485.173) (-1467.716) [-1475.066] (-1475.683) * [-1471.060] (-1473.961) (-1480.871) (-1471.216) -- 0:00:12
966500 -- (-1477.355) (-1470.559) [-1470.232] (-1474.871) * [-1477.721] (-1467.162) (-1469.030) (-1469.190) -- 0:00:11
967000 -- (-1478.856) [-1469.312] (-1483.644) (-1472.457) * [-1478.424] (-1480.963) (-1476.710) (-1468.951) -- 0:00:11
967500 -- (-1469.378) [-1472.000] (-1476.943) (-1480.919) * (-1474.357) (-1479.471) [-1470.131] (-1472.244) -- 0:00:11
968000 -- [-1475.275] (-1478.199) (-1473.670) (-1474.866) * (-1470.266) [-1473.099] (-1474.875) (-1472.986) -- 0:00:11
968500 -- (-1471.133) (-1474.897) [-1469.906] (-1472.064) * (-1469.734) [-1475.924] (-1466.767) (-1474.242) -- 0:00:11
969000 -- [-1477.457] (-1471.494) (-1475.868) (-1471.166) * [-1471.252] (-1477.576) (-1477.887) (-1471.196) -- 0:00:11
969500 -- [-1472.497] (-1478.859) (-1479.705) (-1479.228) * (-1478.543) (-1478.726) (-1470.695) [-1469.324] -- 0:00:10
970000 -- (-1484.367) (-1475.342) (-1483.135) [-1480.500] * (-1480.702) (-1479.298) (-1467.692) [-1478.785] -- 0:00:10
Average standard deviation of split frequencies: 0.005949
970500 -- [-1471.767] (-1471.930) (-1479.576) (-1470.497) * (-1471.685) [-1466.636] (-1468.839) (-1475.796) -- 0:00:10
971000 -- (-1476.223) (-1471.607) (-1477.149) [-1467.554] * [-1467.897] (-1476.595) (-1474.996) (-1471.421) -- 0:00:10
971500 -- (-1472.604) [-1467.187] (-1470.969) (-1486.603) * [-1466.708] (-1481.508) (-1475.534) (-1476.537) -- 0:00:10
972000 -- (-1468.756) (-1467.617) [-1466.173] (-1479.308) * (-1467.282) [-1471.456] (-1471.260) (-1469.812) -- 0:00:10
972500 -- (-1474.005) (-1471.576) (-1470.206) [-1475.490] * [-1462.617] (-1472.569) (-1475.476) (-1477.353) -- 0:00:09
973000 -- (-1485.949) [-1465.423] (-1467.546) (-1472.619) * (-1471.172) (-1478.124) [-1468.110] (-1474.979) -- 0:00:09
973500 -- [-1466.099] (-1470.410) (-1472.295) (-1475.348) * (-1474.583) (-1471.741) (-1472.045) [-1476.650] -- 0:00:09
974000 -- (-1470.938) (-1474.095) (-1469.688) [-1469.897] * [-1475.847] (-1479.229) (-1473.275) (-1470.375) -- 0:00:09
974500 -- (-1466.852) [-1472.406] (-1469.088) (-1471.438) * (-1473.359) (-1473.218) [-1469.941] (-1480.214) -- 0:00:09
975000 -- (-1474.674) [-1477.866] (-1473.470) (-1470.390) * (-1478.239) (-1473.695) (-1481.651) [-1469.586] -- 0:00:08
Average standard deviation of split frequencies: 0.006037
975500 -- [-1472.599] (-1488.336) (-1483.793) (-1473.231) * (-1468.536) (-1472.256) (-1471.065) [-1480.536] -- 0:00:08
976000 -- (-1471.843) (-1470.355) [-1475.280] (-1470.868) * (-1482.789) (-1469.874) [-1473.947] (-1470.422) -- 0:00:08
976500 -- [-1459.482] (-1473.366) (-1478.144) (-1475.101) * (-1479.270) (-1471.951) [-1466.694] (-1479.978) -- 0:00:08
977000 -- (-1474.151) (-1473.430) [-1473.552] (-1476.176) * [-1474.157] (-1472.519) (-1477.512) (-1480.698) -- 0:00:08
977500 -- (-1468.941) (-1469.982) [-1476.607] (-1475.474) * [-1472.366] (-1469.510) (-1469.815) (-1470.501) -- 0:00:08
978000 -- [-1466.869] (-1487.233) (-1472.595) (-1477.645) * (-1472.486) (-1477.682) (-1467.984) [-1471.904] -- 0:00:07
978500 -- (-1482.768) (-1477.868) (-1474.428) [-1467.481] * (-1472.009) [-1471.963] (-1478.071) (-1482.285) -- 0:00:07
979000 -- (-1471.470) (-1474.408) (-1472.262) [-1463.086] * (-1476.813) [-1471.786] (-1477.086) (-1480.839) -- 0:00:07
979500 -- (-1467.554) (-1475.472) [-1475.989] (-1468.522) * (-1478.290) (-1474.802) (-1467.597) [-1473.064] -- 0:00:07
980000 -- (-1473.383) [-1467.112] (-1471.076) (-1481.261) * [-1470.007] (-1477.385) (-1474.391) (-1469.305) -- 0:00:07
Average standard deviation of split frequencies: 0.005859
980500 -- (-1468.615) (-1476.142) [-1474.478] (-1465.956) * (-1467.349) (-1476.884) [-1474.847] (-1478.965) -- 0:00:06
981000 -- (-1465.906) (-1477.089) [-1475.163] (-1472.942) * (-1483.872) (-1474.721) (-1471.939) [-1472.808] -- 0:00:06
981500 -- (-1467.334) [-1478.603] (-1484.976) (-1472.499) * (-1475.193) (-1470.780) [-1467.600] (-1477.350) -- 0:00:06
982000 -- (-1468.694) (-1473.520) (-1477.510) [-1470.485] * (-1473.297) [-1467.595] (-1471.757) (-1469.061) -- 0:00:06
982500 -- (-1473.495) (-1473.856) [-1470.111] (-1471.231) * (-1473.819) [-1469.401] (-1468.796) (-1468.623) -- 0:00:06
983000 -- [-1464.007] (-1475.593) (-1478.679) (-1480.089) * (-1480.648) [-1469.730] (-1483.992) (-1481.903) -- 0:00:06
983500 -- [-1474.812] (-1476.554) (-1472.047) (-1475.625) * (-1474.291) [-1480.104] (-1477.968) (-1477.053) -- 0:00:05
984000 -- (-1485.391) (-1477.754) [-1463.866] (-1471.938) * [-1469.816] (-1469.221) (-1489.025) (-1471.287) -- 0:00:05
984500 -- (-1479.482) [-1468.811] (-1482.117) (-1469.715) * (-1474.443) [-1465.059] (-1478.114) (-1473.383) -- 0:00:05
985000 -- (-1472.411) (-1473.839) (-1472.552) [-1473.955] * (-1474.449) [-1473.826] (-1478.785) (-1471.628) -- 0:00:05
Average standard deviation of split frequencies: 0.005558
985500 -- (-1479.217) (-1473.931) (-1476.854) [-1466.104] * (-1471.867) (-1474.428) [-1474.935] (-1467.657) -- 0:00:05
986000 -- (-1479.535) [-1472.032] (-1482.587) (-1469.415) * (-1476.866) (-1479.659) (-1482.616) [-1466.367] -- 0:00:05
986500 -- (-1471.898) (-1478.779) (-1479.917) [-1466.164] * (-1482.142) (-1474.348) [-1468.361] (-1474.789) -- 0:00:04
987000 -- (-1471.737) (-1473.396) (-1481.127) [-1471.175] * (-1477.343) (-1471.730) [-1470.632] (-1483.484) -- 0:00:04
987500 -- [-1471.982] (-1471.011) (-1480.791) (-1471.390) * [-1467.277] (-1475.189) (-1465.598) (-1465.590) -- 0:00:04
988000 -- (-1472.446) [-1470.418] (-1475.546) (-1466.548) * [-1467.011] (-1481.680) (-1465.933) (-1469.960) -- 0:00:04
988500 -- (-1475.950) [-1470.136] (-1480.413) (-1481.877) * (-1476.774) (-1481.929) [-1466.127] (-1478.380) -- 0:00:04
989000 -- (-1484.293) [-1473.241] (-1481.336) (-1484.557) * (-1471.488) (-1478.140) [-1477.389] (-1471.606) -- 0:00:03
989500 -- [-1476.009] (-1471.604) (-1479.129) (-1477.409) * [-1471.829] (-1475.445) (-1477.868) (-1479.465) -- 0:00:03
990000 -- (-1476.417) (-1469.399) (-1478.410) [-1476.183] * (-1471.663) (-1480.726) (-1479.181) [-1467.307] -- 0:00:03
Average standard deviation of split frequencies: 0.005532
990500 -- (-1475.725) (-1475.228) [-1482.008] (-1476.752) * (-1482.618) [-1466.058] (-1475.473) (-1480.660) -- 0:00:03
991000 -- (-1477.635) [-1468.685] (-1475.406) (-1475.267) * [-1471.114] (-1473.476) (-1474.862) (-1466.263) -- 0:00:03
991500 -- (-1475.150) (-1472.086) (-1472.475) [-1466.832] * (-1473.694) (-1473.589) [-1472.288] (-1478.435) -- 0:00:03
992000 -- (-1484.041) (-1468.290) [-1465.816] (-1476.392) * (-1472.363) [-1463.940] (-1472.606) (-1474.448) -- 0:00:02
992500 -- (-1472.680) [-1470.122] (-1476.581) (-1470.813) * (-1477.385) (-1472.303) (-1470.994) [-1466.937] -- 0:00:02
993000 -- (-1467.483) [-1472.249] (-1487.779) (-1470.571) * (-1481.248) (-1486.342) [-1479.727] (-1463.568) -- 0:00:02
993500 -- [-1480.076] (-1473.144) (-1478.578) (-1475.397) * (-1477.626) (-1483.446) [-1471.378] (-1468.205) -- 0:00:02
994000 -- (-1470.351) (-1473.748) (-1472.378) [-1476.202] * (-1472.645) (-1478.247) (-1469.377) [-1466.453] -- 0:00:02
994500 -- [-1472.677] (-1475.293) (-1476.011) (-1475.935) * [-1472.110] (-1467.799) (-1478.496) (-1472.012) -- 0:00:01
995000 -- (-1473.724) (-1464.708) [-1473.489] (-1477.724) * (-1471.154) (-1471.758) [-1465.387] (-1481.615) -- 0:00:01
Average standard deviation of split frequencies: 0.005354
995500 -- [-1475.134] (-1474.844) (-1477.779) (-1486.421) * (-1484.374) [-1467.480] (-1472.996) (-1476.047) -- 0:00:01
996000 -- (-1478.678) (-1472.403) [-1479.420] (-1478.048) * (-1477.322) (-1469.039) (-1467.710) [-1478.979] -- 0:00:01
996500 -- [-1474.745] (-1472.700) (-1472.131) (-1478.470) * (-1476.934) (-1463.323) [-1467.468] (-1468.528) -- 0:00:01
997000 -- [-1469.439] (-1468.096) (-1473.252) (-1473.877) * [-1472.395] (-1467.948) (-1479.581) (-1472.902) -- 0:00:01
997500 -- (-1474.319) (-1472.344) [-1467.626] (-1471.896) * (-1476.021) [-1468.825] (-1478.290) (-1471.603) -- 0:00:00
998000 -- [-1466.043] (-1477.858) (-1468.347) (-1478.561) * (-1468.804) (-1472.467) [-1478.501] (-1466.554) -- 0:00:00
998500 -- (-1469.151) (-1480.705) [-1468.758] (-1475.624) * (-1464.937) (-1476.161) [-1473.015] (-1471.723) -- 0:00:00
999000 -- (-1474.202) (-1478.828) (-1475.850) [-1478.158] * (-1471.033) [-1473.746] (-1479.330) (-1476.447) -- 0:00:00
999500 -- (-1475.582) (-1472.827) [-1468.180] (-1473.330) * [-1471.680] (-1472.287) (-1472.417) (-1466.856) -- 0:00:00
1000000 -- (-1470.777) [-1470.932] (-1475.992) (-1477.803) * (-1477.312) [-1466.527] (-1478.937) (-1467.535) -- 0:00:00
Average standard deviation of split frequencies: 0.005653
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1470.776690 -- 8.951298
Chain 1 -- -1470.776691 -- 8.951298
Chain 2 -- -1470.931723 -- 17.511611
Chain 2 -- -1470.931726 -- 17.511611
Chain 3 -- -1475.992151 -- 14.167883
Chain 3 -- -1475.992152 -- 14.167883
Chain 4 -- -1477.803459 -- 12.203282
Chain 4 -- -1477.803450 -- 12.203282
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1477.311820 -- 17.561270
Chain 1 -- -1477.311814 -- 17.561270
Chain 2 -- -1466.527409 -- 14.707815
Chain 2 -- -1466.527412 -- 14.707815
Chain 3 -- -1478.936722 -- 14.140628
Chain 3 -- -1478.936725 -- 14.140628
Chain 4 -- -1467.535260 -- 11.117854
Chain 4 -- -1467.535276 -- 11.117854
Analysis completed in 5 mins 57 seconds
Analysis used 357.84 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1458.67
Likelihood of best state for "cold" chain of run 2 was -1458.72
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
51.6 % ( 45 %) Dirichlet(Revmat{all})
66.1 % ( 48 %) Slider(Revmat{all})
29.2 % ( 22 %) Dirichlet(Pi{all})
31.5 % ( 27 %) Slider(Pi{all})
34.5 % ( 40 %) Multiplier(Alpha{1,2})
43.2 % ( 26 %) Multiplier(Alpha{3})
52.9 % ( 29 %) Slider(Pinvar{all})
23.1 % ( 28 %) ExtSPR(Tau{all},V{all})
6.9 % ( 4 %) ExtTBR(Tau{all},V{all})
26.8 % ( 18 %) NNI(Tau{all},V{all})
26.9 % ( 30 %) ParsSPR(Tau{all},V{all})
26.6 % ( 29 %) Multiplier(V{all})
40.8 % ( 50 %) Nodeslider(V{all})
25.6 % ( 27 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
51.5 % ( 43 %) Dirichlet(Revmat{all})
65.4 % ( 52 %) Slider(Revmat{all})
29.6 % ( 37 %) Dirichlet(Pi{all})
32.0 % ( 29 %) Slider(Pi{all})
33.7 % ( 22 %) Multiplier(Alpha{1,2})
42.9 % ( 23 %) Multiplier(Alpha{3})
52.5 % ( 21 %) Slider(Pinvar{all})
23.2 % ( 20 %) ExtSPR(Tau{all},V{all})
7.0 % ( 6 %) ExtTBR(Tau{all},V{all})
27.0 % ( 35 %) NNI(Tau{all},V{all})
26.9 % ( 23 %) ParsSPR(Tau{all},V{all})
26.6 % ( 27 %) Multiplier(V{all})
40.7 % ( 34 %) Nodeslider(V{all})
25.5 % ( 33 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.77 0.57 0.42
2 | 166675 0.78 0.60
3 | 166856 166642 0.81
4 | 166701 166581 166545
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.76 0.57 0.41
2 | 166503 0.79 0.60
3 | 166212 166541 0.80
4 | 167076 166745 166923
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/64/CG13437-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/64/CG13437-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/64/CG13437-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1469.61
| 1 |
| 2 2 2 1 2 1 2 |
| 2 2 |
| 12 21 1 211 11 222 12|
| 2 122 11 1 12 1 1 2 |
| 2 2 1 12 2 2 21 1 |
| 11 1 1 1 1* 1 1 |
|1 2 2* 2 2 2 2 1 2212 1 2 2 1 2 |
| 2 1 12 * 12 1 2 1 2 2 |
| 1 1 22 2 1 1 1 *2 1 |
| 2 1 2 2 1 1|
|2 1 2 1 1 1 1 |
| 2 2 |
| 2 |
| 11 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1473.59
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/64/CG13437-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/64/CG13437-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/64/CG13437-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1465.53 -1479.72
2 -1466.37 -1480.92
--------------------------------------
TOTAL -1465.86 -1480.49
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/64/CG13437-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/64/CG13437-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/64/CG13437-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.277621 0.026815 0.975096 1.599881 1.263421 1406.18 1453.59 1.000
r(A<->C){all} 0.144416 0.001140 0.075064 0.208558 0.143203 850.32 879.84 1.000
r(A<->G){all} 0.292213 0.002590 0.196802 0.394948 0.290827 696.40 768.75 1.000
r(A<->T){all} 0.072289 0.000930 0.017804 0.131197 0.069205 791.16 954.99 1.000
r(C<->G){all} 0.048395 0.000337 0.013903 0.084001 0.046805 1095.66 1110.33 1.000
r(C<->T){all} 0.388771 0.003157 0.283007 0.495945 0.387931 640.85 667.11 1.000
r(G<->T){all} 0.053916 0.000546 0.012753 0.101068 0.051192 895.99 902.68 1.000
pi(A){all} 0.231663 0.000383 0.192301 0.268329 0.230768 1087.50 1144.84 1.000
pi(C){all} 0.291344 0.000390 0.253503 0.329741 0.291166 1028.65 1054.56 1.000
pi(G){all} 0.254996 0.000375 0.215221 0.290583 0.254717 1248.09 1264.71 1.000
pi(T){all} 0.221997 0.000311 0.187087 0.255242 0.221659 779.92 944.29 1.000
alpha{1,2} 0.075216 0.000413 0.023923 0.112844 0.078047 1004.72 1061.98 1.001
alpha{3} 2.568287 0.596214 1.258570 4.081137 2.457264 1248.24 1374.62 1.000
pinvar{all} 0.305945 0.003834 0.179729 0.418067 0.308509 1271.68 1386.34 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/64/CG13437-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/64/CG13437-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/64/CG13437-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/64/CG13437-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
10 -- C10
Key to taxon bipartitions (saved to file "/opt/ADOPS/64/CG13437-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
----------------
1 -- .*********
2 -- .*........
3 -- ..*.......
4 -- ...*......
5 -- ....*.....
6 -- .....*....
7 -- ......*...
8 -- .......*..
9 -- ........*.
10 -- .........*
11 -- ...*******
12 -- ...**.....
13 -- .......**.
14 -- ...**.*...
15 -- .**.......
16 -- ..********
17 -- ...**.****
18 -- ...**.***.
19 -- ...**....*
20 -- .......***
21 -- ...**..***
22 -- ......***.
23 -- ...**.*..*
24 -- ...*****.*
25 -- ...****..*
26 -- .....*...*
----------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/64/CG13437-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
11 3002 1.000000 0.000000 1.000000 1.000000 2
12 3000 0.999334 0.000942 0.998668 1.000000 2
13 2532 0.843438 0.002827 0.841439 0.845436 2
14 1536 0.511659 0.000942 0.510993 0.512325 2
15 1472 0.490340 0.000942 0.489674 0.491006 2
16 1445 0.481346 0.009893 0.474350 0.488341 2
17 1298 0.432378 0.012248 0.423718 0.441039 2
18 753 0.250833 0.003298 0.248501 0.253165 2
19 519 0.172885 0.012719 0.163891 0.181879 2
20 441 0.146902 0.004240 0.143904 0.149900 2
21 423 0.140906 0.008951 0.134577 0.147235 2
22 389 0.129580 0.006124 0.125250 0.133911 2
23 389 0.129580 0.001413 0.128581 0.130580 2
24 358 0.119254 0.008480 0.113258 0.125250 2
25 330 0.109927 0.010364 0.102598 0.117255 2
26 313 0.104264 0.007066 0.099267 0.109260 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/64/CG13437-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.025635 0.000221 0.000146 0.051672 0.024089 1.000 2
length{all}[2] 0.004918 0.000025 0.000001 0.014976 0.003333 1.000 2
length{all}[3] 0.014732 0.000096 0.000054 0.032813 0.013092 1.000 2
length{all}[4] 0.067618 0.000542 0.025634 0.111940 0.065062 1.000 2
length{all}[5] 0.031762 0.000273 0.003437 0.064947 0.029801 1.000 2
length{all}[6] 0.202962 0.002728 0.111141 0.309414 0.197804 1.000 2
length{all}[7] 0.148567 0.001656 0.077319 0.227205 0.144390 1.000 2
length{all}[8] 0.110547 0.001310 0.042250 0.178780 0.106204 1.000 2
length{all}[9] 0.161126 0.001954 0.084162 0.250244 0.155847 1.000 2
length{all}[10] 0.083811 0.000725 0.036593 0.137996 0.080606 1.005 2
length{all}[11] 0.230170 0.003187 0.125401 0.337285 0.225312 1.000 2
length{all}[12] 0.066193 0.000682 0.021677 0.117032 0.062945 1.000 2
length{all}[13] 0.051856 0.000646 0.008536 0.101368 0.048494 1.000 2
length{all}[14] 0.027501 0.000312 0.001216 0.061824 0.024039 1.000 2
length{all}[15] 0.020107 0.000168 0.000026 0.043183 0.018265 1.000 2
length{all}[16] 0.013111 0.000079 0.000016 0.030827 0.011192 0.999 2
length{all}[17] 0.030748 0.000552 0.000002 0.074875 0.025867 1.000 2
length{all}[18] 0.014675 0.000132 0.000006 0.036149 0.012165 0.999 2
length{all}[19] 0.019244 0.000250 0.000078 0.047277 0.015659 0.998 2
length{all}[20] 0.013545 0.000148 0.000065 0.038022 0.009784 0.999 2
length{all}[21] 0.022211 0.000286 0.000109 0.055564 0.018316 0.999 2
length{all}[22] 0.019622 0.000224 0.000045 0.046983 0.017024 1.005 2
length{all}[23] 0.014651 0.000181 0.000034 0.041320 0.010845 1.009 2
length{all}[24] 0.048320 0.000718 0.006093 0.100536 0.044057 0.997 2
length{all}[25] 0.021447 0.000373 0.000073 0.056926 0.016199 0.999 2
length{all}[26] 0.012721 0.000123 0.000132 0.032725 0.009562 1.001 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005653
Maximum standard deviation of split frequencies = 0.012719
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.009
Clade credibility values:
/---------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
|
| /----------------- C4 (4)
+ /-------100-------+
| | \----------------- C5 (5)
| /-------51-------+
| | \----------------------------------- C7 (7)
| |
| |---------------------------------------------------- C6 (6)
| |
\-------100-------+ /----------------- C8 (8)
|----------------84----------------+
| \----------------- C9 (9)
|
\---------------------------------------------------- C10 (10)
Phylogram (based on average branch lengths):
/---- C1 (1)
|
|- C2 (2)
|
|-- C3 (3)
|
| /----------- C4 (4)
+ /---------+
| | \----- C5 (5)
| /---+
| | \------------------------ C7 (7)
| |
| |--------------------------------- C6 (6)
| |
\-------------------------------------+ /------------------ C8 (8)
|-------+
| \-------------------------- C9 (9)
|
\------------- C10 (10)
|---------------| 0.100 expected changes per site
Calculating tree probabilities...
Credible sets of trees (404 trees sampled):
50 % credible set contains 28 trees
90 % credible set contains 174 trees
95 % credible set contains 254 trees
99 % credible set contains 374 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 10 ls = 447
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Sequences read..
Counting site patterns.. 0:00
122 patterns at 149 / 149 sites (100.0%), 0:00
Counting codons..
360 bytes for distance
119072 bytes for conP
16592 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, (((4, 5), 7), 6, (8, 9), 10)); MP score: 191
297680 bytes for conP, adjusted
0.015592 0.020861 0.026935 0.270690 0.027104 0.078785 0.072411 0.056614 0.162915 0.298954 0.051581 0.171584 0.162666 0.140852 0.300000 1.300000
ntime & nrate & np: 14 2 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 16
lnL0 = -1774.341102
Iterating by ming2
Initial: fx= 1774.341102
x= 0.01559 0.02086 0.02694 0.27069 0.02710 0.07878 0.07241 0.05661 0.16292 0.29895 0.05158 0.17158 0.16267 0.14085 0.30000 1.30000
1 h-m-p 0.0000 0.0002 411.5814 +++ 1753.356562 m 0.0002 22 | 1/16
2 h-m-p 0.0001 0.0005 588.5557 +YYYCYCYCC 1706.850894 8 0.0004 54 | 1/16
3 h-m-p 0.0000 0.0001 785.4565 YCYCCC 1703.703382 5 0.0000 81 | 1/16
4 h-m-p 0.0001 0.0003 462.7482 +CYCCC 1688.680874 4 0.0003 108 | 1/16
5 h-m-p 0.0000 0.0001 1081.8678 +YCYCCC 1683.191309 5 0.0001 136 | 1/16
6 h-m-p 0.0001 0.0008 551.5504 +YCYCCCC 1633.244340 6 0.0007 167 | 1/16
7 h-m-p 0.0000 0.0000 6017.3086 +YYYYCCCCC 1619.495410 8 0.0000 199 | 1/16
8 h-m-p 0.0000 0.0001 1798.3464 +YYCCCC 1612.120381 5 0.0000 227 | 1/16
9 h-m-p 0.0000 0.0002 1137.4005 +YCYCCC 1602.173975 5 0.0001 255 | 1/16
10 h-m-p 0.0002 0.0008 227.2332 CYCCC 1598.872924 4 0.0002 281 | 1/16
11 h-m-p 0.0001 0.0006 291.2144 +CYCCC 1587.226784 4 0.0005 308 | 0/16
12 h-m-p 0.0000 0.0000 2926.6387 ++ 1585.322520 m 0.0000 327 | 0/16
13 h-m-p -0.0000 -0.0000 162.7663
h-m-p: -0.00000000e+00 -0.00000000e+00 1.62766279e+02 1585.322520
.. | 0/16
14 h-m-p 0.0000 0.0001 855257.4556 -YCYYYCYCCC 1537.602413 10 0.0000 378 | 0/16
15 h-m-p 0.0000 0.0001 2298.8262 ++ 1489.959583 m 0.0001 397 | 1/16
16 h-m-p 0.0001 0.0003 670.0065 +CYCYYYCCC 1383.885342 8 0.0003 429 | 1/16
17 h-m-p 0.0003 0.0014 222.4516 CYCCC 1380.813523 4 0.0002 455 | 1/16
18 h-m-p 0.0002 0.0010 118.2225 +CYCCC 1375.511229 4 0.0008 482 | 1/16
19 h-m-p 0.0001 0.0006 129.9224 YCCC 1374.238366 3 0.0003 506 | 1/16
20 h-m-p 0.0006 0.0033 62.3949 CCCC 1372.944864 3 0.0010 531 | 1/16
21 h-m-p 0.0020 0.0102 20.9954 YCCC 1372.650492 3 0.0014 555 | 1/16
22 h-m-p 0.0014 0.0189 20.7788 CCC 1372.305183 2 0.0022 578 | 1/16
23 h-m-p 0.0016 0.0217 28.2356 YCCC 1371.756372 3 0.0029 602 | 1/16
24 h-m-p 0.0017 0.0086 35.5545 YC 1371.538604 1 0.0009 622 | 1/16
25 h-m-p 0.0044 0.0563 7.0615 YCCC 1370.875005 3 0.0090 646 | 1/16
26 h-m-p 0.0017 0.0196 37.5825 YCCC 1369.189050 3 0.0034 670 | 1/16
27 h-m-p 0.0026 0.0128 46.9789 CYCCCC 1366.254690 5 0.0036 698 | 1/16
28 h-m-p 0.0079 0.0394 11.0125 CYCCC 1362.336605 4 0.0096 724 | 1/16
29 h-m-p 0.0014 0.0068 43.9717 YCCCC 1355.199517 4 0.0031 750 | 1/16
30 h-m-p 0.8128 4.0640 0.1591 YCCCCC 1352.444704 5 1.6394 778 | 1/16
31 h-m-p 0.7149 3.5744 0.1547 +YYCCCC 1349.028391 5 2.2395 821 | 1/16
32 h-m-p 0.8195 4.0973 0.0752 CYCCC 1347.580503 4 1.5539 862 | 1/16
33 h-m-p 0.8593 5.1721 0.1360 CC 1346.942570 1 0.8593 898 | 1/16
34 h-m-p 0.5376 2.6879 0.1779 CCCC 1346.329774 3 0.6650 938 | 1/16
35 h-m-p 1.3421 8.0000 0.0882 CCCC 1346.043488 3 1.5360 978 | 1/16
36 h-m-p 1.6000 8.0000 0.0312 YCC 1345.978552 2 1.2267 1015 | 1/16
37 h-m-p 1.6000 8.0000 0.0036 YC 1345.974700 1 0.8154 1050 | 1/16
38 h-m-p 0.6908 8.0000 0.0042 CC 1345.973334 1 0.9431 1086 | 1/16
39 h-m-p 1.6000 8.0000 0.0007 C 1345.972818 0 1.4007 1120 | 1/16
40 h-m-p 1.6000 8.0000 0.0003 ++ 1345.971885 m 8.0000 1154 | 1/16
41 h-m-p 1.6000 8.0000 0.0011 ++ 1345.963537 m 8.0000 1188 | 1/16
42 h-m-p 1.6000 8.0000 0.0036 YC 1345.933544 1 3.6598 1223 | 1/16
43 h-m-p 1.6000 8.0000 0.0032 +CCC 1345.832373 2 5.6347 1262 | 1/16
44 h-m-p 1.6000 8.0000 0.0083 CC 1345.817084 1 1.5028 1298 | 1/16
45 h-m-p 1.6000 8.0000 0.0070 CC 1345.815476 1 1.3108 1334 | 1/16
46 h-m-p 1.6000 8.0000 0.0013 C 1345.815294 0 1.4385 1368 | 1/16
47 h-m-p 1.6000 8.0000 0.0002 C 1345.815276 0 1.5003 1402 | 1/16
48 h-m-p 1.6000 8.0000 0.0000 Y 1345.815275 0 1.0764 1436 | 1/16
49 h-m-p 1.6000 8.0000 0.0000 C 1345.815275 0 1.9066 1470 | 1/16
50 h-m-p 1.6000 8.0000 0.0000 Y 1345.815275 0 0.8883 1504 | 1/16
51 h-m-p 1.6000 8.0000 0.0000 Y 1345.815275 0 1.0076 1538 | 1/16
52 h-m-p 1.6000 8.0000 0.0000 C 1345.815275 0 2.3438 1572 | 1/16
53 h-m-p 1.6000 8.0000 0.0000 -----Y 1345.815275 0 0.0004 1611
Out..
lnL = -1345.815275
1612 lfun, 1612 eigenQcodon, 22568 P(t)
Time used: 0:07
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, (((4, 5), 7), 6, (8, 9), 10)); MP score: 191
0.015592 0.020861 0.026935 0.270690 0.027104 0.078785 0.072411 0.056614 0.162915 0.298954 0.051581 0.171584 0.162666 0.140852 1.489518 0.899282 0.148366
ntime & nrate & np: 14 2 17
Bounds (np=17):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.841824
np = 17
lnL0 = -1432.513519
Iterating by ming2
Initial: fx= 1432.513519
x= 0.01559 0.02086 0.02694 0.27069 0.02710 0.07878 0.07241 0.05661 0.16292 0.29895 0.05158 0.17158 0.16267 0.14085 1.48952 0.89928 0.14837
1 h-m-p 0.0000 0.0002 526.8723 +++ 1378.697031 m 0.0002 23 | 1/17
2 h-m-p 0.0000 0.0000 15256.0216 +YYYCYCCCC 1353.949007 8 0.0000 56 | 1/17
3 h-m-p 0.0000 0.0002 219.3083 +CYCCC 1348.337364 4 0.0002 84 | 1/17
4 h-m-p 0.0003 0.0016 57.3914 CYCCC 1347.319238 4 0.0006 111 | 1/17
5 h-m-p 0.0002 0.0010 107.0077 CCC 1346.838655 2 0.0002 135 | 1/17
6 h-m-p 0.0004 0.0054 63.3569 CYCC 1346.379406 3 0.0005 160 | 1/17
7 h-m-p 0.0015 0.0073 19.4349 CYC 1346.180213 2 0.0014 183 | 1/17
8 h-m-p 0.0037 0.0221 7.1524 CC 1346.149820 1 0.0014 205 | 1/17
9 h-m-p 0.0020 0.0705 5.0467 YC 1346.141973 1 0.0009 226 | 1/17
10 h-m-p 0.0015 0.0386 3.0536 CC 1346.135352 1 0.0019 248 | 1/17
11 h-m-p 0.0019 0.4451 3.1200 +CC 1346.111220 1 0.0089 271 | 1/17
12 h-m-p 0.0044 0.2157 6.3096 CC 1346.077304 1 0.0067 293 | 1/17
13 h-m-p 0.0045 0.0693 9.4107 CC 1346.064293 1 0.0018 315 | 1/17
14 h-m-p 0.0116 0.0763 1.4412 CC 1346.060761 1 0.0034 337 | 1/17
15 h-m-p 0.0116 0.4337 0.4179 CC 1346.051787 1 0.0128 359 | 1/17
16 h-m-p 0.0030 0.0973 1.8132 +CC 1345.965309 1 0.0126 398 | 1/17
17 h-m-p 0.0040 0.0350 5.7215 CCC 1345.874206 2 0.0041 422 | 1/17
18 h-m-p 0.2615 2.6450 0.0905 +YCC 1345.635555 2 0.8291 446 | 1/17
19 h-m-p 0.7751 3.8755 0.0323 CCCCC 1345.097341 4 1.0877 490 | 1/17
20 h-m-p 0.9691 5.3727 0.0363 CCCC 1344.880684 3 1.0931 532 | 1/17
21 h-m-p 1.6000 8.0000 0.0159 YC 1344.873233 1 0.7006 569 | 1/17
22 h-m-p 1.6000 8.0000 0.0012 YC 1344.872728 1 0.8347 606 | 1/17
23 h-m-p 1.6000 8.0000 0.0001 Y 1344.872726 0 1.0572 642 | 1/17
24 h-m-p 1.6000 8.0000 0.0000 Y 1344.872726 0 1.1243 678 | 1/17
25 h-m-p 1.6000 8.0000 0.0000 C 1344.872726 0 0.5437 714 | 1/17
26 h-m-p 1.5403 8.0000 0.0000 -Y 1344.872726 0 0.0963 751 | 1/17
27 h-m-p 0.1048 8.0000 0.0000 --------------.. | 1/17
28 h-m-p 0.0160 8.0000 0.0030 ------------- | 1/17
29 h-m-p 0.0160 8.0000 0.0030 -------------
Out..
lnL = -1344.872726
894 lfun, 2682 eigenQcodon, 25032 P(t)
Time used: 0:15
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, (((4, 5), 7), 6, (8, 9), 10)); MP score: 191
initial w for M2:NSpselection reset.
0.015592 0.020861 0.026935 0.270690 0.027104 0.078785 0.072411 0.056614 0.162915 0.298954 0.051581 0.171584 0.162666 0.140852 1.489789 1.309770 0.264508 0.428689 2.549129
ntime & nrate & np: 14 3 19
Bounds (np=19):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 5.527334
np = 19
lnL0 = -1569.491725
Iterating by ming2
Initial: fx= 1569.491725
x= 0.01559 0.02086 0.02694 0.27069 0.02710 0.07878 0.07241 0.05661 0.16292 0.29895 0.05158 0.17158 0.16267 0.14085 1.48979 1.30977 0.26451 0.42869 2.54913
1 h-m-p 0.0000 0.0003 352.9843 +++ 1551.672208 m 0.0003 44 | 1/19
2 h-m-p 0.0002 0.0012 356.8190 ++ 1438.737197 m 0.0012 85 | 2/19
3 h-m-p 0.0000 0.0004 6751.6314 +YCCCC 1412.847501 4 0.0001 133 | 1/19
4 h-m-p 0.0000 0.0000 605049.8030 CYCCC 1400.596995 4 0.0000 179 | 1/19
5 h-m-p 0.0005 0.0023 65.4563 +YYCYCCC 1397.379174 6 0.0015 229 | 1/19
6 h-m-p 0.0002 0.0009 93.0624 ++ 1395.144647 m 0.0009 269 | 1/19
7 h-m-p 0.0019 0.0114 44.8971 +YCCCC 1391.415604 4 0.0057 317 | 1/19
8 h-m-p 0.0097 0.0530 26.2486 CYCCC 1387.319929 4 0.0181 364 | 1/19
9 h-m-p 0.0067 0.0333 22.7634 CCYC 1386.411077 3 0.0066 409 | 1/19
10 h-m-p 0.0080 0.0399 12.3402 CCCC 1385.781568 3 0.0125 455 | 1/19
11 h-m-p 0.0172 0.1904 8.9619 +YYYC 1384.071437 3 0.0664 499 | 1/19
12 h-m-p 0.0063 0.0316 76.9707 +YCCC 1379.516899 3 0.0217 545 | 1/19
13 h-m-p 0.0125 0.0625 33.5416 CYC 1378.447714 2 0.0123 588 | 1/19
14 h-m-p 0.0175 0.0905 23.5914 CCC 1377.333240 2 0.0192 632 | 1/19
15 h-m-p 0.0326 0.1628 10.8752 CCCC 1376.417081 3 0.0403 678 | 1/19
16 h-m-p 0.0167 0.4621 26.2291 +CCCC 1372.103134 3 0.0794 725 | 1/19
17 h-m-p 0.1523 0.7617 6.3023 CYCYCCC 1367.409805 6 0.3163 776 | 1/19
18 h-m-p 0.0805 0.4024 12.5981 YYCC 1365.836561 3 0.0699 820 | 1/19
19 h-m-p 0.2903 3.4090 3.0341 +YCYC 1360.498026 3 0.8205 865 | 1/19
20 h-m-p 0.4149 2.0747 3.6606 CCC 1359.331646 2 0.3949 909 | 1/19
21 h-m-p 0.0942 0.8584 15.3543 +YCC 1355.813626 2 0.2971 953 | 1/19
22 h-m-p 1.6000 8.0000 1.4056 YCCC 1354.404922 3 0.9596 998 | 1/19
23 h-m-p 0.7285 4.5418 1.8514 CCCC 1353.252674 3 0.9909 1044 | 1/19
24 h-m-p 1.5190 7.5951 0.9811 CCC 1352.712093 2 1.5765 1088 | 1/19
25 h-m-p 1.6000 8.0000 0.3503 CCCC 1352.425052 3 2.0424 1134 | 1/19
26 h-m-p 1.5182 8.0000 0.4712 CCCC 1351.993421 3 2.6016 1180 | 1/19
27 h-m-p 0.9794 7.6107 1.2516 YCYCCC 1351.367783 5 2.1093 1228 | 1/19
28 h-m-p 0.6827 3.4134 1.9147 CYCYCC 1350.272614 5 1.3590 1277 | 1/19
29 h-m-p 0.4898 2.4489 0.7793 CCCCC 1349.566705 4 0.6652 1325 | 1/19
30 h-m-p 0.2923 8.0000 1.7732 YCCC 1349.187952 3 0.4618 1370 | 1/19
31 h-m-p 0.3309 1.6545 1.7162 YYYYYC 1348.650352 5 0.3238 1415 | 1/19
32 h-m-p 0.4853 3.0249 1.1451 YYYC 1348.267390 3 0.4665 1458 | 1/19
33 h-m-p 1.0266 5.9475 0.5204 YCC 1347.855329 2 0.7340 1501 | 1/19
34 h-m-p 0.5247 2.6698 0.7279 CCCCC 1347.259527 4 0.6219 1549 | 1/19
35 h-m-p 0.2691 1.3453 0.9371 CCCCC 1346.938547 4 0.3464 1597 | 1/19
36 h-m-p 0.3734 3.0877 0.8694 CCC 1346.636223 2 0.5009 1641 | 1/19
37 h-m-p 1.3186 8.0000 0.3303 YCC 1346.463434 2 0.7459 1684 | 1/19
38 h-m-p 0.2056 2.0456 1.1983 CCCC 1346.362466 3 0.2866 1730 | 1/19
39 h-m-p 0.4750 4.4677 0.7230 CCC 1346.161302 2 0.6549 1774 | 1/19
40 h-m-p 0.5640 2.8199 0.7968 YCCC 1346.052189 3 0.3426 1819 | 1/19
41 h-m-p 0.3419 7.8618 0.7984 YCCC 1345.883096 3 0.6675 1864 | 1/19
42 h-m-p 0.5839 2.9197 0.7681 YYC 1345.789566 2 0.4649 1906 | 1/19
43 h-m-p 0.9324 8.0000 0.3829 CC 1345.695443 1 1.0776 1948 | 1/19
44 h-m-p 0.5748 7.5087 0.7179 CCCC 1345.599471 3 0.9245 1994 | 1/19
45 h-m-p 0.8464 8.0000 0.7841 YCC 1345.522872 2 0.5930 2037 | 1/19
46 h-m-p 0.5847 8.0000 0.7953 CCCC 1345.433842 3 0.8203 2083 | 1/19
47 h-m-p 0.9834 8.0000 0.6634 YYC 1345.326871 2 0.8325 2125 | 1/19
48 h-m-p 0.7823 8.0000 0.7060 YCC 1345.269561 2 0.5194 2168 | 1/19
49 h-m-p 1.5899 8.0000 0.2306 CC 1345.238280 1 0.5774 2210 | 1/19
50 h-m-p 1.4857 8.0000 0.0896 YC 1345.217866 1 1.0168 2251 | 1/19
51 h-m-p 0.9333 8.0000 0.0977 CC 1345.189416 1 1.2194 2293 | 1/19
52 h-m-p 0.3721 8.0000 0.3200 +CCC 1345.084319 2 1.9848 2338 | 1/19
53 h-m-p 1.6000 8.0000 0.3146 YC 1345.042099 1 0.6483 2379 | 1/19
54 h-m-p 0.3716 8.0000 0.5489 CCC 1345.027723 2 0.5607 2423 | 1/19
55 h-m-p 1.2925 8.0000 0.2381 YC 1345.016061 1 0.7985 2464 | 1/19
56 h-m-p 0.3365 8.0000 0.5650 +CCC 1344.986829 2 1.9796 2509 | 1/19
57 h-m-p 0.7342 8.0000 1.5234 CCC 1344.949003 2 0.9956 2553 | 1/19
58 h-m-p 1.5433 8.0000 0.9828 YC 1344.928419 1 0.7823 2594 | 1/19
59 h-m-p 0.7815 8.0000 0.9838 YCC 1344.908487 2 1.3497 2637 | 1/19
60 h-m-p 0.7422 8.0000 1.7891 CCC 1344.897700 2 0.7886 2681 | 1/19
61 h-m-p 1.0230 8.0000 1.3791 YCC 1344.890296 2 0.7446 2724 | 1/19
62 h-m-p 0.8444 8.0000 1.2162 YC 1344.883012 1 1.6046 2765 | 1/19
63 h-m-p 1.6000 8.0000 1.0472 CCC 1344.878699 2 1.5111 2809 | 1/19
64 h-m-p 0.8305 8.0000 1.9054 C 1344.876630 0 0.8305 2849 | 1/19
65 h-m-p 1.2851 8.0000 1.2314 C 1344.874956 0 1.5006 2889 | 1/19
66 h-m-p 1.1972 8.0000 1.5434 CC 1344.874133 1 0.9765 2931 | 1/19
67 h-m-p 1.1331 8.0000 1.3300 CC 1344.873432 1 1.6039 2973 | 1/19
68 h-m-p 1.6000 8.0000 1.2006 YC 1344.873008 1 2.6094 3014 | 1/19
69 h-m-p 1.6000 8.0000 1.2825 C 1344.872859 0 1.9525 3054 | 1/19
70 h-m-p 1.6000 8.0000 1.1614 C 1344.872800 0 1.5983 3094 | 1/19
71 h-m-p 1.2768 8.0000 1.4539 C 1344.872760 0 1.7784 3134 | 1/19
72 h-m-p 1.6000 8.0000 1.2526 C 1344.872742 0 2.0670 3174 | 1/19
73 h-m-p 1.6000 8.0000 1.2432 C 1344.872733 0 1.9458 3214 | 1/19
74 h-m-p 1.6000 8.0000 1.3316 C 1344.872730 0 1.6000 3254 | 1/19
75 h-m-p 1.5039 8.0000 1.4167 C 1344.872728 0 1.8351 3294 | 1/19
76 h-m-p 1.6000 8.0000 1.2754 C 1344.872727 0 2.0968 3334 | 1/19
77 h-m-p 1.6000 8.0000 1.1990 C 1344.872726 0 2.4971 3374 | 1/19
78 h-m-p 1.6000 8.0000 1.1942 C 1344.872726 0 2.1428 3414 | 1/19
79 h-m-p 1.6000 8.0000 1.3846 Y 1344.872726 0 2.7101 3454 | 1/19
80 h-m-p 1.6000 8.0000 1.6068 C 1344.872726 0 1.9386 3494 | 1/19
81 h-m-p 1.6000 8.0000 1.7347 C 1344.872726 0 2.1469 3534 | 1/19
82 h-m-p 0.8971 8.0000 4.1513 Y 1344.872726 0 2.1805 3574 | 1/19
83 h-m-p 0.2940 7.7227 30.7930 +Y 1344.872726 0 0.9889 3615 | 1/19
84 h-m-p 0.0912 0.4562 263.6094 Y 1344.872726 0 0.0912 3655 | 1/19
85 h-m-p 0.0827 0.4136 232.5989 ---Y 1344.872726 0 0.0003 3698 | 1/19
86 h-m-p 0.0835 8.0000 0.8999 ++Y 1344.872726 0 1.0943 3740 | 1/19
87 h-m-p 0.5338 8.0000 1.8449 ---------C 1344.872726 0 0.0000 3789 | 1/19
88 h-m-p 0.0529 8.0000 0.0000 -C 1344.872726 0 0.0033 3830 | 1/19
89 h-m-p 0.0160 8.0000 0.0008 ++C 1344.872726 0 0.3687 3872 | 1/19
90 h-m-p 1.6000 8.0000 0.0001 Y 1344.872726 0 0.2302 3912 | 1/19
91 h-m-p 0.2557 8.0000 0.0001 C 1344.872726 0 0.0639 3952 | 1/19
92 h-m-p 0.0647 8.0000 0.0001 ---Y 1344.872726 0 0.0003 3995
Out..
lnL = -1344.872726
3996 lfun, 15984 eigenQcodon, 167832 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1380.209036 S = -1356.853764 -16.127739
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 122 patterns 1:08
did 20 / 122 patterns 1:09
did 30 / 122 patterns 1:09
did 40 / 122 patterns 1:09
did 50 / 122 patterns 1:09
did 60 / 122 patterns 1:09
did 70 / 122 patterns 1:09
did 80 / 122 patterns 1:09
did 90 / 122 patterns 1:09
did 100 / 122 patterns 1:09
did 110 / 122 patterns 1:09
did 120 / 122 patterns 1:09
did 122 / 122 patterns 1:09
Time used: 1:09
Model 3: discrete
TREE # 1
(1, 2, 3, (((4, 5), 7), 6, (8, 9), 10)); MP score: 191
0.015592 0.020861 0.026935 0.270690 0.027104 0.078785 0.072411 0.056614 0.162915 0.298954 0.051581 0.171584 0.162666 0.140852 1.489786 0.818396 0.798628 0.005802 0.012325 0.020013
ntime & nrate & np: 14 4 20
Bounds (np=20):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 22.917596
np = 20
lnL0 = -1355.000082
Iterating by ming2
Initial: fx= 1355.000082
x= 0.01559 0.02086 0.02694 0.27069 0.02710 0.07878 0.07241 0.05661 0.16292 0.29895 0.05158 0.17158 0.16267 0.14085 1.48979 0.81840 0.79863 0.00580 0.01233 0.02001
1 h-m-p 0.0000 0.0002 259.5422 +++ 1349.278419 m 0.0002 46 | 1/20
2 h-m-p 0.0000 0.0001 111.6100 ++ 1348.690186 m 0.0001 89 | 2/20
3 h-m-p 0.0000 0.0003 359.6476 +YYCCCCC 1347.251087 6 0.0001 142 | 2/20
4 h-m-p 0.0002 0.0009 139.4535 CYC 1346.654080 2 0.0002 186 | 2/20
5 h-m-p 0.0005 0.0028 53.9444 CYCC 1346.109870 3 0.0006 232 | 2/20
6 h-m-p 0.0004 0.0021 32.1183 YCCC 1345.685935 3 0.0010 278 | 1/20
7 h-m-p 0.0002 0.0012 54.8662 YCC 1345.640706 2 0.0001 322 | 1/20
8 h-m-p 0.0002 0.0017 27.7291 YC 1345.515825 1 0.0005 365 | 1/20
9 h-m-p 0.0004 0.0022 11.1771 +CC 1345.382268 1 0.0016 410 | 1/20
10 h-m-p 0.0043 0.0356 4.1729 CC 1345.359150 1 0.0017 454 | 1/20
11 h-m-p 0.0041 0.0245 1.7172 YC 1345.356310 1 0.0017 497 | 1/20
12 h-m-p 0.0039 0.0195 0.4112 YC 1345.356144 1 0.0018 540 | 1/20
13 h-m-p 0.0067 1.9650 0.1090 C 1345.356018 0 0.0071 582 | 1/20
14 h-m-p 0.0027 0.3060 0.2840 YC 1345.355611 1 0.0065 625 | 1/20
15 h-m-p 0.0022 1.0130 0.8505 +CC 1345.352499 1 0.0138 670 | 1/20
16 h-m-p 0.0037 0.2681 3.1491 +YC 1345.343672 1 0.0101 714 | 1/20
17 h-m-p 0.0107 0.1307 2.9637 YC 1345.342511 1 0.0015 757 | 1/20
18 h-m-p 0.0064 0.9031 0.6966 YC 1345.342154 1 0.0027 800 | 1/20
19 h-m-p 0.0081 4.0742 0.2887 +YC 1345.340210 1 0.0602 844 | 1/20
20 h-m-p 0.3966 8.0000 0.0438 +YC 1345.335670 1 3.0797 888 | 1/20
21 h-m-p 1.3126 6.7225 0.1028 CYCC 1345.330273 3 2.0931 935 | 1/20
22 h-m-p 1.0541 8.0000 0.2042 CC 1345.323652 1 1.2531 979 | 1/20
23 h-m-p 0.5970 2.9850 0.2062 YCC 1345.321080 2 1.1221 1024 | 1/20
24 h-m-p 1.3920 7.1238 0.1662 YC 1345.319368 1 0.7743 1067 | 1/20
25 h-m-p 1.6000 8.0000 0.0608 +CC 1345.315663 1 5.6993 1112 | 1/20
26 h-m-p 1.6000 8.0000 0.1175 YCCCCC 1345.304920 5 2.0715 1163 | 1/20
27 h-m-p 0.2208 8.0000 1.1022 +YYC 1345.289787 2 0.8223 1208 | 1/20
28 h-m-p 0.3136 1.5679 0.6091 YCC 1345.286558 2 0.2365 1253 | 1/20
29 h-m-p 0.5746 2.8732 0.1425 CC 1345.275763 1 0.7822 1297 | 1/20
30 h-m-p 0.4366 3.0277 0.2553 ++ 1345.260696 m 3.0277 1339 | 2/20
31 h-m-p 1.6000 8.0000 0.3368 YCC 1345.237248 2 1.1072 1384 | 2/20
32 h-m-p 0.2458 1.7494 1.5174 YYC 1345.211271 2 0.2467 1427 | 1/20
33 h-m-p 0.0012 0.0076 300.7151 CCC 1345.207680 2 0.0005 1472 | 1/20
34 h-m-p 0.2027 1.3084 0.7927 CCC 1345.197677 2 0.3140 1518 | 1/20
35 h-m-p 1.0061 8.0000 0.2474 CCC 1345.167113 2 1.5176 1564 | 1/20
36 h-m-p 1.4162 8.0000 0.2651 CCCC 1345.143008 3 1.8828 1612 | 1/20
37 h-m-p 1.2387 8.0000 0.4029 YC 1345.070417 1 2.9089 1655 | 1/20
38 h-m-p 0.9251 8.0000 1.2669 YCC 1344.975831 2 1.9237 1700 | 1/20
39 h-m-p 1.4697 8.0000 1.6582 YCCC 1344.920252 3 0.8619 1747 | 1/20
40 h-m-p 0.3931 8.0000 3.6361 CC 1344.867850 1 0.5780 1791 | 1/20
41 h-m-p 1.1583 8.0000 1.8146 CCC 1344.827035 2 1.6241 1837 | 1/20
42 h-m-p 1.6000 8.0000 0.4079 YC 1344.822539 1 1.1537 1880 | 1/20
43 h-m-p 1.3055 8.0000 0.3605 YC 1344.822138 1 0.9552 1923 | 1/20
44 h-m-p 1.6000 8.0000 0.0353 Y 1344.822129 0 1.0529 1965 | 1/20
45 h-m-p 1.6000 8.0000 0.0015 Y 1344.822129 0 0.9665 2007 | 1/20
46 h-m-p 1.6000 8.0000 0.0000 Y 1344.822129 0 1.0990 2049 | 1/20
47 h-m-p 1.6000 8.0000 0.0000 +Y 1344.822129 0 6.4000 2092 | 1/20
48 h-m-p 1.4210 8.0000 0.0000 Y 1344.822129 0 0.3552 2134 | 1/20
49 h-m-p 0.4314 8.0000 0.0000 ----------C 1344.822129 0 0.0000 2186
Out..
lnL = -1344.822129
2187 lfun, 8748 eigenQcodon, 91854 P(t)
Time used: 1:38
Model 7: beta
TREE # 1
(1, 2, 3, (((4, 5), 7), 6, (8, 9), 10)); MP score: 191
0.015592 0.020861 0.026935 0.270690 0.027104 0.078785 0.072411 0.056614 0.162915 0.298954 0.051581 0.171584 0.162666 0.140852 1.486503 0.574037 1.335590
ntime & nrate & np: 14 1 17
Bounds (np=17):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 11.396284
np = 17
lnL0 = -1449.309375
Iterating by ming2
Initial: fx= 1449.309375
x= 0.01559 0.02086 0.02694 0.27069 0.02710 0.07878 0.07241 0.05661 0.16292 0.29895 0.05158 0.17158 0.16267 0.14085 1.48650 0.57404 1.33559
1 h-m-p 0.0000 0.0002 321.1890 +++ 1436.932786 m 0.0002 40 | 1/17
2 h-m-p 0.0003 0.0020 232.7881 +YCYYYCCC 1379.526488 7 0.0019 89 | 1/17
3 h-m-p 0.0000 0.0000 18203.2814 +YYYYYCCC 1365.593234 7 0.0000 135 | 1/17
4 h-m-p 0.0002 0.0008 100.9431 CCYCCC 1362.297843 5 0.0005 181 | 1/17
5 h-m-p 0.0010 0.0048 48.3178 YCCCC 1359.916793 4 0.0024 224 | 1/17
6 h-m-p 0.0003 0.0017 53.1703 YCCC 1359.343895 3 0.0008 265 | 1/17
7 h-m-p 0.0004 0.0045 103.9047 +YYCC 1357.584814 3 0.0014 306 | 1/17
8 h-m-p 0.0021 0.0103 58.1947 CCCCC 1355.809773 4 0.0031 350 | 1/17
9 h-m-p 0.0016 0.0078 83.7193 YCCCCC 1352.835570 5 0.0036 395 | 1/17
10 h-m-p 0.0016 0.0081 75.2895 CCCCC 1351.250673 4 0.0025 439 | 1/17
11 h-m-p 0.0012 0.0062 66.0154 CCCCC 1350.393548 4 0.0017 483 | 1/17
12 h-m-p 0.0041 0.0211 28.0304 CC 1350.177683 1 0.0014 521 | 1/17
13 h-m-p 0.0028 0.0225 13.9827 CYC 1350.047372 2 0.0024 560 | 1/17
14 h-m-p 0.0059 0.0406 5.6412 CC 1350.016314 1 0.0024 598 | 1/17
15 h-m-p 0.0030 0.4451 4.3823 ++CCCCC 1349.435208 4 0.0693 644 | 1/17
16 h-m-p 0.0089 0.0443 15.7969 CCC 1349.366045 2 0.0025 684 | 1/17
17 h-m-p 0.3375 1.9162 0.1173 YCCC 1347.728539 3 0.7479 725 | 1/17
18 h-m-p 0.7717 3.9511 0.1137 CCC 1347.003589 2 0.7127 765 | 1/17
19 h-m-p 0.3830 4.4443 0.2116 YCCC 1346.533452 3 0.7541 806 | 1/17
20 h-m-p 1.6000 8.0000 0.0586 CCC 1346.379664 2 2.2550 846 | 1/17
21 h-m-p 1.6000 8.0000 0.0534 CCC 1346.225545 2 2.3843 886 | 1/17
22 h-m-p 1.6000 8.0000 0.0605 CCC 1346.196077 2 1.4016 926 | 1/17
23 h-m-p 1.6000 8.0000 0.0455 CC 1346.187933 1 1.4042 964 | 1/17
24 h-m-p 1.6000 8.0000 0.0348 +C 1346.163965 0 6.3509 1001 | 1/17
25 h-m-p 1.2225 8.0000 0.1807 +YC 1346.036330 1 5.9411 1039 | 1/17
26 h-m-p 1.3313 8.0000 0.8066 +YCCC 1345.673616 3 3.8323 1081 | 1/17
27 h-m-p 1.6000 8.0000 1.3823 CCC 1345.499474 2 1.8063 1121 | 1/17
28 h-m-p 1.6000 8.0000 1.4958 YCCC 1345.408623 3 2.5389 1162 | 1/17
29 h-m-p 1.6000 8.0000 1.6998 CCC 1345.363362 2 2.0862 1202 | 1/17
30 h-m-p 1.6000 8.0000 1.4654 CCC 1345.349428 2 2.1984 1242 | 1/17
31 h-m-p 1.6000 8.0000 1.0500 C 1345.346433 0 1.6000 1278 | 1/17
32 h-m-p 1.6000 8.0000 0.4745 C 1345.345776 0 1.7347 1314 | 1/17
33 h-m-p 1.6000 8.0000 0.1863 +C 1345.344719 0 6.3634 1351 | 1/17
34 h-m-p 1.6000 8.0000 0.1024 ++ 1345.338471 m 8.0000 1387 | 1/17
35 h-m-p 1.6000 8.0000 0.3780 YC 1345.336901 1 1.0896 1424 | 1/17
36 h-m-p 1.6000 8.0000 0.0658 Y 1345.336880 0 1.0434 1460 | 1/17
37 h-m-p 1.6000 8.0000 0.0013 Y 1345.336880 0 1.1302 1496 | 1/17
38 h-m-p 1.6000 8.0000 0.0006 Y 1345.336880 0 1.0595 1532 | 1/17
39 h-m-p 1.6000 8.0000 0.0000 C 1345.336880 0 1.6000 1568 | 1/17
40 h-m-p 1.6000 8.0000 0.0000 Y 1345.336880 0 0.4000 1604 | 1/17
41 h-m-p 0.0723 8.0000 0.0000 ---------C 1345.336880 0 0.0000 1649
Out..
lnL = -1345.336880
1650 lfun, 18150 eigenQcodon, 231000 P(t)
Time used: 2:50
Model 8: beta&w>1
TREE # 1
(1, 2, 3, (((4, 5), 7), 6, (8, 9), 10)); MP score: 191
initial w for M8:NSbetaw>1 reset.
0.015592 0.020861 0.026935 0.270690 0.027104 0.078785 0.072411 0.056614 0.162915 0.298954 0.051581 0.171584 0.162666 0.140852 1.489934 0.900000 0.549954 1.997831 2.180158
ntime & nrate & np: 14 2 19
Bounds (np=19):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 9.538456
np = 19
lnL0 = -1453.763865
Iterating by ming2
Initial: fx= 1453.763865
x= 0.01559 0.02086 0.02694 0.27069 0.02710 0.07878 0.07241 0.05661 0.16292 0.29895 0.05158 0.17158 0.16267 0.14085 1.48993 0.90000 0.54995 1.99783 2.18016
1 h-m-p 0.0000 0.0003 483.3850 +++ 1412.670657 m 0.0003 44 | 1/19
2 h-m-p 0.0000 0.0000 223.0700 ++ 1412.336271 m 0.0000 85 | 2/19
3 h-m-p 0.0000 0.0005 1087.2904 ++YCYYYYCYCY 1357.461764 10 0.0005 140 | 2/19
4 h-m-p 0.0002 0.0008 80.8633 YCYCCCCC 1356.561903 7 0.0003 191 | 1/19
5 h-m-p 0.0001 0.0047 216.0303 CCCC 1354.432481 3 0.0001 236 | 1/19
6 h-m-p 0.0007 0.0126 28.6372 YYCCC 1353.973286 4 0.0012 282 | 1/19
7 h-m-p 0.0013 0.0086 27.0657 CCCC 1353.389458 3 0.0021 328 | 1/19
8 h-m-p 0.0050 0.0270 11.2624 YYC 1352.949936 2 0.0045 370 | 1/19
9 h-m-p 0.0026 0.0200 19.8120 CC 1352.370843 1 0.0030 412 | 1/19
10 h-m-p 0.0029 0.0146 19.5844 CYCCC 1350.718980 4 0.0057 459 | 1/19
11 h-m-p 0.0011 0.0054 32.5760 YCCCC 1349.519090 4 0.0027 506 | 1/19
12 h-m-p 0.0016 0.0081 16.5271 YCCC 1349.167403 3 0.0039 551 | 1/19
13 h-m-p 0.0005 0.0026 30.0633 ++ 1348.636438 m 0.0026 591 | 2/19
14 h-m-p 0.0018 0.0096 43.6428 CCCC 1348.351101 3 0.0019 637 | 2/19
15 h-m-p 0.0056 0.0279 12.6996 CC 1348.260231 1 0.0022 678 | 2/19
16 h-m-p 0.0064 0.0772 4.2591 YC 1348.232995 1 0.0029 718 | 2/19
17 h-m-p 0.0029 0.2197 4.2765 +CC 1348.109027 1 0.0125 760 | 2/19
18 h-m-p 0.0024 0.0940 22.2147 +CCCC 1347.271788 3 0.0147 806 | 2/19
19 h-m-p 0.1628 0.8141 1.9039 YYC 1346.448859 2 0.1334 847 | 2/19
20 h-m-p 1.6000 8.0000 0.0591 YCCC 1346.261817 3 0.8432 891 | 2/19
21 h-m-p 0.5674 8.0000 0.0878 CC 1346.249080 1 0.5304 932 | 2/19
22 h-m-p 0.9158 8.0000 0.0509 C 1346.238029 0 0.9060 971 | 2/19
23 h-m-p 1.0484 8.0000 0.0440 YC 1346.221336 1 2.3845 1011 | 2/19
24 h-m-p 0.7014 8.0000 0.1495 +YC 1346.116184 1 5.2181 1052 | 2/19
25 h-m-p 1.1099 8.0000 0.7027 +CCC 1345.801519 2 3.7424 1096 | 2/19
26 h-m-p 1.6000 8.0000 1.1682 YYC 1345.636897 2 1.3342 1137 | 2/19
27 h-m-p 1.4470 8.0000 1.0771 CCC 1345.563741 2 1.8166 1180 | 2/19
28 h-m-p 1.4030 8.0000 1.3946 CYC 1345.509334 2 1.7000 1222 | 2/19
29 h-m-p 1.4252 8.0000 1.6635 CC 1345.471306 1 1.4281 1263 | 2/19
30 h-m-p 1.6000 8.0000 1.3803 CCC 1345.445952 2 2.0210 1306 | 2/19
31 h-m-p 1.6000 8.0000 1.3556 CCC 1345.428444 2 2.0053 1349 | 2/19
32 h-m-p 1.6000 8.0000 1.2131 YCC 1345.409830 2 2.7074 1391 | 2/19
33 h-m-p 1.6000 8.0000 0.9767 YC 1345.384369 1 3.5588 1431 | 2/19
34 h-m-p 1.6000 8.0000 0.5229 YCC 1345.354110 2 2.6142 1473 | 2/19
35 h-m-p 1.6000 8.0000 0.8164 CYC 1345.338448 2 1.5274 1515 | 2/19
36 h-m-p 1.5083 8.0000 0.8268 C 1345.337404 0 1.2986 1554 | 2/19
37 h-m-p 1.6000 8.0000 0.5490 C 1345.337081 0 1.6518 1593 | 2/19
38 h-m-p 1.6000 8.0000 0.2184 Y 1345.337052 0 0.9685 1632 | 2/19
39 h-m-p 1.6000 8.0000 0.0243 C 1345.337049 0 2.0565 1671 | 2/19
40 h-m-p 1.6000 8.0000 0.0035 ++ 1345.337020 m 8.0000 1710 | 2/19
41 h-m-p 0.0205 0.6073 1.3823 +++ 1345.336314 m 0.6073 1750 | 2/19
42 h-m-p 0.0000 0.0000 1311514.4324
h-m-p: 0.00000000e+00 0.00000000e+00 1.31151443e+06 1345.336314
.. | 2/19
43 h-m-p 0.0000 0.0099 100.6723 YYCC 1345.215777 3 0.0000 1829 | 2/19
44 h-m-p 0.0009 0.1959 3.1544 YC 1345.213664 1 0.0004 1869 | 2/19
45 h-m-p 0.0003 0.0206 4.5441 YC 1345.210874 1 0.0005 1909 | 2/19
46 h-m-p 0.0005 0.0325 5.0188 YC 1345.205847 1 0.0011 1949 | 2/19
47 h-m-p 0.0012 0.0674 4.8350 YC 1345.198785 1 0.0019 1989 | 2/19
48 h-m-p 0.0018 0.0475 5.1239 CC 1345.196555 1 0.0007 2030 | 2/19
49 h-m-p 0.0035 0.4041 0.9986 YC 1345.195723 1 0.0024 2070 | 2/19
50 h-m-p 0.0098 1.0230 0.2410 -C 1345.195697 0 0.0010 2110 | 2/19
51 h-m-p 0.0009 0.3988 0.2667 Y 1345.195686 0 0.0006 2149 | 2/19
52 h-m-p 0.0055 2.7360 0.0830 C 1345.195680 0 0.0021 2188 | 2/19
53 h-m-p 0.0160 8.0000 0.0784 C 1345.195652 0 0.0162 2227 | 2/19
54 h-m-p 0.0046 2.2952 0.5811 YC 1345.195623 1 0.0024 2267 | 2/19
55 h-m-p 0.0143 7.1625 0.1024 C 1345.195617 0 0.0030 2306 | 2/19
56 h-m-p 0.0160 8.0000 0.0296 Y 1345.195616 0 0.0031 2345 | 2/19
57 h-m-p 0.0160 8.0000 0.0294 Y 1345.195616 0 0.0027 2384 | 2/19
58 h-m-p 0.0160 8.0000 0.0236 C 1345.195613 0 0.0180 2423 | 2/19
59 h-m-p 0.0160 8.0000 0.1430 ++C 1345.195341 0 0.3008 2464 | 2/19
60 h-m-p 1.1403 8.0000 0.0377 ++ 1345.193262 m 8.0000 2503 | 2/19
61 h-m-p 0.5139 8.0000 0.5874 +YC 1345.184180 1 4.3712 2544 | 2/19
62 h-m-p 1.6000 8.0000 1.1677 ++ 1345.115446 m 8.0000 2583 | 2/19
63 h-m-p 0.7056 4.6472 13.2401 ++ 1344.983673 m 4.6472 2622 | 3/19
64 h-m-p 0.0636 0.3181 3.3167 -CC 1344.982139 1 0.0062 2664 | 3/19
65 h-m-p 1.6000 8.0000 0.0044 CC 1344.979741 1 1.3286 2704 | 3/19
66 h-m-p 1.6000 8.0000 0.0003 Y 1344.979737 0 1.0481 2742 | 3/19
67 h-m-p 1.6000 8.0000 0.0000 Y 1344.979737 0 1.1618 2780 | 3/19
68 h-m-p 1.6000 8.0000 0.0000 ------C 1344.979737 0 0.0001 2824
Out..
lnL = -1344.979737
2825 lfun, 33900 eigenQcodon, 435050 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1390.151759 S = -1356.832973 -26.347900
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 122 patterns 5:03
did 20 / 122 patterns 5:03
did 30 / 122 patterns 5:03
did 40 / 122 patterns 5:03
did 50 / 122 patterns 5:03
did 60 / 122 patterns 5:04
did 70 / 122 patterns 5:04
did 80 / 122 patterns 5:04
did 90 / 122 patterns 5:04
did 100 / 122 patterns 5:04
did 110 / 122 patterns 5:05
did 120 / 122 patterns 5:05
did 122 / 122 patterns 5:05
Time used: 5:05
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=10, Len=149
D_melanogaster_CG13437-PA MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
D_sechellia_CG13437-PA MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
D_simulans_CG13437-PA MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
D_biarmipes_CG13437-PA MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADPERRPS
D_suzukii_CG13437-PA MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADPERRPS
D_eugracilis_CG13437-PA MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
D_ficusphila_CG13437-PA MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
D_rhopaloa_CG13437-PA MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTDRRPS
D_elegans_CG13437-PA MSMLGFVYLVLILGWILIVLFLKCKKSLSAPFRFGENYTDAIAETDRRPS
D_takahashii_CG13437-PA MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS
****************************:**************:.:****
D_melanogaster_CG13437-PA VHVIQLQHDDVEREDHYMNHFHQNTENLQRYSHRSQRSTLEERTIERTYP
D_sechellia_CG13437-PA VHVIQLQHDDVEREDHYMNHFHQNTENLQRYSHRSQRSTLEERTIERTYP
D_simulans_CG13437-PA VHVIQLQHDDVEREDHYMNHFHQNTENLQRYSHRSQRSTLEERTIERTYP
D_biarmipes_CG13437-PA VHVIQLQQDDVEREDHYMNNFHRNTENLQRYSHRSQRSTLEERTIERTYP
D_suzukii_CG13437-PA VHVIQLQQDDVEREDHYMNNFHRNTENLQRYSHRSQRSTLEERTIERTYP
D_eugracilis_CG13437-PA VHVIQLQHDDVEREDHYMNNFHRNTENLQRYSHRSQRSTLEERTIERTYP
D_ficusphila_CG13437-PA VHVIQLQHDDVEREDHYLDNFHRNTENLQRYSHRSQRSTLEERTIERTYP
D_rhopaloa_CG13437-PA VHVIQLQHDDVEREDHYMNNFHQNTENLQRYSHRSQRSTLEERTIERTYP
D_elegans_CG13437-PA VHVIQLQHDDVEREDHYMNNFHRNTENLQRYSHRSQRSTLEERTIERTYP
D_takahashii_CG13437-PA VHVIQLQHDDVEREDHYMNNFHRNTENLQRYSHRSQRSTLEERTIERTYP
*******:*********:::**:***************************
D_melanogaster_CG13437-PA TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
D_sechellia_CG13437-PA TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
D_simulans_CG13437-PA TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
D_biarmipes_CG13437-PA TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
D_suzukii_CG13437-PA TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
D_eugracilis_CG13437-PA TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
D_ficusphila_CG13437-PA TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
D_rhopaloa_CG13437-PA TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
D_elegans_CG13437-PA TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
D_takahashii_CG13437-PA TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
*************************************************
>D_melanogaster_CG13437-PA ATGAGCATGCTAGGATTTGTTTACCTGGTTCTCATCCTGGGCTGGATACT GATCGTTCTGTTCCTGAAGTGCAAAAAGTCCTTGGCCGCTCCGTTTCGGT TTGGCGAGAACTACACCGATGCCATCGCCGATACGGAACGTCGCCCATCG GTTCACGTTATCCAGTTGCAGCACGATGATGTGGAGCGCGAGGATCACTA TATGAACCACTTTCACCAAAACACGGAGAATCTGCAGCGCTACTCGCATC GCTCGCAACGTTCCACGTTGGAGGAGCGTACGATCGAGCGGACATATCCC ACGGATGCGGTGATAAATCCTGCCTATATGCACGACGAGGACTACGTGAT CAATGCACCTCCTCCGTCCTACGAGGAAGTGATGCGGCAGCCGCAGGTGT ATCCACAGGTGCGCCACAACAACCACAAGATCAGCGATGCTGACATC >D_sechellia_CG13437-PA ATGAGCATGCTAGGATTTGTCTACCTGGTTCTCATCCTGGGCTGGATACT GATCGTTCTGTTCCTGAAGTGCAAAAAGTCCTTGGCCGCTCCATTTCGGT TTGGCGAGAACTACACCGATGCCATCGCCGATACGGAACGTCGCCCATCG GTCCACGTTATCCAGTTGCAGCACGATGATGTGGAGCGCGAGGATCACTA TATGAACCATTTCCACCAAAACACGGAGAATCTGCAGCGCTACTCGCATC GCTCGCAACGTTCCACGCTGGAGGAGCGTACGATCGAGCGGACATATCCC ACGGATGCGGTGATAAATCCTGCCTATATGCACGACGAGGACTACGTGAT CAATGCACCTCCTCCGTCCTACGAGGAAGTGATGCGGCAGCCGCAGGTGT ATCCACAGGTGCGCCACAACAACCACAAGATCAGCGATGCTGACATC >D_simulans_CG13437-PA ATGAGCATGCTAGGATTTGTCTACCTGGTTCTTATCCTGGGCTGGATACT GATCGTTCTGTTCCTGAAGTGCAAAAAGTCCTTGGCCGCTCCATTTCGGT TTGGCGAGAACTACACCGATGCCATCGCCGATACGGAACGTCGCCCATCG GTCCACGTTATCCAGTTGCAGCACGATGATGTGGAGCGCGAGGATCACTA TATGAACCATTTCCACCAAAACACGGAGAATCTGCAGCGCTACTCGCATC GCTCGCAACGTTCTACGCTGGAGGAGCGTACGATCGAGCGGACATATCCC ACGGATGCGGTGATAAATCCTGCCTATATGCACGACGAGGACTACGTGAT CAATGCACCTCCTCCGTCCTACGAGGAAGTGATGCGCCAGCCGCAGGTGT ATCCACAGGTGCGCCACAACAACCACAAGATCAGCGATGCTGACATC >D_biarmipes_CG13437-PA ATGAGCATGCTGGGATTCGTCTATCTGGTTCTCATCCTGGGTTGGATACT GATCGTGTTGTTCCTCAAGTGCAAGAAGTCCTTGGCCGCTCCCTTTCGCT TTGGCGAAAACTACACCGATGCCATCGCCGATCCGGAACGACGTCCCTCA GTCCATGTGATCCAGCTGCAGCAGGATGATGTGGAGCGCGAAGATCACTA CATGAACAACTTTCACCGGAACACGGAGAACCTGCAGCGGTACTCGCATC GCTCGCAACGCTCCACCCTGGAGGAGCGGACCATCGAGAGGACCTATCCC ACGGATGCGGTGATAAACCCTGCTTATATGCACGACGAGGATTATGTGAT CAATGCCCCGCCACCTTCCTACGAGGAGGTGATGCGCCAGCCACAGGTGT ATCCCCAGGTGCGCCACAACAACCACAAGATCAGCGATGCTGACATC >D_suzukii_CG13437-PA ATGAGCATGCTGGGATTCGTCTATCTGGTTCTCATCCTGGGTTGGATACT GATCGTCTTGTTCCTCAAGTGCAAAAAGTCCTTGGCCGCTCCCTTTCGCT TTGGCGAAAACTACACCGATGCCATCGCCGATCCAGAACGACGTCCCTCA GTCCATGTGATCCAGCTGCAGCAGGATGATGTGGAGCGCGAAGATCATTA TATGAACAACTTTCACCGAAACACGGAGAACCTGCAGCGGTACTCGCATC GCTCGCAACGCTCCACTTTGGAGGAGCGGACAATCGAAAGGACCTATCCC ACAGATGCGGTGATAAATCCTGCTTATATGCACGATGAGGACTATGTGAT CAATGCCCCGCCACCATCCTACGAGGAGGTGATGCGCCAGCCACAGGTGT ATCCTCAGGTGCGCCATAACAACCACAAGATCAGCGATGCTGACATC >D_eugracilis_CG13437-PA ATGAGCATGCTGGGATTTGTCTACCTGGTTCTTATTCTGGGCTGGATACT GATCGTGTTGTTTCTGAAGTGCAAAAAGTCCTTAGCCGCTCCTTTTCGCT TTGGGGAAAACTACACCGATGCTATCGCAGATACTGAACGTCGTCCCTCT GTCCACGTAATCCAGCTGCAGCACGATGATGTGGAACGCGAAGATCATTA TATGAACAACTTTCATCGAAACACAGAGAATCTGCAGCGATATTCTCATC GCTCGCAACGCTCGACTTTGGAAGAGCGGACTATCGAGAGAACATATCCC ACGGATGCCGTGATAAATCCTGCCTATATGCACGATGAGGATTACGTGAT CAATGCTCCTCCGCCATCCTATGAGGAAGTGATGCGCCAGCCACAAGTGT ATCCTCAGGTTCGCCACAACAACCACAAGATCAGCGATGCTGACATC >D_ficusphila_CG13437-PA ATGAGCATGCTGGGATTTGTCTACCTGGTCCTCATCCTGGGTTGGATACT GATCGTATTGTTTCTGAAATGCAAAAAGTCCTTGGCCGCTCCCTTTCGCT TTGGCGAAAACTACACTGATGCCATCGCCGATACTGAGCGCCGGCCCTCA GTGCATGTGATCCAACTCCAGCACGATGATGTGGAACGCGAAGATCATTA CTTGGACAACTTTCACCGCAACACGGAGAACCTGCAGCGCTACTCGCATC GCTCGCAACGTTCCACTTTGGAGGAGCGGACAATTGAGCGGACCTATCCC ACGGATGCGGTGATAAATCCTGCCTATATGCACGATGAGGACTACGTGAT CAATGCCCCGCCACCATCTTACGAGGAGGTGATGCGCCAGCCGCAGGTGT ATCCTCAGGTGCGCCACAACAACCACAAGATCAGCGATGCTGACATC >D_rhopaloa_CG13437-PA ATGAGCATGCTGGGCTTTGTCTACCTGGTTCTTATCCTGGGCTGGATTCT AATCGTGCTGTTTCTTAAGTGCAAAAAGTCCTTGGCGGCTCCCTTTCGCT TTGGCGAAAACTACACCGACGCCATCGCCGATACGGATCGCCGTCCCTCC GTGCATGTAATCCAGCTGCAACACGATGATGTGGAGCGCGAAGATCATTA TATGAACAACTTTCACCAAAACACAGAGAATCTGCAGCGATACTCGCATC GTTCGCAACGCTCCACTTTGGAGGAGCGGACAATCGAGAGAACCTATCCA ACGGATGCGGTGATAAATCCTGCTTATATGCACGATGAGGATTACGTGAT CAACGCCCCTCCACCATCCTACGAAGAGGTGATGCGCCAGCCGCAGGTAT ATCCTCAGGTGCGCCACAACAACCACAAGATCAGCGATGCCGACATC >D_elegans_CG13437-PA ATGAGCATGCTGGGCTTTGTCTACTTGGTTCTCATCCTGGGCTGGATACT GATCGTCCTGTTTCTCAAGTGCAAAAAGTCCTTGTCCGCTCCATTTCGCT TTGGCGAAAACTACACAGATGCCATCGCCGAAACGGATCGACGTCCATCG GTGCATGTGATCCAGCTGCAACACGATGATGTGGAGCGGGAAGATCACTA TATGAACAACTTTCACCGGAACACGGAGAATCTGCAGCGCTACTCGCATC GTTCGCAACGCTCCACGCTGGAGGAGCGGACCATCGAGCGGACCTATCCC ACGGATGCGGTGATCAATCCTGCCTACATGCACGATGAGGATTATGTGAT CAACGCCCCTCCACCGTCATACGAGGAGGTAATGCGCCAGCCGCAGGTGT ATCCTCAGGTGCGACACAACAACCACAAGATCAGCGATGCCGACATC >D_takahashii_CG13437-PA ATGAGCATGCTGGGATTTGTCTATCTGGTTCTCATCCTGGGCTGGATACT GATCGTCTTGTTTCTTAAGTGCAAAAAGTCCTTGGCCGCCCCCTTTCGCT TTGGCGAAAACTACACCGATGCCATCGCCGATACGGAGCGACGTCCCTCA GTCCATGTGATTCAACTGCAGCACGATGATGTGGAACGAGAAGATCACTA CATGAACAACTTTCACCGAAACACGGAGAATCTGCAGCGATACTCGCATC GCTCGCAGCGATCCACCTTGGAGGAGCGGACAATCGAGAGGACATATCCC ACGGATGCGGTGATAAATCCAGCCTATATGCACGATGAGGATTACGTGAT CAACGCCCCTCCACCATCCTACGAGGAGGTGATGCGCCAACCACAGGTGT ATCCTCAGGTGCGCCACAACAACCACAAGATCAGCGATGCTGACATC
>D_melanogaster_CG13437-PA MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS VHVIQLQHDDVEREDHYMNHFHQNTENLQRYSHRSQRSTLEERTIERTYP TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI >D_sechellia_CG13437-PA MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS VHVIQLQHDDVEREDHYMNHFHQNTENLQRYSHRSQRSTLEERTIERTYP TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI >D_simulans_CG13437-PA MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS VHVIQLQHDDVEREDHYMNHFHQNTENLQRYSHRSQRSTLEERTIERTYP TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI >D_biarmipes_CG13437-PA MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADPERRPS VHVIQLQQDDVEREDHYMNNFHRNTENLQRYSHRSQRSTLEERTIERTYP TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI >D_suzukii_CG13437-PA MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADPERRPS VHVIQLQQDDVEREDHYMNNFHRNTENLQRYSHRSQRSTLEERTIERTYP TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI >D_eugracilis_CG13437-PA MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS VHVIQLQHDDVEREDHYMNNFHRNTENLQRYSHRSQRSTLEERTIERTYP TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI >D_ficusphila_CG13437-PA MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS VHVIQLQHDDVEREDHYLDNFHRNTENLQRYSHRSQRSTLEERTIERTYP TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI >D_rhopaloa_CG13437-PA MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTDRRPS VHVIQLQHDDVEREDHYMNNFHQNTENLQRYSHRSQRSTLEERTIERTYP TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI >D_elegans_CG13437-PA MSMLGFVYLVLILGWILIVLFLKCKKSLSAPFRFGENYTDAIAETDRRPS VHVIQLQHDDVEREDHYMNNFHRNTENLQRYSHRSQRSTLEERTIERTYP TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI >D_takahashii_CG13437-PA MSMLGFVYLVLILGWILIVLFLKCKKSLAAPFRFGENYTDAIADTERRPS VHVIQLQHDDVEREDHYMNNFHRNTENLQRYSHRSQRSTLEERTIERTYP TDAVINPAYMHDEDYVINAPPPSYEEVMRQPQVYPQVRHNNHKISDADI
#NEXUS
[ID: 3701588263]
begin taxa;
dimensions ntax=10;
taxlabels
D_melanogaster_CG13437-PA
D_sechellia_CG13437-PA
D_simulans_CG13437-PA
D_biarmipes_CG13437-PA
D_suzukii_CG13437-PA
D_eugracilis_CG13437-PA
D_ficusphila_CG13437-PA
D_rhopaloa_CG13437-PA
D_elegans_CG13437-PA
D_takahashii_CG13437-PA
;
end;
begin trees;
translate
1 D_melanogaster_CG13437-PA,
2 D_sechellia_CG13437-PA,
3 D_simulans_CG13437-PA,
4 D_biarmipes_CG13437-PA,
5 D_suzukii_CG13437-PA,
6 D_eugracilis_CG13437-PA,
7 D_ficusphila_CG13437-PA,
8 D_rhopaloa_CG13437-PA,
9 D_elegans_CG13437-PA,
10 D_takahashii_CG13437-PA
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.0240894,2:0.00333311,3:0.01309153,(((4:0.06506244,5:0.02980107)0.999:0.06294476,7:0.1443904)0.512:0.02403913,6:0.1978038,(8:0.1062042,9:0.1558475)0.843:0.04849357,10:0.08060624)1.000:0.2253118);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.0240894,2:0.00333311,3:0.01309153,(((4:0.06506244,5:0.02980107):0.06294476,7:0.1443904):0.02403913,6:0.1978038,(8:0.1062042,9:0.1558475):0.04849357,10:0.08060624):0.2253118);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/64/CG13437-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/64/CG13437-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/64/CG13437-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1465.53 -1479.72
2 -1466.37 -1480.92
--------------------------------------
TOTAL -1465.86 -1480.49
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/64/CG13437-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/64/CG13437-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/64/CG13437-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.277621 0.026815 0.975096 1.599881 1.263421 1406.18 1453.59 1.000
r(A<->C){all} 0.144416 0.001140 0.075064 0.208558 0.143203 850.32 879.84 1.000
r(A<->G){all} 0.292213 0.002590 0.196802 0.394948 0.290827 696.40 768.75 1.000
r(A<->T){all} 0.072289 0.000930 0.017804 0.131197 0.069205 791.16 954.99 1.000
r(C<->G){all} 0.048395 0.000337 0.013903 0.084001 0.046805 1095.66 1110.33 1.000
r(C<->T){all} 0.388771 0.003157 0.283007 0.495945 0.387931 640.85 667.11 1.000
r(G<->T){all} 0.053916 0.000546 0.012753 0.101068 0.051192 895.99 902.68 1.000
pi(A){all} 0.231663 0.000383 0.192301 0.268329 0.230768 1087.50 1144.84 1.000
pi(C){all} 0.291344 0.000390 0.253503 0.329741 0.291166 1028.65 1054.56 1.000
pi(G){all} 0.254996 0.000375 0.215221 0.290583 0.254717 1248.09 1264.71 1.000
pi(T){all} 0.221997 0.000311 0.187087 0.255242 0.221659 779.92 944.29 1.000
alpha{1,2} 0.075216 0.000413 0.023923 0.112844 0.078047 1004.72 1061.98 1.001
alpha{3} 2.568287 0.596214 1.258570 4.081137 2.457264 1248.24 1374.62 1.000
pinvar{all} 0.305945 0.003834 0.179729 0.418067 0.308509 1271.68 1386.34 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/64/CG13437-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 10 ls = 149
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 4 3 3 3 3 5 | Ser TCT 0 0 1 0 0 2 | Tyr TAT 4 4 4 5 6 6 | Cys TGT 0 0 0 0 0 0
TTC 1 2 2 2 2 0 | TCC 3 3 2 3 3 2 | TAC 5 5 5 4 3 3 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 1 | TCA 0 0 0 1 1 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 2 2 2 3 2 | TCG 3 3 3 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 1 0 0 1 | Pro CCT 3 3 3 2 2 4 | His CAT 1 2 2 2 4 3 | Arg CGT 3 3 3 1 1 2
CTC 1 1 0 2 2 0 | CCC 1 1 1 4 3 2 | CAC 8 7 7 5 3 5 | CGC 5 5 6 6 6 6
CTA 1 1 1 0 0 0 | CCA 2 3 3 2 4 2 | Gln CAA 2 2 2 1 1 2 | CGA 0 0 0 1 2 2
CTG 6 7 7 7 6 7 | CCG 3 2 2 2 1 1 | CAG 6 6 6 7 7 5 | CGG 3 3 2 3 2 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 1 | Thr ACT 0 0 0 0 1 3 | Asn AAT 3 3 3 1 2 3 | Ser AGT 0 0 0 0 0 0
ATC 8 8 8 8 8 7 | ACC 1 1 1 4 2 1 | AAC 5 5 5 8 7 6 | AGC 2 2 2 2 2 2
ATA 2 2 2 2 2 2 | ACA 1 1 1 0 2 2 | Lys AAA 1 1 1 0 1 1 | Arg AGA 0 0 0 0 0 1
Met ATG 5 5 5 5 5 5 | ACG 5 5 5 2 1 1 | AAG 3 3 3 4 3 3 | AGG 0 0 0 1 1 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 5 3 3 1 1 2 | Ala GCT 2 2 2 3 3 4 | Asp GAT 7 7 7 8 8 9 | Gly GGT 0 0 0 1 1 0
GTC 0 2 2 2 3 2 | GCC 4 4 4 4 4 3 | GAC 3 3 3 2 2 1 | GGC 2 2 2 1 1 1
GTA 0 0 0 0 0 1 | GCA 1 1 1 0 0 1 | Glu GAA 2 2 2 3 4 6 | GGA 1 1 1 1 1 1
GTG 6 6 6 8 7 6 | GCG 1 1 1 1 1 0 | GAG 9 9 9 8 7 5 | GGG 0 0 0 0 0 1
--------------------------------------------------------------------------------------------------------------------------------------
------------------------------------------------------------------------------------------------------
Phe TTT 5 5 5 5 | Ser TCT 1 0 0 0 | Tyr TAT 3 4 4 4 | Cys TGT 0 0 0 0
TTC 0 0 0 0 | TCC 2 4 3 3 | TAC 6 5 5 5 | TGC 1 1 1 1
Leu TTA 0 0 0 0 | TCA 1 0 1 1 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0
TTG 4 2 2 3 | TCG 2 2 3 2 | TAG 0 0 0 0 | Trp TGG 1 1 1 1
------------------------------------------------------------------------------------------------------
Leu CTT 0 2 0 1 | Pro CCT 2 3 3 2 | His CAT 3 3 2 2 | Arg CGT 1 2 2 1
CTC 2 0 2 1 | CCC 3 2 1 3 | CAC 5 5 6 6 | CGC 8 6 4 4
CTA 0 1 0 0 | CCA 2 3 3 4 | Gln CAA 2 3 2 2 | CGA 0 1 2 5
CTG 6 6 7 6 | CCG 2 1 2 0 | CAG 5 5 5 5 | CGG 3 1 4 1
------------------------------------------------------------------------------------------------------
Ile ATT 1 1 0 1 | Thr ACT 3 1 0 0 | Asn AAT 2 2 2 2 | Ser AGT 0 0 0 0
ATC 7 8 9 7 | ACC 1 2 2 2 | AAC 6 7 7 7 | AGC 2 2 2 2
ATA 2 1 1 2 | ACA 1 2 1 2 | Lys AAA 2 1 1 1 | Arg AGA 0 1 0 0
Met ATG 4 5 5 5 | ACG 2 2 4 3 | AAG 2 3 3 3 | AGG 0 0 0 1
------------------------------------------------------------------------------------------------------
Val GTT 0 1 1 1 | Ala GCT 2 2 1 1 | Asp GAT 8 9 9 9 | Gly GGT 1 0 0 0
GTC 2 1 2 3 | GCC 5 4 5 6 | GAC 3 2 1 1 | GGC 1 3 3 2
GTA 1 2 1 0 | GCA 0 0 0 0 | Glu GAA 3 3 3 3 | GGA 1 0 0 1
GTG 8 7 7 7 | GCG 1 2 1 1 | GAG 8 7 8 8 | GGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_CG13437-PA
position 1: T:0.16779 C:0.30201 A:0.24161 G:0.28859
position 2: T:0.28188 C:0.20134 A:0.39597 G:0.12081
position 3: T:0.21477 C:0.33557 A:0.08725 G:0.36242
Average T:0.22148 C:0.27964 A:0.24161 G:0.25727
#2: D_sechellia_CG13437-PA
position 1: T:0.16107 C:0.30872 A:0.24161 G:0.28859
position 2: T:0.28188 C:0.20134 A:0.39597 G:0.12081
position 3: T:0.20134 C:0.34899 A:0.09396 G:0.35570
Average T:0.21477 C:0.28635 A:0.24385 G:0.25503
#3: D_simulans_CG13437-PA
position 1: T:0.16107 C:0.30872 A:0.24161 G:0.28859
position 2: T:0.28188 C:0.20134 A:0.39597 G:0.12081
position 3: T:0.21477 C:0.34228 A:0.09396 G:0.34899
Average T:0.21924 C:0.28412 A:0.24385 G:0.25280
#4: D_biarmipes_CG13437-PA
position 1: T:0.16107 C:0.30201 A:0.24832 G:0.28859
position 2: T:0.28188 C:0.20134 A:0.38926 G:0.12752
position 3: T:0.18121 C:0.38926 A:0.07383 G:0.35570
Average T:0.20805 C:0.29754 A:0.23714 G:0.25727
#5: D_suzukii_CG13437-PA
position 1: T:0.16779 C:0.29530 A:0.24832 G:0.28859
position 2: T:0.28188 C:0.20134 A:0.38926 G:0.12752
position 3: T:0.21477 C:0.34899 A:0.12081 G:0.31544
Average T:0.22148 C:0.28188 A:0.25280 G:0.24385
#6: D_eugracilis_CG13437-PA
position 1: T:0.16779 C:0.28859 A:0.25503 G:0.28859
position 2: T:0.28188 C:0.20134 A:0.38926 G:0.12752
position 3: T:0.30201 C:0.28188 A:0.14765 G:0.26846
Average T:0.25056 C:0.25727 A:0.26398 G:0.22819
#7: D_ficusphila_CG13437-PA
position 1: T:0.17450 C:0.29530 A:0.23490 G:0.29530
position 2: T:0.28188 C:0.20134 A:0.38926 G:0.12752
position 3: T:0.21477 C:0.36242 A:0.10067 G:0.32215
Average T:0.22371 C:0.28635 A:0.24161 G:0.24832
#8: D_rhopaloa_CG13437-PA
position 1: T:0.16107 C:0.29530 A:0.25503 G:0.28859
position 2: T:0.28188 C:0.20134 A:0.39597 G:0.12081
position 3: T:0.23490 C:0.34899 A:0.12081 G:0.29530
Average T:0.22595 C:0.28188 A:0.25727 G:0.23490
#9: D_elegans_CG13437-PA
position 1: T:0.16779 C:0.30201 A:0.24832 G:0.28188
position 2: T:0.28188 C:0.20134 A:0.38926 G:0.12752
position 3: T:0.19463 C:0.35570 A:0.10067 G:0.34899
Average T:0.21477 C:0.28635 A:0.24609 G:0.25280
#10: D_takahashii_CG13437-PA
position 1: T:0.16779 C:0.28859 A:0.25503 G:0.28859
position 2: T:0.28188 C:0.20134 A:0.38926 G:0.12752
position 3: T:0.19463 C:0.35570 A:0.14094 G:0.30872
Average T:0.21477 C:0.28188 A:0.26174 G:0.24161
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 41 | Ser S TCT 4 | Tyr Y TAT 44 | Cys C TGT 0
TTC 9 | TCC 28 | TAC 46 | TGC 10
Leu L TTA 1 | TCA 5 | *** * TAA 0 | *** * TGA 0
TTG 25 | TCG 24 | TAG 0 | Trp W TGG 10
------------------------------------------------------------------------------
Leu L CTT 5 | Pro P CCT 27 | His H CAT 24 | Arg R CGT 19
CTC 11 | CCC 21 | CAC 57 | CGC 56
CTA 4 | CCA 28 | Gln Q CAA 19 | CGA 13
CTG 65 | CCG 16 | CAG 57 | CGG 23
------------------------------------------------------------------------------
Ile I ATT 4 | Thr T ACT 8 | Asn N AAT 23 | Ser S AGT 0
ATC 78 | ACC 17 | AAC 63 | AGC 20
ATA 18 | ACA 13 | Lys K AAA 10 | Arg R AGA 2
Met M ATG 49 | ACG 30 | AAG 30 | AGG 3
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 22 | Asp D GAT 81 | Gly G GGT 3
GTC 19 | GCC 43 | GAC 21 | GGC 18
GTA 5 | GCA 4 | Glu E GAA 31 | GGA 8
GTG 68 | GCG 10 | GAG 78 | GGG 1
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.16577 C:0.29866 A:0.24698 G:0.28859
position 2: T:0.28188 C:0.20134 A:0.39195 G:0.12483
position 3: T:0.21678 C:0.34698 A:0.10805 G:0.32819
Average T:0.22148 C:0.28233 A:0.24899 G:0.24720
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_CG13437-PA
D_sechellia_CG13437-PA -1.0000 (0.0000 0.0616)
D_simulans_CG13437-PA -1.0000 (0.0000 0.0945)-1.0000 (0.0000 0.0301)
D_biarmipes_CG13437-PA 0.0181 (0.0117 0.6446) 0.0189 (0.0117 0.6189) 0.0182 (0.0117 0.6433)
D_suzukii_CG13437-PA 0.0180 (0.0117 0.6473) 0.0175 (0.0117 0.6678) 0.0168 (0.0117 0.6941)-1.0000 (0.0000 0.1884)
D_eugracilis_CG13437-PA 0.0075 (0.0058 0.7748) 0.0073 (0.0058 0.7987) 0.0078 (0.0058 0.7459) 0.0076 (0.0058 0.7674) 0.0090 (0.0058 0.6448)
D_ficusphila_CG13437-PA 0.0264 (0.0161 0.6106) 0.0247 (0.0161 0.6532) 0.0237 (0.0161 0.6788) 0.0256 (0.0117 0.4568) 0.0327 (0.0117 0.3573) 0.0079 (0.0058 0.7406)
D_rhopaloa_CG13437-PA 0.0074 (0.0058 0.7816) 0.0070 (0.0058 0.8354) 0.0072 (0.0058 0.8083) 0.0201 (0.0117 0.5802) 0.0242 (0.0117 0.4821) 0.0096 (0.0058 0.6047) 0.0239 (0.0131 0.5488)
D_elegans_CG13437-PA 0.0246 (0.0146 0.5949) 0.0257 (0.0147 0.5710) 0.0247 (0.0147 0.5937) 0.0311 (0.0147 0.4717) 0.0276 (0.0147 0.5305) 0.0090 (0.0088 0.9775) 0.0258 (0.0147 0.5689) 0.0191 (0.0087 0.4586)
D_takahashii_CG13437-PA 0.0087 (0.0058 0.6665) 0.0085 (0.0058 0.6874) 0.0081 (0.0058 0.7143) 0.0157 (0.0058 0.3712) 0.0163 (0.0058 0.3566)-1.0000 (0.0000 0.6179) 0.0144 (0.0058 0.4039) 0.0121 (0.0058 0.4793) 0.0173 (0.0088 0.5080)
Model 0: one-ratio
TREE # 1: (1, 2, 3, (((4, 5), 7), 6, (8, 9), 10)); MP score: 191
lnL(ntime: 14 np: 16): -1345.815275 +0.000000
11..1 11..2 11..3 11..12 12..13 13..14 14..4 14..5 13..7 12..6 12..15 15..8 15..9 12..10
0.043497 0.000004 0.021323 0.354564 0.033967 0.082492 0.098759 0.032907 0.192660 0.246617 0.088305 0.134408 0.215272 0.111541 1.489518 0.011604
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.65632
(1: 0.043497, 2: 0.000004, 3: 0.021323, (((4: 0.098759, 5: 0.032907): 0.082492, 7: 0.192660): 0.033967, 6: 0.246617, (8: 0.134408, 9: 0.215272): 0.088305, 10: 0.111541): 0.354564);
(D_melanogaster_CG13437-PA: 0.043497, D_sechellia_CG13437-PA: 0.000004, D_simulans_CG13437-PA: 0.021323, (((D_biarmipes_CG13437-PA: 0.098759, D_suzukii_CG13437-PA: 0.032907): 0.082492, D_ficusphila_CG13437-PA: 0.192660): 0.033967, D_eugracilis_CG13437-PA: 0.246617, (D_rhopaloa_CG13437-PA: 0.134408, D_elegans_CG13437-PA: 0.215272): 0.088305, D_takahashii_CG13437-PA: 0.111541): 0.354564);
Detailed output identifying parameters
kappa (ts/tv) = 1.48952
omega (dN/dS) = 0.01160
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.043 351.1 95.9 0.0116 0.0008 0.0648 0.3 6.2
11..2 0.000 351.1 95.9 0.0116 0.0000 0.0000 0.0 0.0
11..3 0.021 351.1 95.9 0.0116 0.0004 0.0318 0.1 3.0
11..12 0.355 351.1 95.9 0.0116 0.0061 0.5283 2.2 50.7
12..13 0.034 351.1 95.9 0.0116 0.0006 0.0506 0.2 4.9
13..14 0.082 351.1 95.9 0.0116 0.0014 0.1229 0.5 11.8
14..4 0.099 351.1 95.9 0.0116 0.0017 0.1471 0.6 14.1
14..5 0.033 351.1 95.9 0.0116 0.0006 0.0490 0.2 4.7
13..7 0.193 351.1 95.9 0.0116 0.0033 0.2871 1.2 27.5
12..6 0.247 351.1 95.9 0.0116 0.0043 0.3674 1.5 35.2
12..15 0.088 351.1 95.9 0.0116 0.0015 0.1316 0.5 12.6
15..8 0.134 351.1 95.9 0.0116 0.0023 0.2003 0.8 19.2
15..9 0.215 351.1 95.9 0.0116 0.0037 0.3207 1.3 30.8
12..10 0.112 351.1 95.9 0.0116 0.0019 0.1662 0.7 15.9
tree length for dN: 0.0286
tree length for dS: 2.4678
Time used: 0:07
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, (((4, 5), 7), 6, (8, 9), 10)); MP score: 191
check convergence..
lnL(ntime: 14 np: 17): -1344.872726 +0.000000
11..1 11..2 11..3 11..12 12..13 13..14 14..4 14..5 13..7 12..6 12..15 15..8 15..9 12..10
0.043699 0.000004 0.021426 0.358301 0.034550 0.083736 0.099540 0.033466 0.193794 0.250390 0.090624 0.134539 0.217468 0.113283 1.489789 0.994009 0.009630
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.67482
(1: 0.043699, 2: 0.000004, 3: 0.021426, (((4: 0.099540, 5: 0.033466): 0.083736, 7: 0.193794): 0.034550, 6: 0.250390, (8: 0.134539, 9: 0.217468): 0.090624, 10: 0.113283): 0.358301);
(D_melanogaster_CG13437-PA: 0.043699, D_sechellia_CG13437-PA: 0.000004, D_simulans_CG13437-PA: 0.021426, (((D_biarmipes_CG13437-PA: 0.099540, D_suzukii_CG13437-PA: 0.033466): 0.083736, D_ficusphila_CG13437-PA: 0.193794): 0.034550, D_eugracilis_CG13437-PA: 0.250390, (D_rhopaloa_CG13437-PA: 0.134539, D_elegans_CG13437-PA: 0.217468): 0.090624, D_takahashii_CG13437-PA: 0.113283): 0.358301);
Detailed output identifying parameters
kappa (ts/tv) = 1.48979
dN/dS (w) for site classes (K=2)
p: 0.99401 0.00599
w: 0.00963 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.044 351.1 95.9 0.0156 0.0010 0.0642 0.4 6.2
11..2 0.000 351.1 95.9 0.0156 0.0000 0.0000 0.0 0.0
11..3 0.021 351.1 95.9 0.0156 0.0005 0.0315 0.2 3.0
11..12 0.358 351.1 95.9 0.0156 0.0082 0.5265 2.9 50.5
12..13 0.035 351.1 95.9 0.0156 0.0008 0.0508 0.3 4.9
13..14 0.084 351.1 95.9 0.0156 0.0019 0.1230 0.7 11.8
14..4 0.100 351.1 95.9 0.0156 0.0023 0.1463 0.8 14.0
14..5 0.033 351.1 95.9 0.0156 0.0008 0.0492 0.3 4.7
13..7 0.194 351.1 95.9 0.0156 0.0044 0.2848 1.6 27.3
12..6 0.250 351.1 95.9 0.0156 0.0057 0.3679 2.0 35.3
12..15 0.091 351.1 95.9 0.0156 0.0021 0.1332 0.7 12.8
15..8 0.135 351.1 95.9 0.0156 0.0031 0.1977 1.1 19.0
15..9 0.217 351.1 95.9 0.0156 0.0050 0.3196 1.7 30.7
12..10 0.113 351.1 95.9 0.0156 0.0026 0.1665 0.9 16.0
Time used: 0:15
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, (((4, 5), 7), 6, (8, 9), 10)); MP score: 191
lnL(ntime: 14 np: 19): -1344.872726 +0.000000
11..1 11..2 11..3 11..12 12..13 13..14 14..4 14..5 13..7 12..6 12..15 15..8 15..9 12..10
0.043699 0.000004 0.021426 0.358301 0.034550 0.083736 0.099540 0.033466 0.193793 0.250390 0.090624 0.134539 0.217467 0.113283 1.489786 0.994009 0.005991 0.009630 86.951551
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.67482
(1: 0.043699, 2: 0.000004, 3: 0.021426, (((4: 0.099540, 5: 0.033466): 0.083736, 7: 0.193793): 0.034550, 6: 0.250390, (8: 0.134539, 9: 0.217467): 0.090624, 10: 0.113283): 0.358301);
(D_melanogaster_CG13437-PA: 0.043699, D_sechellia_CG13437-PA: 0.000004, D_simulans_CG13437-PA: 0.021426, (((D_biarmipes_CG13437-PA: 0.099540, D_suzukii_CG13437-PA: 0.033466): 0.083736, D_ficusphila_CG13437-PA: 0.193793): 0.034550, D_eugracilis_CG13437-PA: 0.250390, (D_rhopaloa_CG13437-PA: 0.134539, D_elegans_CG13437-PA: 0.217467): 0.090624, D_takahashii_CG13437-PA: 0.113283): 0.358301);
Detailed output identifying parameters
kappa (ts/tv) = 1.48979
dN/dS (w) for site classes (K=3)
p: 0.99401 0.00599 0.00000
w: 0.00963 1.00000 86.95155
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.044 351.1 95.9 0.0156 0.0010 0.0642 0.4 6.2
11..2 0.000 351.1 95.9 0.0156 0.0000 0.0000 0.0 0.0
11..3 0.021 351.1 95.9 0.0156 0.0005 0.0315 0.2 3.0
11..12 0.358 351.1 95.9 0.0156 0.0082 0.5265 2.9 50.5
12..13 0.035 351.1 95.9 0.0156 0.0008 0.0508 0.3 4.9
13..14 0.084 351.1 95.9 0.0156 0.0019 0.1230 0.7 11.8
14..4 0.100 351.1 95.9 0.0156 0.0023 0.1463 0.8 14.0
14..5 0.033 351.1 95.9 0.0156 0.0008 0.0492 0.3 4.7
13..7 0.194 351.1 95.9 0.0156 0.0044 0.2848 1.6 27.3
12..6 0.250 351.1 95.9 0.0156 0.0057 0.3679 2.0 35.3
12..15 0.091 351.1 95.9 0.0156 0.0021 0.1332 0.7 12.8
15..8 0.135 351.1 95.9 0.0156 0.0031 0.1977 1.1 19.0
15..9 0.217 351.1 95.9 0.0156 0.0050 0.3196 1.7 30.7
12..10 0.113 351.1 95.9 0.0156 0.0026 0.1665 0.9 16.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG13437-PA)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.138 0.108 0.098 0.095 0.094 0.094 0.094 0.094 0.094 0.094
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
sum of density on p0-p1 = 1.000000
Time used: 1:09
Model 3: discrete (3 categories)
TREE # 1: (1, 2, 3, (((4, 5), 7), 6, (8, 9), 10)); MP score: 191
lnL(ntime: 14 np: 20): -1344.822129 +0.000000
11..1 11..2 11..3 11..12 12..13 13..14 14..4 14..5 13..7 12..6 12..15 15..8 15..9 12..10
0.043657 0.000004 0.021403 0.357697 0.034403 0.083467 0.099380 0.033325 0.193564 0.249618 0.090085 0.134544 0.217094 0.112873 1.486503 0.993574 0.000000 0.009540 0.071474 0.737088
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.67111
(1: 0.043657, 2: 0.000004, 3: 0.021403, (((4: 0.099380, 5: 0.033325): 0.083467, 7: 0.193564): 0.034403, 6: 0.249618, (8: 0.134544, 9: 0.217094): 0.090085, 10: 0.112873): 0.357697);
(D_melanogaster_CG13437-PA: 0.043657, D_sechellia_CG13437-PA: 0.000004, D_simulans_CG13437-PA: 0.021403, (((D_biarmipes_CG13437-PA: 0.099380, D_suzukii_CG13437-PA: 0.033325): 0.083467, D_ficusphila_CG13437-PA: 0.193564): 0.034403, D_eugracilis_CG13437-PA: 0.249618, (D_rhopaloa_CG13437-PA: 0.134544, D_elegans_CG13437-PA: 0.217094): 0.090085, D_takahashii_CG13437-PA: 0.112873): 0.357697);
Detailed output identifying parameters
kappa (ts/tv) = 1.48650
dN/dS (w) for site classes (K=3)
p: 0.99357 0.00000 0.00643
w: 0.00954 0.07147 0.73709
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.044 351.1 95.9 0.0142 0.0009 0.0645 0.3 6.2
11..2 0.000 351.1 95.9 0.0142 0.0000 0.0000 0.0 0.0
11..3 0.021 351.1 95.9 0.0142 0.0004 0.0316 0.2 3.0
11..12 0.358 351.1 95.9 0.0142 0.0075 0.5283 2.6 50.7
12..13 0.034 351.1 95.9 0.0142 0.0007 0.0508 0.3 4.9
13..14 0.083 351.1 95.9 0.0142 0.0018 0.1233 0.6 11.8
14..4 0.099 351.1 95.9 0.0142 0.0021 0.1468 0.7 14.1
14..5 0.033 351.1 95.9 0.0142 0.0007 0.0492 0.2 4.7
13..7 0.194 351.1 95.9 0.0142 0.0041 0.2859 1.4 27.4
12..6 0.250 351.1 95.9 0.0142 0.0052 0.3687 1.8 35.4
12..15 0.090 351.1 95.9 0.0142 0.0019 0.1331 0.7 12.8
15..8 0.135 351.1 95.9 0.0142 0.0028 0.1987 1.0 19.1
15..9 0.217 351.1 95.9 0.0142 0.0046 0.3207 1.6 30.7
12..10 0.113 351.1 95.9 0.0142 0.0024 0.1667 0.8 16.0
Naive Empirical Bayes (NEB) analysis
Time used: 1:38
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, (((4, 5), 7), 6, (8, 9), 10)); MP score: 191
lnL(ntime: 14 np: 17): -1345.336880 +0.000000
11..1 11..2 11..3 11..12 12..13 13..14 14..4 14..5 13..7 12..6 12..15 15..8 15..9 12..10
0.043493 0.000004 0.021323 0.354782 0.034025 0.082449 0.098779 0.032934 0.192722 0.246674 0.088264 0.134424 0.215376 0.111555 1.489934 0.318778 24.693150
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.65680
(1: 0.043493, 2: 0.000004, 3: 0.021323, (((4: 0.098779, 5: 0.032934): 0.082449, 7: 0.192722): 0.034025, 6: 0.246674, (8: 0.134424, 9: 0.215376): 0.088264, 10: 0.111555): 0.354782);
(D_melanogaster_CG13437-PA: 0.043493, D_sechellia_CG13437-PA: 0.000004, D_simulans_CG13437-PA: 0.021323, (((D_biarmipes_CG13437-PA: 0.098779, D_suzukii_CG13437-PA: 0.032934): 0.082449, D_ficusphila_CG13437-PA: 0.192722): 0.034025, D_eugracilis_CG13437-PA: 0.246674, (D_rhopaloa_CG13437-PA: 0.134424, D_elegans_CG13437-PA: 0.215376): 0.088264, D_takahashii_CG13437-PA: 0.111555): 0.354782);
Detailed output identifying parameters
kappa (ts/tv) = 1.48993
Parameters in M7 (beta):
p = 0.31878 q = 24.69315
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00008 0.00038 0.00110 0.00247 0.00484 0.00873 0.01522 0.02705 0.05702
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.043 351.1 95.9 0.0117 0.0008 0.0648 0.3 6.2
11..2 0.000 351.1 95.9 0.0117 0.0000 0.0000 0.0 0.0
11..3 0.021 351.1 95.9 0.0117 0.0004 0.0318 0.1 3.0
11..12 0.355 351.1 95.9 0.0117 0.0062 0.5284 2.2 50.7
12..13 0.034 351.1 95.9 0.0117 0.0006 0.0507 0.2 4.9
13..14 0.082 351.1 95.9 0.0117 0.0014 0.1228 0.5 11.8
14..4 0.099 351.1 95.9 0.0117 0.0017 0.1471 0.6 14.1
14..5 0.033 351.1 95.9 0.0117 0.0006 0.0491 0.2 4.7
13..7 0.193 351.1 95.9 0.0117 0.0034 0.2870 1.2 27.5
12..6 0.247 351.1 95.9 0.0117 0.0043 0.3674 1.5 35.2
12..15 0.088 351.1 95.9 0.0117 0.0015 0.1315 0.5 12.6
15..8 0.134 351.1 95.9 0.0117 0.0023 0.2002 0.8 19.2
15..9 0.215 351.1 95.9 0.0117 0.0037 0.3208 1.3 30.8
12..10 0.112 351.1 95.9 0.0117 0.0019 0.1661 0.7 15.9
Time used: 2:50
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, (((4, 5), 7), 6, (8, 9), 10)); MP score: 191
lnL(ntime: 14 np: 19): -1344.979737 +0.000000
11..1 11..2 11..3 11..12 12..13 13..14 14..4 14..5 13..7 12..6 12..15 15..8 15..9 12..10
0.043665 0.000004 0.021410 0.357677 0.034484 0.083519 0.099416 0.033392 0.193608 0.249783 0.090250 0.134506 0.217107 0.113017 1.491067 0.994835 1.034932 99.000000 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.67184
(1: 0.043665, 2: 0.000004, 3: 0.021410, (((4: 0.099416, 5: 0.033392): 0.083519, 7: 0.193608): 0.034484, 6: 0.249783, (8: 0.134506, 9: 0.217107): 0.090250, 10: 0.113017): 0.357677);
(D_melanogaster_CG13437-PA: 0.043665, D_sechellia_CG13437-PA: 0.000004, D_simulans_CG13437-PA: 0.021410, (((D_biarmipes_CG13437-PA: 0.099416, D_suzukii_CG13437-PA: 0.033392): 0.083519, D_ficusphila_CG13437-PA: 0.193608): 0.034484, D_eugracilis_CG13437-PA: 0.249783, (D_rhopaloa_CG13437-PA: 0.134506, D_elegans_CG13437-PA: 0.217107): 0.090250, D_takahashii_CG13437-PA: 0.113017): 0.357677);
Detailed output identifying parameters
kappa (ts/tv) = 1.49107
Parameters in M8 (beta&w>1):
p0 = 0.99484 p = 1.03493 q = 99.00000
(p1 = 0.00516) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.09948 0.09948 0.09948 0.09948 0.09948 0.09948 0.09948 0.09948 0.09948 0.09948 0.00516
w: 0.00058 0.00178 0.00311 0.00460 0.00633 0.00840 0.01097 0.01438 0.01953 0.03046 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.044 351.0 96.0 0.0151 0.0010 0.0642 0.3 6.2
11..2 0.000 351.0 96.0 0.0151 0.0000 0.0000 0.0 0.0
11..3 0.021 351.0 96.0 0.0151 0.0005 0.0315 0.2 3.0
11..12 0.358 351.0 96.0 0.0151 0.0080 0.5263 2.8 50.5
12..13 0.034 351.0 96.0 0.0151 0.0008 0.0507 0.3 4.9
13..14 0.084 351.0 96.0 0.0151 0.0019 0.1229 0.7 11.8
14..4 0.099 351.0 96.0 0.0151 0.0022 0.1463 0.8 14.0
14..5 0.033 351.0 96.0 0.0151 0.0007 0.0491 0.3 4.7
13..7 0.194 351.0 96.0 0.0151 0.0043 0.2849 1.5 27.3
12..6 0.250 351.0 96.0 0.0151 0.0056 0.3675 2.0 35.3
12..15 0.090 351.0 96.0 0.0151 0.0020 0.1328 0.7 12.7
15..8 0.135 351.0 96.0 0.0151 0.0030 0.1979 1.1 19.0
15..9 0.217 351.0 96.0 0.0151 0.0048 0.3195 1.7 30.7
12..10 0.113 351.0 96.0 0.0151 0.0025 0.1663 0.9 16.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG13437-PA)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.000 0.000 0.000 0.005 0.040 0.201 0.753
ws: 0.140 0.108 0.097 0.094 0.094 0.093 0.093 0.093 0.093 0.093
Time used: 5:05
Model 1: NearlyNeutral -1344.872726 Model 2: PositiveSelection -1344.872726 Model 0: one-ratio -1345.815275 Model 3: discrete -1344.822129 Model 7: beta -1345.33688 Model 8: beta&w>1 -1344.979737 Model 0 vs 1 1.8850979999997435 Model 2 vs 1 0.0 Model 8 vs 7 0.7142860000003566
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
