--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Tue Nov 29 16:38:20 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/59/CG13024-PB/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/59/CG13024-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/59/CG13024-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/59/CG13024-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2426.96 -2443.86
2 -2427.10 -2444.07
--------------------------------------
TOTAL -2427.03 -2443.97
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/59/CG13024-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/59/CG13024-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/59/CG13024-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.004648 0.012456 0.806620 1.234269 0.996298 1217.83 1320.82 1.000
r(A<->C){all} 0.089564 0.000428 0.050870 0.129398 0.087875 915.11 998.83 1.000
r(A<->G){all} 0.210864 0.001282 0.141135 0.280922 0.208585 839.39 864.07 1.000
r(A<->T){all} 0.101494 0.000852 0.047083 0.160701 0.099267 1020.98 1057.71 1.000
r(C<->G){all} 0.084672 0.000297 0.051391 0.118019 0.083938 802.53 954.78 1.000
r(C<->T){all} 0.464835 0.002383 0.370195 0.559038 0.465560 624.50 681.68 1.000
r(G<->T){all} 0.048571 0.000370 0.012783 0.085004 0.046742 994.58 1075.27 1.000
pi(A){all} 0.244072 0.000236 0.213065 0.273137 0.243804 681.79 849.37 1.000
pi(C){all} 0.318011 0.000238 0.288030 0.347349 0.317587 1174.18 1208.64 1.000
pi(G){all} 0.262192 0.000232 0.232789 0.291849 0.262020 992.08 1079.31 1.000
pi(T){all} 0.175725 0.000163 0.149717 0.199258 0.175639 1051.85 1153.16 1.000
alpha{1,2} 0.124867 0.000373 0.089709 0.162963 0.123570 1280.41 1339.82 1.003
alpha{3} 2.846692 0.792181 1.321923 4.649449 2.735073 1240.40 1355.95 1.000
pinvar{all} 0.454350 0.002338 0.353485 0.541223 0.456702 1040.04 1199.42 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -2075.381039
Model 2: PositiveSelection -2075.381039
Model 0: one-ratio -2085.143498
Model 3: discrete -2072.665669
Model 7: beta -2074.670976
Model 8: beta&w>1 -2072.86893
Model 0 vs 1 19.52491800000007
Model 2 vs 1 0.0
Model 8 vs 7 3.604091999999582
>C1
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNTSS
IHNNNNTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAASGSLLL
TAANLERFAEIHKKQERHNKMLMPSNPSSSNYNANLAIGSGKDAVIAIEG
QQPADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPPKKPKRGLCDRG
RQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooooo
>C2
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSGS
INNNNNTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAASGSLLL
TAANLERFAEIHKKQERHNKMLMPSNPSSSNYNANLSLGSGKDAVIAIEG
QQPADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPPKKPKRGLCDRG
RQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooooo
>C3
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSS
INNNNNTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAASGSLLL
TAANLERFAEIHKKQERHNKMLMPSNPSSSNYNANLALGSGKDAVIAIEG
QQPADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPPKKPKRGLCDRG
RQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooooo
>C4
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSS
INNNNNTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAASGSLLL
TAANLERFAEIHKKQERHNKMLMPSNPSSSNYNANLTLASGKDAVIAIEG
QQSSAADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPPKKPKRGLCD
RGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooo
>C5
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSN
INNNNNTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAASGSLLL
TAANLERFAEIHKKQERHNKMLMPSNPSTSNYNANLTLASGKDAVIAIEG
QQPGDVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPPKKPKRGLCDRG
RQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooooo
>C6
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSH
MNNNNNTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAASGSLLL
TAANLERFAEIHKKQERHNKMLMPPSNPSSSNYNANLTLATSGNKDAVIA
IEGQQQPAAEMDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPPKKPKRG
LCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSo
>C7
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSS
SHITNNNSNTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAASGS
LLLTAANLERFAEIHKKQERHNKMLMPGHPTSSNYNANLTLASGKDAVIA
IEGQPPAEVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPPKKPKRGLC
DRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSooo
>C8
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSN
INNNNNNNNTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAASGS
LLLTAANLERFAEIHKKQERHNKMLMPSNPSSSNYNANLTLASGKDAVIA
IEGQQPAEVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPPKKPKRGLC
DRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSooo
>C9
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSN
ANNNNNNNNTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAASGS
LLLTAANLERFAEIHKKQERHNKMLMPSNPSSSNYNANLTLASGKDAVIA
IEGQQPNEVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPPKKPKRGLC
DRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSooo
>C10
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSN
VNNVNNNSNNNNTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMPGHPSSSNYNANLTLATGQDA
VITIDGQQPSEVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPPKKPKR
GLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKS
>C11
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSDSSN
NTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAASGSLLLTAANL
ERFAEIHKKQERNNKMLMPSNPSSSNYNANLTLASGKDAVIAIEGEPADV
DPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPPKKPKRGLCDRGRQVTVL
IVSMSTIFMLLIMGMVYALEMRARDMPKSoooooooooooo
>C12
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSN
TNNNNTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAASGSLLLT
AANLERFAEIHKKQERHNKMLMPSNPSSSNYNANLTLASGKDAVIAIEGQ
PEDVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPPKKPKRGLCDRGRQ
VTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooooooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=12, Len=258
C1 MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNTS-
C2 MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSG-
C3 MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSS-
C4 MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSS-
C5 MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSS-
C6 MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSS-
C7 MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSS
C8 MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSN
C9 MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSN
C10 MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSN
C11 MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSDSS-
C12 MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSN
**********************************************::.
C1 --SIHNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
C2 --SINNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
C3 --SINNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
C4 --SINNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
C5 --NINNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
C6 --HMNNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
C7 SHITNNNSN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
C8 INNNNNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
C9 ANNNNNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
C10 VNNVNNNSNNNNTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
C11 -------NN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
C12 ----TNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
.* **************************************
C1 SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLAIGSG--
C2 SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLSLGSG--
C3 SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLALGSG--
C4 SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLTLASG--
C5 SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSTSNYNANLTLASG--
C6 SGSLLLTAANLERFAEIHKKQERHNKMLMPPSNPSSSNYNANLTLATSGN
C7 SGSLLLTAANLERFAEIHKKQERHNKMLMP-GHPTSSNYNANLTLASG--
C8 SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLTLASG--
C9 SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLTLASG--
C10 SGSLLLTAANLERFAEIHKKQERHNKMLMP-GHPSSSNYNANLTLATG--
C11 SGSLLLTAANLERFAEIHKKQERNNKMLMP-SNPSSSNYNANLTLASG--
C12 SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLTLASG--
***********************:****** .:*::*******::.:.
C1 KDAVIAIEGQQP--ADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
C2 KDAVIAIEGQQP--ADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
C3 KDAVIAIEGQQP--ADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
C4 KDAVIAIEGQQSSAADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
C5 KDAVIAIEGQ--QPGDVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
C6 KDAVIAIEGQQQPAAEMDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
C7 KDAVIAIEGQ--PPAEVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
C8 KDAVIAIEGQ--QPAEVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
C9 KDAVIAIEGQ--QPNEVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
C10 QDAVITIDGQ--QPSEVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
C11 KDAVIAIEGE---PADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
C12 KDAVIAIEGQ---PEDVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
:****:*:*: ::*********************************
C1 KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooo
C2 KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooo
C3 KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooo
C4 KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooo
C5 KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooo
C6 KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSo---
C7 KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSooo-
C8 KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSooo-
C9 KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSooo-
C10 KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKS----
C11 KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooo
C12 KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooo
**********************************************
C1 oo------
C2 oo------
C3 oo------
C4 --------
C5 oo------
C6 --------
C7 --------
C8 --------
C9 --------
C10 --------
C11 oooooooo
C12 oooo----
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 241 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [37210]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [37210]--->[36257]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/59/CG13024-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.679 Mb, Max= 31.644 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNTS-
--SIHNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLAIGSG--
KDAVIAIEGQQP--ADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooo
oo------
>C2
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSG-
--SINNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLSLGSG--
KDAVIAIEGQQP--ADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooo
oo------
>C3
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSS-
--SINNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLALGSG--
KDAVIAIEGQQP--ADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooo
oo------
>C4
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSS-
--SINNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLTLASG--
KDAVIAIEGQQSSAADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooo
--------
>C5
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSS-
--NINNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSTSNYNANLTLASG--
KDAVIAIEGQ--QPGDVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooo
oo------
>C6
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSS-
--HMNNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMPPSNPSSSNYNANLTLATSGN
KDAVIAIEGQQQPAAEMDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSo---
--------
>C7
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSS
SHITNNNSN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMP-GHPTSSNYNANLTLASG--
KDAVIAIEGQ--PPAEVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSooo-
--------
>C8
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSN
INNNNNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLTLASG--
KDAVIAIEGQ--QPAEVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSooo-
--------
>C9
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSN
ANNNNNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLTLASG--
KDAVIAIEGQ--QPNEVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSooo-
--------
>C10
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSN
VNNVNNNSNNNNTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMP-GHPSSSNYNANLTLATG--
QDAVITIDGQ--QPSEVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKS----
--------
>C11
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSDSS-
-------NN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERNNKMLMP-SNPSSSNYNANLTLASG--
KDAVIAIEGE---PADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooo
oooooooo
>C12
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSN
----TNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLTLASG--
KDAVIAIEGQ---PEDVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooo
oooo----
FORMAT of file /tmp/tmp4422786738556149953aln Not Supported[FATAL:T-COFFEE]
>C1
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNTS-
--SIHNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLAIGSG--
KDAVIAIEGQQP--ADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooo
oo------
>C2
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSG-
--SINNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLSLGSG--
KDAVIAIEGQQP--ADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooo
oo------
>C3
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSS-
--SINNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLALGSG--
KDAVIAIEGQQP--ADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooo
oo------
>C4
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSS-
--SINNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLTLASG--
KDAVIAIEGQQSSAADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooo
--------
>C5
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSS-
--NINNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSTSNYNANLTLASG--
KDAVIAIEGQ--QPGDVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooo
oo------
>C6
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSS-
--HMNNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMPPSNPSSSNYNANLTLATSGN
KDAVIAIEGQQQPAAEMDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSo---
--------
>C7
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSS
SHITNNNSN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMP-GHPTSSNYNANLTLASG--
KDAVIAIEGQ--PPAEVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSooo-
--------
>C8
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSN
INNNNNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLTLASG--
KDAVIAIEGQ--QPAEVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSooo-
--------
>C9
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSN
ANNNNNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLTLASG--
KDAVIAIEGQ--QPNEVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSooo-
--------
>C10
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSN
VNNVNNNSNNNNTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMP-GHPSSSNYNANLTLATG--
QDAVITIDGQ--QPSEVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKS----
--------
>C11
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSDSS-
-------NN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERNNKMLMP-SNPSSSNYNANLTLASG--
KDAVIAIEGE---PADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooo
oooooooo
>C12
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSN
----TNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLTLASG--
KDAVIAIEGQ---PEDVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooo
oooo----
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:258 S:96 BS:258
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# SEQ_INDEX C11 10
# SEQ_INDEX C12 11
# PW_SEQ_DISTANCES
BOT 0 1 97.93 C1 C2 97.93
TOP 1 0 97.93 C2 C1 97.93
BOT 0 2 98.76 C1 C3 98.76
TOP 2 0 98.76 C3 C1 98.76
BOT 0 3 97.49 C1 C4 97.49
TOP 3 0 97.49 C4 C1 97.49
BOT 0 4 96.65 C1 C5 96.65
TOP 4 0 96.65 C5 C1 96.65
BOT 0 5 94.92 C1 C6 94.92
TOP 5 0 94.92 C6 C1 94.92
BOT 0 6 94.92 C1 C7 94.92
TOP 6 0 94.92 C7 C1 94.92
BOT 0 7 96.61 C1 C8 96.61
TOP 7 0 96.61 C8 C1 96.61
BOT 0 8 96.19 C1 C9 96.19
TOP 8 0 96.19 C9 C1 96.19
BOT 0 9 93.13 C1 C10 93.13
TOP 9 0 93.13 C10 C1 93.13
BOT 0 10 97.01 C1 C11 97.01
TOP 10 0 97.01 C11 C1 97.01
BOT 0 11 97.47 C1 C12 97.47
TOP 11 0 97.47 C12 C1 97.47
BOT 1 2 99.17 C2 C3 99.17
TOP 2 1 99.17 C3 C2 99.17
BOT 1 3 98.33 C2 C4 98.33
TOP 3 1 98.33 C4 C2 98.33
BOT 1 4 97.49 C2 C5 97.49
TOP 4 1 97.49 C5 C2 97.49
BOT 1 5 95.76 C2 C6 95.76
TOP 5 1 95.76 C6 C2 95.76
BOT 1 6 95.76 C2 C7 95.76
TOP 6 1 95.76 C7 C2 95.76
BOT 1 7 97.46 C2 C8 97.46
TOP 7 1 97.46 C8 C2 97.46
BOT 1 8 97.03 C2 C9 97.03
TOP 8 1 97.03 C9 C2 97.03
BOT 1 9 93.99 C2 C10 93.99
TOP 9 1 93.99 C10 C2 93.99
BOT 1 10 97.44 C2 C11 97.44
TOP 10 1 97.44 C11 C2 97.44
BOT 1 11 97.89 C2 C12 97.89
TOP 11 1 97.89 C12 C2 97.89
BOT 2 3 98.74 C3 C4 98.74
TOP 3 2 98.74 C4 C3 98.74
BOT 2 4 97.91 C3 C5 97.91
TOP 4 2 97.91 C5 C3 97.91
BOT 2 5 96.19 C3 C6 96.19
TOP 5 2 96.19 C6 C3 96.19
BOT 2 6 96.19 C3 C7 96.19
TOP 6 2 96.19 C7 C3 96.19
BOT 2 7 97.88 C3 C8 97.88
TOP 7 2 97.88 C8 C3 97.88
BOT 2 8 97.46 C3 C9 97.46
TOP 8 2 97.46 C9 C3 97.46
BOT 2 9 94.42 C3 C10 94.42
TOP 9 2 94.42 C10 C3 94.42
BOT 2 10 97.86 C3 C11 97.86
TOP 10 2 97.86 C11 C3 97.86
BOT 2 11 98.31 C3 C12 98.31
TOP 11 2 98.31 C12 C3 98.31
BOT 3 4 97.91 C4 C5 97.91
TOP 4 3 97.91 C5 C4 97.91
BOT 3 5 96.64 C4 C6 96.64
TOP 5 3 96.64 C6 C4 96.64
BOT 3 6 96.22 C4 C7 96.22
TOP 6 3 96.22 C7 C4 96.22
BOT 3 7 97.90 C4 C8 97.90
TOP 7 3 97.90 C8 C4 97.90
BOT 3 8 97.48 C4 C9 97.48
TOP 8 3 97.48 C9 C4 97.48
BOT 3 9 94.47 C4 C10 94.47
TOP 9 3 94.47 C10 C4 94.47
BOT 3 10 98.28 C4 C11 98.28
TOP 10 3 98.28 C11 C4 98.28
BOT 3 11 98.73 C4 C12 98.73
TOP 11 3 98.73 C12 C4 98.73
BOT 4 5 95.76 C5 C6 95.76
TOP 5 4 95.76 C6 C5 95.76
BOT 4 6 95.80 C5 C7 95.80
TOP 6 4 95.80 C7 C5 95.80
BOT 4 7 98.32 C5 C8 98.32
TOP 7 4 98.32 C8 C5 98.32
BOT 4 8 98.32 C5 C9 98.32
TOP 8 4 98.32 C9 C5 98.32
BOT 4 9 95.32 C5 C10 95.32
TOP 9 4 95.32 C10 C5 95.32
BOT 4 10 97.87 C5 C11 97.87
TOP 10 4 97.87 C11 C5 97.87
BOT 4 11 98.74 C5 C12 98.74
TOP 11 4 98.74 C12 C5 98.74
BOT 5 6 95.76 C6 C7 95.76
TOP 6 5 95.76 C7 C6 95.76
BOT 5 7 97.03 C6 C8 97.03
TOP 7 5 97.03 C8 C6 97.03
BOT 5 8 96.61 C6 C9 96.61
TOP 8 5 96.61 C9 C6 96.61
BOT 5 9 94.47 C6 C10 94.47
TOP 9 5 94.47 C10 C6 94.47
BOT 5 10 96.52 C6 C11 96.52
TOP 10 5 96.52 C11 C6 96.52
BOT 5 11 97.00 C6 C12 97.00
TOP 11 5 97.00 C12 C6 97.00
BOT 6 7 95.85 C7 C8 95.85
TOP 7 6 95.85 C8 C7 95.85
BOT 6 8 95.44 C7 C9 95.44
TOP 8 6 95.44 C9 C7 95.44
BOT 6 9 94.96 C7 C10 94.96
TOP 9 6 94.96 C10 C7 94.96
BOT 6 10 96.55 C7 C11 96.55
TOP 10 6 96.55 C11 C7 96.55
BOT 6 11 96.61 C7 C12 96.61
TOP 11 6 96.61 C12 C7 96.61
BOT 7 8 99.17 C8 C9 99.17
TOP 8 7 99.17 C9 C8 99.17
BOT 7 9 95.80 C8 C10 95.80
TOP 9 7 95.80 C10 C8 95.80
BOT 7 10 98.28 C8 C11 98.28
TOP 10 7 98.28 C11 C8 98.28
BOT 7 11 98.73 C8 C12 98.73
TOP 11 7 98.73 C12 C8 98.73
BOT 8 9 95.80 C9 C10 95.80
TOP 9 8 95.80 C10 C9 95.80
BOT 8 10 97.84 C9 C11 97.84
TOP 10 8 97.84 C11 C9 97.84
BOT 8 11 98.73 C9 C12 98.73
TOP 11 8 98.73 C12 C9 98.73
BOT 9 10 94.76 C10 C11 94.76
TOP 10 9 94.76 C11 C10 94.76
BOT 9 11 95.71 C10 C12 95.71
TOP 11 9 95.71 C12 C10 95.71
BOT 10 11 98.31 C11 C12 98.31
TOP 11 10 98.31 C12 C11 98.31
AVG 0 C1 * 96.46
AVG 1 C2 * 97.11
AVG 2 C3 * 97.54
AVG 3 C4 * 97.47
AVG 4 C5 * 97.28
AVG 5 C6 * 96.06
AVG 6 C7 * 95.82
AVG 7 C8 * 97.55
AVG 8 C9 * 97.28
AVG 9 C10 * 94.80
AVG 10 C11 * 97.34
AVG 11 C12 * 97.84
TOT TOT * 96.88
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCAGGACTATTGGCACATTCCCCGCGCCTCGCTGGCATCCTCCTCGAG
C2 ATGCAGGACTATTGGCACATTCCCCGCGCCTCGCTGGCATCCTCCTCGAG
C3 ATGCAGGACTATTGGCACATTCCCCGCGCCTCGCTGGCATCCTCCTCGAG
C4 ATGCAGGACTACTGGCACATTCCCCGCGCCTCGCTGGCATCCTCCTCGAG
C5 ATGCAGGACTATTGGCACATTCCCCGCGCCTCGCTGGCATCCTCCTCGAG
C6 ATGCAGGACTATTGGCACATTCCACGCGCCTCGCTGGCCTCCTCCTCGAG
C7 ATGCAGGACTATTGGCACATTCCACGCGCCTCGCTGGCCTCCTCGTCGAG
C8 ATGCAGGACTATTGGCACATTCCACGCGCCTCGCTGGCCTCATCCTCGAG
C9 ATGCAGGACTACTGGCACATTCCCCGCGCCTCTCTGGCCTCATCCTCAAG
C10 ATGCAGGACTATTGGCACATTCCCCGCGCCTCGCTGGCCTCCTCCTCGAG
C11 ATGCAGGACTATTGGCACATTCCCCGCGCCTCGCTGGCCTCTTCCTCGAG
C12 ATGCAGGACTATTGGCACATTCCCCGCGCCTCGCTGGCCTCTTCCTCGAG
*********** ***********.******** *****.** ** **.**
C1 CTCGGCCATTAGTTCGGCCAGCTCGTCCAAGTCCTCGAACAAATCGCACT
C2 CTCGGCCATCAGTTCGGCCAGCTCCTCCAAGTCCTCGAACAAATCGCACT
C3 CTCGGCCATCAGTTCGGCCAGCTCCTCCAAGTCCTCGAACAAATCGCACT
C4 CTCGGCCATCAGTTCGGCCAGCTCCTCCAAGTCCTCCAACAAATCGCATT
C5 CTCGGCCATCAGTTCGGCCAGCTCCTCCAAGTCCTCAAACAAATCGCATT
C6 CTCGGCCATCAGTTCGGCCAGCTCCTCAAAGTCCTCGAACAAATCGCACT
C7 CTCGGCCATCAGTTCGGCCAGCTCCTCGAAGTCCTCGAACAAATCGCACT
C8 CTCGGCCATCAGTTCGGCCAGCTCCTCGAAGTCCTCGAACAAATCGCACT
C9 CTCGGCCATCAGTTCGGCCAGCTCCTCAAAGTCCTCGAACAAATCGCACT
C10 CTCGGCCATCAGTTCGGCCAGCTCCTCAAAGTCCTCAAACAAGTCGCACT
C11 CTCAGCCATTAGTTCGGCTAGCTCCTCAAAGTCCTCGAACAAATCGCACT
C12 CTCGGCCATCAGTTCGGCGAGCTCCTCCAAGTCCTCGAACAAATCACACT
***.***** ******** ***** ** ******** *****.**.** *
C1 CCAATCCACCTACCCTAAACCAACGCAGTTCGCCCAGTAACACTAGC---
C2 CGAATCCGCCTACCCTAAACCAGCGCAGTTCGCCCAGTAACAGTGGC---
C3 CGAATCCGCCTACCCTAAACCAGCGCAGTTCGCCCAGTAACAGTAGC---
C4 CGAATCCGCCTACCCTGAACCAGCGCAGTTCGCCCAGTAACAGTAGC---
C5 CGAATCCGCCCACACTGAACCAGCGCAGTTCGCCCAGTAACAGTAGC---
C6 CGAATCCACCCACCCTCAACCAGCGCAGTTCGCCCAGCAACAGTAGC---
C7 CGAATCCGCCCACCCTTAACCAGCGCAGTTCGCCCAGCAACAGTAGCAGC
C8 CGAATCCGCCCACCCTCAACCAGCGCAGTTCGCCCAGCAACAGTAGCAAT
C9 CGAATCCGCCCACCCTCAACCAGCGGAGTTCGCCCAGCAACAGCAGCAAT
C10 CGAATCCGCCCACCCTCAACCAGCGCAGTTCCCCAAGCAACAGTAGCAAT
C11 CGAATCCGCCTACCCTGAACCAGCGCAGTTCGCCTAGCGACAGTAGC---
C12 CGAATCCGCCCACCCTGAACCAACGTAGTTCGCCCAGCAACAGTAGCAAT
* *****.** **.** *****.** ***** ** ** .*** .**
C1 ------AGCATTCACAATAACAATAAT---------ACAAGTGCTGCAGT
C2 ------AGCATTAACAATAACAATAAT---------ACAAGTGCTGCAGT
C3 ------AGCATTAACAATAACAATAAT---------ACAAGTGCTGCAGT
C4 ------AGCATTAACAATAACAACAAT---------ACAAGTGCTGCTGT
C5 ------AACATTAACAATAACAATAAT---------ACAAGTGCTGCAGT
C6 ------CATATGAATAACAACAATAAT---------ACAAGTGCTGCTGT
C7 AGCCATATTACCAACAATAATAGCAAT---------ACCAGTGCTGCTGT
C8 ATTAACAACAACAATAATAATAATAAT---------ACAAGTGCTGCTGT
C9 GCAAATAATAATAATAATAATAATAAT---------ACAAGTGCTGCTGT
C10 GTTAATAATGTTAACAACAACAGCAACAACAATAATACAAGTGCTGCTGT
C11 ---------------------AATAAT---------ACAAGTGCTGCTGT
C12 ------------ACTAACAACAATAAT---------ACAAGTGCCGCAGT
*. ** **.***** **:**
C1 AACTGCGGCAGCAGCGGCCGCTGTTCTGGCGGCTGCCAAGAGGGGATCGA
C2 AACTGCGGCAGCAGCGGCGGCTGTTCTGGCGGCAGCCAAGAGGGGATCGA
C3 AACTGCGGCAGCAGCGGCGGCTGTTCTGGCGGCAGCCAAGAGGGGATCGA
C4 AACTGCGGCAGCAGCGGCGGCTGTTCTGGCTGCTGCCAAGAGGGGATCGA
C5 AACTGCGGCAGCAGCGGCGGCTGTTCTGGCTGCTGCCAAGAGGGGATCGA
C6 TACGGCGGCGGCGGCGGCTGCGGTTCTGGCGGCCGCCAAGCGGGGATCGA
C7 TACGGCGGCGGCAGCGGCGGCGGTTCTGGCGGCCGCCAAGCGGGGATCGA
C8 TACGGCGGCGGCAGCGGCAGCGGTACTGGCGGCTGCCAAGCGGGGATCGA
C9 TACGGCGGCGGCTGCGGCAGCGGTACTGGCTGCTGCCAAGCGGGGATCGA
C10 GACAGCGGCGGCAGCGGCAGCGGTACTAGCAGCTGCCAAGCGGGGATCGA
C11 GACAGCAGCGGCAGCGGCGGCGGTACTGGCGGCTGCCAAGCGGGGATCGA
C12 GACGGCCGCAGCAGCGGCAGCAGTACTGGCGGCCGCCAAGCGGGGATCGA
** ** **.** ***** ** **:**.** ** ******.*********
C1 GGAGCTCCCAGGGCTCCAGCGACAGTAACAACAGCACGCGGAGCGCTGCT
C2 GGAGCTCCCAGGGCTCCAGCGACAGTAACAACAGCACGCGGAGCGCTGCT
C3 GGAGCTCCCAGGGCTCCAGCGACAGTAACAACAGCACGCGGAGCGCTGCT
C4 GGAGTTCCCAGGGCTCCAGCGACAGTAACAACAGCACGCGGAGCGCTGCT
C5 GGAGTTCCCAGGGCTCCAGCGACAGTAACAACAGCACGCGGAGCGCTGCT
C6 GGAGTTCGCAGGGCTCCAGCGACAGCAACAACAGCACACGGAGCGCTGCT
C7 GGAGTTCGCAGGGCTCCAGCGACAGCAACAACAGCACACGGAGCGCTGCT
C8 GGAGTTCGCAGGGCTCCAGCGACAGTAACAACAGCACACGGAGCGCTGCT
C9 GGAGTTCGCAGGGCTCCAGCGACAGTAACAACAGCACACGGAGCGCTGCT
C10 GGAGTTCCCAGGGCTCCAGCGACAGCAACAACAGCACACGGAGCGCTGCT
C11 GGAGTTCGCAGGGCTCCAGCGACAGCAACAACAGCACACGGAGCGCTGCT
C12 GAAGTTCGCAGGGCTCCAGCGACAGCAACAACAGCACACGGAGCGCTGCT
*.** ** ***************** ***********.************
C1 TCCGGCTCACTGCTGTTGACGGCAGCGAATCTGGAACGCTTTGCGGAGAT
C2 TCCGGCTCACTGCTGTTGACGGCAGCGAATCTGGAACGCTTTGCGGAGAT
C3 TCCGGCTCACTGCTGTTGACGGCAGCGAATCTGGAACGCTTTGCGGAGAT
C4 TCCGGCTCACTGCTGTTGACGGCAGCGAATCTGGAACGCTTTGCGGAGAT
C5 TCCGGCTCACTGCTGTTGACGGCAGCGAATCTGGAACGCTTTGCGGAGAT
C6 TCCGGCTCACTGCTGCTAACGGCAGCGAATCTGGAACGCTTCGCGGAGAT
C7 TCCGGCTCACTGCTGCTGACGGCAGCGAATCTGGAACGCTTTGCGGAGAT
C8 TCCGGCTCACTGCTGCTGACGGCAGCGAATCTGGAACGCTTCGCCGAGAT
C9 TCCGGCTCACTGCTGTTGACGGCAGCGAATCTGGAACGCTTCGCGGAGAT
C10 TCCGGCTCACTGCTGCTGACGGCAGCGAATCTGGAACGCTTCGCGGAGAT
C11 TCCGGCTCACTGCTGTTGACGGCAGCGAATCTGGAACGCTTCGCGGAGAT
C12 TCCGGCTCACTGCTGTTGACGGCAGCGAATCTGGAACGCTTTGCGGAGAT
*************** *.*********************** ** *****
C1 CCACAAGAAGCAGGAGCGACACAACAAGATGCTGATGCCC---AGTAATC
C2 CCACAAGAAGCAGGAGCGCCACAACAAGATGCTGATGCCC---AGCAATC
C3 CCACAAGAAGCAGGAGCGCCACAACAAGATGCTGATGCCC---AGCAATC
C4 CCACAAGAAGCAGGAGCGCCACAACAAGATGCTGATGCCC---AGCAATC
C5 CCACAAGAAGCAGGAGCGCCACAACAAGATGCTGATGCCC---AGCAATC
C6 CCACAAGAAGCAGGAGCGCCACAACAAGATGCTGATGCCGCCCAGCAATC
C7 CCACAAGAAGCAGGAGCGGCACAACAAGATGCTGATGCCC---GGCCATC
C8 CCACAAGAAGCAGGAGCGCCACAACAAGATGCTGATGCCC---AGCAATC
C9 CCACAAGAAGCAGGAGCGCCACAACAAGATGCTGATGCCC---AGTAATC
C10 CCACAAGAAGCAGGAGCGGCACAACAAGATGCTGATGCCC---GGCCATC
C11 CCACAAGAAGCAGGAGCGGAACAACAAGATGCTGATGCCC---AGCAATC
C12 CCACAAGAAGCAGGAGCGGCACAACAAGATGCTGATGCCC---AGCAATC
****************** .******************* .* .***
C1 CCTCCTCGTCAAACTATAATGCCAACCTGGCCATCGGCAGCGGC------
C2 CCTCCTCGTCCAACTATAATGCCAACCTGTCCCTCGGCAGCGGC------
C3 CCTCCTCGTCAAACTATAATGCTAACCTGGCCCTCGGCAGCGGC------
C4 CCTCCTCCTCAAACTACAACGCCAACCTGACCCTCGCTAGCGGC------
C5 CCTCCACTTCAAACTACAACGCCAACCTGACTCTCGCCAGTGGC------
C6 CCTCGTCGTCCAACTACAATGCCAACCTGACGCTGGCAACGAGCGGCAAC
C7 CCACGTCGTCCAACTACAATGCCAACCTGACGCTGGCCAGCGGC------
C8 CCTCGTCGTCCAACTACAATGCCAATCTGACGCTGGCCAGCGGC------
C9 CTTCGTCGTCCAACTACAATGCCAATCTGACGCTAGCCAGCGGC------
C10 CATCTTCGTCCAACTACAATGCCAACCTAACGCTCGCCACTGGC------
C11 CCTCATCGTCCAACTACAATGCCAACCTGACGCTCGCCAGCGGC------
C12 CCTCGTCGTCCAACTACAATGCCAACCTAACGCTCGCCAGCGGC------
* :* :* **.***** ** ** ** **. * .* * * .**
C1 AAGGATGCGGTTATCGCCATCGAGGGTCAGCAGCCA------GCCGACGT
C2 AAGGATGCGGTTATCGCCATCGAGGGTCAGCAGCCG------GCCGACGT
C3 AAGGATGCGGTTATCGCCATCGAGGGTCAGCAGCCG------GCCGACGT
C4 AAGGATGCAGTTATCGCCATCGAGGGTCAGCAGTCGTCAGCGGCCGACGT
C5 AAGGATGCGGTTATTGCCATCGAGGGTCAG------CAGCCGGGTGACGT
C6 AAGGATGCGGTAATCGCCATCGAGGGCCAGCAGCAGCCGGCGGCCGAGAT
C7 AAGGATGCGGTCATCGCCATCGAGGGCCAG------CCGCCGGCCGAGGT
C8 AAGGATGCGGTGATCGCCATCGAGGGTCAG------CAGCCGGCCGAGGT
C9 AAGGATGCGGTTATCGCCATCGAGGGCCAA------CAGCCGAACGAAGT
C10 CAGGATGCGGTGATCACCATCGATGGCCAG------CAGCCATCGGAAGT
C11 AAGGATGCGGTCATCGCCATCGAGGGCGAG---------CCGGCCGATGT
C12 AAGGATGCGGTGATCGCCATCGAGGGCCAG---------CCGGAAGATGT
.*******.** ** .******* ** *. ** .*
C1 CGATCCCAACTTGCAGTATGTGAAAACCAAAGACCTGGATACCGTATCCA
C2 CGATCCCAATTTGCAGTATGTGAAAACCAAAGACCTGGATACCGTATCCA
C3 CGATCCCAATTTGCAGTATGTGAAAACCAAAGACCTGGATACCGTATCCA
C4 GGATCCCAACTTGCAGTATGTGAAAACCAAAGACCTGGATACCGTATCCA
C5 GGATCCCAACTTGCAGTATGTGAAAACCAAAGACCTGGATACCGTATCCA
C6 GGATCCCAATTTGCAGTATGTGAAAACCAAAGACCTGGACACCGTGTCCA
C7 GGATCCCAATTTGCAGTACGTGAAAACCAAAGACCTGGACACCGTGTCCA
C8 GGATCCCAATTTGCAGTATGTGAAAACCAAAGACCTGGACACCGTATCCA
C9 GGATCCCAATTTGCAGTACGTGAAAACCAAAGACCTGGACACCGTATCCA
C10 GGATCCCAACTTGCAGTATGTGAAAACCAAAGACCTGGACACCGTATCCA
C11 GGATCCCAATTTGCAGTATGTGAAAACCAAAGACCTGGATACCGTATCCA
C12 TGATCCCAATTTGCAGTATGTGAAAACCAAAGACCTGGACACCGTATCCA
******** ******** ******************** *****.****
C1 TCGCTAGCTCTATGCACTTCACGATGGTCAATGGAGAGGGTGGTCCACCG
C2 TCGCTAGCTCCATGCACTTCACGATGGTCAATGGAGAGGGTGGTCCGCCA
C3 TCGCTAGCTCCATGCACTTCACGATGGTCAATGGAGAGGGTGGTCCGCCA
C4 TTGCTAGCTCCATGCACTTCACGATGGTCAATGGAGAGGGTGGTCCGCCG
C5 TTGCTAGCTCCATGCATTTTACGATGGTCAATGGAGAGGGTGGTCCGCCG
C6 TCGCTAGCTCCATGCACTTTACGATGGTCAACGGAGAGGGCGGTCCGCCC
C7 TCGCCAGCTCCATGCACTTTACGATGGTCAACGGCGAGGGTGGTCCGCCC
C8 TCGCCAGCTCCATGCACTTCACGATGGTCAACGGCGAGGGTGGTCCGCCC
C9 TTGCGAGCTCTATGCACTTCACGATGGTCAATGGAGAAGGTGGTCCCCCG
C10 TTGCCAGCTCGATGCACTTTACGATGGTCAACGGCGAGGGTGGTCCGCCC
C11 TTGCCAGTTCCATGCACTTCACGATGGTCAATGGAGAGGGTGGTCCGCCC
C12 TCGCCAGCTCCATGCACTTCACGATGGTCAATGGGGAGGGTGGTCCGCCC
* ** ** ** ***** ** *********** ** **.** ***** **
C1 AAGAAACCGAAGCGCGGTCTATGCGATCGGGGGCGCCAGGTCACCGTGTT
C2 AAGAAACCGAAGCGTGGTCTATGCGATCGCGGACGCCAGGTCACCGTGTT
C3 AAGAAACCGAAGCGTGGTCTATGCGATCGCGGACGCCAGGTCACCGTGTT
C4 AAGAAGCCGAAGCGCGGTCTCTGCGATCGGGGACGCCAGGTCACCGTATT
C5 AAGAAACCGAAGCGTGGTCTCTGCGATCGGGGACGCCAGGTCACCGTGTT
C6 AAGAAACCGAAGCGCGGCCTCTGCGATCGGGGACGCCAGGTCACCGTGTT
C7 AAGAAGCCCAAGCGCGGCCTCTGCGATCGGGGACGCCAGGTCACCGTGTT
C8 AAGAAGCCGAAGCGCGGTCTCTGCGATCGGGGACGCCAGGTCACCGTGTT
C9 AAGAAACCGAAGCGTGGTCTCTGCGATCGTGGACGCCAGGTCACCGTGTT
C10 AAGAAGCCCAAGCGCGGTCTCTGCGATCGAGGACGCCAGGTCACCGTGTT
C11 AAGAAACCGAAGCGCGGTCTCTGCGATCGGGGACGCCAGGTCACCGTGTT
C12 AAGAAACCGAAGCGCGGTCTCTGCGATCGGGGACGCCAGGTCACCGTGTT
*****.** ***** ** **.******** **.**************.**
C1 GATAGTCAGCATGAGTACCATCTTCATGCTGCTCATCATGGGCATGGTCT
C2 GATAGTCAGCATGAGTACCATCTTCATGCTGCTCATCATGGGCATGGTCT
C3 GATTGTCAGCATGAGTACCATCTTCATGCTGCTCATCATGGGCATGGTCT
C4 GATAGTCAGCATGAGTACCATCTTCATGCTGCTCATCATGGGCATGGTCT
C5 GATAGTCAGCATGAGTACCATCTTCATGCTGCTCATCATGGGCATGGTCT
C6 GATAGTGAGCATGAGCACCATCTTTATGCTGCTCATCATGGGCATGGTCT
C7 GATAGTGAGCATGAGCACCATCTTCATGCTGCTCATCATGGGCATGGTCT
C8 GATAGTGAGCATGAGCACCATCTTTATGCTGCTCATCATGGGCATGGTCT
C9 GATAGTGAGCATGAGCACCATCTTTATGCTGCTCATCATGGGCATGGTCT
C10 GATTGTGAGCATGAGTACCATCTTCATGCTCCTCATCATGGGCATGGTCT
C11 GATTGTCAGCATGAGCACCATTTTCATGCTGCTCATTATGGGCATGGTCT
C12 GATTGTGAGCATGAGCACCATCTTTATGCTGCTCATTATGGGAATGGTCT
***:** ******** ***** ** ***** ***** *****.*******
C1 ATGCGCTGGAGATGCGCGCCCGTGACATGCCCAAGAGC------------
C2 ATGCGCTGGAGATGCGCGCCCGTGACATGCCCAAGAGC------------
C3 ATGCGCTGGAGATGCGCGCCCGCGACATGCCCAAGAGC------------
C4 ATGCGCTAGAGATGCGCGCCCGCGACATGCCCAAGAGC------------
C5 ATGCGCTGGAGATGCGCGCCCGCGACATGCCCAAGAGC------------
C6 ATGCGCTGGAGATGCGCGCCCGCGACATGCCCAAGAGC------------
C7 ATGCGCTGGAGATGCGCGCCCGCGACATGCCCAAGAGC------------
C8 ATGCGCTGGAGATGCGCGCCCGCGACATGCCCAAGAGC------------
C9 ATGCGCTGGAGATGCGCGCCCGCGACATGCCCAAGAGC------------
C10 ATGCGCTGGAGATGCGCGCCCGCGACATGCCCAAGAGC------------
C11 ATGCGCTGGAGATGCGCGCCCGTGACATGCCCAAGAGC------------
C12 ATGCGCTGGAGATGCGCGCCCGTGACATGCCCAAGAGC------------
*******.************** ***************
C1 ------------------------
C2 ------------------------
C3 ------------------------
C4 ------------------------
C5 ------------------------
C6 ------------------------
C7 ------------------------
C8 ------------------------
C9 ------------------------
C10 ------------------------
C11 ------------------------
C12 ------------------------
>C1
ATGCAGGACTATTGGCACATTCCCCGCGCCTCGCTGGCATCCTCCTCGAG
CTCGGCCATTAGTTCGGCCAGCTCGTCCAAGTCCTCGAACAAATCGCACT
CCAATCCACCTACCCTAAACCAACGCAGTTCGCCCAGTAACACTAGC---
------AGCATTCACAATAACAATAAT---------ACAAGTGCTGCAGT
AACTGCGGCAGCAGCGGCCGCTGTTCTGGCGGCTGCCAAGAGGGGATCGA
GGAGCTCCCAGGGCTCCAGCGACAGTAACAACAGCACGCGGAGCGCTGCT
TCCGGCTCACTGCTGTTGACGGCAGCGAATCTGGAACGCTTTGCGGAGAT
CCACAAGAAGCAGGAGCGACACAACAAGATGCTGATGCCC---AGTAATC
CCTCCTCGTCAAACTATAATGCCAACCTGGCCATCGGCAGCGGC------
AAGGATGCGGTTATCGCCATCGAGGGTCAGCAGCCA------GCCGACGT
CGATCCCAACTTGCAGTATGTGAAAACCAAAGACCTGGATACCGTATCCA
TCGCTAGCTCTATGCACTTCACGATGGTCAATGGAGAGGGTGGTCCACCG
AAGAAACCGAAGCGCGGTCTATGCGATCGGGGGCGCCAGGTCACCGTGTT
GATAGTCAGCATGAGTACCATCTTCATGCTGCTCATCATGGGCATGGTCT
ATGCGCTGGAGATGCGCGCCCGTGACATGCCCAAGAGC------------
------------------------
>C2
ATGCAGGACTATTGGCACATTCCCCGCGCCTCGCTGGCATCCTCCTCGAG
CTCGGCCATCAGTTCGGCCAGCTCCTCCAAGTCCTCGAACAAATCGCACT
CGAATCCGCCTACCCTAAACCAGCGCAGTTCGCCCAGTAACAGTGGC---
------AGCATTAACAATAACAATAAT---------ACAAGTGCTGCAGT
AACTGCGGCAGCAGCGGCGGCTGTTCTGGCGGCAGCCAAGAGGGGATCGA
GGAGCTCCCAGGGCTCCAGCGACAGTAACAACAGCACGCGGAGCGCTGCT
TCCGGCTCACTGCTGTTGACGGCAGCGAATCTGGAACGCTTTGCGGAGAT
CCACAAGAAGCAGGAGCGCCACAACAAGATGCTGATGCCC---AGCAATC
CCTCCTCGTCCAACTATAATGCCAACCTGTCCCTCGGCAGCGGC------
AAGGATGCGGTTATCGCCATCGAGGGTCAGCAGCCG------GCCGACGT
CGATCCCAATTTGCAGTATGTGAAAACCAAAGACCTGGATACCGTATCCA
TCGCTAGCTCCATGCACTTCACGATGGTCAATGGAGAGGGTGGTCCGCCA
AAGAAACCGAAGCGTGGTCTATGCGATCGCGGACGCCAGGTCACCGTGTT
GATAGTCAGCATGAGTACCATCTTCATGCTGCTCATCATGGGCATGGTCT
ATGCGCTGGAGATGCGCGCCCGTGACATGCCCAAGAGC------------
------------------------
>C3
ATGCAGGACTATTGGCACATTCCCCGCGCCTCGCTGGCATCCTCCTCGAG
CTCGGCCATCAGTTCGGCCAGCTCCTCCAAGTCCTCGAACAAATCGCACT
CGAATCCGCCTACCCTAAACCAGCGCAGTTCGCCCAGTAACAGTAGC---
------AGCATTAACAATAACAATAAT---------ACAAGTGCTGCAGT
AACTGCGGCAGCAGCGGCGGCTGTTCTGGCGGCAGCCAAGAGGGGATCGA
GGAGCTCCCAGGGCTCCAGCGACAGTAACAACAGCACGCGGAGCGCTGCT
TCCGGCTCACTGCTGTTGACGGCAGCGAATCTGGAACGCTTTGCGGAGAT
CCACAAGAAGCAGGAGCGCCACAACAAGATGCTGATGCCC---AGCAATC
CCTCCTCGTCAAACTATAATGCTAACCTGGCCCTCGGCAGCGGC------
AAGGATGCGGTTATCGCCATCGAGGGTCAGCAGCCG------GCCGACGT
CGATCCCAATTTGCAGTATGTGAAAACCAAAGACCTGGATACCGTATCCA
TCGCTAGCTCCATGCACTTCACGATGGTCAATGGAGAGGGTGGTCCGCCA
AAGAAACCGAAGCGTGGTCTATGCGATCGCGGACGCCAGGTCACCGTGTT
GATTGTCAGCATGAGTACCATCTTCATGCTGCTCATCATGGGCATGGTCT
ATGCGCTGGAGATGCGCGCCCGCGACATGCCCAAGAGC------------
------------------------
>C4
ATGCAGGACTACTGGCACATTCCCCGCGCCTCGCTGGCATCCTCCTCGAG
CTCGGCCATCAGTTCGGCCAGCTCCTCCAAGTCCTCCAACAAATCGCATT
CGAATCCGCCTACCCTGAACCAGCGCAGTTCGCCCAGTAACAGTAGC---
------AGCATTAACAATAACAACAAT---------ACAAGTGCTGCTGT
AACTGCGGCAGCAGCGGCGGCTGTTCTGGCTGCTGCCAAGAGGGGATCGA
GGAGTTCCCAGGGCTCCAGCGACAGTAACAACAGCACGCGGAGCGCTGCT
TCCGGCTCACTGCTGTTGACGGCAGCGAATCTGGAACGCTTTGCGGAGAT
CCACAAGAAGCAGGAGCGCCACAACAAGATGCTGATGCCC---AGCAATC
CCTCCTCCTCAAACTACAACGCCAACCTGACCCTCGCTAGCGGC------
AAGGATGCAGTTATCGCCATCGAGGGTCAGCAGTCGTCAGCGGCCGACGT
GGATCCCAACTTGCAGTATGTGAAAACCAAAGACCTGGATACCGTATCCA
TTGCTAGCTCCATGCACTTCACGATGGTCAATGGAGAGGGTGGTCCGCCG
AAGAAGCCGAAGCGCGGTCTCTGCGATCGGGGACGCCAGGTCACCGTATT
GATAGTCAGCATGAGTACCATCTTCATGCTGCTCATCATGGGCATGGTCT
ATGCGCTAGAGATGCGCGCCCGCGACATGCCCAAGAGC------------
------------------------
>C5
ATGCAGGACTATTGGCACATTCCCCGCGCCTCGCTGGCATCCTCCTCGAG
CTCGGCCATCAGTTCGGCCAGCTCCTCCAAGTCCTCAAACAAATCGCATT
CGAATCCGCCCACACTGAACCAGCGCAGTTCGCCCAGTAACAGTAGC---
------AACATTAACAATAACAATAAT---------ACAAGTGCTGCAGT
AACTGCGGCAGCAGCGGCGGCTGTTCTGGCTGCTGCCAAGAGGGGATCGA
GGAGTTCCCAGGGCTCCAGCGACAGTAACAACAGCACGCGGAGCGCTGCT
TCCGGCTCACTGCTGTTGACGGCAGCGAATCTGGAACGCTTTGCGGAGAT
CCACAAGAAGCAGGAGCGCCACAACAAGATGCTGATGCCC---AGCAATC
CCTCCACTTCAAACTACAACGCCAACCTGACTCTCGCCAGTGGC------
AAGGATGCGGTTATTGCCATCGAGGGTCAG------CAGCCGGGTGACGT
GGATCCCAACTTGCAGTATGTGAAAACCAAAGACCTGGATACCGTATCCA
TTGCTAGCTCCATGCATTTTACGATGGTCAATGGAGAGGGTGGTCCGCCG
AAGAAACCGAAGCGTGGTCTCTGCGATCGGGGACGCCAGGTCACCGTGTT
GATAGTCAGCATGAGTACCATCTTCATGCTGCTCATCATGGGCATGGTCT
ATGCGCTGGAGATGCGCGCCCGCGACATGCCCAAGAGC------------
------------------------
>C6
ATGCAGGACTATTGGCACATTCCACGCGCCTCGCTGGCCTCCTCCTCGAG
CTCGGCCATCAGTTCGGCCAGCTCCTCAAAGTCCTCGAACAAATCGCACT
CGAATCCACCCACCCTCAACCAGCGCAGTTCGCCCAGCAACAGTAGC---
------CATATGAATAACAACAATAAT---------ACAAGTGCTGCTGT
TACGGCGGCGGCGGCGGCTGCGGTTCTGGCGGCCGCCAAGCGGGGATCGA
GGAGTTCGCAGGGCTCCAGCGACAGCAACAACAGCACACGGAGCGCTGCT
TCCGGCTCACTGCTGCTAACGGCAGCGAATCTGGAACGCTTCGCGGAGAT
CCACAAGAAGCAGGAGCGCCACAACAAGATGCTGATGCCGCCCAGCAATC
CCTCGTCGTCCAACTACAATGCCAACCTGACGCTGGCAACGAGCGGCAAC
AAGGATGCGGTAATCGCCATCGAGGGCCAGCAGCAGCCGGCGGCCGAGAT
GGATCCCAATTTGCAGTATGTGAAAACCAAAGACCTGGACACCGTGTCCA
TCGCTAGCTCCATGCACTTTACGATGGTCAACGGAGAGGGCGGTCCGCCC
AAGAAACCGAAGCGCGGCCTCTGCGATCGGGGACGCCAGGTCACCGTGTT
GATAGTGAGCATGAGCACCATCTTTATGCTGCTCATCATGGGCATGGTCT
ATGCGCTGGAGATGCGCGCCCGCGACATGCCCAAGAGC------------
------------------------
>C7
ATGCAGGACTATTGGCACATTCCACGCGCCTCGCTGGCCTCCTCGTCGAG
CTCGGCCATCAGTTCGGCCAGCTCCTCGAAGTCCTCGAACAAATCGCACT
CGAATCCGCCCACCCTTAACCAGCGCAGTTCGCCCAGCAACAGTAGCAGC
AGCCATATTACCAACAATAATAGCAAT---------ACCAGTGCTGCTGT
TACGGCGGCGGCAGCGGCGGCGGTTCTGGCGGCCGCCAAGCGGGGATCGA
GGAGTTCGCAGGGCTCCAGCGACAGCAACAACAGCACACGGAGCGCTGCT
TCCGGCTCACTGCTGCTGACGGCAGCGAATCTGGAACGCTTTGCGGAGAT
CCACAAGAAGCAGGAGCGGCACAACAAGATGCTGATGCCC---GGCCATC
CCACGTCGTCCAACTACAATGCCAACCTGACGCTGGCCAGCGGC------
AAGGATGCGGTCATCGCCATCGAGGGCCAG------CCGCCGGCCGAGGT
GGATCCCAATTTGCAGTACGTGAAAACCAAAGACCTGGACACCGTGTCCA
TCGCCAGCTCCATGCACTTTACGATGGTCAACGGCGAGGGTGGTCCGCCC
AAGAAGCCCAAGCGCGGCCTCTGCGATCGGGGACGCCAGGTCACCGTGTT
GATAGTGAGCATGAGCACCATCTTCATGCTGCTCATCATGGGCATGGTCT
ATGCGCTGGAGATGCGCGCCCGCGACATGCCCAAGAGC------------
------------------------
>C8
ATGCAGGACTATTGGCACATTCCACGCGCCTCGCTGGCCTCATCCTCGAG
CTCGGCCATCAGTTCGGCCAGCTCCTCGAAGTCCTCGAACAAATCGCACT
CGAATCCGCCCACCCTCAACCAGCGCAGTTCGCCCAGCAACAGTAGCAAT
ATTAACAACAACAATAATAATAATAAT---------ACAAGTGCTGCTGT
TACGGCGGCGGCAGCGGCAGCGGTACTGGCGGCTGCCAAGCGGGGATCGA
GGAGTTCGCAGGGCTCCAGCGACAGTAACAACAGCACACGGAGCGCTGCT
TCCGGCTCACTGCTGCTGACGGCAGCGAATCTGGAACGCTTCGCCGAGAT
CCACAAGAAGCAGGAGCGCCACAACAAGATGCTGATGCCC---AGCAATC
CCTCGTCGTCCAACTACAATGCCAATCTGACGCTGGCCAGCGGC------
AAGGATGCGGTGATCGCCATCGAGGGTCAG------CAGCCGGCCGAGGT
GGATCCCAATTTGCAGTATGTGAAAACCAAAGACCTGGACACCGTATCCA
TCGCCAGCTCCATGCACTTCACGATGGTCAACGGCGAGGGTGGTCCGCCC
AAGAAGCCGAAGCGCGGTCTCTGCGATCGGGGACGCCAGGTCACCGTGTT
GATAGTGAGCATGAGCACCATCTTTATGCTGCTCATCATGGGCATGGTCT
ATGCGCTGGAGATGCGCGCCCGCGACATGCCCAAGAGC------------
------------------------
>C9
ATGCAGGACTACTGGCACATTCCCCGCGCCTCTCTGGCCTCATCCTCAAG
CTCGGCCATCAGTTCGGCCAGCTCCTCAAAGTCCTCGAACAAATCGCACT
CGAATCCGCCCACCCTCAACCAGCGGAGTTCGCCCAGCAACAGCAGCAAT
GCAAATAATAATAATAATAATAATAAT---------ACAAGTGCTGCTGT
TACGGCGGCGGCTGCGGCAGCGGTACTGGCTGCTGCCAAGCGGGGATCGA
GGAGTTCGCAGGGCTCCAGCGACAGTAACAACAGCACACGGAGCGCTGCT
TCCGGCTCACTGCTGTTGACGGCAGCGAATCTGGAACGCTTCGCGGAGAT
CCACAAGAAGCAGGAGCGCCACAACAAGATGCTGATGCCC---AGTAATC
CTTCGTCGTCCAACTACAATGCCAATCTGACGCTAGCCAGCGGC------
AAGGATGCGGTTATCGCCATCGAGGGCCAA------CAGCCGAACGAAGT
GGATCCCAATTTGCAGTACGTGAAAACCAAAGACCTGGACACCGTATCCA
TTGCGAGCTCTATGCACTTCACGATGGTCAATGGAGAAGGTGGTCCCCCG
AAGAAACCGAAGCGTGGTCTCTGCGATCGTGGACGCCAGGTCACCGTGTT
GATAGTGAGCATGAGCACCATCTTTATGCTGCTCATCATGGGCATGGTCT
ATGCGCTGGAGATGCGCGCCCGCGACATGCCCAAGAGC------------
------------------------
>C10
ATGCAGGACTATTGGCACATTCCCCGCGCCTCGCTGGCCTCCTCCTCGAG
CTCGGCCATCAGTTCGGCCAGCTCCTCAAAGTCCTCAAACAAGTCGCACT
CGAATCCGCCCACCCTCAACCAGCGCAGTTCCCCAAGCAACAGTAGCAAT
GTTAATAATGTTAACAACAACAGCAACAACAATAATACAAGTGCTGCTGT
GACAGCGGCGGCAGCGGCAGCGGTACTAGCAGCTGCCAAGCGGGGATCGA
GGAGTTCCCAGGGCTCCAGCGACAGCAACAACAGCACACGGAGCGCTGCT
TCCGGCTCACTGCTGCTGACGGCAGCGAATCTGGAACGCTTCGCGGAGAT
CCACAAGAAGCAGGAGCGGCACAACAAGATGCTGATGCCC---GGCCATC
CATCTTCGTCCAACTACAATGCCAACCTAACGCTCGCCACTGGC------
CAGGATGCGGTGATCACCATCGATGGCCAG------CAGCCATCGGAAGT
GGATCCCAACTTGCAGTATGTGAAAACCAAAGACCTGGACACCGTATCCA
TTGCCAGCTCGATGCACTTTACGATGGTCAACGGCGAGGGTGGTCCGCCC
AAGAAGCCCAAGCGCGGTCTCTGCGATCGAGGACGCCAGGTCACCGTGTT
GATTGTGAGCATGAGTACCATCTTCATGCTCCTCATCATGGGCATGGTCT
ATGCGCTGGAGATGCGCGCCCGCGACATGCCCAAGAGC------------
------------------------
>C11
ATGCAGGACTATTGGCACATTCCCCGCGCCTCGCTGGCCTCTTCCTCGAG
CTCAGCCATTAGTTCGGCTAGCTCCTCAAAGTCCTCGAACAAATCGCACT
CGAATCCGCCTACCCTGAACCAGCGCAGTTCGCCTAGCGACAGTAGC---
---------------------AATAAT---------ACAAGTGCTGCTGT
GACAGCAGCGGCAGCGGCGGCGGTACTGGCGGCTGCCAAGCGGGGATCGA
GGAGTTCGCAGGGCTCCAGCGACAGCAACAACAGCACACGGAGCGCTGCT
TCCGGCTCACTGCTGTTGACGGCAGCGAATCTGGAACGCTTCGCGGAGAT
CCACAAGAAGCAGGAGCGGAACAACAAGATGCTGATGCCC---AGCAATC
CCTCATCGTCCAACTACAATGCCAACCTGACGCTCGCCAGCGGC------
AAGGATGCGGTCATCGCCATCGAGGGCGAG---------CCGGCCGATGT
GGATCCCAATTTGCAGTATGTGAAAACCAAAGACCTGGATACCGTATCCA
TTGCCAGTTCCATGCACTTCACGATGGTCAATGGAGAGGGTGGTCCGCCC
AAGAAACCGAAGCGCGGTCTCTGCGATCGGGGACGCCAGGTCACCGTGTT
GATTGTCAGCATGAGCACCATTTTCATGCTGCTCATTATGGGCATGGTCT
ATGCGCTGGAGATGCGCGCCCGTGACATGCCCAAGAGC------------
------------------------
>C12
ATGCAGGACTATTGGCACATTCCCCGCGCCTCGCTGGCCTCTTCCTCGAG
CTCGGCCATCAGTTCGGCGAGCTCCTCCAAGTCCTCGAACAAATCACACT
CGAATCCGCCCACCCTGAACCAACGTAGTTCGCCCAGCAACAGTAGCAAT
------------ACTAACAACAATAAT---------ACAAGTGCCGCAGT
GACGGCCGCAGCAGCGGCAGCAGTACTGGCGGCCGCCAAGCGGGGATCGA
GAAGTTCGCAGGGCTCCAGCGACAGCAACAACAGCACACGGAGCGCTGCT
TCCGGCTCACTGCTGTTGACGGCAGCGAATCTGGAACGCTTTGCGGAGAT
CCACAAGAAGCAGGAGCGGCACAACAAGATGCTGATGCCC---AGCAATC
CCTCGTCGTCCAACTACAATGCCAACCTAACGCTCGCCAGCGGC------
AAGGATGCGGTGATCGCCATCGAGGGCCAG---------CCGGAAGATGT
TGATCCCAATTTGCAGTATGTGAAAACCAAAGACCTGGACACCGTATCCA
TCGCCAGCTCCATGCACTTCACGATGGTCAATGGGGAGGGTGGTCCGCCC
AAGAAACCGAAGCGCGGTCTCTGCGATCGGGGACGCCAGGTCACCGTGTT
GATTGTGAGCATGAGCACCATCTTTATGCTGCTCATTATGGGAATGGTCT
ATGCGCTGGAGATGCGCGCCCGTGACATGCCCAAGAGC------------
------------------------
>C1
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNTSo
ooSIHNNNNoooTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMPoSNPSSSNYNANLAIGSGoo
KDAVIAIEGQQPooADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKS
>C2
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSGo
ooSINNNNNoooTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMPoSNPSSSNYNANLSLGSGoo
KDAVIAIEGQQPooADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKS
>C3
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSo
ooSINNNNNoooTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMPoSNPSSSNYNANLALGSGoo
KDAVIAIEGQQPooADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKS
>C4
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSo
ooSINNNNNoooTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMPoSNPSSSNYNANLTLASGoo
KDAVIAIEGQQSSAADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKS
>C5
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSo
ooNINNNNNoooTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMPoSNPSTSNYNANLTLASGoo
KDAVIAIEGQooQPGDVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKS
>C6
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSo
ooHMNNNNNoooTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMPPSNPSSSNYNANLTLATSGN
KDAVIAIEGQQQPAAEMDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKS
>C7
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSS
SHITNNNSNoooTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMPoGHPTSSNYNANLTLASGoo
KDAVIAIEGQooPPAEVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKS
>C8
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSN
INNNNNNNNoooTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMPoSNPSSSNYNANLTLASGoo
KDAVIAIEGQooQPAEVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKS
>C9
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSN
ANNNNNNNNoooTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMPoSNPSSSNYNANLTLASGoo
KDAVIAIEGQooQPNEVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKS
>C10
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSN
VNNVNNNSNNNNTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMPoGHPSSSNYNANLTLATGoo
QDAVITIDGQooQPSEVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKS
>C11
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSDSSo
oooooooNNoooTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERNNKMLMPoSNPSSSNYNANLTLASGoo
KDAVIAIEGEoooPADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKS
>C12
MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSN
ooooTNNNNoooTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMPoSNPSSSNYNANLTLASGoo
KDAVIAIEGQoooPEDVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKS
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/59/CG13024-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 12 taxa and 774 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Taxon 10 -> C10
Taxon 11 -> C11
Taxon 12 -> C12
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1480436196
Setting output file names to "/opt/ADOPS/59/CG13024-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 731169096
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 4785386002
Seed = 2075499230
Swapseed = 1480436196
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 36 unique site patterns
Division 2 has 25 unique site patterns
Division 3 has 122 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -3604.703754 -- -24.979900
Chain 2 -- -3573.992427 -- -24.979900
Chain 3 -- -3539.014827 -- -24.979900
Chain 4 -- -3558.564211 -- -24.979900
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -3621.300639 -- -24.979900
Chain 2 -- -3598.050953 -- -24.979900
Chain 3 -- -3650.097503 -- -24.979900
Chain 4 -- -3654.152506 -- -24.979900
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-3604.704] (-3573.992) (-3539.015) (-3558.564) * [-3621.301] (-3598.051) (-3650.098) (-3654.153)
500 -- [-2583.951] (-2591.330) (-2584.172) (-2579.955) * (-2624.593) [-2582.824] (-2599.537) (-2623.279) -- 0:33:19
1000 -- (-2537.890) (-2561.111) [-2515.015] (-2547.995) * (-2584.695) [-2493.374] (-2540.505) (-2570.791) -- 0:16:39
1500 -- [-2478.363] (-2526.696) (-2482.775) (-2497.472) * (-2532.702) [-2456.592] (-2502.997) (-2517.570) -- 0:11:05
2000 -- (-2454.293) (-2505.950) [-2444.465] (-2456.779) * (-2486.247) [-2443.995] (-2493.144) (-2497.925) -- 0:16:38
2500 -- (-2450.714) (-2455.745) [-2439.167] (-2457.003) * (-2457.235) (-2445.084) [-2439.994] (-2484.252) -- 0:13:18
3000 -- (-2431.846) (-2434.257) [-2438.599] (-2451.765) * [-2440.279] (-2455.848) (-2428.324) (-2447.524) -- 0:11:04
3500 -- (-2427.573) [-2430.829] (-2433.092) (-2447.328) * (-2451.445) (-2443.635) [-2430.673] (-2437.778) -- 0:09:29
4000 -- (-2430.162) [-2440.599] (-2446.005) (-2447.950) * [-2430.625] (-2449.724) (-2433.337) (-2432.166) -- 0:12:27
4500 -- [-2424.258] (-2441.213) (-2440.384) (-2454.513) * (-2440.605) (-2433.675) [-2431.914] (-2431.700) -- 0:11:03
5000 -- [-2432.975] (-2437.123) (-2436.010) (-2444.932) * (-2428.061) (-2437.885) (-2431.515) [-2435.192] -- 0:09:57
Average standard deviation of split frequencies: 0.067344
5500 -- (-2427.950) [-2426.501] (-2437.739) (-2431.129) * (-2435.599) (-2434.902) (-2445.846) [-2434.976] -- 0:09:02
6000 -- [-2434.308] (-2437.952) (-2444.896) (-2444.495) * (-2437.717) (-2427.604) [-2432.369] (-2438.093) -- 0:11:02
6500 -- [-2428.843] (-2442.448) (-2429.189) (-2441.395) * (-2432.315) [-2429.117] (-2432.749) (-2445.249) -- 0:10:11
7000 -- (-2434.057) [-2430.833] (-2432.449) (-2438.587) * (-2436.023) (-2434.896) (-2427.789) [-2429.196] -- 0:09:27
7500 -- (-2434.652) (-2442.194) [-2425.259] (-2436.416) * [-2428.168] (-2439.863) (-2444.765) (-2436.790) -- 0:08:49
8000 -- (-2435.602) [-2433.686] (-2431.973) (-2439.191) * (-2428.328) (-2428.266) [-2428.810] (-2437.796) -- 0:10:20
8500 -- (-2446.171) [-2427.736] (-2432.419) (-2438.602) * (-2433.710) (-2432.225) [-2430.590] (-2440.876) -- 0:09:43
9000 -- (-2436.833) (-2437.644) [-2427.720] (-2427.949) * (-2435.105) [-2438.111] (-2444.309) (-2441.103) -- 0:09:10
9500 -- (-2435.960) (-2434.967) (-2430.107) [-2429.954] * [-2433.247] (-2451.602) (-2442.448) (-2450.526) -- 0:08:41
10000 -- [-2432.079] (-2428.763) (-2432.906) (-2440.601) * (-2431.650) (-2436.271) (-2441.857) [-2433.427] -- 0:09:54
Average standard deviation of split frequencies: 0.077990
10500 -- (-2433.222) (-2434.054) [-2437.577] (-2439.292) * [-2431.731] (-2441.366) (-2443.152) (-2434.183) -- 0:09:25
11000 -- (-2434.063) (-2434.450) [-2433.600] (-2432.960) * [-2436.618] (-2436.123) (-2453.303) (-2442.863) -- 0:08:59
11500 -- (-2429.125) [-2430.513] (-2439.377) (-2432.412) * (-2429.923) (-2443.695) (-2440.513) [-2430.119] -- 0:08:35
12000 -- [-2436.218] (-2439.779) (-2441.012) (-2430.590) * [-2433.376] (-2434.611) (-2427.202) (-2432.735) -- 0:09:36
12500 -- [-2440.024] (-2440.165) (-2438.266) (-2436.934) * (-2432.322) (-2427.615) (-2430.404) [-2433.392] -- 0:09:13
13000 -- (-2446.379) [-2433.233] (-2438.139) (-2441.894) * (-2430.702) (-2444.052) [-2430.967] (-2430.684) -- 0:08:51
13500 -- (-2432.075) [-2432.076] (-2437.417) (-2432.311) * (-2434.649) (-2435.022) [-2431.069] (-2437.147) -- 0:09:44
14000 -- (-2438.375) (-2435.792) (-2430.031) [-2434.714] * (-2445.457) [-2429.138] (-2427.113) (-2453.794) -- 0:09:23
14500 -- (-2437.915) (-2440.069) [-2436.071] (-2434.532) * [-2433.703] (-2436.216) (-2436.106) (-2446.081) -- 0:09:03
15000 -- (-2438.663) (-2437.695) [-2429.314] (-2434.444) * (-2433.304) (-2435.656) [-2426.723] (-2444.002) -- 0:08:45
Average standard deviation of split frequencies: 0.114385
15500 -- (-2447.840) (-2438.524) (-2436.094) [-2429.470] * (-2447.031) [-2437.139] (-2435.149) (-2444.992) -- 0:09:31
16000 -- [-2431.768] (-2441.556) (-2438.450) (-2431.962) * (-2448.419) [-2434.198] (-2437.300) (-2449.073) -- 0:09:13
16500 -- (-2428.602) [-2433.007] (-2434.541) (-2442.303) * (-2437.935) (-2439.140) [-2432.299] (-2441.234) -- 0:08:56
17000 -- [-2429.124] (-2433.896) (-2449.657) (-2441.257) * [-2446.477] (-2444.065) (-2438.117) (-2439.099) -- 0:08:40
17500 -- (-2435.441) (-2437.305) (-2430.296) [-2442.609] * (-2440.888) [-2439.386] (-2434.119) (-2429.810) -- 0:09:21
18000 -- [-2428.079] (-2440.312) (-2441.002) (-2443.823) * [-2437.888] (-2437.504) (-2449.002) (-2435.595) -- 0:09:05
18500 -- [-2430.483] (-2440.815) (-2437.988) (-2440.971) * (-2429.772) [-2435.555] (-2433.337) (-2434.666) -- 0:08:50
19000 -- [-2426.871] (-2443.625) (-2428.669) (-2439.189) * (-2438.510) (-2441.494) [-2429.897] (-2429.434) -- 0:08:36
19500 -- (-2434.152) (-2431.760) [-2435.646] (-2434.266) * (-2442.880) (-2435.487) [-2438.458] (-2437.336) -- 0:09:13
20000 -- (-2443.798) (-2435.777) (-2432.543) [-2439.035] * (-2435.825) (-2443.309) [-2434.168] (-2439.922) -- 0:08:59
Average standard deviation of split frequencies: 0.072707
20500 -- (-2430.575) (-2450.650) [-2433.425] (-2427.865) * (-2434.870) (-2437.143) [-2429.868] (-2425.084) -- 0:08:45
21000 -- [-2433.561] (-2444.773) (-2448.682) (-2429.482) * [-2438.066] (-2435.487) (-2427.391) (-2438.395) -- 0:08:32
21500 -- [-2430.237] (-2440.465) (-2432.578) (-2426.941) * (-2439.721) (-2453.207) (-2434.070) [-2428.997] -- 0:09:06
22000 -- (-2432.063) (-2440.044) (-2439.500) [-2424.120] * (-2436.988) [-2437.435] (-2446.738) (-2434.132) -- 0:08:53
22500 -- (-2433.534) [-2436.086] (-2435.445) (-2426.905) * (-2432.922) (-2438.287) [-2435.409] (-2436.334) -- 0:08:41
23000 -- (-2442.365) (-2429.285) [-2433.736] (-2439.678) * [-2438.040] (-2443.231) (-2443.350) (-2435.287) -- 0:08:29
23500 -- (-2439.512) (-2436.021) [-2431.855] (-2434.044) * (-2436.309) (-2431.391) [-2432.106] (-2440.956) -- 0:09:00
24000 -- (-2435.136) (-2438.209) (-2437.805) [-2434.987] * (-2430.230) [-2433.408] (-2430.913) (-2445.452) -- 0:08:48
24500 -- [-2439.516] (-2437.901) (-2435.906) (-2441.436) * (-2428.103) (-2436.980) (-2443.223) [-2442.861] -- 0:08:37
25000 -- (-2440.207) (-2440.948) (-2431.131) [-2440.148] * [-2428.068] (-2434.974) (-2447.832) (-2437.170) -- 0:09:06
Average standard deviation of split frequencies: 0.047140
25500 -- (-2450.365) (-2433.566) [-2431.589] (-2437.478) * (-2445.004) (-2428.649) (-2439.445) [-2435.065] -- 0:08:55
26000 -- [-2434.099] (-2433.792) (-2434.264) (-2437.510) * (-2438.636) [-2427.790] (-2440.501) (-2434.667) -- 0:08:44
26500 -- (-2438.158) (-2431.024) (-2431.951) [-2432.750] * [-2431.251] (-2430.879) (-2441.888) (-2438.630) -- 0:08:34
27000 -- (-2438.166) [-2428.989] (-2451.337) (-2431.698) * [-2435.167] (-2432.725) (-2431.132) (-2437.193) -- 0:09:00
27500 -- [-2434.886] (-2430.061) (-2428.262) (-2433.642) * (-2434.666) [-2436.487] (-2436.520) (-2438.577) -- 0:08:50
28000 -- [-2436.895] (-2442.337) (-2427.271) (-2429.410) * [-2426.176] (-2457.038) (-2438.047) (-2439.977) -- 0:08:40
28500 -- [-2443.583] (-2438.876) (-2428.251) (-2429.651) * [-2437.654] (-2435.077) (-2436.763) (-2437.714) -- 0:08:31
29000 -- (-2433.907) (-2431.176) [-2434.083] (-2435.702) * (-2431.210) (-2442.777) [-2441.804] (-2434.425) -- 0:08:55
29500 -- (-2452.725) (-2441.333) (-2442.047) [-2434.002] * (-2434.436) (-2460.267) [-2433.816] (-2444.624) -- 0:08:46
30000 -- [-2440.158] (-2431.293) (-2446.182) (-2442.257) * (-2435.377) (-2445.987) [-2434.043] (-2434.379) -- 0:08:37
Average standard deviation of split frequencies: 0.033980
30500 -- (-2443.657) (-2436.941) [-2447.250] (-2438.463) * [-2425.079] (-2438.999) (-2439.760) (-2442.845) -- 0:08:28
31000 -- (-2448.222) (-2435.183) [-2438.478] (-2444.482) * [-2434.762] (-2441.741) (-2434.067) (-2434.668) -- 0:08:51
31500 -- (-2439.179) [-2438.962] (-2434.115) (-2444.325) * [-2430.251] (-2433.257) (-2429.792) (-2436.563) -- 0:08:42
32000 -- (-2433.029) (-2432.701) (-2448.845) [-2435.247] * [-2428.387] (-2440.297) (-2427.903) (-2437.790) -- 0:08:34
32500 -- [-2426.046] (-2439.322) (-2448.352) (-2429.827) * (-2430.555) [-2433.810] (-2437.980) (-2446.484) -- 0:08:26
33000 -- (-2433.516) [-2431.374] (-2442.355) (-2437.094) * (-2444.420) [-2432.392] (-2440.291) (-2436.426) -- 0:08:47
33500 -- [-2430.433] (-2432.230) (-2439.307) (-2434.596) * (-2428.653) [-2431.344] (-2432.168) (-2444.475) -- 0:08:39
34000 -- [-2442.713] (-2434.394) (-2453.275) (-2436.243) * (-2428.996) [-2434.220] (-2435.640) (-2444.653) -- 0:08:31
34500 -- (-2427.756) (-2440.146) (-2437.765) [-2433.070] * (-2430.482) (-2442.484) [-2443.873] (-2443.278) -- 0:08:23
35000 -- [-2428.722] (-2431.548) (-2443.063) (-2437.626) * [-2438.838] (-2450.243) (-2436.058) (-2437.366) -- 0:08:43
Average standard deviation of split frequencies: 0.026189
35500 -- (-2428.988) [-2431.173] (-2447.191) (-2445.096) * [-2429.251] (-2445.650) (-2432.908) (-2442.775) -- 0:08:36
36000 -- (-2434.695) [-2433.792] (-2435.056) (-2438.947) * [-2435.109] (-2433.873) (-2435.647) (-2442.818) -- 0:08:28
36500 -- (-2429.656) [-2431.905] (-2431.895) (-2434.110) * [-2432.711] (-2448.332) (-2448.644) (-2435.664) -- 0:08:21
37000 -- [-2430.043] (-2431.374) (-2441.617) (-2435.122) * (-2425.629) (-2436.896) [-2427.781] (-2439.088) -- 0:08:40
37500 -- (-2436.084) (-2429.160) [-2439.348] (-2444.946) * (-2434.267) (-2433.327) (-2427.450) [-2429.456] -- 0:08:33
38000 -- [-2426.661] (-2431.497) (-2441.132) (-2428.584) * (-2436.269) (-2441.295) (-2438.578) [-2427.361] -- 0:08:26
38500 -- (-2431.511) (-2439.100) (-2437.445) [-2429.931] * (-2433.182) (-2444.361) [-2433.116] (-2429.987) -- 0:08:44
39000 -- (-2431.126) (-2440.033) (-2434.843) [-2435.192] * (-2431.961) (-2445.668) [-2432.113] (-2439.970) -- 0:08:37
39500 -- (-2436.587) [-2434.244] (-2445.125) (-2437.543) * (-2436.955) (-2434.626) [-2428.999] (-2444.831) -- 0:08:30
40000 -- (-2446.165) (-2428.343) [-2434.503] (-2433.824) * (-2439.669) [-2436.519] (-2436.163) (-2439.125) -- 0:08:23
Average standard deviation of split frequencies: 0.016229
40500 -- (-2437.679) [-2432.687] (-2429.790) (-2445.074) * (-2445.004) [-2434.374] (-2432.212) (-2434.109) -- 0:08:41
41000 -- (-2444.473) (-2437.824) (-2434.172) [-2436.129] * (-2443.541) (-2442.976) (-2436.903) [-2429.895] -- 0:08:34
41500 -- (-2450.866) (-2436.494) (-2430.981) [-2433.424] * (-2433.335) (-2439.008) (-2438.096) [-2430.963] -- 0:08:28
42000 -- (-2450.687) (-2426.495) (-2441.296) [-2421.993] * (-2431.484) (-2435.094) (-2436.591) [-2442.255] -- 0:08:21
42500 -- (-2443.587) (-2435.643) (-2432.401) [-2432.608] * [-2428.389] (-2442.870) (-2438.469) (-2433.176) -- 0:08:38
43000 -- (-2430.390) (-2434.417) (-2428.193) [-2442.274] * [-2431.703] (-2429.558) (-2433.019) (-2433.309) -- 0:08:31
43500 -- (-2433.787) (-2435.988) [-2437.549] (-2435.128) * (-2436.205) [-2434.459] (-2443.651) (-2439.159) -- 0:08:25
44000 -- [-2439.499] (-2447.817) (-2442.203) (-2437.325) * (-2436.423) [-2436.868] (-2436.093) (-2439.438) -- 0:08:19
44500 -- (-2438.912) (-2450.392) [-2434.850] (-2431.532) * [-2447.946] (-2428.107) (-2443.933) (-2440.989) -- 0:08:35
45000 -- (-2447.611) (-2457.758) [-2432.282] (-2432.410) * (-2440.805) (-2441.156) [-2439.573] (-2442.615) -- 0:08:29
Average standard deviation of split frequencies: 0.023698
45500 -- (-2435.595) [-2428.604] (-2425.067) (-2444.753) * (-2444.040) (-2438.661) [-2438.503] (-2441.001) -- 0:08:23
46000 -- (-2435.906) (-2433.792) (-2441.759) [-2428.555] * (-2439.602) (-2435.163) [-2428.994] (-2445.263) -- 0:08:17
46500 -- (-2433.190) (-2436.732) [-2440.253] (-2440.802) * [-2436.453] (-2445.328) (-2434.822) (-2438.955) -- 0:08:32
47000 -- (-2439.380) [-2427.065] (-2428.688) (-2437.157) * [-2431.368] (-2430.165) (-2444.964) (-2438.759) -- 0:08:26
47500 -- (-2435.610) [-2429.291] (-2433.928) (-2438.088) * (-2434.641) (-2441.156) (-2454.362) [-2436.636] -- 0:08:21
48000 -- (-2447.069) (-2439.871) [-2426.814] (-2433.052) * [-2430.379] (-2442.653) (-2438.038) (-2429.476) -- 0:08:15
48500 -- [-2434.206] (-2438.860) (-2430.364) (-2441.600) * (-2439.769) [-2436.891] (-2444.731) (-2438.648) -- 0:08:30
49000 -- (-2441.105) (-2437.881) [-2432.545] (-2437.936) * [-2431.290] (-2434.550) (-2435.943) (-2447.243) -- 0:08:24
49500 -- (-2440.689) (-2437.410) (-2435.296) [-2426.693] * [-2432.423] (-2436.869) (-2451.830) (-2438.848) -- 0:08:19
50000 -- [-2430.438] (-2435.969) (-2434.281) (-2429.216) * (-2444.968) (-2433.170) [-2436.598] (-2438.992) -- 0:08:33
Average standard deviation of split frequencies: 0.037216
50500 -- (-2438.063) [-2432.786] (-2434.933) (-2429.931) * (-2432.697) (-2438.305) [-2430.041] (-2432.953) -- 0:08:27
51000 -- (-2441.530) [-2430.400] (-2425.598) (-2438.613) * (-2428.812) (-2441.693) (-2424.692) [-2432.801] -- 0:08:22
51500 -- (-2428.377) (-2434.558) [-2434.759] (-2433.236) * [-2432.798] (-2440.358) (-2435.361) (-2432.967) -- 0:08:17
52000 -- (-2431.094) (-2433.579) [-2436.364] (-2439.132) * [-2427.114] (-2436.911) (-2426.072) (-2439.732) -- 0:08:30
52500 -- (-2434.332) [-2428.350] (-2430.020) (-2442.635) * (-2433.282) (-2438.840) (-2435.422) [-2439.039] -- 0:08:25
53000 -- (-2434.034) (-2449.124) [-2430.299] (-2437.976) * (-2433.631) [-2434.906] (-2442.664) (-2432.481) -- 0:08:20
53500 -- (-2430.144) (-2426.738) (-2432.167) [-2430.419] * (-2430.074) (-2439.398) [-2433.705] (-2436.502) -- 0:08:15
54000 -- (-2435.973) (-2428.421) (-2437.170) [-2438.174] * (-2435.683) (-2443.102) [-2430.025] (-2439.092) -- 0:08:28
54500 -- (-2429.796) (-2434.626) [-2434.051] (-2441.630) * (-2433.637) (-2441.916) (-2431.836) [-2433.801] -- 0:08:23
55000 -- (-2432.578) (-2429.498) (-2430.496) [-2439.769] * (-2437.404) (-2439.217) (-2432.698) [-2436.208] -- 0:08:18
Average standard deviation of split frequencies: 0.036302
55500 -- (-2440.104) (-2428.826) [-2430.836] (-2436.455) * (-2433.605) (-2433.409) [-2437.419] (-2437.522) -- 0:08:13
56000 -- (-2445.562) (-2427.452) [-2431.830] (-2433.949) * (-2438.426) (-2436.872) (-2434.133) [-2432.111] -- 0:08:25
56500 -- (-2437.064) (-2428.871) (-2430.930) [-2429.714] * (-2430.490) (-2431.369) [-2435.137] (-2434.919) -- 0:08:20
57000 -- [-2425.610] (-2426.849) (-2427.800) (-2435.898) * (-2439.555) (-2440.793) [-2427.691] (-2443.322) -- 0:08:16
57500 -- [-2431.663] (-2437.481) (-2441.885) (-2439.270) * (-2439.848) (-2432.821) [-2431.555] (-2456.426) -- 0:08:11
58000 -- (-2443.038) [-2436.689] (-2435.409) (-2436.553) * (-2436.137) (-2436.357) (-2430.258) [-2433.317] -- 0:08:23
58500 -- (-2439.687) (-2429.544) [-2433.074] (-2438.281) * (-2436.945) (-2431.405) [-2433.292] (-2436.334) -- 0:08:18
59000 -- (-2447.111) (-2437.291) [-2429.317] (-2438.899) * (-2440.330) (-2439.856) [-2433.994] (-2426.325) -- 0:08:14
59500 -- (-2432.986) (-2439.394) [-2433.129] (-2442.917) * [-2433.317] (-2443.134) (-2431.686) (-2439.091) -- 0:08:10
60000 -- (-2443.541) [-2429.913] (-2436.357) (-2444.578) * (-2430.699) (-2436.568) (-2435.852) [-2432.525] -- 0:08:21
Average standard deviation of split frequencies: 0.038852
60500 -- [-2440.913] (-2438.500) (-2445.515) (-2446.002) * [-2434.741] (-2433.794) (-2434.523) (-2432.211) -- 0:08:16
61000 -- [-2437.032] (-2434.589) (-2443.476) (-2445.919) * (-2436.070) (-2440.822) [-2433.423] (-2434.736) -- 0:08:12
61500 -- (-2430.492) [-2438.064] (-2438.824) (-2441.975) * [-2436.404] (-2435.717) (-2441.561) (-2437.136) -- 0:08:23
62000 -- (-2438.708) (-2432.041) (-2434.655) [-2425.478] * (-2439.793) (-2439.220) [-2434.009] (-2433.668) -- 0:08:19
62500 -- (-2431.058) (-2441.648) [-2436.671] (-2426.852) * (-2435.099) (-2434.976) (-2431.381) [-2423.893] -- 0:08:15
63000 -- (-2431.090) (-2436.401) (-2439.682) [-2434.292] * (-2438.186) [-2438.124] (-2431.638) (-2427.694) -- 0:08:10
63500 -- (-2430.487) [-2431.636] (-2447.129) (-2441.357) * [-2434.682] (-2437.744) (-2437.299) (-2447.793) -- 0:08:21
64000 -- [-2435.281] (-2431.664) (-2438.939) (-2438.382) * (-2439.034) (-2443.575) (-2430.853) [-2435.149] -- 0:08:17
64500 -- (-2440.390) [-2423.952] (-2437.526) (-2435.904) * [-2437.953] (-2445.580) (-2427.404) (-2445.017) -- 0:08:13
65000 -- (-2444.608) (-2431.361) [-2433.832] (-2446.409) * (-2439.906) [-2431.584] (-2439.497) (-2430.586) -- 0:08:09
Average standard deviation of split frequencies: 0.040334
65500 -- [-2426.676] (-2438.918) (-2436.992) (-2427.767) * (-2438.294) [-2429.549] (-2443.986) (-2434.099) -- 0:08:19
66000 -- (-2437.825) (-2439.374) (-2432.646) [-2430.023] * (-2437.373) (-2442.006) [-2437.090] (-2433.223) -- 0:08:15
66500 -- (-2432.889) (-2440.048) (-2433.388) [-2433.081] * (-2437.410) (-2445.356) (-2441.512) [-2433.699] -- 0:08:11
67000 -- (-2432.297) (-2446.008) [-2436.569] (-2443.600) * (-2430.950) (-2436.047) [-2437.107] (-2434.579) -- 0:08:07
67500 -- (-2441.611) (-2436.978) [-2432.570] (-2440.870) * (-2429.562) (-2435.896) (-2436.734) [-2432.423] -- 0:08:17
68000 -- (-2429.186) [-2432.450] (-2431.964) (-2437.247) * [-2433.035] (-2448.104) (-2438.170) (-2434.656) -- 0:08:13
68500 -- (-2432.012) [-2432.061] (-2446.445) (-2432.924) * (-2437.346) (-2436.441) [-2429.823] (-2435.823) -- 0:08:09
69000 -- (-2437.894) (-2431.801) (-2443.811) [-2432.923] * (-2440.506) [-2434.594] (-2436.905) (-2439.389) -- 0:08:05
69500 -- (-2430.824) (-2439.919) [-2433.298] (-2439.940) * [-2436.869] (-2449.892) (-2444.064) (-2438.295) -- 0:08:15
70000 -- (-2442.590) (-2447.279) (-2431.670) [-2431.809] * (-2437.491) (-2438.238) [-2439.160] (-2436.027) -- 0:08:11
Average standard deviation of split frequencies: 0.041987
70500 -- (-2432.660) (-2449.700) [-2424.706] (-2439.391) * (-2440.824) (-2456.140) (-2432.204) [-2435.087] -- 0:08:07
71000 -- (-2435.347) (-2450.737) [-2438.007] (-2441.906) * (-2435.305) [-2448.120] (-2439.959) (-2433.577) -- 0:08:17
71500 -- (-2441.835) (-2445.098) (-2446.330) [-2426.693] * [-2434.704] (-2446.568) (-2432.026) (-2429.444) -- 0:08:13
72000 -- [-2426.719] (-2436.319) (-2438.168) (-2436.437) * (-2431.578) (-2446.698) (-2437.742) [-2426.307] -- 0:08:09
72500 -- (-2431.038) (-2451.101) [-2433.359] (-2431.959) * (-2442.045) (-2438.701) [-2429.186] (-2444.425) -- 0:08:06
73000 -- (-2438.944) (-2437.838) (-2431.967) [-2436.289] * (-2439.728) [-2432.942] (-2432.243) (-2446.259) -- 0:08:15
73500 -- [-2440.520] (-2437.841) (-2429.988) (-2436.560) * (-2437.259) (-2432.566) [-2436.620] (-2439.336) -- 0:08:11
74000 -- [-2434.156] (-2437.784) (-2441.966) (-2439.512) * (-2438.304) (-2430.699) (-2436.715) [-2427.187] -- 0:08:08
74500 -- (-2436.162) [-2435.412] (-2436.947) (-2429.570) * (-2429.394) (-2431.696) (-2430.954) [-2431.493] -- 0:08:16
75000 -- (-2435.209) (-2441.198) (-2447.824) [-2434.122] * (-2439.764) (-2421.471) [-2431.005] (-2430.839) -- 0:08:13
Average standard deviation of split frequencies: 0.042324
75500 -- (-2432.939) (-2440.695) (-2434.752) [-2434.131] * (-2443.752) (-2429.632) (-2431.086) [-2423.986] -- 0:08:09
76000 -- [-2430.463] (-2430.989) (-2450.384) (-2437.726) * (-2440.473) [-2429.458] (-2436.028) (-2427.696) -- 0:08:06
76500 -- [-2432.361] (-2434.803) (-2439.911) (-2432.919) * (-2431.185) (-2437.806) (-2438.803) [-2432.438] -- 0:08:14
77000 -- (-2439.170) (-2435.470) [-2431.645] (-2435.976) * (-2433.117) (-2431.689) [-2430.340] (-2436.298) -- 0:08:11
77500 -- [-2436.510] (-2436.643) (-2428.486) (-2429.555) * (-2431.752) (-2436.918) [-2438.198] (-2446.335) -- 0:08:08
78000 -- (-2436.825) [-2437.225] (-2437.611) (-2435.772) * (-2441.134) (-2436.560) [-2430.214] (-2450.201) -- 0:08:04
78500 -- (-2432.171) [-2444.254] (-2428.062) (-2432.917) * [-2429.439] (-2442.558) (-2433.610) (-2441.907) -- 0:08:13
79000 -- (-2443.040) [-2440.728] (-2442.511) (-2428.626) * (-2447.910) (-2436.674) [-2433.926] (-2442.930) -- 0:08:09
79500 -- (-2438.978) [-2447.809] (-2431.029) (-2428.819) * (-2445.331) (-2436.387) (-2439.356) [-2436.147] -- 0:08:06
80000 -- (-2436.594) [-2437.219] (-2435.963) (-2442.553) * (-2439.756) [-2438.280] (-2432.778) (-2441.994) -- 0:08:14
Average standard deviation of split frequencies: 0.037255
80500 -- (-2428.571) [-2434.194] (-2437.649) (-2446.245) * [-2436.241] (-2441.301) (-2433.658) (-2435.157) -- 0:08:11
81000 -- (-2432.469) (-2434.349) [-2429.269] (-2442.416) * (-2439.152) (-2428.738) [-2430.192] (-2424.980) -- 0:08:07
81500 -- (-2437.180) (-2431.807) (-2438.010) [-2439.260] * (-2443.281) [-2443.419] (-2423.129) (-2429.059) -- 0:08:04
82000 -- (-2435.960) (-2436.351) (-2440.448) [-2434.217] * [-2437.802] (-2443.517) (-2436.378) (-2437.058) -- 0:08:12
82500 -- (-2440.980) (-2438.608) (-2433.439) [-2429.113] * (-2444.251) [-2430.036] (-2437.586) (-2438.860) -- 0:08:09
83000 -- [-2435.021] (-2431.012) (-2439.842) (-2435.103) * (-2446.586) (-2439.778) [-2439.132] (-2432.507) -- 0:08:06
83500 -- (-2433.056) (-2446.265) (-2438.496) [-2437.207] * [-2433.755] (-2433.424) (-2433.798) (-2437.738) -- 0:08:02
84000 -- (-2437.316) (-2426.091) (-2438.832) [-2437.628] * (-2436.103) [-2433.307] (-2436.149) (-2434.904) -- 0:08:10
84500 -- (-2433.935) (-2423.327) [-2430.287] (-2434.382) * (-2438.765) (-2444.982) [-2431.610] (-2437.174) -- 0:08:07
85000 -- (-2440.015) (-2431.958) [-2432.251] (-2435.217) * (-2440.237) (-2441.456) (-2430.943) [-2433.010] -- 0:08:04
Average standard deviation of split frequencies: 0.027407
85500 -- (-2439.045) (-2439.263) [-2432.801] (-2439.932) * (-2437.206) (-2434.112) [-2436.797] (-2446.757) -- 0:08:01
86000 -- (-2446.081) (-2442.296) (-2434.008) [-2437.207] * (-2438.563) (-2429.103) (-2458.451) [-2442.983] -- 0:08:08
86500 -- (-2440.001) (-2455.590) [-2441.321] (-2442.938) * (-2439.545) [-2431.719] (-2442.859) (-2435.967) -- 0:08:05
87000 -- [-2436.144] (-2440.025) (-2429.469) (-2447.482) * (-2446.146) [-2433.685] (-2447.536) (-2445.247) -- 0:08:02
87500 -- [-2436.654] (-2428.339) (-2433.553) (-2448.569) * (-2433.989) (-2431.623) (-2436.767) [-2433.467] -- 0:07:59
88000 -- (-2437.828) [-2425.680] (-2433.186) (-2453.653) * (-2430.650) [-2434.463] (-2425.089) (-2438.059) -- 0:08:07
88500 -- [-2440.267] (-2442.186) (-2433.167) (-2444.185) * (-2433.867) (-2431.053) [-2432.334] (-2442.486) -- 0:08:04
89000 -- (-2430.655) (-2444.250) [-2424.644] (-2442.725) * (-2437.332) (-2436.023) (-2441.657) [-2429.505] -- 0:08:01
89500 -- [-2431.134] (-2430.285) (-2433.396) (-2434.902) * (-2435.864) [-2431.699] (-2445.480) (-2434.919) -- 0:08:08
90000 -- (-2443.082) [-2428.580] (-2443.905) (-2434.391) * (-2428.102) (-2426.592) [-2436.472] (-2443.621) -- 0:08:05
Average standard deviation of split frequencies: 0.029571
90500 -- (-2432.779) [-2436.468] (-2434.174) (-2441.076) * (-2438.660) (-2430.496) [-2429.446] (-2435.544) -- 0:08:02
91000 -- (-2434.765) (-2438.209) (-2437.543) [-2437.150] * (-2431.764) (-2437.888) (-2426.114) [-2438.629] -- 0:07:59
91500 -- (-2427.510) (-2436.285) (-2437.577) [-2434.897] * (-2439.153) (-2455.432) (-2431.013) [-2431.967] -- 0:08:06
92000 -- (-2440.950) [-2434.459] (-2436.725) (-2432.552) * (-2438.020) (-2443.982) [-2433.652] (-2431.804) -- 0:08:03
92500 -- (-2430.620) [-2428.616] (-2436.096) (-2427.309) * (-2441.121) (-2443.107) (-2438.398) [-2439.275] -- 0:08:00
93000 -- [-2434.784] (-2437.172) (-2444.751) (-2433.286) * (-2432.278) (-2439.863) (-2436.661) [-2426.013] -- 0:07:57
93500 -- (-2430.991) [-2433.261] (-2444.467) (-2439.150) * (-2432.934) (-2431.092) (-2437.190) [-2432.474] -- 0:08:04
94000 -- [-2436.207] (-2431.548) (-2433.525) (-2427.122) * [-2429.045] (-2437.443) (-2440.309) (-2433.088) -- 0:08:01
94500 -- (-2441.808) [-2435.310] (-2441.211) (-2445.049) * (-2432.497) [-2439.556] (-2441.049) (-2435.265) -- 0:07:59
95000 -- (-2440.088) [-2436.336] (-2449.056) (-2441.020) * (-2430.594) (-2438.531) (-2440.143) [-2437.072] -- 0:07:56
Average standard deviation of split frequencies: 0.034680
95500 -- (-2436.476) (-2434.972) [-2431.010] (-2429.886) * (-2436.892) (-2440.036) [-2435.873] (-2433.517) -- 0:08:03
96000 -- [-2440.040] (-2429.220) (-2437.143) (-2437.585) * (-2432.912) (-2445.870) (-2423.740) [-2435.188] -- 0:08:00
96500 -- (-2442.693) [-2437.648] (-2433.705) (-2441.324) * (-2447.958) [-2435.885] (-2441.500) (-2434.398) -- 0:07:57
97000 -- (-2433.514) (-2429.605) (-2433.786) [-2438.298] * [-2439.043] (-2438.007) (-2435.978) (-2437.191) -- 0:07:54
97500 -- [-2434.423] (-2434.486) (-2433.708) (-2443.388) * [-2430.119] (-2430.985) (-2436.546) (-2435.239) -- 0:08:01
98000 -- (-2440.437) [-2437.097] (-2435.700) (-2443.742) * (-2432.656) (-2436.104) (-2430.324) [-2435.877] -- 0:07:58
98500 -- [-2431.811] (-2435.869) (-2441.219) (-2436.840) * (-2436.706) [-2430.856] (-2433.469) (-2437.460) -- 0:07:55
99000 -- (-2435.395) [-2432.237] (-2435.220) (-2435.024) * (-2430.489) (-2433.978) [-2431.637] (-2433.783) -- 0:08:02
99500 -- (-2443.749) (-2437.840) [-2429.833] (-2443.510) * [-2431.443] (-2430.444) (-2437.251) (-2441.634) -- 0:07:59
100000 -- (-2431.717) [-2436.402] (-2432.425) (-2432.077) * (-2438.096) (-2441.869) (-2434.484) [-2435.696] -- 0:07:57
Average standard deviation of split frequencies: 0.032194
100500 -- (-2435.406) (-2437.913) [-2434.367] (-2437.484) * [-2437.485] (-2441.856) (-2440.703) (-2429.866) -- 0:07:54
101000 -- (-2445.283) (-2446.402) (-2439.708) [-2433.982] * (-2433.703) (-2437.959) [-2427.680] (-2437.776) -- 0:08:00
101500 -- (-2433.575) (-2435.314) (-2436.733) [-2439.025] * [-2442.704] (-2444.893) (-2438.615) (-2433.304) -- 0:07:58
102000 -- (-2430.203) (-2443.321) [-2433.307] (-2432.201) * (-2434.617) (-2438.471) [-2440.604] (-2430.275) -- 0:07:55
102500 -- [-2431.190] (-2449.591) (-2432.218) (-2445.303) * [-2427.742] (-2440.301) (-2425.218) (-2430.742) -- 0:07:52
103000 -- (-2439.125) (-2440.003) [-2434.357] (-2443.956) * (-2432.373) (-2440.937) [-2431.687] (-2440.658) -- 0:07:58
103500 -- (-2460.411) (-2448.527) (-2437.978) [-2441.696] * (-2430.346) (-2434.331) (-2436.508) [-2431.699] -- 0:07:56
104000 -- (-2448.828) (-2444.710) [-2435.597] (-2443.766) * [-2429.794] (-2443.336) (-2443.809) (-2433.700) -- 0:07:53
104500 -- (-2425.897) (-2443.271) (-2432.331) [-2430.127] * [-2425.866] (-2437.736) (-2441.295) (-2435.330) -- 0:07:51
105000 -- (-2434.739) (-2444.056) [-2433.410] (-2434.808) * [-2437.100] (-2441.864) (-2439.821) (-2434.169) -- 0:07:57
Average standard deviation of split frequencies: 0.033354
105500 -- (-2434.940) (-2451.002) [-2431.266] (-2441.446) * [-2430.200] (-2440.365) (-2433.485) (-2436.630) -- 0:07:54
106000 -- (-2453.558) (-2434.374) (-2441.535) [-2438.377] * [-2435.550] (-2437.881) (-2433.322) (-2438.226) -- 0:07:52
106500 -- [-2437.367] (-2439.707) (-2429.000) (-2433.079) * [-2430.634] (-2439.057) (-2426.910) (-2444.595) -- 0:07:49
107000 -- (-2450.630) (-2431.176) (-2431.722) [-2431.036] * (-2436.637) [-2428.233] (-2432.513) (-2432.420) -- 0:07:55
107500 -- [-2441.349] (-2432.658) (-2433.319) (-2446.096) * (-2436.363) (-2431.730) [-2427.525] (-2433.249) -- 0:07:53
108000 -- (-2433.085) (-2429.412) (-2437.807) [-2431.850] * [-2426.123] (-2432.280) (-2442.668) (-2436.931) -- 0:07:50
108500 -- (-2427.672) (-2445.355) [-2430.455] (-2441.551) * (-2434.097) [-2442.174] (-2451.723) (-2443.254) -- 0:07:48
109000 -- (-2430.593) (-2436.902) [-2431.501] (-2439.382) * [-2439.076] (-2434.334) (-2436.142) (-2448.133) -- 0:07:54
109500 -- (-2433.663) (-2451.153) [-2433.621] (-2446.271) * (-2438.598) (-2443.841) [-2428.290] (-2446.670) -- 0:07:51
110000 -- (-2436.311) (-2443.446) (-2452.082) [-2434.795] * (-2437.585) [-2433.086] (-2436.819) (-2436.696) -- 0:07:49
Average standard deviation of split frequencies: 0.037538
110500 -- [-2441.765] (-2436.222) (-2438.262) (-2437.740) * [-2438.691] (-2445.129) (-2439.844) (-2442.713) -- 0:07:54
111000 -- [-2435.662] (-2441.262) (-2443.209) (-2442.637) * (-2438.990) (-2437.901) (-2437.601) [-2437.781] -- 0:07:52
111500 -- (-2430.949) (-2446.696) (-2433.599) [-2435.304] * (-2441.381) (-2432.639) (-2439.404) [-2443.128] -- 0:07:50
112000 -- (-2434.350) (-2451.491) (-2436.145) [-2441.786] * (-2435.144) (-2441.751) [-2440.867] (-2443.021) -- 0:07:47
112500 -- [-2432.344] (-2427.871) (-2436.221) (-2442.340) * (-2435.979) [-2438.361] (-2436.079) (-2442.972) -- 0:07:53
113000 -- (-2431.251) [-2430.977] (-2437.613) (-2443.810) * (-2440.651) (-2438.827) [-2434.025] (-2442.593) -- 0:07:50
113500 -- (-2434.863) [-2430.734] (-2445.181) (-2437.183) * (-2436.578) [-2430.373] (-2438.744) (-2436.523) -- 0:07:48
114000 -- [-2431.921] (-2429.255) (-2435.613) (-2429.282) * [-2436.432] (-2436.593) (-2440.746) (-2442.892) -- 0:07:46
114500 -- [-2426.556] (-2432.571) (-2429.464) (-2438.629) * (-2439.006) (-2436.135) [-2438.177] (-2436.840) -- 0:07:51
115000 -- [-2431.079] (-2443.366) (-2440.565) (-2435.131) * (-2446.545) [-2436.033] (-2438.467) (-2434.531) -- 0:07:49
Average standard deviation of split frequencies: 0.032257
115500 -- (-2439.317) (-2435.997) (-2437.083) [-2425.638] * (-2432.139) [-2434.911] (-2433.728) (-2432.043) -- 0:07:47
116000 -- (-2435.223) (-2429.030) (-2436.605) [-2432.517] * (-2445.279) (-2431.878) (-2437.061) [-2431.783] -- 0:07:44
116500 -- (-2439.213) [-2430.782] (-2439.568) (-2434.702) * (-2454.972) [-2431.727] (-2432.982) (-2441.185) -- 0:07:50
117000 -- (-2429.918) [-2431.661] (-2448.910) (-2433.129) * [-2435.322] (-2432.756) (-2441.999) (-2446.600) -- 0:07:47
117500 -- (-2439.845) (-2443.039) [-2426.046] (-2445.753) * (-2442.281) (-2433.824) [-2432.521] (-2444.414) -- 0:07:45
118000 -- (-2446.440) (-2439.464) [-2436.149] (-2431.164) * (-2447.578) (-2437.484) [-2425.044] (-2441.078) -- 0:07:43
118500 -- (-2439.948) (-2439.210) (-2436.279) [-2432.982] * (-2443.615) (-2435.897) [-2431.950] (-2441.937) -- 0:07:48
119000 -- (-2445.846) (-2433.771) [-2429.660] (-2431.686) * (-2441.991) (-2438.365) [-2429.242] (-2435.323) -- 0:07:46
119500 -- (-2427.954) (-2442.449) [-2432.191] (-2433.029) * (-2438.665) (-2432.567) (-2439.850) [-2433.476] -- 0:07:44
120000 -- (-2433.332) (-2433.840) [-2433.326] (-2433.478) * (-2426.733) (-2448.746) [-2437.724] (-2432.301) -- 0:07:49
Average standard deviation of split frequencies: 0.031986
120500 -- (-2441.899) (-2439.478) [-2426.761] (-2435.987) * (-2430.972) (-2440.651) (-2432.269) [-2434.578] -- 0:07:47
121000 -- (-2441.530) [-2432.795] (-2434.987) (-2451.697) * (-2428.835) (-2441.988) (-2437.883) [-2431.400] -- 0:07:44
121500 -- (-2452.742) [-2432.855] (-2439.151) (-2430.056) * (-2431.092) [-2426.841] (-2435.609) (-2431.651) -- 0:07:42
122000 -- (-2437.842) (-2434.649) (-2442.719) [-2430.263] * (-2441.704) [-2433.561] (-2441.408) (-2430.053) -- 0:07:47
122500 -- (-2442.886) (-2436.143) (-2440.482) [-2427.920] * (-2433.400) (-2436.131) (-2435.526) [-2432.555] -- 0:07:45
123000 -- (-2441.968) [-2432.103] (-2446.020) (-2429.144) * [-2433.044] (-2444.126) (-2427.571) (-2444.843) -- 0:07:43
123500 -- [-2429.475] (-2431.630) (-2441.076) (-2442.711) * (-2442.094) (-2435.819) [-2426.219] (-2448.146) -- 0:07:41
124000 -- [-2427.278] (-2437.135) (-2446.641) (-2431.694) * (-2434.306) (-2440.304) [-2432.360] (-2449.365) -- 0:07:46
124500 -- (-2441.046) (-2441.649) (-2438.765) [-2425.484] * [-2436.811] (-2433.418) (-2432.260) (-2443.896) -- 0:07:44
125000 -- (-2423.066) (-2436.380) (-2446.397) [-2436.185] * (-2431.568) [-2426.833] (-2430.088) (-2446.590) -- 0:07:42
Average standard deviation of split frequencies: 0.030398
125500 -- [-2428.955] (-2437.859) (-2440.328) (-2437.592) * (-2434.389) [-2431.817] (-2431.372) (-2440.352) -- 0:07:39
126000 -- (-2432.185) [-2435.033] (-2432.548) (-2435.759) * (-2433.700) [-2428.808] (-2434.910) (-2437.623) -- 0:07:44
126500 -- (-2436.271) (-2437.767) (-2452.481) [-2433.034] * (-2431.735) (-2436.605) [-2428.336] (-2442.798) -- 0:07:42
127000 -- (-2435.410) (-2437.618) (-2443.953) [-2435.916] * (-2436.094) (-2443.433) (-2438.502) [-2436.989] -- 0:07:40
127500 -- (-2440.592) (-2428.567) [-2439.992] (-2443.956) * [-2431.039] (-2434.063) (-2432.231) (-2437.139) -- 0:07:38
128000 -- (-2443.978) (-2437.461) (-2436.703) [-2432.773] * [-2435.120] (-2432.926) (-2446.805) (-2436.985) -- 0:07:43
128500 -- (-2440.784) [-2437.795] (-2443.328) (-2437.935) * (-2430.661) (-2430.915) [-2431.430] (-2434.228) -- 0:07:41
129000 -- [-2436.191] (-2429.620) (-2437.722) (-2432.494) * (-2437.540) (-2438.457) (-2447.346) [-2441.405] -- 0:07:39
129500 -- (-2435.281) [-2425.571] (-2439.678) (-2431.093) * [-2431.398] (-2423.566) (-2436.651) (-2431.496) -- 0:07:37
130000 -- (-2439.377) [-2434.689] (-2438.992) (-2436.753) * [-2428.150] (-2435.910) (-2440.192) (-2431.212) -- 0:07:41
Average standard deviation of split frequencies: 0.029538
130500 -- [-2432.300] (-2436.152) (-2439.024) (-2438.907) * [-2433.175] (-2435.859) (-2434.110) (-2432.425) -- 0:07:39
131000 -- (-2429.505) [-2430.379] (-2440.829) (-2431.127) * (-2447.055) (-2435.267) [-2432.610] (-2429.498) -- 0:07:37
131500 -- (-2437.621) [-2423.672] (-2436.426) (-2434.427) * [-2436.690] (-2435.480) (-2431.592) (-2440.071) -- 0:07:42
132000 -- (-2439.660) [-2427.278] (-2446.249) (-2431.476) * (-2436.593) (-2441.670) (-2431.713) [-2429.909] -- 0:07:40
132500 -- (-2445.183) (-2430.512) [-2432.436] (-2437.134) * [-2441.830] (-2435.443) (-2445.169) (-2429.232) -- 0:07:38
133000 -- [-2432.568] (-2435.775) (-2430.532) (-2429.709) * [-2442.584] (-2438.709) (-2450.820) (-2429.125) -- 0:07:36
133500 -- [-2430.518] (-2426.591) (-2433.597) (-2428.394) * (-2436.691) (-2434.708) (-2427.471) [-2434.501] -- 0:07:40
134000 -- (-2442.266) (-2428.190) (-2430.227) [-2433.091] * (-2436.989) (-2430.784) (-2435.917) [-2436.019] -- 0:07:38
134500 -- (-2436.819) (-2443.219) [-2433.159] (-2449.371) * (-2444.148) (-2446.708) [-2436.584] (-2448.985) -- 0:07:36
135000 -- [-2429.937] (-2435.416) (-2433.044) (-2431.161) * (-2435.184) [-2437.240] (-2438.957) (-2438.412) -- 0:07:34
Average standard deviation of split frequencies: 0.027296
135500 -- [-2433.999] (-2444.706) (-2439.341) (-2438.341) * [-2432.391] (-2432.068) (-2435.855) (-2437.077) -- 0:07:39
136000 -- [-2428.710] (-2434.783) (-2445.228) (-2441.656) * (-2438.887) (-2439.598) (-2438.193) [-2436.442] -- 0:07:37
136500 -- (-2439.457) (-2442.987) (-2444.448) [-2439.906] * (-2439.129) (-2435.096) [-2442.349] (-2431.581) -- 0:07:35
137000 -- (-2432.688) (-2431.155) (-2438.995) [-2436.200] * (-2439.179) (-2438.383) [-2444.243] (-2442.217) -- 0:07:33
137500 -- (-2438.860) (-2443.966) [-2433.778] (-2434.780) * [-2452.385] (-2435.793) (-2435.831) (-2455.898) -- 0:07:37
138000 -- (-2453.595) (-2454.912) [-2436.243] (-2441.747) * (-2438.028) [-2436.609] (-2441.699) (-2442.677) -- 0:07:35
138500 -- (-2442.041) (-2444.578) (-2435.521) [-2435.360] * (-2435.183) (-2437.072) (-2437.463) [-2438.575] -- 0:07:34
139000 -- [-2440.286] (-2433.919) (-2437.967) (-2439.231) * (-2436.846) [-2433.620] (-2431.481) (-2450.613) -- 0:07:38
139500 -- (-2447.002) [-2427.780] (-2440.917) (-2437.163) * (-2431.560) (-2436.386) [-2435.962] (-2440.109) -- 0:07:36
140000 -- (-2433.408) (-2432.560) [-2435.636] (-2438.774) * (-2435.760) (-2436.455) [-2432.015] (-2439.190) -- 0:07:34
Average standard deviation of split frequencies: 0.025134
140500 -- (-2425.033) [-2432.950] (-2435.314) (-2433.644) * (-2437.148) (-2434.107) (-2436.057) [-2439.160] -- 0:07:32
141000 -- (-2441.207) [-2430.391] (-2433.018) (-2442.415) * (-2432.428) [-2437.609] (-2440.680) (-2431.192) -- 0:07:36
141500 -- (-2434.995) (-2434.827) (-2437.859) [-2429.320] * (-2435.386) (-2428.630) (-2441.270) [-2432.263] -- 0:07:35
142000 -- [-2435.612] (-2441.486) (-2433.370) (-2431.035) * (-2430.694) (-2442.817) [-2431.975] (-2427.525) -- 0:07:33
142500 -- (-2445.175) [-2446.038] (-2436.736) (-2430.853) * (-2440.078) (-2428.192) [-2428.579] (-2436.716) -- 0:07:31
143000 -- (-2435.809) (-2433.275) (-2443.309) [-2435.142] * (-2436.394) [-2431.137] (-2434.164) (-2437.962) -- 0:07:35
143500 -- (-2441.104) [-2432.083] (-2436.166) (-2438.139) * [-2435.134] (-2435.760) (-2431.574) (-2446.715) -- 0:07:33
144000 -- [-2425.899] (-2435.452) (-2432.149) (-2438.933) * (-2439.181) [-2438.784] (-2438.078) (-2429.163) -- 0:07:31
144500 -- (-2437.640) (-2439.850) [-2424.647] (-2436.575) * (-2450.150) [-2428.980] (-2438.445) (-2431.497) -- 0:07:29
145000 -- [-2430.199] (-2429.822) (-2436.549) (-2434.951) * (-2447.844) (-2441.636) [-2428.975] (-2431.564) -- 0:07:34
Average standard deviation of split frequencies: 0.023409
145500 -- [-2439.866] (-2437.696) (-2440.322) (-2427.369) * (-2445.571) (-2439.895) [-2432.836] (-2434.353) -- 0:07:32
146000 -- [-2430.543] (-2431.749) (-2437.005) (-2426.719) * (-2445.367) (-2436.309) [-2433.197] (-2438.300) -- 0:07:30
146500 -- (-2434.543) [-2431.479] (-2431.215) (-2432.056) * (-2439.003) (-2445.508) [-2432.710] (-2434.256) -- 0:07:28
147000 -- (-2438.704) (-2434.165) (-2433.163) [-2435.361] * (-2447.739) [-2437.369] (-2431.774) (-2436.583) -- 0:07:32
147500 -- [-2441.264] (-2444.504) (-2437.900) (-2432.469) * (-2429.163) [-2428.860] (-2432.994) (-2430.614) -- 0:07:30
148000 -- [-2434.220] (-2440.525) (-2435.683) (-2438.450) * (-2428.434) [-2433.152] (-2433.623) (-2444.675) -- 0:07:29
148500 -- (-2435.401) [-2429.124] (-2437.515) (-2436.913) * (-2431.673) [-2428.480] (-2432.376) (-2442.384) -- 0:07:27
149000 -- (-2446.062) (-2432.285) (-2433.292) [-2428.700] * [-2435.233] (-2445.533) (-2440.017) (-2445.568) -- 0:07:31
149500 -- (-2436.758) (-2439.768) (-2440.393) [-2443.698] * [-2429.402] (-2443.480) (-2442.475) (-2435.062) -- 0:07:29
150000 -- (-2446.748) (-2437.267) (-2437.776) [-2432.029] * (-2447.731) [-2426.640] (-2443.508) (-2440.095) -- 0:07:27
Average standard deviation of split frequencies: 0.021902
150500 -- (-2448.644) [-2429.663] (-2444.706) (-2430.177) * [-2436.570] (-2428.557) (-2444.523) (-2446.592) -- 0:07:31
151000 -- (-2436.097) (-2440.476) [-2435.336] (-2434.782) * (-2445.688) (-2441.708) (-2438.726) [-2428.243] -- 0:07:29
151500 -- (-2447.667) (-2454.938) [-2437.818] (-2434.249) * (-2433.506) [-2433.565] (-2442.192) (-2428.147) -- 0:07:28
152000 -- (-2443.223) (-2430.552) [-2425.256] (-2444.944) * (-2443.297) [-2433.788] (-2432.714) (-2442.247) -- 0:07:26
152500 -- (-2430.088) [-2430.750] (-2440.880) (-2438.221) * (-2438.243) [-2430.331] (-2433.076) (-2442.833) -- 0:07:30
153000 -- [-2430.071] (-2434.744) (-2436.905) (-2447.252) * (-2428.560) [-2431.569] (-2438.688) (-2438.055) -- 0:07:28
153500 -- [-2428.825] (-2430.638) (-2438.450) (-2449.638) * [-2432.534] (-2437.442) (-2440.860) (-2436.386) -- 0:07:26
154000 -- [-2429.893] (-2441.378) (-2429.875) (-2448.850) * (-2432.329) (-2438.385) (-2428.265) [-2424.900] -- 0:07:24
154500 -- (-2433.521) (-2430.419) (-2429.990) [-2441.754] * [-2433.282] (-2438.631) (-2428.642) (-2431.106) -- 0:07:28
155000 -- [-2432.106] (-2433.334) (-2437.632) (-2437.616) * [-2435.594] (-2439.777) (-2429.833) (-2439.732) -- 0:07:27
Average standard deviation of split frequencies: 0.020020
155500 -- (-2437.827) [-2430.687] (-2440.243) (-2441.878) * (-2431.319) (-2439.680) [-2430.385] (-2436.817) -- 0:07:25
156000 -- (-2426.293) [-2428.932] (-2439.909) (-2441.318) * (-2431.392) [-2437.220] (-2440.190) (-2432.019) -- 0:07:23
156500 -- [-2432.523] (-2436.386) (-2448.873) (-2434.734) * (-2435.872) (-2431.913) (-2444.806) [-2432.518] -- 0:07:27
157000 -- [-2438.525] (-2450.523) (-2438.647) (-2438.702) * (-2443.384) [-2431.851] (-2444.058) (-2446.211) -- 0:07:25
157500 -- [-2430.549] (-2439.248) (-2433.407) (-2433.405) * (-2439.348) (-2439.022) [-2439.228] (-2437.162) -- 0:07:23
158000 -- [-2432.042] (-2446.250) (-2426.952) (-2434.153) * (-2437.671) [-2440.492] (-2445.263) (-2433.846) -- 0:07:27
158500 -- (-2435.081) (-2453.689) [-2429.931] (-2439.296) * (-2438.301) (-2436.714) [-2433.629] (-2432.628) -- 0:07:25
159000 -- (-2433.617) (-2444.267) (-2428.316) [-2428.448] * (-2435.115) (-2436.028) (-2435.703) [-2437.787] -- 0:07:24
159500 -- [-2426.125] (-2442.653) (-2429.813) (-2431.784) * (-2438.239) (-2436.942) [-2431.377] (-2433.337) -- 0:07:22
160000 -- (-2435.577) (-2450.153) [-2430.353] (-2439.676) * (-2429.870) (-2443.112) (-2438.337) [-2441.066] -- 0:07:26
Average standard deviation of split frequencies: 0.020722
160500 -- (-2430.109) [-2434.924] (-2433.870) (-2442.430) * (-2437.072) [-2432.388] (-2434.576) (-2443.788) -- 0:07:24
161000 -- (-2433.263) (-2431.503) [-2425.071] (-2446.007) * (-2437.207) [-2433.722] (-2430.974) (-2435.495) -- 0:07:22
161500 -- (-2433.946) (-2430.656) [-2429.607] (-2432.982) * (-2433.125) (-2440.667) [-2430.952] (-2433.553) -- 0:07:21
162000 -- (-2442.453) (-2439.571) [-2428.751] (-2440.962) * [-2430.673] (-2437.333) (-2434.834) (-2442.906) -- 0:07:24
162500 -- (-2444.918) (-2439.051) [-2430.264] (-2439.384) * [-2430.963] (-2438.866) (-2434.434) (-2442.703) -- 0:07:23
163000 -- (-2429.807) [-2432.590] (-2439.816) (-2445.643) * (-2446.528) [-2430.634] (-2429.830) (-2432.504) -- 0:07:21
163500 -- (-2432.271) [-2432.236] (-2434.324) (-2441.026) * (-2438.984) [-2434.150] (-2435.935) (-2435.962) -- 0:07:19
164000 -- (-2434.839) (-2432.738) [-2428.242] (-2434.224) * (-2440.701) (-2446.426) [-2435.603] (-2444.363) -- 0:07:23
164500 -- (-2433.534) (-2437.566) [-2438.306] (-2436.647) * [-2430.801] (-2437.675) (-2441.301) (-2431.061) -- 0:07:21
165000 -- (-2440.405) (-2429.817) (-2434.249) [-2431.606] * [-2427.727] (-2438.833) (-2444.929) (-2428.853) -- 0:07:20
Average standard deviation of split frequencies: 0.021298
165500 -- (-2427.921) (-2444.726) [-2435.602] (-2436.623) * (-2430.825) (-2448.201) (-2453.417) [-2435.435] -- 0:07:18
166000 -- [-2432.395] (-2432.320) (-2442.034) (-2436.835) * (-2429.701) [-2435.728] (-2445.319) (-2433.336) -- 0:07:22
166500 -- [-2431.921] (-2433.992) (-2439.579) (-2437.441) * (-2435.905) (-2437.934) (-2442.755) [-2426.633] -- 0:07:20
167000 -- [-2432.061] (-2435.426) (-2430.642) (-2435.916) * (-2451.587) (-2443.776) (-2445.973) [-2428.242] -- 0:07:18
167500 -- [-2431.955] (-2445.020) (-2431.403) (-2430.519) * (-2437.180) (-2441.696) (-2436.558) [-2432.190] -- 0:07:22
168000 -- (-2438.725) (-2439.859) [-2430.261] (-2430.951) * [-2430.819] (-2445.484) (-2436.349) (-2436.524) -- 0:07:20
168500 -- (-2438.258) (-2439.525) [-2430.963] (-2436.862) * (-2443.223) (-2437.769) [-2433.653] (-2437.799) -- 0:07:19
169000 -- (-2436.909) (-2435.443) (-2434.465) [-2439.259] * [-2425.557] (-2438.791) (-2433.555) (-2438.876) -- 0:07:17
169500 -- (-2438.934) [-2423.849] (-2440.810) (-2441.215) * (-2429.303) [-2439.540] (-2432.183) (-2430.767) -- 0:07:20
170000 -- (-2450.334) (-2436.200) (-2436.644) [-2436.365] * (-2439.875) (-2436.922) [-2435.929] (-2434.099) -- 0:07:19
Average standard deviation of split frequencies: 0.021234
170500 -- (-2440.176) [-2434.424] (-2436.368) (-2430.130) * (-2442.379) [-2434.011] (-2438.441) (-2439.636) -- 0:07:17
171000 -- (-2437.772) [-2434.053] (-2448.224) (-2432.731) * (-2451.251) (-2435.902) [-2434.496] (-2431.224) -- 0:07:16
171500 -- (-2441.645) (-2436.831) (-2435.087) [-2438.580] * (-2436.886) (-2441.956) (-2428.617) [-2430.623] -- 0:07:19
172000 -- (-2445.387) (-2442.782) [-2427.807] (-2458.162) * (-2434.403) [-2433.293] (-2443.743) (-2435.035) -- 0:07:18
172500 -- (-2439.960) (-2439.771) [-2430.389] (-2432.800) * (-2446.788) (-2431.760) (-2438.699) [-2433.274] -- 0:07:16
173000 -- (-2437.560) (-2435.507) (-2435.953) [-2434.453] * (-2433.430) (-2436.496) [-2432.617] (-2437.661) -- 0:07:15
173500 -- (-2434.429) [-2435.989] (-2448.700) (-2430.655) * (-2429.552) [-2428.854] (-2434.153) (-2438.347) -- 0:07:18
174000 -- (-2434.260) [-2432.030] (-2443.446) (-2437.330) * (-2437.796) [-2429.806] (-2432.108) (-2437.795) -- 0:07:16
174500 -- (-2441.329) [-2435.843] (-2441.666) (-2433.044) * (-2446.044) (-2436.435) [-2433.603] (-2439.353) -- 0:07:15
175000 -- (-2442.207) (-2430.674) (-2452.831) [-2429.162] * (-2433.493) (-2432.028) [-2440.081] (-2435.468) -- 0:07:13
Average standard deviation of split frequencies: 0.021963
175500 -- (-2431.436) (-2435.514) [-2432.258] (-2439.688) * (-2441.001) [-2433.730] (-2437.386) (-2436.211) -- 0:07:16
176000 -- (-2429.605) (-2431.447) [-2435.618] (-2437.474) * [-2433.380] (-2432.510) (-2463.444) (-2432.845) -- 0:07:15
176500 -- (-2440.499) [-2437.536] (-2437.012) (-2435.869) * (-2438.577) (-2434.969) [-2437.746] (-2437.243) -- 0:07:13
177000 -- (-2428.314) (-2440.346) (-2441.543) [-2434.363] * (-2435.142) (-2442.840) [-2435.334] (-2435.738) -- 0:07:17
177500 -- (-2431.186) (-2441.411) (-2456.149) [-2431.287] * [-2427.524] (-2443.765) (-2443.198) (-2432.314) -- 0:07:15
178000 -- [-2439.948] (-2442.162) (-2440.101) (-2436.991) * [-2423.945] (-2433.194) (-2434.678) (-2439.113) -- 0:07:14
178500 -- [-2428.420] (-2438.382) (-2441.503) (-2443.078) * (-2441.734) (-2432.429) (-2432.129) [-2431.845] -- 0:07:12
179000 -- (-2444.502) (-2432.856) (-2438.642) [-2430.624] * (-2433.711) (-2435.028) (-2436.605) [-2428.113] -- 0:07:15
179500 -- (-2428.664) (-2442.335) (-2440.000) [-2437.338] * [-2434.725] (-2445.962) (-2440.476) (-2427.677) -- 0:07:14
180000 -- [-2432.894] (-2454.819) (-2433.250) (-2438.074) * (-2433.014) (-2444.461) [-2428.083] (-2428.330) -- 0:07:12
Average standard deviation of split frequencies: 0.021918
180500 -- (-2433.741) (-2450.351) [-2429.354] (-2440.560) * (-2433.484) (-2438.506) [-2439.345] (-2430.022) -- 0:07:11
181000 -- (-2437.139) (-2437.442) [-2433.580] (-2442.059) * (-2438.753) (-2435.215) (-2445.777) [-2441.850] -- 0:07:14
181500 -- (-2436.274) [-2431.974] (-2456.482) (-2437.000) * (-2434.797) (-2427.774) (-2439.397) [-2434.092] -- 0:07:12
182000 -- (-2436.960) [-2434.964] (-2439.936) (-2443.205) * (-2441.050) (-2441.351) [-2435.282] (-2437.492) -- 0:07:11
182500 -- (-2436.126) [-2435.148] (-2432.730) (-2434.952) * (-2444.370) (-2436.079) [-2430.702] (-2453.602) -- 0:07:10
183000 -- (-2432.653) (-2437.569) (-2433.644) [-2437.732] * (-2436.711) (-2435.604) (-2428.866) [-2429.542] -- 0:07:13
183500 -- [-2443.163] (-2446.975) (-2435.803) (-2436.758) * (-2441.840) [-2433.595] (-2432.509) (-2437.600) -- 0:07:11
184000 -- [-2431.309] (-2444.549) (-2440.923) (-2434.998) * [-2435.272] (-2440.021) (-2434.273) (-2439.596) -- 0:07:10
184500 -- (-2432.905) [-2427.991] (-2452.710) (-2428.113) * (-2432.020) (-2433.904) [-2427.553] (-2432.573) -- 0:07:08
185000 -- [-2433.169] (-2434.621) (-2444.324) (-2430.685) * (-2447.570) [-2431.913] (-2440.310) (-2429.391) -- 0:07:11
Average standard deviation of split frequencies: 0.021543
185500 -- [-2436.533] (-2440.061) (-2447.575) (-2430.105) * (-2432.979) [-2433.818] (-2440.031) (-2440.707) -- 0:07:10
186000 -- (-2433.170) [-2431.422] (-2429.058) (-2439.504) * [-2431.165] (-2432.760) (-2438.498) (-2436.946) -- 0:07:08
186500 -- (-2437.678) [-2436.100] (-2438.381) (-2439.478) * (-2434.644) [-2429.767] (-2436.673) (-2443.328) -- 0:07:11
187000 -- [-2434.450] (-2428.345) (-2439.481) (-2436.118) * (-2442.855) (-2433.047) (-2443.474) [-2438.119] -- 0:07:10
187500 -- (-2444.388) [-2428.566] (-2430.674) (-2448.900) * (-2436.357) [-2436.243] (-2436.122) (-2436.098) -- 0:07:09
188000 -- [-2434.633] (-2436.982) (-2435.333) (-2442.439) * (-2444.613) (-2436.190) (-2433.540) [-2430.308] -- 0:07:07
188500 -- (-2446.102) (-2432.962) (-2452.092) [-2434.353] * [-2430.399] (-2443.155) (-2428.123) (-2433.415) -- 0:07:10
189000 -- (-2450.503) (-2437.099) (-2435.798) [-2433.919] * (-2440.272) [-2427.276] (-2434.873) (-2428.028) -- 0:07:09
189500 -- (-2438.438) [-2431.807] (-2440.600) (-2439.375) * [-2428.955] (-2425.313) (-2439.133) (-2439.705) -- 0:07:07
190000 -- (-2429.224) (-2436.657) [-2424.610] (-2439.053) * (-2436.843) [-2434.913] (-2439.051) (-2444.827) -- 0:07:06
Average standard deviation of split frequencies: 0.019161
190500 -- [-2426.686] (-2439.793) (-2440.804) (-2440.811) * (-2438.967) (-2432.421) (-2449.656) [-2433.839] -- 0:07:09
191000 -- (-2436.970) [-2430.382] (-2431.594) (-2433.339) * (-2437.698) (-2436.275) (-2433.691) [-2425.223] -- 0:07:07
191500 -- (-2439.173) (-2434.507) [-2431.298] (-2432.476) * (-2443.848) (-2438.732) [-2442.804] (-2436.802) -- 0:07:06
192000 -- [-2430.223] (-2430.840) (-2439.287) (-2438.040) * (-2445.495) (-2435.981) (-2446.280) [-2434.077] -- 0:07:05
192500 -- [-2424.739] (-2432.061) (-2439.100) (-2443.303) * (-2435.132) (-2428.380) [-2431.453] (-2442.320) -- 0:07:07
193000 -- (-2432.099) (-2433.722) [-2427.200] (-2431.894) * (-2430.434) (-2435.194) (-2436.665) [-2437.398] -- 0:07:06
193500 -- (-2434.810) (-2435.275) [-2429.998] (-2436.447) * (-2438.008) [-2427.834] (-2428.582) (-2436.119) -- 0:07:05
194000 -- (-2436.446) (-2435.291) (-2435.618) [-2425.619] * (-2432.010) (-2444.939) [-2428.977] (-2442.069) -- 0:07:03
194500 -- (-2435.356) [-2433.337] (-2437.927) (-2438.627) * [-2428.712] (-2441.703) (-2437.544) (-2434.899) -- 0:07:06
195000 -- [-2429.742] (-2439.677) (-2431.303) (-2431.258) * (-2427.047) (-2434.205) [-2431.661] (-2438.454) -- 0:07:05
Average standard deviation of split frequencies: 0.017137
195500 -- (-2440.628) (-2428.762) [-2431.062] (-2438.145) * [-2429.262] (-2442.356) (-2439.527) (-2436.027) -- 0:07:03
196000 -- (-2427.553) [-2430.017] (-2433.147) (-2447.007) * (-2437.310) (-2436.876) [-2430.716] (-2435.138) -- 0:07:02
196500 -- (-2440.537) (-2429.846) (-2444.234) [-2429.211] * [-2428.898] (-2432.438) (-2439.531) (-2435.389) -- 0:07:05
197000 -- (-2436.113) [-2428.305] (-2433.075) (-2439.491) * (-2438.141) (-2427.395) [-2430.240] (-2436.166) -- 0:07:03
197500 -- (-2433.542) [-2435.360] (-2439.014) (-2438.137) * (-2431.461) (-2439.449) (-2428.612) [-2438.781] -- 0:07:02
198000 -- [-2432.865] (-2430.933) (-2448.926) (-2435.737) * (-2429.441) (-2432.809) [-2435.260] (-2438.176) -- 0:07:05
198500 -- (-2440.378) [-2428.242] (-2433.449) (-2432.577) * (-2429.754) (-2432.640) (-2434.045) [-2438.127] -- 0:07:03
199000 -- (-2436.902) [-2433.278] (-2429.365) (-2430.577) * (-2443.253) (-2436.552) (-2429.694) [-2438.702] -- 0:07:02
199500 -- (-2432.662) (-2437.653) (-2428.235) [-2442.058] * [-2431.809] (-2435.136) (-2429.911) (-2443.306) -- 0:07:01
200000 -- (-2432.969) (-2437.946) [-2427.716] (-2444.542) * (-2439.041) (-2434.154) [-2436.396] (-2446.198) -- 0:07:04
Average standard deviation of split frequencies: 0.017913
200500 -- (-2434.797) (-2446.342) (-2437.329) [-2437.866] * [-2433.548] (-2434.855) (-2432.990) (-2438.713) -- 0:07:02
201000 -- [-2429.258] (-2438.710) (-2429.331) (-2443.393) * (-2435.343) (-2435.281) [-2434.075] (-2438.930) -- 0:07:01
201500 -- (-2433.041) [-2428.330] (-2429.572) (-2440.580) * (-2441.435) [-2435.865] (-2439.982) (-2432.197) -- 0:07:00
202000 -- (-2429.696) (-2436.304) [-2435.239] (-2433.506) * [-2435.360] (-2436.340) (-2447.874) (-2440.352) -- 0:07:02
202500 -- [-2440.968] (-2438.665) (-2447.163) (-2435.432) * (-2441.692) (-2441.172) (-2446.749) [-2434.465] -- 0:07:01
203000 -- (-2435.294) [-2428.388] (-2436.045) (-2436.469) * (-2444.018) (-2431.208) [-2428.915] (-2429.965) -- 0:07:00
203500 -- (-2429.114) (-2429.373) (-2439.352) [-2437.288] * [-2443.021] (-2434.229) (-2435.919) (-2443.927) -- 0:06:58
204000 -- (-2445.762) (-2436.676) [-2432.770] (-2444.321) * (-2434.426) (-2436.720) (-2448.732) [-2438.130] -- 0:07:01
204500 -- (-2423.761) [-2428.394] (-2447.048) (-2431.521) * (-2433.003) (-2434.674) [-2435.600] (-2428.284) -- 0:07:00
205000 -- (-2432.156) [-2429.443] (-2430.991) (-2439.651) * (-2431.031) (-2439.819) (-2433.971) [-2432.051] -- 0:06:58
Average standard deviation of split frequencies: 0.016019
205500 -- [-2437.571] (-2428.317) (-2442.349) (-2437.844) * (-2430.745) (-2430.609) [-2442.658] (-2431.595) -- 0:06:57
206000 -- [-2441.195] (-2433.614) (-2438.329) (-2436.528) * (-2439.209) (-2433.714) [-2424.972] (-2440.908) -- 0:07:00
206500 -- (-2438.172) (-2437.690) [-2431.804] (-2432.628) * (-2429.081) [-2432.621] (-2432.330) (-2440.440) -- 0:06:58
207000 -- [-2425.466] (-2446.127) (-2430.040) (-2440.621) * (-2437.400) [-2432.774] (-2426.501) (-2443.291) -- 0:06:57
207500 -- (-2434.976) [-2431.427] (-2438.371) (-2427.093) * (-2437.083) (-2441.705) (-2427.746) [-2442.253] -- 0:07:00
208000 -- [-2432.556] (-2427.094) (-2443.879) (-2432.238) * (-2432.373) (-2441.640) (-2429.615) [-2426.337] -- 0:06:58
208500 -- (-2433.228) [-2428.431] (-2435.880) (-2436.489) * (-2440.179) (-2452.065) (-2437.783) [-2428.604] -- 0:06:57
209000 -- (-2434.541) [-2429.902] (-2437.617) (-2432.358) * (-2436.002) (-2438.346) [-2441.620] (-2436.266) -- 0:06:56
209500 -- (-2433.294) (-2428.283) [-2429.765] (-2436.947) * [-2438.726] (-2436.960) (-2437.757) (-2426.820) -- 0:06:58
210000 -- (-2438.562) [-2431.143] (-2435.397) (-2433.721) * (-2446.065) (-2435.551) [-2432.676] (-2429.841) -- 0:06:57
Average standard deviation of split frequencies: 0.015524
210500 -- (-2433.516) (-2443.039) [-2433.422] (-2431.664) * (-2445.721) (-2431.524) [-2437.749] (-2436.111) -- 0:06:56
211000 -- [-2428.814] (-2467.091) (-2437.738) (-2448.625) * (-2440.659) (-2444.241) (-2433.669) [-2438.412] -- 0:06:55
211500 -- (-2433.251) (-2445.507) (-2434.358) [-2439.908] * [-2431.712] (-2437.831) (-2435.163) (-2436.300) -- 0:06:57
212000 -- (-2432.270) [-2435.202] (-2437.532) (-2438.256) * (-2437.604) [-2441.636] (-2436.991) (-2428.833) -- 0:06:56
212500 -- (-2436.948) (-2435.606) [-2431.685] (-2430.016) * (-2429.114) [-2432.320] (-2431.379) (-2435.957) -- 0:06:55
213000 -- (-2439.386) (-2444.645) [-2434.403] (-2438.928) * [-2437.850] (-2442.989) (-2436.023) (-2436.702) -- 0:06:53
213500 -- (-2437.507) [-2432.841] (-2437.362) (-2427.848) * (-2434.780) [-2428.892] (-2438.663) (-2429.370) -- 0:06:56
214000 -- [-2430.532] (-2438.190) (-2433.677) (-2425.040) * (-2434.970) (-2447.692) [-2429.156] (-2447.234) -- 0:06:55
214500 -- (-2442.224) [-2436.161] (-2431.913) (-2431.691) * [-2435.747] (-2436.490) (-2429.128) (-2434.196) -- 0:06:53
215000 -- (-2448.530) [-2430.583] (-2437.725) (-2432.315) * (-2435.675) (-2432.007) (-2432.392) [-2431.760] -- 0:06:52
Average standard deviation of split frequencies: 0.016232
215500 -- (-2439.145) [-2435.861] (-2437.901) (-2439.218) * [-2440.154] (-2437.714) (-2433.306) (-2455.278) -- 0:06:55
216000 -- (-2453.130) (-2432.819) [-2437.235] (-2431.800) * (-2453.603) [-2446.692] (-2440.408) (-2437.719) -- 0:06:53
216500 -- (-2469.153) (-2442.953) [-2440.871] (-2440.921) * (-2445.820) (-2443.295) (-2437.915) [-2428.350] -- 0:06:52
217000 -- (-2449.734) (-2437.019) [-2434.535] (-2437.500) * (-2436.875) (-2431.918) [-2440.900] (-2431.089) -- 0:06:51
217500 -- (-2436.172) [-2426.069] (-2440.552) (-2428.389) * (-2441.582) (-2438.285) [-2436.445] (-2434.897) -- 0:06:53
218000 -- (-2431.250) [-2430.709] (-2428.796) (-2439.037) * [-2433.308] (-2437.921) (-2438.839) (-2434.392) -- 0:06:52
218500 -- [-2429.498] (-2436.244) (-2433.062) (-2434.507) * [-2434.057] (-2430.510) (-2433.392) (-2432.470) -- 0:06:51
219000 -- [-2434.135] (-2441.879) (-2438.277) (-2435.986) * (-2442.485) (-2441.376) (-2449.676) [-2426.975] -- 0:06:53
219500 -- (-2444.467) (-2427.117) (-2436.633) [-2431.033] * (-2442.959) (-2437.855) [-2426.048] (-2446.609) -- 0:06:52
220000 -- [-2428.861] (-2434.846) (-2433.102) (-2446.466) * (-2432.460) (-2439.201) [-2433.735] (-2435.136) -- 0:06:51
Average standard deviation of split frequencies: 0.015087
220500 -- (-2427.746) (-2433.160) [-2425.810] (-2437.376) * (-2438.882) [-2432.925] (-2435.495) (-2432.003) -- 0:06:50
221000 -- (-2432.876) [-2432.404] (-2439.167) (-2440.839) * (-2455.437) (-2437.499) [-2431.725] (-2436.016) -- 0:06:52
221500 -- (-2428.983) (-2433.193) (-2440.407) [-2443.596] * (-2447.159) (-2438.297) (-2427.370) [-2440.822] -- 0:06:51
222000 -- [-2438.498] (-2427.597) (-2450.793) (-2443.241) * (-2436.873) (-2446.828) [-2429.440] (-2436.710) -- 0:06:50
222500 -- (-2430.138) [-2442.991] (-2436.738) (-2438.368) * [-2434.903] (-2443.783) (-2433.249) (-2439.687) -- 0:06:48
223000 -- [-2434.784] (-2430.749) (-2436.358) (-2440.466) * (-2441.234) (-2454.165) [-2432.520] (-2439.131) -- 0:06:51
223500 -- [-2428.988] (-2429.116) (-2432.571) (-2436.233) * [-2433.345] (-2451.062) (-2437.126) (-2443.432) -- 0:06:49
224000 -- (-2427.559) (-2441.812) [-2428.359] (-2441.530) * (-2435.091) (-2432.716) [-2434.556] (-2440.827) -- 0:06:48
224500 -- (-2433.899) [-2434.337] (-2434.852) (-2440.606) * [-2437.579] (-2428.899) (-2437.495) (-2442.137) -- 0:06:47
225000 -- [-2429.902] (-2438.363) (-2435.605) (-2438.313) * (-2441.128) [-2429.055] (-2434.388) (-2435.774) -- 0:06:49
Average standard deviation of split frequencies: 0.015253
225500 -- (-2437.369) (-2439.898) (-2444.814) [-2433.625] * [-2435.257] (-2431.417) (-2435.875) (-2439.365) -- 0:06:48
226000 -- (-2441.306) [-2429.868] (-2440.439) (-2441.733) * (-2430.863) (-2432.288) (-2444.108) [-2437.914] -- 0:06:47
226500 -- [-2435.238] (-2431.645) (-2444.910) (-2433.898) * (-2430.544) (-2436.977) (-2447.345) [-2432.360] -- 0:06:46
227000 -- (-2438.901) (-2424.378) (-2437.986) [-2428.396] * [-2444.806] (-2438.604) (-2435.159) (-2435.514) -- 0:06:48
227500 -- [-2439.153] (-2428.698) (-2438.543) (-2435.457) * (-2438.818) (-2438.492) [-2434.051] (-2437.003) -- 0:06:47
228000 -- (-2430.953) (-2439.800) (-2447.130) [-2431.655] * [-2436.803] (-2442.861) (-2440.047) (-2431.887) -- 0:06:46
228500 -- (-2432.807) (-2439.042) (-2438.281) [-2435.163] * (-2424.195) (-2432.575) (-2433.904) [-2436.402] -- 0:06:48
229000 -- (-2435.605) [-2429.030] (-2437.698) (-2446.163) * (-2437.810) [-2434.141] (-2441.209) (-2437.699) -- 0:06:47
229500 -- (-2428.907) (-2437.057) (-2437.746) [-2432.732] * (-2432.784) [-2426.761] (-2437.629) (-2434.352) -- 0:06:46
230000 -- [-2433.429] (-2433.141) (-2445.523) (-2430.597) * [-2432.943] (-2441.925) (-2443.699) (-2437.169) -- 0:06:45
Average standard deviation of split frequencies: 0.017243
230500 -- (-2434.380) (-2434.564) (-2434.353) [-2427.361] * [-2429.221] (-2434.774) (-2433.725) (-2437.540) -- 0:06:47
231000 -- [-2427.133] (-2446.195) (-2435.910) (-2434.148) * (-2439.883) (-2445.316) [-2438.079] (-2437.863) -- 0:06:46
231500 -- (-2434.388) (-2432.493) (-2432.916) [-2434.379] * [-2429.768] (-2447.947) (-2434.166) (-2436.415) -- 0:06:44
232000 -- (-2439.843) (-2444.296) [-2427.866] (-2430.363) * (-2439.806) (-2436.745) [-2427.636] (-2441.124) -- 0:06:43
232500 -- (-2439.661) (-2441.971) [-2433.779] (-2435.268) * [-2437.584] (-2435.762) (-2433.722) (-2443.765) -- 0:06:46
233000 -- (-2437.753) (-2430.812) (-2427.421) [-2429.885] * [-2437.332] (-2449.256) (-2435.975) (-2440.233) -- 0:06:44
233500 -- (-2435.225) (-2442.617) [-2438.555] (-2435.708) * (-2436.737) (-2448.618) (-2435.549) [-2432.960] -- 0:06:43
234000 -- (-2434.806) [-2434.547] (-2434.016) (-2432.307) * (-2435.781) [-2439.707] (-2436.849) (-2437.343) -- 0:06:42
234500 -- (-2433.340) (-2429.438) [-2427.699] (-2427.911) * (-2439.754) (-2440.468) [-2435.915] (-2427.279) -- 0:06:44
235000 -- (-2433.397) [-2428.565] (-2442.588) (-2432.436) * (-2430.160) (-2443.457) [-2426.362] (-2440.446) -- 0:06:43
Average standard deviation of split frequencies: 0.021348
235500 -- [-2439.026] (-2445.961) (-2429.006) (-2431.658) * (-2434.987) (-2438.561) [-2446.260] (-2434.839) -- 0:06:42
236000 -- [-2431.084] (-2434.289) (-2431.895) (-2439.171) * (-2430.348) (-2435.556) [-2433.391] (-2432.745) -- 0:06:41
236500 -- (-2429.442) [-2426.625] (-2433.595) (-2440.749) * (-2433.909) (-2444.790) (-2436.592) [-2439.463] -- 0:06:43
237000 -- (-2445.992) (-2429.761) (-2439.099) [-2428.390] * (-2439.330) (-2445.110) [-2438.324] (-2435.207) -- 0:06:42
237500 -- (-2441.954) (-2434.566) (-2434.896) [-2431.402] * (-2430.472) (-2445.817) [-2440.587] (-2446.629) -- 0:06:41
238000 -- (-2439.577) [-2437.793] (-2436.893) (-2431.528) * (-2438.882) (-2445.680) (-2442.125) [-2432.135] -- 0:06:43
238500 -- (-2447.883) (-2435.740) [-2434.445] (-2433.360) * [-2434.416] (-2443.351) (-2445.365) (-2430.377) -- 0:06:42
239000 -- (-2449.407) [-2438.689] (-2439.365) (-2436.182) * [-2430.966] (-2443.452) (-2433.890) (-2440.796) -- 0:06:41
239500 -- (-2441.745) [-2435.209] (-2431.512) (-2444.728) * (-2431.211) (-2435.340) [-2437.634] (-2445.537) -- 0:06:40
240000 -- [-2437.845] (-2431.800) (-2431.234) (-2445.376) * (-2436.940) (-2432.279) [-2427.951] (-2442.946) -- 0:06:42
Average standard deviation of split frequencies: 0.023966
240500 -- (-2436.988) (-2434.658) (-2443.619) [-2427.021] * (-2446.495) (-2432.999) [-2432.878] (-2431.196) -- 0:06:41
241000 -- (-2435.562) (-2435.542) (-2445.116) [-2432.240] * (-2434.526) (-2428.613) [-2424.270] (-2434.596) -- 0:06:39
241500 -- (-2435.212) (-2441.353) [-2437.727] (-2437.655) * [-2434.477] (-2434.898) (-2432.466) (-2437.936) -- 0:06:38
242000 -- (-2434.383) (-2439.231) [-2439.278] (-2428.238) * (-2441.641) (-2438.612) (-2444.369) [-2435.468] -- 0:06:40
242500 -- (-2434.546) (-2438.900) (-2438.823) [-2430.586] * [-2433.841] (-2434.493) (-2452.159) (-2429.472) -- 0:06:39
243000 -- [-2431.018] (-2440.407) (-2441.391) (-2452.336) * [-2436.520] (-2429.798) (-2449.290) (-2435.821) -- 0:06:38
243500 -- (-2446.204) (-2445.232) (-2428.526) [-2434.080] * (-2435.118) [-2436.360] (-2428.645) (-2443.177) -- 0:06:37
244000 -- (-2442.913) (-2446.656) [-2434.987] (-2440.420) * [-2435.776] (-2433.229) (-2437.613) (-2436.203) -- 0:06:39
244500 -- (-2444.700) (-2437.096) (-2443.119) [-2437.257] * (-2437.741) [-2438.069] (-2435.724) (-2433.685) -- 0:06:38
245000 -- (-2431.374) [-2432.423] (-2427.350) (-2435.720) * [-2437.867] (-2439.483) (-2437.583) (-2432.415) -- 0:06:37
Average standard deviation of split frequencies: 0.021755
245500 -- (-2432.013) (-2435.511) (-2441.079) [-2434.442] * (-2437.505) (-2427.027) (-2445.565) [-2429.269] -- 0:06:36
246000 -- (-2434.719) (-2445.073) (-2441.975) [-2423.962] * (-2444.286) [-2440.436] (-2436.691) (-2432.579) -- 0:06:38
246500 -- (-2426.511) (-2443.245) [-2430.837] (-2435.374) * (-2444.274) (-2436.160) [-2436.103] (-2439.388) -- 0:06:37
247000 -- [-2433.405] (-2430.804) (-2430.498) (-2440.195) * (-2447.041) (-2440.075) [-2427.860] (-2439.473) -- 0:06:36
247500 -- [-2430.556] (-2436.452) (-2430.311) (-2435.339) * (-2437.054) (-2438.441) (-2440.736) [-2432.054] -- 0:06:38
248000 -- (-2437.694) (-2440.360) [-2435.072] (-2425.877) * (-2435.054) (-2431.099) (-2439.344) [-2429.311] -- 0:06:37
248500 -- (-2445.500) (-2437.039) [-2430.455] (-2433.448) * (-2430.605) (-2442.933) (-2431.749) [-2434.591] -- 0:06:36
249000 -- (-2435.588) (-2439.799) (-2436.392) [-2436.265] * [-2428.048] (-2444.679) (-2436.752) (-2427.159) -- 0:06:35
249500 -- (-2438.518) [-2428.776] (-2441.105) (-2442.198) * (-2424.289) [-2432.239] (-2436.957) (-2432.073) -- 0:06:37
250000 -- (-2437.898) (-2434.306) [-2432.605] (-2456.674) * (-2427.199) [-2437.020] (-2432.691) (-2438.552) -- 0:06:36
Average standard deviation of split frequencies: 0.021129
250500 -- [-2431.351] (-2441.638) (-2441.576) (-2436.086) * [-2434.812] (-2432.783) (-2428.979) (-2434.897) -- 0:06:34
251000 -- [-2429.041] (-2437.638) (-2431.864) (-2440.298) * (-2426.826) [-2440.396] (-2446.108) (-2440.013) -- 0:06:33
251500 -- (-2434.884) [-2428.260] (-2437.483) (-2433.352) * (-2435.024) [-2434.492] (-2439.187) (-2429.684) -- 0:06:35
252000 -- (-2438.209) (-2429.609) (-2443.514) [-2430.192] * (-2432.922) (-2426.799) (-2435.400) [-2436.136] -- 0:06:34
252500 -- (-2431.754) (-2435.496) [-2428.695] (-2431.693) * (-2432.775) (-2431.403) [-2438.965] (-2434.249) -- 0:06:33
253000 -- (-2431.911) (-2440.002) (-2430.146) [-2438.106] * (-2445.750) (-2425.812) (-2436.705) [-2429.890] -- 0:06:32
253500 -- (-2438.120) (-2443.221) (-2438.698) [-2438.465] * [-2437.303] (-2425.660) (-2437.072) (-2423.041) -- 0:06:34
254000 -- (-2437.933) [-2436.996] (-2433.278) (-2439.755) * (-2445.724) [-2440.060] (-2433.602) (-2433.078) -- 0:06:33
254500 -- (-2432.612) [-2430.343] (-2429.236) (-2433.297) * (-2437.995) (-2437.085) [-2425.565] (-2441.592) -- 0:06:32
255000 -- (-2433.611) (-2443.357) (-2442.887) [-2429.107] * (-2445.697) (-2438.994) [-2425.590] (-2431.342) -- 0:06:31
Average standard deviation of split frequencies: 0.020601
255500 -- (-2455.276) [-2433.231] (-2436.208) (-2448.444) * (-2435.125) (-2443.385) [-2427.276] (-2442.877) -- 0:06:33
256000 -- (-2434.088) [-2436.144] (-2452.293) (-2433.842) * [-2441.527] (-2442.472) (-2443.681) (-2445.980) -- 0:06:32
256500 -- (-2428.741) (-2436.027) (-2445.368) [-2438.777] * (-2431.223) [-2436.816] (-2436.595) (-2428.124) -- 0:06:31
257000 -- [-2434.362] (-2439.844) (-2435.913) (-2430.751) * (-2432.952) (-2447.840) (-2438.754) [-2432.254] -- 0:06:33
257500 -- (-2436.807) (-2454.555) (-2438.946) [-2429.750] * (-2435.242) (-2441.044) (-2432.915) [-2432.979] -- 0:06:32
258000 -- (-2440.106) [-2433.273] (-2441.890) (-2432.111) * [-2426.793] (-2438.245) (-2437.017) (-2434.203) -- 0:06:31
258500 -- (-2441.767) (-2443.108) [-2443.058] (-2446.425) * (-2434.578) (-2437.006) (-2434.835) [-2423.387] -- 0:06:30
259000 -- [-2433.991] (-2431.859) (-2445.612) (-2441.130) * (-2430.556) (-2438.750) (-2442.750) [-2438.163] -- 0:06:31
259500 -- (-2436.465) (-2437.129) (-2430.682) [-2430.338] * (-2433.631) (-2439.882) [-2433.926] (-2430.504) -- 0:06:30
260000 -- (-2430.826) (-2427.862) (-2442.574) [-2430.403] * [-2423.829] (-2437.880) (-2435.100) (-2430.184) -- 0:06:29
Average standard deviation of split frequencies: 0.021588
260500 -- (-2442.312) (-2431.445) (-2440.505) [-2437.421] * (-2429.916) (-2432.597) [-2424.736] (-2436.223) -- 0:06:28
261000 -- (-2437.402) (-2438.637) (-2436.265) [-2435.176] * (-2440.012) [-2431.827] (-2445.842) (-2438.276) -- 0:06:30
261500 -- [-2424.543] (-2436.680) (-2437.115) (-2437.176) * [-2425.110] (-2440.753) (-2442.009) (-2436.924) -- 0:06:29
262000 -- [-2450.426] (-2439.305) (-2431.608) (-2443.065) * (-2433.802) (-2439.923) (-2441.181) [-2430.701] -- 0:06:28
262500 -- (-2436.340) [-2437.421] (-2434.383) (-2436.585) * (-2438.560) (-2435.268) [-2436.260] (-2435.379) -- 0:06:27
263000 -- (-2437.495) (-2431.985) (-2446.840) [-2440.615] * (-2426.709) (-2442.078) (-2432.749) [-2435.534] -- 0:06:29
263500 -- (-2435.079) [-2432.431] (-2438.996) (-2439.466) * (-2429.138) [-2442.661] (-2436.784) (-2434.903) -- 0:06:28
264000 -- [-2428.917] (-2438.465) (-2439.883) (-2428.697) * [-2430.396] (-2448.901) (-2433.814) (-2443.309) -- 0:06:27
264500 -- (-2427.679) (-2425.577) [-2430.916] (-2444.586) * (-2438.075) [-2431.167] (-2435.097) (-2441.658) -- 0:06:26
265000 -- [-2429.709] (-2438.541) (-2426.427) (-2433.625) * (-2445.019) (-2431.802) (-2427.343) [-2434.741] -- 0:06:28
Average standard deviation of split frequencies: 0.021156
265500 -- [-2438.693] (-2446.645) (-2433.520) (-2433.080) * (-2437.229) [-2438.198] (-2431.990) (-2435.314) -- 0:06:27
266000 -- (-2436.887) [-2433.473] (-2436.432) (-2447.012) * (-2438.291) [-2432.509] (-2436.998) (-2448.703) -- 0:06:26
266500 -- [-2438.855] (-2446.151) (-2441.886) (-2441.277) * (-2444.015) (-2432.428) [-2432.702] (-2433.533) -- 0:06:28
267000 -- (-2433.306) (-2440.927) [-2430.324] (-2436.017) * [-2432.214] (-2446.064) (-2446.027) (-2435.552) -- 0:06:27
267500 -- (-2438.179) [-2435.510] (-2431.144) (-2441.346) * (-2433.524) [-2436.652] (-2430.211) (-2442.323) -- 0:06:26
268000 -- (-2430.084) (-2437.177) [-2432.793] (-2439.874) * [-2434.441] (-2434.241) (-2429.859) (-2435.866) -- 0:06:25
268500 -- [-2432.075] (-2426.705) (-2444.261) (-2436.831) * (-2443.982) (-2432.259) (-2428.517) [-2433.706] -- 0:06:26
269000 -- (-2436.716) [-2432.798] (-2434.650) (-2433.052) * [-2437.144] (-2437.121) (-2431.881) (-2438.188) -- 0:06:25
269500 -- [-2434.472] (-2440.374) (-2433.339) (-2447.688) * [-2428.969] (-2439.415) (-2448.623) (-2441.363) -- 0:06:24
270000 -- [-2435.444] (-2440.646) (-2436.154) (-2437.807) * (-2434.736) [-2427.524] (-2442.163) (-2434.532) -- 0:06:23
Average standard deviation of split frequencies: 0.018287
270500 -- [-2429.349] (-2442.760) (-2439.455) (-2441.785) * (-2428.166) [-2437.884] (-2434.148) (-2435.684) -- 0:06:25
271000 -- (-2437.497) (-2443.416) (-2450.662) [-2433.550] * (-2427.880) [-2429.825] (-2432.497) (-2434.821) -- 0:06:24
271500 -- (-2433.783) (-2434.622) (-2443.771) [-2431.103] * (-2428.351) (-2435.703) [-2432.370] (-2434.734) -- 0:06:23
272000 -- [-2438.091] (-2438.977) (-2442.287) (-2432.278) * (-2436.525) (-2435.785) [-2440.670] (-2424.593) -- 0:06:22
272500 -- (-2436.777) (-2441.811) (-2447.394) [-2434.708] * (-2427.197) [-2430.927] (-2442.366) (-2432.555) -- 0:06:24
273000 -- (-2445.625) [-2432.489] (-2438.141) (-2435.198) * [-2432.353] (-2431.036) (-2439.130) (-2444.491) -- 0:06:23
273500 -- (-2437.087) (-2438.122) [-2432.476] (-2434.269) * (-2442.824) (-2430.162) (-2432.118) [-2429.453] -- 0:06:22
274000 -- (-2438.557) [-2438.526] (-2439.584) (-2432.623) * [-2428.410] (-2440.656) (-2443.344) (-2429.659) -- 0:06:21
274500 -- [-2431.720] (-2439.983) (-2433.841) (-2444.305) * (-2427.753) [-2432.840] (-2439.761) (-2438.097) -- 0:06:23
275000 -- (-2433.305) (-2439.024) [-2439.246] (-2434.313) * (-2432.591) [-2429.913] (-2435.811) (-2439.710) -- 0:06:22
Average standard deviation of split frequencies: 0.016283
275500 -- (-2437.228) [-2427.594] (-2442.421) (-2434.198) * (-2435.672) [-2431.921] (-2443.840) (-2444.707) -- 0:06:21
276000 -- [-2427.661] (-2441.388) (-2433.083) (-2434.612) * (-2441.809) (-2441.104) (-2439.230) [-2426.834] -- 0:06:22
276500 -- (-2427.998) [-2431.592] (-2434.908) (-2442.088) * [-2436.730] (-2431.854) (-2434.315) (-2436.759) -- 0:06:22
277000 -- (-2441.184) [-2435.965] (-2434.731) (-2439.182) * (-2431.959) (-2435.702) [-2432.359] (-2434.669) -- 0:06:21
277500 -- (-2431.986) (-2434.716) (-2436.209) [-2434.043] * [-2434.987] (-2430.443) (-2441.295) (-2443.389) -- 0:06:20
278000 -- (-2432.827) (-2426.329) [-2448.115] (-2436.941) * (-2439.794) (-2448.348) (-2443.488) [-2428.882] -- 0:06:21
278500 -- [-2431.455] (-2436.634) (-2438.922) (-2438.351) * (-2429.959) [-2432.619] (-2432.273) (-2427.204) -- 0:06:20
279000 -- (-2442.608) (-2427.956) (-2431.499) [-2430.507] * (-2440.326) (-2427.336) [-2435.795] (-2436.212) -- 0:06:19
279500 -- (-2434.726) (-2434.167) [-2429.773] (-2428.266) * (-2425.519) [-2429.143] (-2442.124) (-2451.342) -- 0:06:18
280000 -- (-2434.257) (-2443.273) (-2437.797) [-2426.435] * [-2434.205] (-2432.680) (-2442.761) (-2439.351) -- 0:06:20
Average standard deviation of split frequencies: 0.015676
280500 -- (-2442.141) (-2452.574) (-2442.212) [-2432.706] * [-2432.820] (-2441.685) (-2441.100) (-2441.544) -- 0:06:19
281000 -- [-2422.561] (-2440.456) (-2437.365) (-2432.818) * (-2434.012) (-2439.430) [-2437.308] (-2442.898) -- 0:06:18
281500 -- (-2429.975) (-2434.786) (-2435.776) [-2431.161] * (-2433.489) (-2444.493) [-2433.451] (-2436.128) -- 0:06:20
282000 -- (-2428.908) (-2443.305) (-2437.585) [-2444.141] * (-2434.844) (-2435.921) [-2438.321] (-2437.290) -- 0:06:19
282500 -- (-2436.825) [-2431.148] (-2439.023) (-2429.969) * (-2432.587) (-2427.609) (-2439.921) [-2434.864] -- 0:06:18
283000 -- (-2433.565) (-2435.030) [-2434.597] (-2431.672) * (-2442.941) (-2438.254) (-2430.380) [-2430.873] -- 0:06:17
283500 -- (-2437.059) [-2436.977] (-2434.615) (-2435.991) * [-2441.568] (-2437.402) (-2445.051) (-2430.474) -- 0:06:19
284000 -- (-2439.158) [-2428.534] (-2436.890) (-2437.357) * (-2431.549) [-2434.472] (-2443.391) (-2431.371) -- 0:06:18
284500 -- [-2431.551] (-2434.128) (-2443.264) (-2437.957) * (-2426.528) [-2430.900] (-2439.800) (-2433.896) -- 0:06:17
285000 -- [-2429.258] (-2451.327) (-2438.787) (-2431.881) * [-2429.296] (-2434.325) (-2441.850) (-2442.483) -- 0:06:16
Average standard deviation of split frequencies: 0.015762
285500 -- (-2434.911) (-2435.673) (-2434.057) [-2438.458] * [-2424.494] (-2431.095) (-2432.934) (-2438.705) -- 0:06:17
286000 -- [-2434.464] (-2450.873) (-2442.916) (-2432.264) * [-2431.045] (-2439.367) (-2437.739) (-2438.900) -- 0:06:16
286500 -- (-2438.640) (-2442.492) (-2438.798) [-2435.340] * (-2446.722) (-2440.183) [-2428.993] (-2443.940) -- 0:06:16
287000 -- (-2447.041) (-2440.821) [-2431.725] (-2438.116) * [-2430.766] (-2444.889) (-2432.605) (-2441.763) -- 0:06:15
287500 -- (-2434.654) (-2442.846) [-2438.129] (-2448.017) * (-2440.929) [-2427.104] (-2432.719) (-2432.001) -- 0:06:16
288000 -- (-2437.825) (-2434.288) (-2444.711) [-2437.862] * (-2437.077) (-2428.385) (-2433.042) [-2433.377] -- 0:06:15
288500 -- (-2437.804) [-2430.791] (-2439.371) (-2442.574) * (-2437.320) (-2435.932) (-2447.462) [-2434.022] -- 0:06:14
289000 -- (-2426.016) [-2431.319] (-2440.052) (-2428.851) * [-2436.481] (-2434.451) (-2435.357) (-2434.363) -- 0:06:13
289500 -- (-2442.357) [-2440.515] (-2440.906) (-2430.986) * [-2427.708] (-2439.534) (-2430.704) (-2443.774) -- 0:06:15
290000 -- [-2426.227] (-2425.442) (-2428.242) (-2429.546) * [-2434.160] (-2441.767) (-2440.764) (-2434.356) -- 0:06:14
Average standard deviation of split frequencies: 0.016110
290500 -- [-2429.885] (-2438.948) (-2433.699) (-2435.987) * [-2438.146] (-2428.968) (-2438.375) (-2436.989) -- 0:06:13
291000 -- (-2432.592) (-2435.704) [-2438.132] (-2436.903) * (-2432.026) [-2431.203] (-2431.324) (-2442.527) -- 0:06:15
291500 -- [-2437.431] (-2442.562) (-2443.069) (-2432.514) * (-2429.148) [-2442.496] (-2452.556) (-2440.798) -- 0:06:14
292000 -- (-2435.109) [-2428.910] (-2435.808) (-2429.292) * (-2439.042) (-2434.613) (-2437.728) [-2439.313] -- 0:06:13
292500 -- (-2438.049) (-2433.347) (-2438.605) [-2424.534] * (-2437.473) (-2439.493) (-2443.484) [-2430.022] -- 0:06:12
293000 -- (-2438.206) (-2429.213) [-2434.337] (-2432.687) * [-2433.575] (-2428.943) (-2435.032) (-2433.845) -- 0:06:14
293500 -- (-2438.826) (-2431.669) (-2439.046) [-2433.491] * (-2433.035) [-2424.327] (-2435.475) (-2438.363) -- 0:06:13
294000 -- (-2435.741) (-2430.778) [-2433.684] (-2432.710) * (-2425.379) (-2429.652) [-2435.799] (-2432.563) -- 0:06:12
294500 -- [-2426.515] (-2441.298) (-2438.514) (-2448.032) * (-2433.040) (-2431.387) [-2432.535] (-2436.058) -- 0:06:11
295000 -- (-2436.425) (-2430.843) [-2432.163] (-2436.352) * (-2435.961) (-2432.772) (-2436.046) [-2434.044] -- 0:06:12
Average standard deviation of split frequencies: 0.015713
295500 -- (-2431.737) [-2432.506] (-2437.408) (-2439.937) * (-2439.208) [-2438.866] (-2440.043) (-2430.978) -- 0:06:11
296000 -- (-2435.690) [-2430.162] (-2435.528) (-2442.664) * (-2433.445) (-2442.393) (-2433.976) [-2431.887] -- 0:06:11
296500 -- (-2432.221) (-2439.028) (-2440.029) [-2436.737] * (-2434.430) [-2441.731] (-2435.348) (-2437.334) -- 0:06:10
297000 -- (-2442.001) (-2430.913) [-2443.016] (-2436.593) * (-2438.541) [-2434.192] (-2434.431) (-2435.411) -- 0:06:11
297500 -- (-2431.723) [-2437.941] (-2440.120) (-2440.013) * [-2431.539] (-2438.742) (-2437.941) (-2439.488) -- 0:06:10
298000 -- [-2426.797] (-2440.549) (-2439.865) (-2431.319) * (-2439.144) (-2433.218) [-2429.019] (-2433.037) -- 0:06:09
298500 -- (-2435.752) (-2430.741) (-2431.069) [-2434.330] * (-2440.081) (-2439.582) (-2430.475) [-2432.369] -- 0:06:08
299000 -- (-2444.736) (-2437.160) (-2426.867) [-2436.712] * [-2430.029] (-2446.978) (-2440.279) (-2434.352) -- 0:06:10
299500 -- (-2441.857) (-2435.419) [-2427.399] (-2428.322) * (-2426.264) [-2439.680] (-2446.754) (-2445.348) -- 0:06:09
300000 -- (-2441.001) (-2437.406) (-2433.108) [-2437.383] * [-2431.115] (-2434.111) (-2440.621) (-2442.028) -- 0:06:08
Average standard deviation of split frequencies: 0.017560
300500 -- (-2438.838) (-2435.120) [-2433.439] (-2433.316) * (-2431.364) (-2433.441) [-2428.740] (-2438.725) -- 0:06:10
301000 -- [-2441.417] (-2442.654) (-2435.498) (-2433.656) * [-2431.251] (-2444.075) (-2436.341) (-2430.328) -- 0:06:09
301500 -- (-2438.850) (-2447.419) [-2426.337] (-2434.099) * (-2437.059) (-2438.452) (-2433.181) [-2424.584] -- 0:06:08
302000 -- (-2438.556) (-2437.813) [-2430.971] (-2434.104) * (-2429.769) [-2431.630] (-2439.784) (-2440.649) -- 0:06:07
302500 -- (-2432.912) [-2440.938] (-2442.229) (-2435.972) * (-2428.204) [-2426.712] (-2435.544) (-2440.461) -- 0:06:08
303000 -- (-2431.368) (-2430.351) [-2439.415] (-2442.825) * (-2432.294) (-2437.142) (-2436.333) [-2436.216] -- 0:06:08
303500 -- [-2428.611] (-2438.750) (-2434.853) (-2438.009) * [-2433.570] (-2431.948) (-2439.910) (-2440.104) -- 0:06:07
304000 -- [-2431.070] (-2427.049) (-2438.641) (-2435.024) * [-2439.507] (-2442.164) (-2433.518) (-2434.645) -- 0:06:06
304500 -- (-2426.611) (-2438.657) (-2430.767) [-2429.527] * (-2441.724) [-2432.189] (-2435.791) (-2433.522) -- 0:06:07
305000 -- (-2438.596) (-2449.203) [-2435.771] (-2437.001) * (-2431.192) (-2433.741) (-2439.729) [-2430.719] -- 0:06:06
Average standard deviation of split frequencies: 0.016843
305500 -- (-2432.409) (-2451.521) [-2441.649] (-2429.600) * (-2430.579) (-2433.749) (-2443.755) [-2430.788] -- 0:06:06
306000 -- (-2430.433) (-2442.614) (-2438.088) [-2436.982] * [-2426.008] (-2435.764) (-2440.757) (-2440.501) -- 0:06:05
306500 -- [-2436.219] (-2447.361) (-2434.615) (-2429.534) * (-2435.620) [-2434.044] (-2434.729) (-2437.094) -- 0:06:06
307000 -- (-2430.764) (-2435.238) (-2432.818) [-2436.208] * [-2430.595] (-2442.356) (-2443.635) (-2441.154) -- 0:06:05
307500 -- (-2433.561) (-2441.270) [-2439.468] (-2442.732) * (-2433.495) (-2434.468) (-2447.867) [-2432.495] -- 0:06:04
308000 -- (-2435.534) (-2435.246) (-2433.450) [-2441.061] * (-2430.483) [-2435.280] (-2454.874) (-2435.128) -- 0:06:03
308500 -- [-2431.357] (-2432.911) (-2444.706) (-2442.819) * (-2445.361) (-2442.383) (-2435.860) [-2435.242] -- 0:06:05
309000 -- [-2426.436] (-2438.166) (-2434.281) (-2439.869) * (-2441.416) (-2442.104) [-2443.849] (-2422.490) -- 0:06:04
309500 -- (-2436.316) (-2444.308) [-2428.417] (-2436.290) * (-2453.712) (-2436.915) (-2438.360) [-2430.044] -- 0:06:03
310000 -- (-2444.464) [-2434.677] (-2440.743) (-2441.907) * (-2438.928) (-2432.065) (-2440.280) [-2435.351] -- 0:06:05
Average standard deviation of split frequencies: 0.015882
310500 -- [-2434.713] (-2439.067) (-2440.689) (-2439.622) * (-2445.470) (-2444.849) (-2458.625) [-2438.205] -- 0:06:04
311000 -- (-2429.328) (-2432.460) (-2431.198) [-2429.271] * (-2428.733) (-2430.773) (-2459.831) [-2434.890] -- 0:06:03
311500 -- [-2434.017] (-2434.860) (-2446.440) (-2436.172) * [-2445.129] (-2435.210) (-2446.450) (-2437.979) -- 0:06:02
312000 -- [-2423.672] (-2431.809) (-2439.751) (-2429.576) * [-2431.709] (-2440.354) (-2454.703) (-2448.666) -- 0:06:03
312500 -- (-2438.415) (-2436.401) (-2438.555) [-2434.568] * [-2439.522] (-2436.326) (-2446.984) (-2436.640) -- 0:06:03
313000 -- [-2434.853] (-2439.776) (-2447.835) (-2445.000) * (-2437.737) (-2447.933) (-2455.548) [-2435.208] -- 0:06:02
313500 -- [-2438.102] (-2441.575) (-2445.368) (-2432.462) * [-2424.886] (-2431.694) (-2437.955) (-2439.182) -- 0:06:01
314000 -- (-2430.884) (-2432.340) (-2433.015) [-2430.944] * (-2433.293) (-2432.988) (-2434.845) [-2446.573] -- 0:06:02
314500 -- (-2430.240) (-2438.788) [-2430.287] (-2435.482) * (-2440.255) [-2428.125] (-2434.154) (-2439.331) -- 0:06:01
315000 -- (-2442.979) (-2439.104) (-2437.476) [-2431.541] * (-2429.577) (-2435.497) (-2437.860) [-2428.648] -- 0:06:00
Average standard deviation of split frequencies: 0.016111
315500 -- (-2431.309) [-2434.170] (-2435.272) (-2428.840) * (-2431.482) (-2429.985) (-2445.641) [-2436.811] -- 0:06:00
316000 -- [-2430.995] (-2441.227) (-2429.190) (-2436.787) * (-2438.563) (-2428.337) (-2437.279) [-2442.373] -- 0:06:01
316500 -- (-2435.458) (-2432.589) (-2440.654) [-2433.263] * (-2441.728) (-2433.509) (-2438.286) [-2439.092] -- 0:06:00
317000 -- (-2442.655) [-2430.899] (-2440.519) (-2432.514) * (-2436.492) [-2433.949] (-2439.651) (-2445.678) -- 0:05:59
317500 -- (-2433.933) [-2432.407] (-2433.222) (-2427.326) * (-2440.970) (-2430.963) (-2430.714) [-2436.118] -- 0:06:01
318000 -- (-2432.665) [-2431.820] (-2427.917) (-2430.400) * (-2446.023) (-2438.927) (-2441.563) [-2431.265] -- 0:06:00
318500 -- (-2434.524) [-2427.305] (-2438.327) (-2435.006) * (-2437.108) (-2437.221) (-2428.977) [-2436.949] -- 0:05:59
319000 -- (-2433.972) (-2431.170) [-2430.813] (-2438.457) * (-2437.899) (-2433.653) [-2430.718] (-2432.017) -- 0:05:58
319500 -- (-2432.304) (-2435.606) [-2439.577] (-2444.584) * [-2429.318] (-2437.274) (-2433.260) (-2439.320) -- 0:05:59
320000 -- (-2435.388) [-2443.066] (-2430.934) (-2433.357) * (-2442.778) (-2434.474) (-2430.889) [-2438.569] -- 0:05:59
Average standard deviation of split frequencies: 0.016759
320500 -- [-2430.086] (-2440.525) (-2440.814) (-2439.399) * (-2436.634) (-2432.573) [-2430.268] (-2432.693) -- 0:05:58
321000 -- (-2424.013) (-2437.670) [-2435.735] (-2440.147) * (-2436.885) (-2452.213) [-2433.802] (-2453.091) -- 0:05:57
321500 -- (-2437.290) [-2431.139] (-2448.337) (-2433.684) * (-2443.628) [-2427.290] (-2447.023) (-2433.889) -- 0:05:58
322000 -- (-2432.448) (-2433.352) [-2423.935] (-2433.605) * (-2434.562) [-2436.189] (-2439.879) (-2432.507) -- 0:05:57
322500 -- (-2434.989) (-2438.864) [-2433.029] (-2429.502) * (-2438.176) [-2427.505] (-2432.764) (-2435.819) -- 0:05:57
323000 -- [-2429.010] (-2436.422) (-2429.098) (-2436.832) * (-2427.618) (-2437.395) (-2429.054) [-2430.281] -- 0:05:56
323500 -- (-2434.085) (-2432.676) [-2426.216] (-2439.035) * (-2430.540) (-2447.102) [-2427.681] (-2439.956) -- 0:05:57
324000 -- [-2432.945] (-2436.866) (-2435.287) (-2441.189) * [-2429.902] (-2445.707) (-2444.686) (-2431.156) -- 0:05:56
324500 -- [-2430.239] (-2436.002) (-2432.895) (-2436.548) * (-2433.444) (-2431.151) (-2443.604) [-2423.067] -- 0:05:55
325000 -- (-2443.360) (-2434.679) (-2442.932) [-2435.182] * (-2440.190) [-2435.109] (-2435.504) (-2424.478) -- 0:05:55
Average standard deviation of split frequencies: 0.016292
325500 -- (-2436.345) (-2439.695) (-2429.849) [-2426.190] * (-2443.398) [-2436.733] (-2444.351) (-2434.791) -- 0:05:56
326000 -- (-2435.994) [-2442.050] (-2428.494) (-2431.756) * (-2440.872) (-2431.863) (-2428.813) [-2432.507] -- 0:05:55
326500 -- (-2439.895) (-2432.627) (-2444.586) [-2433.289] * (-2440.501) (-2437.256) (-2439.504) [-2429.905] -- 0:05:54
327000 -- (-2456.257) (-2435.292) [-2435.823] (-2447.017) * (-2435.455) [-2439.012] (-2437.433) (-2434.670) -- 0:05:56
327500 -- [-2433.250] (-2436.786) (-2437.417) (-2432.434) * (-2442.414) (-2435.421) [-2440.767] (-2431.162) -- 0:05:55
328000 -- (-2436.495) [-2437.269] (-2434.031) (-2425.800) * (-2436.701) (-2444.877) [-2436.858] (-2428.654) -- 0:05:54
328500 -- (-2437.729) (-2431.762) (-2435.603) [-2432.158] * (-2433.669) [-2438.245] (-2432.654) (-2443.679) -- 0:05:53
329000 -- (-2435.484) (-2444.158) (-2437.809) [-2430.674] * [-2435.687] (-2441.227) (-2430.444) (-2441.916) -- 0:05:54
329500 -- (-2430.113) (-2438.602) [-2434.371] (-2432.208) * (-2438.420) [-2434.358] (-2431.680) (-2439.391) -- 0:05:54
330000 -- (-2434.749) [-2432.661] (-2434.398) (-2432.284) * (-2441.405) (-2433.785) (-2436.551) [-2431.771] -- 0:05:53
Average standard deviation of split frequencies: 0.016727
330500 -- (-2424.363) (-2428.785) [-2426.767] (-2434.872) * (-2434.987) [-2433.233] (-2437.917) (-2432.886) -- 0:05:52
331000 -- [-2425.497] (-2436.069) (-2432.067) (-2441.217) * (-2440.744) (-2434.070) [-2431.406] (-2439.799) -- 0:05:53
331500 -- (-2431.174) (-2439.836) (-2434.871) [-2432.820] * (-2438.376) [-2436.669] (-2436.652) (-2428.584) -- 0:05:52
332000 -- [-2434.782] (-2438.401) (-2437.888) (-2434.022) * (-2431.301) (-2438.493) (-2430.034) [-2429.143] -- 0:05:52
332500 -- (-2435.612) [-2430.453] (-2431.808) (-2429.695) * (-2432.922) (-2440.364) [-2444.787] (-2441.770) -- 0:05:51
333000 -- (-2438.295) [-2426.391] (-2439.019) (-2432.952) * [-2433.639] (-2432.380) (-2440.354) (-2434.222) -- 0:05:52
333500 -- (-2442.488) [-2431.427] (-2424.698) (-2438.282) * [-2440.219] (-2429.289) (-2431.069) (-2439.099) -- 0:05:51
334000 -- (-2437.700) (-2437.517) (-2435.972) [-2432.497] * (-2441.425) (-2434.925) (-2441.703) [-2434.262] -- 0:05:50
334500 -- (-2438.779) (-2442.947) (-2444.057) [-2434.024] * (-2436.713) [-2432.758] (-2440.137) (-2439.876) -- 0:05:50
335000 -- [-2430.036] (-2430.647) (-2432.081) (-2426.713) * (-2437.294) [-2432.185] (-2440.803) (-2437.248) -- 0:05:51
Average standard deviation of split frequencies: 0.016368
335500 -- (-2434.574) (-2444.423) (-2431.891) [-2429.598] * (-2428.100) [-2427.430] (-2444.689) (-2431.124) -- 0:05:50
336000 -- (-2442.817) (-2436.403) [-2427.102] (-2429.757) * [-2436.264] (-2431.006) (-2432.585) (-2438.859) -- 0:05:49
336500 -- (-2431.679) (-2426.644) [-2442.645] (-2435.674) * (-2428.929) (-2441.047) (-2436.985) [-2432.596] -- 0:05:50
337000 -- [-2432.043] (-2436.222) (-2435.641) (-2428.755) * (-2427.387) (-2431.283) (-2444.240) [-2432.213] -- 0:05:50
337500 -- (-2444.584) (-2442.508) [-2429.243] (-2435.822) * [-2442.594] (-2436.912) (-2441.749) (-2434.456) -- 0:05:49
338000 -- (-2438.625) (-2435.757) (-2428.511) [-2429.620] * (-2445.328) (-2437.756) (-2440.379) [-2436.153] -- 0:05:48
338500 -- (-2436.591) (-2437.822) [-2435.364] (-2427.080) * (-2447.106) (-2444.056) [-2439.036] (-2430.901) -- 0:05:49
339000 -- (-2440.661) [-2429.841] (-2436.924) (-2439.886) * (-2458.613) (-2434.713) (-2432.533) [-2436.601] -- 0:05:49
339500 -- (-2431.371) [-2434.547] (-2441.865) (-2436.410) * (-2436.910) [-2429.002] (-2429.841) (-2447.800) -- 0:05:48
340000 -- [-2428.864] (-2437.208) (-2436.406) (-2432.413) * (-2444.704) (-2435.571) (-2429.274) [-2432.941] -- 0:05:47
Average standard deviation of split frequencies: 0.017436
340500 -- [-2431.712] (-2449.613) (-2449.014) (-2432.363) * (-2431.609) [-2435.119] (-2427.877) (-2432.217) -- 0:05:48
341000 -- (-2429.970) [-2434.632] (-2432.298) (-2429.517) * (-2433.305) (-2444.587) [-2446.244] (-2432.373) -- 0:05:47
341500 -- (-2436.850) (-2432.885) [-2428.512] (-2441.201) * (-2434.013) [-2437.783] (-2437.008) (-2446.609) -- 0:05:47
342000 -- (-2437.274) (-2437.495) [-2432.557] (-2436.602) * (-2430.811) [-2434.775] (-2430.436) (-2453.490) -- 0:05:46
342500 -- (-2439.257) [-2440.658] (-2444.264) (-2435.260) * (-2434.373) [-2427.390] (-2434.597) (-2455.983) -- 0:05:47
343000 -- (-2446.309) (-2436.875) (-2428.743) [-2431.776] * (-2451.441) [-2425.541] (-2438.645) (-2435.150) -- 0:05:46
343500 -- (-2444.518) [-2433.895] (-2431.054) (-2439.968) * (-2429.403) (-2433.216) [-2432.868] (-2437.978) -- 0:05:45
344000 -- (-2440.558) (-2442.791) [-2431.603] (-2438.587) * (-2432.927) [-2432.066] (-2433.105) (-2445.553) -- 0:05:45
344500 -- (-2435.686) (-2444.038) (-2442.194) [-2429.393] * [-2436.309] (-2440.304) (-2440.231) (-2439.816) -- 0:05:46
345000 -- [-2430.820] (-2441.475) (-2435.649) (-2441.993) * [-2442.654] (-2435.564) (-2442.907) (-2437.198) -- 0:05:45
Average standard deviation of split frequencies: 0.017076
345500 -- (-2441.779) (-2438.529) [-2429.377] (-2439.906) * [-2440.409] (-2455.811) (-2438.806) (-2448.687) -- 0:05:44
346000 -- [-2435.514] (-2436.267) (-2434.500) (-2441.699) * (-2435.557) [-2430.214] (-2435.263) (-2443.937) -- 0:05:44
346500 -- (-2428.821) (-2439.381) (-2434.666) [-2430.144] * [-2430.932] (-2431.548) (-2448.894) (-2440.895) -- 0:05:45
347000 -- (-2439.552) (-2443.249) (-2435.438) [-2430.434] * [-2427.715] (-2430.785) (-2442.965) (-2454.449) -- 0:05:44
347500 -- (-2454.253) (-2443.444) (-2435.509) [-2435.428] * (-2435.906) (-2435.436) (-2437.532) [-2434.871] -- 0:05:43
348000 -- (-2436.357) [-2431.433] (-2440.218) (-2444.684) * [-2429.594] (-2446.879) (-2444.749) (-2430.112) -- 0:05:44
348500 -- (-2434.333) (-2434.368) (-2432.091) [-2436.180] * (-2432.862) (-2443.640) (-2450.799) [-2445.212] -- 0:05:43
349000 -- (-2436.710) (-2437.345) (-2441.628) [-2433.124] * (-2435.662) [-2425.021] (-2435.499) (-2441.674) -- 0:05:43
349500 -- (-2435.129) (-2428.893) (-2439.761) [-2424.034] * (-2434.993) [-2432.850] (-2433.786) (-2436.699) -- 0:05:42
350000 -- (-2435.682) (-2442.539) (-2440.608) [-2432.149] * (-2430.985) [-2429.341] (-2430.895) (-2431.536) -- 0:05:43
Average standard deviation of split frequencies: 0.018372
350500 -- (-2438.451) (-2440.921) (-2437.887) [-2432.037] * [-2435.499] (-2439.451) (-2446.249) (-2433.724) -- 0:05:42
351000 -- (-2442.223) (-2434.982) (-2442.471) [-2438.636] * (-2440.191) (-2457.595) [-2428.631] (-2442.671) -- 0:05:42
351500 -- (-2439.016) (-2436.366) [-2428.994] (-2428.425) * (-2434.792) (-2434.208) (-2428.830) [-2441.489] -- 0:05:41
352000 -- (-2437.109) (-2439.356) [-2429.041] (-2432.822) * (-2435.315) (-2428.532) [-2431.993] (-2443.050) -- 0:05:42
352500 -- (-2436.344) (-2438.853) [-2430.269] (-2429.994) * [-2431.059] (-2432.024) (-2438.246) (-2443.361) -- 0:05:41
353000 -- (-2437.690) [-2434.760] (-2433.425) (-2430.491) * (-2431.815) [-2437.098] (-2443.106) (-2437.426) -- 0:05:40
353500 -- (-2437.983) (-2436.309) [-2430.366] (-2429.859) * (-2441.344) (-2438.726) [-2430.091] (-2431.168) -- 0:05:40
354000 -- [-2431.365] (-2433.873) (-2447.352) (-2437.863) * (-2436.522) (-2429.178) (-2436.208) [-2433.437] -- 0:05:41
354500 -- (-2434.564) (-2430.552) (-2450.706) [-2443.397] * (-2443.920) [-2427.438] (-2429.884) (-2430.598) -- 0:05:40
355000 -- (-2442.615) (-2429.437) (-2433.263) [-2434.133] * (-2433.973) (-2432.586) [-2430.276] (-2432.603) -- 0:05:39
Average standard deviation of split frequencies: 0.016596
355500 -- (-2439.153) (-2438.019) (-2436.044) [-2432.253] * (-2438.220) [-2430.536] (-2445.667) (-2440.014) -- 0:05:39
356000 -- (-2426.959) (-2432.127) (-2434.642) [-2426.616] * (-2438.253) [-2426.247] (-2433.175) (-2437.213) -- 0:05:40
356500 -- (-2443.407) (-2439.188) (-2427.204) [-2435.692] * (-2443.457) (-2435.363) [-2436.616] (-2450.214) -- 0:05:39
357000 -- (-2436.917) [-2430.779] (-2434.835) (-2434.478) * (-2436.613) (-2435.630) [-2430.165] (-2435.092) -- 0:05:38
357500 -- (-2434.942) (-2435.308) [-2433.761] (-2434.851) * (-2448.041) [-2426.531] (-2440.567) (-2436.913) -- 0:05:39
358000 -- (-2436.840) (-2443.367) [-2433.447] (-2436.583) * (-2433.873) [-2427.337] (-2438.149) (-2436.380) -- 0:05:38
358500 -- (-2437.733) (-2435.248) (-2430.364) [-2433.967] * (-2449.366) [-2429.571] (-2441.737) (-2432.866) -- 0:05:38
359000 -- (-2438.377) (-2427.843) (-2436.198) [-2426.175] * (-2458.364) [-2427.591] (-2432.639) (-2438.357) -- 0:05:37
359500 -- (-2439.292) (-2432.079) [-2429.936] (-2438.119) * (-2458.053) (-2440.942) [-2435.957] (-2435.900) -- 0:05:38
360000 -- (-2445.051) (-2435.107) [-2430.911] (-2432.487) * (-2453.998) (-2441.414) [-2426.043] (-2434.623) -- 0:05:37
Average standard deviation of split frequencies: 0.016207
360500 -- (-2435.593) (-2439.687) [-2434.350] (-2429.247) * (-2445.529) (-2437.605) [-2434.145] (-2430.912) -- 0:05:37
361000 -- (-2432.758) (-2439.905) [-2430.390] (-2428.301) * (-2455.358) (-2432.974) [-2426.843] (-2438.064) -- 0:05:36
361500 -- (-2429.785) (-2444.710) [-2432.518] (-2440.642) * (-2437.752) [-2432.244] (-2437.713) (-2445.577) -- 0:05:37
362000 -- (-2441.014) [-2432.472] (-2456.330) (-2441.793) * (-2442.420) (-2433.555) (-2436.318) [-2429.778] -- 0:05:36
362500 -- (-2445.399) [-2433.845] (-2425.941) (-2453.974) * (-2447.294) (-2439.173) [-2430.076] (-2436.500) -- 0:05:35
363000 -- (-2439.399) (-2429.949) (-2433.292) [-2432.718] * (-2440.914) (-2434.626) (-2448.354) [-2429.740] -- 0:05:35
363500 -- (-2439.754) (-2436.210) [-2425.009] (-2442.976) * [-2430.162] (-2435.000) (-2434.302) (-2431.290) -- 0:05:36
364000 -- [-2433.392] (-2433.614) (-2438.853) (-2447.550) * (-2430.822) [-2434.661] (-2437.413) (-2440.359) -- 0:05:35
364500 -- [-2435.153] (-2440.173) (-2438.842) (-2436.765) * (-2445.688) [-2434.329] (-2434.157) (-2440.126) -- 0:05:34
365000 -- (-2452.313) [-2425.118] (-2437.536) (-2432.842) * [-2434.231] (-2433.000) (-2443.814) (-2446.510) -- 0:05:34
Average standard deviation of split frequencies: 0.016315
365500 -- (-2435.511) [-2435.451] (-2438.958) (-2440.089) * (-2433.008) (-2441.074) [-2430.041] (-2442.545) -- 0:05:35
366000 -- (-2431.509) [-2432.772] (-2438.699) (-2433.569) * (-2437.230) (-2446.559) (-2431.725) [-2435.959] -- 0:05:34
366500 -- (-2426.138) [-2427.127] (-2440.867) (-2438.032) * (-2439.216) [-2430.622] (-2447.049) (-2448.136) -- 0:05:33
367000 -- (-2434.007) (-2429.101) [-2433.055] (-2431.455) * (-2450.261) (-2427.083) [-2431.656] (-2449.765) -- 0:05:32
367500 -- [-2427.162] (-2430.926) (-2430.900) (-2435.025) * (-2439.801) (-2429.010) [-2429.335] (-2438.603) -- 0:05:33
368000 -- (-2433.083) (-2433.845) [-2434.326] (-2429.770) * (-2432.092) [-2428.284] (-2434.905) (-2437.938) -- 0:05:33
368500 -- (-2437.839) (-2434.018) (-2436.261) [-2433.997] * (-2440.709) [-2425.662] (-2436.250) (-2442.350) -- 0:05:32
369000 -- [-2434.680] (-2436.087) (-2434.975) (-2440.899) * (-2432.231) [-2432.258] (-2430.348) (-2439.703) -- 0:05:33
369500 -- (-2433.771) (-2443.099) (-2428.720) [-2426.110] * (-2435.909) (-2441.679) (-2436.119) [-2443.262] -- 0:05:32
370000 -- (-2431.997) (-2432.162) [-2427.092] (-2433.855) * (-2450.929) (-2447.409) (-2433.122) [-2432.387] -- 0:05:32
Average standard deviation of split frequencies: 0.014922
370500 -- (-2435.817) [-2425.887] (-2438.327) (-2440.169) * [-2434.100] (-2437.215) (-2445.670) (-2437.237) -- 0:05:31
371000 -- (-2442.772) (-2438.136) [-2427.052] (-2443.004) * (-2430.884) (-2437.096) (-2437.812) [-2428.532] -- 0:05:32
371500 -- (-2441.048) (-2442.294) [-2445.328] (-2436.445) * (-2446.207) (-2438.244) [-2434.003] (-2437.681) -- 0:05:31
372000 -- (-2441.056) (-2429.690) [-2444.432] (-2437.006) * [-2434.066] (-2437.435) (-2432.567) (-2441.310) -- 0:05:30
372500 -- (-2438.369) [-2428.011] (-2440.627) (-2428.312) * (-2431.418) [-2441.739] (-2444.893) (-2445.204) -- 0:05:30
373000 -- (-2451.418) [-2435.377] (-2447.968) (-2433.443) * (-2433.376) (-2440.939) (-2438.542) [-2436.294] -- 0:05:31
373500 -- [-2434.283] (-2444.065) (-2433.871) (-2435.306) * (-2445.268) [-2434.000] (-2436.700) (-2437.591) -- 0:05:30
374000 -- (-2441.395) (-2429.171) [-2431.867] (-2438.314) * (-2445.944) (-2434.728) (-2441.643) [-2430.496] -- 0:05:29
374500 -- [-2434.965] (-2426.197) (-2441.561) (-2437.007) * (-2452.397) (-2438.946) [-2435.824] (-2433.521) -- 0:05:29
375000 -- (-2444.183) (-2433.700) [-2442.564] (-2435.549) * (-2437.026) (-2436.193) [-2432.764] (-2433.315) -- 0:05:30
Average standard deviation of split frequencies: 0.014042
375500 -- [-2432.283] (-2433.000) (-2447.310) (-2438.641) * (-2426.713) (-2443.472) [-2434.626] (-2439.794) -- 0:05:29
376000 -- (-2431.993) [-2428.252] (-2431.871) (-2433.575) * (-2438.312) [-2438.040] (-2445.919) (-2447.384) -- 0:05:28
376500 -- [-2433.947] (-2438.030) (-2427.232) (-2439.339) * (-2434.735) [-2429.115] (-2440.694) (-2454.329) -- 0:05:27
377000 -- [-2426.598] (-2441.852) (-2434.138) (-2431.536) * (-2439.497) (-2434.947) (-2440.559) [-2443.628] -- 0:05:28
377500 -- (-2440.548) [-2432.889] (-2444.465) (-2427.718) * (-2446.509) (-2440.151) (-2439.650) [-2427.585] -- 0:05:28
378000 -- (-2434.144) (-2439.734) (-2437.813) [-2433.498] * (-2436.515) (-2436.013) (-2436.109) [-2441.860] -- 0:05:27
378500 -- (-2434.535) (-2433.507) [-2431.217] (-2434.629) * (-2435.539) (-2435.818) (-2439.370) [-2437.232] -- 0:05:28
379000 -- [-2428.609] (-2433.653) (-2431.880) (-2438.916) * (-2444.542) [-2438.689] (-2438.734) (-2447.708) -- 0:05:27
379500 -- (-2440.624) (-2426.723) [-2435.221] (-2444.755) * (-2431.553) [-2427.609] (-2444.654) (-2431.868) -- 0:05:27
380000 -- [-2431.468] (-2433.115) (-2435.292) (-2434.781) * [-2429.771] (-2436.864) (-2429.007) (-2442.359) -- 0:05:26
Average standard deviation of split frequencies: 0.013787
380500 -- (-2439.197) (-2433.273) (-2446.848) [-2433.814] * (-2442.146) [-2429.260] (-2433.369) (-2439.662) -- 0:05:27
381000 -- [-2436.096] (-2432.978) (-2447.196) (-2434.619) * (-2438.540) [-2430.786] (-2443.197) (-2436.579) -- 0:05:26
381500 -- [-2440.008] (-2437.004) (-2439.446) (-2440.432) * (-2436.504) [-2435.357] (-2435.830) (-2434.514) -- 0:05:25
382000 -- (-2428.782) (-2435.135) [-2427.571] (-2439.078) * (-2442.057) (-2433.519) [-2437.462] (-2445.491) -- 0:05:25
382500 -- [-2432.897] (-2436.168) (-2428.146) (-2433.632) * (-2441.639) (-2436.307) [-2435.082] (-2433.813) -- 0:05:26
383000 -- [-2439.935] (-2434.293) (-2432.592) (-2441.198) * (-2435.663) (-2430.739) [-2434.842] (-2438.002) -- 0:05:25
383500 -- (-2434.060) (-2437.287) [-2433.690] (-2434.159) * (-2433.514) (-2449.341) [-2430.188] (-2431.699) -- 0:05:24
384000 -- (-2441.238) (-2436.399) (-2435.345) [-2429.493] * (-2440.017) (-2442.262) [-2427.465] (-2433.082) -- 0:05:24
384500 -- (-2435.646) [-2431.318] (-2445.228) (-2445.040) * (-2440.471) (-2440.690) [-2431.827] (-2435.735) -- 0:05:24
385000 -- (-2444.793) (-2432.925) [-2436.419] (-2430.243) * (-2441.437) [-2436.346] (-2441.176) (-2429.728) -- 0:05:24
Average standard deviation of split frequencies: 0.012457
385500 -- (-2433.048) (-2433.790) [-2431.992] (-2432.779) * (-2439.760) (-2443.838) (-2429.979) [-2435.660] -- 0:05:23
386000 -- [-2432.514] (-2441.762) (-2447.015) (-2429.515) * (-2429.647) (-2441.416) (-2429.935) [-2427.862] -- 0:05:22
386500 -- (-2434.263) (-2436.911) [-2429.791] (-2438.679) * (-2434.949) (-2433.719) [-2435.843] (-2437.862) -- 0:05:23
387000 -- (-2443.770) [-2429.289] (-2436.000) (-2434.930) * (-2434.876) (-2433.171) (-2440.222) [-2433.315] -- 0:05:23
387500 -- (-2430.851) [-2443.880] (-2428.251) (-2428.328) * (-2431.354) (-2453.442) (-2441.872) [-2430.637] -- 0:05:22
388000 -- (-2432.583) [-2430.918] (-2437.627) (-2432.670) * [-2439.928] (-2437.690) (-2446.651) (-2431.961) -- 0:05:21
388500 -- (-2436.704) (-2435.659) (-2432.903) [-2432.963] * [-2441.894] (-2437.070) (-2444.362) (-2424.220) -- 0:05:22
389000 -- (-2446.973) (-2439.740) [-2431.763] (-2445.274) * (-2443.780) (-2435.652) (-2444.091) [-2431.713] -- 0:05:21
389500 -- [-2426.180] (-2433.621) (-2431.544) (-2437.957) * [-2437.981] (-2434.479) (-2439.344) (-2442.465) -- 0:05:21
390000 -- (-2431.694) (-2438.809) (-2460.108) [-2423.852] * (-2439.012) (-2432.793) [-2429.443] (-2427.445) -- 0:05:22
Average standard deviation of split frequencies: 0.012549
390500 -- (-2435.773) (-2430.512) [-2434.137] (-2446.091) * (-2425.651) [-2435.011] (-2438.224) (-2432.724) -- 0:05:21
391000 -- (-2425.804) (-2439.497) (-2433.464) [-2433.409] * (-2441.322) [-2429.499] (-2445.109) (-2434.788) -- 0:05:20
391500 -- (-2445.310) (-2442.209) (-2430.300) [-2425.178] * [-2431.394] (-2431.247) (-2444.741) (-2434.010) -- 0:05:20
392000 -- (-2451.824) (-2446.008) (-2439.254) [-2429.583] * (-2426.117) [-2430.955] (-2433.767) (-2445.053) -- 0:05:21
392500 -- [-2431.454] (-2437.898) (-2442.414) (-2425.285) * [-2425.279] (-2438.781) (-2427.588) (-2434.443) -- 0:05:20
393000 -- (-2428.495) [-2441.391] (-2438.106) (-2436.634) * (-2427.971) (-2432.178) (-2429.237) [-2436.599] -- 0:05:19
393500 -- [-2431.964] (-2430.723) (-2440.079) (-2447.753) * [-2427.724] (-2437.526) (-2439.135) (-2442.522) -- 0:05:19
394000 -- [-2435.433] (-2437.303) (-2440.694) (-2438.102) * (-2437.450) [-2431.542] (-2439.012) (-2431.440) -- 0:05:19
394500 -- (-2434.151) (-2444.256) (-2428.748) [-2431.835] * [-2442.052] (-2436.315) (-2436.152) (-2435.683) -- 0:05:19
395000 -- (-2431.865) (-2445.442) [-2428.722] (-2434.605) * (-2443.148) (-2438.879) [-2434.724] (-2438.670) -- 0:05:18
Average standard deviation of split frequencies: 0.012618
395500 -- (-2441.556) [-2433.510] (-2430.198) (-2434.343) * (-2440.661) (-2445.558) (-2430.893) [-2437.356] -- 0:05:17
396000 -- (-2435.701) (-2441.348) [-2436.318] (-2427.758) * [-2430.218] (-2437.218) (-2434.231) (-2437.949) -- 0:05:18
396500 -- (-2443.160) (-2436.053) (-2430.611) [-2426.978] * (-2436.067) (-2442.374) [-2426.235] (-2435.403) -- 0:05:18
397000 -- [-2435.368] (-2430.043) (-2428.769) (-2433.975) * (-2440.383) (-2428.749) (-2436.327) [-2436.375] -- 0:05:17
397500 -- (-2436.426) [-2436.142] (-2436.493) (-2431.577) * (-2451.642) (-2434.660) (-2430.091) [-2435.245] -- 0:05:18
398000 -- (-2435.226) [-2432.329] (-2434.790) (-2432.494) * [-2439.217] (-2437.868) (-2437.643) (-2445.026) -- 0:05:17
398500 -- (-2446.986) [-2432.156] (-2436.000) (-2432.912) * (-2437.980) [-2435.761] (-2445.654) (-2438.873) -- 0:05:16
399000 -- (-2449.020) (-2434.018) (-2443.157) [-2429.380] * (-2437.402) (-2438.236) [-2434.340] (-2431.971) -- 0:05:16
399500 -- (-2436.960) (-2430.679) (-2436.064) [-2425.146] * [-2438.674] (-2433.037) (-2442.206) (-2432.994) -- 0:05:17
400000 -- (-2426.820) [-2430.817] (-2431.903) (-2427.345) * (-2444.921) [-2425.886] (-2440.789) (-2441.875) -- 0:05:16
Average standard deviation of split frequencies: 0.012471
400500 -- [-2433.040] (-2447.032) (-2438.795) (-2444.532) * (-2436.964) [-2436.131] (-2440.558) (-2456.836) -- 0:05:15
401000 -- (-2441.737) (-2438.605) (-2441.154) [-2433.523] * (-2443.291) [-2428.496] (-2437.440) (-2435.075) -- 0:05:15
401500 -- (-2433.426) (-2428.234) (-2440.287) [-2430.399] * (-2439.882) (-2447.769) [-2433.526] (-2432.241) -- 0:05:16
402000 -- [-2438.611] (-2435.696) (-2430.426) (-2432.827) * [-2431.406] (-2442.467) (-2442.288) (-2446.630) -- 0:05:15
402500 -- (-2432.762) (-2435.390) (-2435.554) [-2426.665] * [-2436.463] (-2433.848) (-2429.244) (-2441.149) -- 0:05:14
403000 -- [-2433.504] (-2431.502) (-2449.693) (-2435.499) * (-2440.050) (-2428.318) (-2434.112) [-2434.315] -- 0:05:14
403500 -- (-2443.775) (-2439.364) (-2443.076) [-2434.660] * (-2430.659) [-2433.017] (-2433.629) (-2449.473) -- 0:05:14
404000 -- (-2445.754) [-2429.130] (-2437.303) (-2441.951) * [-2430.118] (-2433.229) (-2433.681) (-2440.894) -- 0:05:14
404500 -- (-2428.048) [-2430.635] (-2438.828) (-2436.753) * [-2441.752] (-2441.019) (-2436.503) (-2440.919) -- 0:05:13
405000 -- (-2434.198) [-2428.437] (-2440.995) (-2431.893) * [-2429.025] (-2433.510) (-2433.809) (-2432.399) -- 0:05:12
Average standard deviation of split frequencies: 0.012153
405500 -- [-2431.519] (-2439.400) (-2436.211) (-2433.645) * (-2431.825) [-2428.995] (-2441.104) (-2437.100) -- 0:05:13
406000 -- (-2442.386) [-2438.106] (-2438.700) (-2432.586) * (-2438.619) (-2432.472) (-2433.305) [-2440.788] -- 0:05:13
406500 -- (-2431.146) (-2443.556) (-2439.542) [-2448.433] * [-2426.325] (-2436.055) (-2434.084) (-2433.927) -- 0:05:12
407000 -- (-2434.522) (-2434.217) (-2435.794) [-2436.817] * (-2437.368) [-2432.355] (-2437.099) (-2429.638) -- 0:05:13
407500 -- (-2433.323) [-2432.927] (-2436.929) (-2430.000) * (-2440.333) (-2428.448) [-2430.481] (-2438.440) -- 0:05:12
408000 -- (-2437.193) (-2439.067) [-2436.068] (-2435.533) * (-2435.987) [-2430.083] (-2436.124) (-2445.581) -- 0:05:11
408500 -- [-2434.435] (-2430.940) (-2433.326) (-2435.462) * [-2433.962] (-2439.439) (-2432.488) (-2440.968) -- 0:05:11
409000 -- (-2436.244) (-2437.719) [-2442.523] (-2434.848) * [-2429.239] (-2444.196) (-2439.761) (-2428.762) -- 0:05:12
409500 -- (-2436.396) [-2431.112] (-2430.092) (-2434.476) * (-2430.377) [-2433.156] (-2433.267) (-2434.235) -- 0:05:11
410000 -- (-2429.964) (-2438.084) (-2432.646) [-2435.301] * (-2436.089) (-2431.554) [-2437.722] (-2445.561) -- 0:05:10
Average standard deviation of split frequencies: 0.013010
410500 -- (-2433.465) [-2438.805] (-2435.801) (-2440.977) * (-2441.792) (-2430.746) (-2427.838) [-2435.829] -- 0:05:10
411000 -- (-2437.240) [-2432.395] (-2438.710) (-2451.645) * (-2436.791) (-2438.611) (-2434.691) [-2438.039] -- 0:05:10
411500 -- (-2436.175) (-2442.203) [-2438.247] (-2437.582) * (-2437.940) (-2430.967) [-2433.027] (-2439.922) -- 0:05:10
412000 -- (-2445.325) [-2433.330] (-2438.168) (-2431.975) * (-2444.948) (-2427.339) [-2432.779] (-2439.364) -- 0:05:09
412500 -- [-2433.911] (-2441.182) (-2432.267) (-2430.389) * (-2440.705) (-2440.131) (-2432.484) [-2434.906] -- 0:05:09
413000 -- [-2429.577] (-2442.766) (-2443.039) (-2449.348) * (-2438.954) (-2431.393) [-2435.428] (-2441.374) -- 0:05:09
413500 -- [-2428.264] (-2433.015) (-2430.034) (-2438.222) * (-2438.945) (-2451.220) (-2438.925) [-2432.041] -- 0:05:09
414000 -- (-2448.766) (-2431.977) [-2426.725] (-2438.156) * [-2434.167] (-2441.882) (-2438.631) (-2434.210) -- 0:05:08
414500 -- [-2435.240] (-2432.156) (-2428.568) (-2436.546) * (-2432.718) [-2432.891] (-2439.424) (-2433.306) -- 0:05:07
415000 -- (-2435.616) (-2437.502) (-2438.778) [-2432.925] * (-2432.460) (-2429.324) (-2442.132) [-2435.807] -- 0:05:08
Average standard deviation of split frequencies: 0.013069
415500 -- [-2437.590] (-2436.611) (-2445.154) (-2433.765) * (-2431.730) (-2433.852) [-2438.822] (-2433.371) -- 0:05:08
416000 -- (-2435.838) [-2425.608] (-2432.582) (-2434.804) * [-2430.714] (-2436.806) (-2431.948) (-2447.172) -- 0:05:07
416500 -- (-2446.473) (-2425.005) [-2433.702] (-2431.259) * (-2426.934) (-2444.990) [-2433.946] (-2433.628) -- 0:05:08
417000 -- (-2434.232) (-2438.932) [-2428.211] (-2443.392) * (-2443.503) [-2428.146] (-2432.111) (-2435.089) -- 0:05:07
417500 -- (-2427.645) (-2428.631) (-2436.833) [-2438.541] * (-2429.494) (-2429.100) [-2440.096] (-2435.852) -- 0:05:06
418000 -- [-2437.459] (-2439.215) (-2449.879) (-2439.857) * (-2438.539) [-2430.077] (-2441.808) (-2446.676) -- 0:05:06
418500 -- [-2431.738] (-2434.524) (-2435.247) (-2426.580) * (-2429.602) (-2446.109) [-2434.994] (-2433.330) -- 0:05:07
419000 -- (-2430.118) [-2437.342] (-2431.170) (-2438.205) * [-2432.800] (-2433.140) (-2430.507) (-2441.996) -- 0:05:06
419500 -- (-2441.700) (-2426.663) (-2449.822) [-2430.172] * (-2433.812) (-2440.970) [-2432.629] (-2444.109) -- 0:05:05
420000 -- (-2446.284) (-2448.158) (-2447.752) [-2429.953] * (-2446.494) [-2434.240] (-2434.569) (-2433.825) -- 0:05:05
Average standard deviation of split frequencies: 0.014419
420500 -- (-2446.768) (-2427.061) (-2443.394) [-2427.586] * (-2442.683) (-2438.570) (-2427.765) [-2434.840] -- 0:05:05
421000 -- (-2441.789) (-2433.327) (-2428.227) [-2434.660] * (-2431.082) (-2438.480) (-2434.278) [-2433.310] -- 0:05:05
421500 -- [-2438.249] (-2438.738) (-2432.530) (-2436.237) * [-2431.465] (-2426.217) (-2435.971) (-2433.920) -- 0:05:04
422000 -- (-2448.318) (-2434.170) [-2434.202] (-2431.129) * (-2438.431) (-2433.072) [-2444.116] (-2444.639) -- 0:05:04
422500 -- (-2437.624) (-2444.006) (-2433.638) [-2433.145] * (-2434.093) [-2429.516] (-2439.479) (-2429.582) -- 0:05:04
423000 -- (-2427.876) (-2437.573) (-2443.184) [-2434.927] * (-2438.002) (-2438.872) (-2434.478) [-2439.956] -- 0:05:04
423500 -- (-2435.757) [-2435.533] (-2436.868) (-2439.655) * (-2443.070) (-2432.500) [-2430.367] (-2447.628) -- 0:05:03
424000 -- (-2434.036) [-2435.930] (-2439.141) (-2441.705) * (-2445.003) (-2438.644) [-2434.362] (-2452.737) -- 0:05:02
424500 -- [-2442.585] (-2430.379) (-2437.134) (-2437.854) * [-2436.656] (-2440.919) (-2436.875) (-2440.889) -- 0:05:03
425000 -- (-2434.994) (-2431.595) [-2434.893] (-2450.887) * (-2438.524) [-2426.595] (-2435.567) (-2440.714) -- 0:05:03
Average standard deviation of split frequencies: 0.013869
425500 -- (-2446.716) [-2433.060] (-2430.912) (-2445.839) * (-2442.493) [-2431.336] (-2425.277) (-2430.146) -- 0:05:02
426000 -- (-2444.672) [-2430.140] (-2430.721) (-2428.042) * [-2439.900] (-2435.934) (-2433.568) (-2434.590) -- 0:05:01
426500 -- (-2439.340) (-2435.043) (-2441.193) [-2434.173] * (-2433.992) [-2437.547] (-2437.214) (-2432.186) -- 0:05:02
427000 -- (-2445.849) (-2441.204) (-2431.200) [-2434.938] * (-2431.510) (-2433.104) (-2439.410) [-2439.842] -- 0:05:01
427500 -- (-2438.423) (-2436.823) (-2427.968) [-2432.554] * [-2433.744] (-2433.475) (-2433.864) (-2441.432) -- 0:05:01
428000 -- (-2441.904) (-2439.237) (-2431.826) [-2437.295] * [-2435.399] (-2448.416) (-2432.366) (-2435.903) -- 0:05:02
428500 -- (-2441.025) [-2434.152] (-2436.165) (-2438.256) * (-2431.021) [-2438.084] (-2432.745) (-2432.812) -- 0:05:01
429000 -- (-2433.747) (-2436.235) [-2433.989] (-2437.891) * (-2437.696) (-2433.201) [-2431.302] (-2437.966) -- 0:05:00
429500 -- (-2431.950) [-2431.576] (-2431.299) (-2443.725) * (-2435.531) (-2433.474) (-2435.316) [-2445.157] -- 0:05:00
430000 -- (-2441.670) (-2440.569) (-2435.230) [-2428.919] * [-2431.956] (-2432.792) (-2430.616) (-2440.317) -- 0:05:00
Average standard deviation of split frequencies: 0.013573
430500 -- (-2440.750) [-2438.982] (-2437.806) (-2432.396) * (-2434.947) [-2432.406] (-2434.505) (-2452.482) -- 0:05:00
431000 -- [-2433.392] (-2436.425) (-2445.885) (-2427.118) * (-2433.864) (-2441.403) [-2434.458] (-2435.600) -- 0:04:59
431500 -- [-2430.053] (-2432.985) (-2436.890) (-2435.050) * (-2432.755) [-2429.510] (-2432.527) (-2437.513) -- 0:04:59
432000 -- (-2436.156) [-2442.623] (-2440.785) (-2430.183) * (-2437.804) (-2444.897) (-2431.409) [-2429.807] -- 0:04:59
432500 -- (-2431.955) (-2442.851) (-2442.963) [-2437.875] * (-2447.725) (-2440.934) [-2433.111] (-2441.259) -- 0:04:59
433000 -- (-2432.901) [-2434.552] (-2431.479) (-2444.661) * (-2444.823) (-2433.545) (-2444.113) [-2431.257] -- 0:04:58
433500 -- (-2436.274) (-2435.895) (-2432.561) [-2434.739] * (-2439.156) [-2432.244] (-2438.437) (-2439.143) -- 0:04:57
434000 -- (-2431.490) (-2431.949) [-2434.466] (-2438.232) * (-2435.660) (-2451.559) (-2438.572) [-2434.035] -- 0:04:58
434500 -- (-2429.261) [-2430.609] (-2437.827) (-2434.249) * [-2435.281] (-2433.027) (-2439.366) (-2441.298) -- 0:04:58
435000 -- (-2441.360) (-2427.778) (-2438.943) [-2427.270] * (-2432.450) (-2441.066) [-2443.463] (-2442.935) -- 0:04:57
Average standard deviation of split frequencies: 0.014056
435500 -- (-2432.883) (-2436.163) [-2438.739] (-2433.929) * (-2428.625) (-2440.625) [-2436.117] (-2446.431) -- 0:04:56
436000 -- [-2435.998] (-2435.262) (-2434.086) (-2432.366) * [-2431.881] (-2432.911) (-2436.882) (-2447.831) -- 0:04:57
436500 -- (-2439.017) [-2428.765] (-2434.093) (-2426.682) * (-2428.614) (-2436.313) [-2434.419] (-2445.320) -- 0:04:56
437000 -- (-2442.718) (-2435.250) [-2426.006] (-2431.345) * [-2432.877] (-2438.562) (-2433.627) (-2445.692) -- 0:04:56
437500 -- (-2440.998) [-2434.388] (-2428.457) (-2439.501) * (-2440.837) [-2436.589] (-2439.684) (-2436.347) -- 0:04:57
438000 -- (-2443.779) (-2437.333) [-2431.411] (-2440.889) * (-2440.372) [-2430.947] (-2445.626) (-2430.650) -- 0:04:56
438500 -- (-2426.461) (-2436.723) [-2434.160] (-2439.984) * (-2441.549) (-2436.356) (-2439.399) [-2437.866] -- 0:04:55
439000 -- (-2437.525) (-2433.590) (-2441.118) [-2429.005] * (-2432.571) (-2436.886) [-2439.720] (-2438.695) -- 0:04:55
439500 -- (-2443.134) [-2431.073] (-2435.942) (-2437.800) * (-2434.437) [-2429.946] (-2446.338) (-2438.468) -- 0:04:55
440000 -- [-2435.326] (-2436.890) (-2436.164) (-2440.860) * (-2431.558) [-2433.758] (-2448.144) (-2438.077) -- 0:04:55
Average standard deviation of split frequencies: 0.013051
440500 -- [-2433.236] (-2432.967) (-2439.097) (-2431.053) * [-2429.348] (-2432.445) (-2444.229) (-2430.679) -- 0:04:54
441000 -- (-2435.789) (-2438.101) (-2444.620) [-2438.785] * (-2429.429) (-2427.947) (-2435.834) [-2431.946] -- 0:04:55
441500 -- (-2429.766) [-2437.359] (-2443.050) (-2434.474) * (-2433.872) (-2435.868) (-2436.024) [-2434.755] -- 0:04:54
442000 -- (-2440.951) (-2437.806) (-2440.046) [-2432.542] * [-2436.691] (-2437.609) (-2448.052) (-2428.945) -- 0:04:54
442500 -- [-2430.111] (-2445.322) (-2438.427) (-2434.554) * (-2435.316) (-2446.434) (-2434.848) [-2427.847] -- 0:04:54
443000 -- (-2433.893) [-2435.109] (-2442.819) (-2434.781) * [-2429.430] (-2433.979) (-2449.057) (-2437.229) -- 0:04:54
443500 -- (-2432.427) (-2438.648) (-2438.503) [-2426.678] * [-2437.282] (-2429.800) (-2448.995) (-2439.131) -- 0:04:53
444000 -- (-2427.577) [-2428.772] (-2432.784) (-2433.198) * (-2440.722) [-2439.756] (-2442.918) (-2432.219) -- 0:04:53
444500 -- (-2432.074) (-2441.176) (-2445.066) [-2433.063] * (-2444.320) (-2433.540) (-2442.600) [-2437.577] -- 0:04:53
445000 -- [-2440.704] (-2434.580) (-2437.061) (-2430.905) * (-2450.313) (-2439.067) (-2441.992) [-2430.864] -- 0:04:53
Average standard deviation of split frequencies: 0.012965
445500 -- [-2432.763] (-2444.938) (-2427.918) (-2451.103) * [-2435.706] (-2436.189) (-2431.738) (-2443.375) -- 0:04:52
446000 -- [-2433.557] (-2442.130) (-2424.478) (-2442.814) * (-2445.270) (-2439.970) (-2432.239) [-2430.290] -- 0:04:53
446500 -- (-2448.310) (-2438.608) [-2436.236] (-2430.519) * (-2438.969) (-2432.609) [-2432.738] (-2436.455) -- 0:04:52
447000 -- [-2433.647] (-2438.308) (-2442.208) (-2430.098) * (-2433.898) (-2436.819) [-2438.596] (-2438.301) -- 0:04:51
447500 -- [-2439.803] (-2437.133) (-2438.492) (-2432.119) * (-2438.116) (-2433.807) (-2440.591) [-2440.920] -- 0:04:51
448000 -- (-2436.185) (-2433.398) [-2428.129] (-2428.439) * [-2438.886] (-2436.702) (-2437.240) (-2450.783) -- 0:04:52
448500 -- (-2430.416) (-2443.492) [-2433.300] (-2443.513) * [-2433.741] (-2439.345) (-2440.248) (-2445.195) -- 0:04:51
449000 -- (-2447.100) (-2439.133) [-2437.485] (-2447.446) * (-2439.345) (-2433.704) [-2432.893] (-2435.905) -- 0:04:50
449500 -- [-2439.139] (-2437.936) (-2445.019) (-2436.070) * (-2441.825) [-2437.022] (-2432.507) (-2432.374) -- 0:04:51
450000 -- (-2438.212) (-2432.702) [-2435.261] (-2440.998) * (-2444.460) [-2430.831] (-2432.089) (-2437.835) -- 0:04:50
Average standard deviation of split frequencies: 0.012971
450500 -- (-2441.797) [-2430.303] (-2436.114) (-2440.736) * [-2434.699] (-2442.046) (-2430.213) (-2438.781) -- 0:04:50
451000 -- (-2439.076) (-2430.053) (-2439.355) [-2431.614] * (-2445.304) (-2444.759) [-2437.768] (-2433.795) -- 0:04:49
451500 -- (-2427.390) [-2432.974] (-2436.166) (-2431.766) * [-2431.368] (-2428.455) (-2431.502) (-2439.015) -- 0:04:50
452000 -- [-2432.526] (-2439.315) (-2438.552) (-2430.752) * (-2436.588) (-2430.646) (-2450.848) [-2436.209] -- 0:04:49
452500 -- [-2430.456] (-2433.718) (-2430.985) (-2432.917) * (-2433.875) (-2430.200) [-2441.218] (-2430.934) -- 0:04:49
453000 -- (-2431.862) (-2460.579) (-2435.603) [-2429.193] * (-2441.264) [-2430.826] (-2441.133) (-2439.885) -- 0:04:49
453500 -- (-2429.180) (-2434.754) [-2437.672] (-2436.139) * [-2435.971] (-2432.802) (-2438.971) (-2440.819) -- 0:04:49
454000 -- (-2439.306) [-2436.488] (-2438.835) (-2440.586) * (-2440.470) [-2434.250] (-2433.091) (-2435.437) -- 0:04:48
454500 -- (-2438.791) (-2447.190) [-2437.422] (-2445.707) * [-2431.511] (-2440.980) (-2433.470) (-2431.101) -- 0:04:48
455000 -- (-2444.771) [-2427.617] (-2436.709) (-2435.105) * (-2435.193) [-2443.781] (-2442.855) (-2438.618) -- 0:04:48
Average standard deviation of split frequencies: 0.012543
455500 -- (-2433.667) (-2426.476) [-2435.870] (-2436.617) * [-2442.728] (-2428.453) (-2456.276) (-2434.977) -- 0:04:48
456000 -- [-2448.804] (-2436.656) (-2429.588) (-2438.639) * (-2438.845) [-2428.851] (-2437.142) (-2431.697) -- 0:04:47
456500 -- (-2435.049) [-2427.582] (-2436.932) (-2429.622) * (-2427.494) [-2430.476] (-2433.527) (-2436.723) -- 0:04:48
457000 -- (-2443.946) (-2446.178) (-2431.956) [-2428.737] * (-2428.037) (-2435.829) (-2446.404) [-2432.941] -- 0:04:47
457500 -- (-2438.603) [-2442.689] (-2438.851) (-2429.988) * (-2428.355) (-2428.858) (-2437.195) [-2429.853] -- 0:04:46
458000 -- (-2439.291) (-2432.886) (-2430.327) [-2430.338] * (-2426.865) [-2429.506] (-2436.070) (-2436.878) -- 0:04:46
458500 -- (-2438.259) [-2428.263] (-2437.824) (-2438.388) * (-2449.091) (-2431.821) [-2435.715] (-2432.605) -- 0:04:46
459000 -- (-2449.943) [-2434.270] (-2437.611) (-2442.434) * (-2439.952) (-2445.495) (-2435.797) [-2434.218] -- 0:04:46
459500 -- (-2434.101) (-2436.545) (-2442.290) [-2438.233] * (-2436.565) [-2438.123] (-2432.310) (-2430.836) -- 0:04:45
460000 -- (-2440.077) [-2426.033] (-2439.537) (-2435.664) * (-2440.968) (-2435.363) (-2446.357) [-2431.503] -- 0:04:45
Average standard deviation of split frequencies: 0.011870
460500 -- [-2436.288] (-2428.992) (-2438.700) (-2428.243) * [-2435.017] (-2432.668) (-2425.305) (-2440.288) -- 0:04:45
461000 -- (-2434.907) (-2444.276) (-2439.549) [-2426.189] * (-2441.270) (-2438.730) (-2430.910) [-2430.080] -- 0:04:45
461500 -- (-2444.904) [-2428.422] (-2434.930) (-2435.838) * (-2439.685) (-2434.894) [-2423.326] (-2438.282) -- 0:04:44
462000 -- (-2439.903) [-2431.831] (-2434.072) (-2439.160) * [-2436.243] (-2439.481) (-2433.615) (-2433.748) -- 0:04:44
462500 -- (-2430.085) (-2441.596) [-2427.482] (-2448.540) * [-2435.390] (-2442.232) (-2425.430) (-2445.868) -- 0:04:44
463000 -- (-2438.607) [-2429.365] (-2433.493) (-2431.205) * (-2431.417) [-2436.769] (-2443.931) (-2441.752) -- 0:04:44
463500 -- (-2443.927) (-2429.715) [-2427.335] (-2439.864) * [-2430.797] (-2442.297) (-2428.668) (-2444.442) -- 0:04:43
464000 -- (-2443.161) [-2430.794] (-2435.779) (-2440.598) * [-2435.530] (-2429.033) (-2431.147) (-2435.858) -- 0:04:44
464500 -- (-2434.814) (-2430.128) [-2432.806] (-2428.088) * (-2442.730) (-2430.483) [-2423.938] (-2433.835) -- 0:04:43
465000 -- (-2445.251) (-2445.692) (-2425.772) [-2429.131] * (-2443.797) (-2447.201) [-2429.736] (-2430.128) -- 0:04:43
Average standard deviation of split frequencies: 0.011869
465500 -- (-2439.414) (-2450.938) [-2430.038] (-2439.982) * [-2426.434] (-2437.338) (-2434.687) (-2444.579) -- 0:04:42
466000 -- (-2443.223) [-2437.342] (-2431.356) (-2435.210) * (-2428.173) (-2440.271) (-2445.978) [-2445.194] -- 0:04:43
466500 -- (-2436.197) (-2431.209) [-2432.581] (-2439.941) * (-2445.909) [-2436.168] (-2437.693) (-2439.852) -- 0:04:42
467000 -- (-2437.434) (-2427.832) [-2437.796] (-2436.379) * (-2440.734) (-2429.643) [-2434.625] (-2430.801) -- 0:04:41
467500 -- (-2434.113) (-2435.210) [-2429.020] (-2447.981) * (-2434.907) (-2431.280) (-2444.475) [-2431.607] -- 0:04:41
468000 -- (-2444.883) (-2433.787) [-2431.063] (-2437.304) * (-2442.302) [-2434.020] (-2433.069) (-2436.858) -- 0:04:41
468500 -- (-2444.611) [-2427.808] (-2432.844) (-2428.286) * (-2430.746) [-2443.490] (-2437.681) (-2443.503) -- 0:04:41
469000 -- [-2429.904] (-2436.206) (-2439.358) (-2435.234) * (-2436.338) (-2437.371) [-2437.603] (-2440.738) -- 0:04:40
469500 -- (-2433.837) [-2444.754] (-2434.160) (-2443.062) * [-2434.580] (-2431.106) (-2429.204) (-2441.321) -- 0:04:40
470000 -- [-2433.321] (-2439.554) (-2436.874) (-2437.900) * (-2445.647) (-2433.146) [-2435.453] (-2434.243) -- 0:04:40
Average standard deviation of split frequencies: 0.012019
470500 -- [-2437.366] (-2437.986) (-2436.974) (-2448.183) * [-2434.186] (-2436.456) (-2445.547) (-2428.118) -- 0:04:40
471000 -- (-2428.062) [-2445.737] (-2445.100) (-2446.630) * (-2444.409) [-2431.020] (-2447.793) (-2431.977) -- 0:04:39
471500 -- (-2436.436) [-2438.187] (-2442.184) (-2445.597) * (-2444.070) (-2430.678) (-2442.946) [-2435.370] -- 0:04:39
472000 -- (-2443.131) (-2432.453) (-2425.121) [-2431.741] * (-2443.624) [-2430.088] (-2437.589) (-2440.675) -- 0:04:39
472500 -- (-2438.085) (-2442.018) (-2432.928) [-2433.132] * [-2425.161] (-2432.671) (-2436.162) (-2437.660) -- 0:04:39
473000 -- (-2440.062) (-2432.523) (-2435.822) [-2444.546] * (-2431.158) (-2430.036) (-2439.929) [-2436.206] -- 0:04:38
473500 -- (-2434.649) (-2429.587) [-2434.400] (-2432.015) * [-2427.757] (-2437.350) (-2445.952) (-2432.870) -- 0:04:37
474000 -- (-2433.475) (-2436.784) (-2442.551) [-2435.084] * (-2439.166) (-2451.984) (-2437.221) [-2432.285] -- 0:04:38
474500 -- (-2431.706) [-2437.679] (-2434.085) (-2428.984) * (-2435.076) (-2442.509) [-2433.633] (-2438.203) -- 0:04:37
475000 -- (-2436.814) (-2424.322) (-2435.517) [-2429.995] * (-2435.539) (-2433.861) [-2426.649] (-2437.801) -- 0:04:37
Average standard deviation of split frequencies: 0.012148
475500 -- [-2428.105] (-2436.201) (-2436.819) (-2440.331) * [-2435.258] (-2440.778) (-2429.599) (-2428.447) -- 0:04:37
476000 -- (-2437.153) (-2434.220) [-2428.120] (-2431.700) * (-2433.956) (-2431.798) (-2449.160) [-2435.141] -- 0:04:37
476500 -- (-2432.103) (-2428.643) [-2432.086] (-2433.557) * (-2429.567) [-2426.993] (-2431.277) (-2437.462) -- 0:04:36
477000 -- [-2424.743] (-2444.088) (-2433.794) (-2442.702) * (-2439.081) (-2436.005) [-2434.656] (-2430.791) -- 0:04:36
477500 -- (-2428.263) (-2443.618) [-2431.598] (-2438.778) * (-2438.810) (-2443.978) (-2427.950) [-2431.604] -- 0:04:36
478000 -- (-2433.425) (-2441.415) (-2427.810) [-2432.552] * (-2437.422) (-2434.041) [-2429.504] (-2443.382) -- 0:04:36
478500 -- [-2432.024] (-2443.091) (-2433.398) (-2438.216) * [-2429.772] (-2434.986) (-2430.899) (-2434.164) -- 0:04:35
479000 -- (-2436.753) [-2434.425] (-2435.346) (-2444.619) * [-2434.321] (-2435.336) (-2442.187) (-2438.868) -- 0:04:35
479500 -- (-2436.243) (-2434.307) [-2436.050] (-2446.469) * [-2426.846] (-2434.617) (-2435.457) (-2438.801) -- 0:04:35
480000 -- (-2442.331) [-2436.229] (-2435.528) (-2435.841) * [-2432.834] (-2437.103) (-2443.694) (-2435.770) -- 0:04:35
Average standard deviation of split frequencies: 0.012684
480500 -- [-2432.569] (-2432.117) (-2443.547) (-2432.062) * (-2430.020) (-2432.092) (-2438.666) [-2436.981] -- 0:04:34
481000 -- (-2436.783) (-2431.773) [-2432.881] (-2442.799) * (-2440.720) (-2440.074) (-2436.210) [-2430.694] -- 0:04:34
481500 -- (-2433.395) (-2431.969) (-2436.007) [-2434.647] * (-2440.446) (-2439.203) (-2431.823) [-2429.257] -- 0:04:34
482000 -- [-2439.003] (-2431.853) (-2434.928) (-2433.793) * (-2446.421) [-2438.005] (-2432.278) (-2439.508) -- 0:04:34
482500 -- [-2438.340] (-2441.849) (-2439.188) (-2432.000) * (-2432.452) (-2436.842) (-2431.573) [-2440.159] -- 0:04:33
483000 -- [-2436.165] (-2445.465) (-2430.779) (-2432.616) * (-2433.696) (-2438.670) (-2437.517) [-2435.327] -- 0:04:32
483500 -- [-2425.522] (-2442.617) (-2435.069) (-2444.361) * (-2439.184) (-2439.884) (-2447.659) [-2427.681] -- 0:04:33
484000 -- [-2427.617] (-2449.681) (-2433.671) (-2437.932) * (-2430.468) (-2434.661) (-2434.143) [-2429.535] -- 0:04:32
484500 -- (-2427.851) [-2439.914] (-2440.048) (-2436.023) * [-2430.764] (-2429.338) (-2445.587) (-2438.523) -- 0:04:32
485000 -- [-2429.411] (-2433.238) (-2451.818) (-2424.774) * (-2436.806) [-2428.352] (-2441.258) (-2443.587) -- 0:04:32
Average standard deviation of split frequencies: 0.012416
485500 -- [-2436.791] (-2434.721) (-2440.760) (-2431.688) * (-2445.776) (-2438.596) [-2427.065] (-2439.946) -- 0:04:32
486000 -- (-2444.111) [-2437.250] (-2438.287) (-2438.883) * (-2437.910) (-2436.918) [-2429.248] (-2441.819) -- 0:04:31
486500 -- (-2454.543) (-2435.504) (-2431.494) [-2427.549] * (-2433.531) [-2439.571] (-2438.951) (-2436.366) -- 0:04:31
487000 -- (-2440.572) (-2441.304) (-2426.008) [-2427.315] * (-2429.629) (-2436.377) (-2432.359) [-2424.688] -- 0:04:31
487500 -- [-2434.397] (-2431.885) (-2431.061) (-2439.144) * (-2435.443) [-2442.932] (-2440.197) (-2438.594) -- 0:04:31
488000 -- [-2432.071] (-2439.205) (-2429.452) (-2434.176) * [-2432.636] (-2439.789) (-2448.341) (-2438.846) -- 0:04:30
488500 -- (-2425.208) (-2429.290) (-2441.152) [-2429.238] * (-2430.471) (-2440.405) (-2444.225) [-2432.896] -- 0:04:30
489000 -- [-2430.510] (-2435.768) (-2434.931) (-2427.758) * (-2433.297) (-2434.692) (-2436.053) [-2436.253] -- 0:04:30
489500 -- (-2436.424) [-2432.326] (-2448.212) (-2432.968) * [-2431.835] (-2444.416) (-2436.699) (-2437.063) -- 0:04:30
490000 -- (-2435.640) [-2435.285] (-2439.009) (-2457.344) * (-2430.553) (-2433.467) (-2429.783) [-2434.238] -- 0:04:29
Average standard deviation of split frequencies: 0.011849
490500 -- (-2438.338) [-2435.588] (-2432.480) (-2442.837) * [-2436.203] (-2436.121) (-2433.831) (-2436.174) -- 0:04:29
491000 -- [-2430.908] (-2443.707) (-2445.897) (-2440.819) * [-2442.334] (-2439.722) (-2444.384) (-2431.649) -- 0:04:29
491500 -- (-2435.535) [-2437.114] (-2428.881) (-2442.184) * [-2438.858] (-2451.884) (-2438.202) (-2438.132) -- 0:04:28
492000 -- (-2433.794) (-2428.920) [-2436.041] (-2439.205) * (-2444.217) (-2438.789) (-2434.186) [-2442.848] -- 0:04:28
492500 -- (-2435.899) [-2430.852] (-2442.109) (-2435.223) * [-2439.485] (-2437.232) (-2432.740) (-2429.111) -- 0:04:28
493000 -- (-2441.917) (-2435.999) [-2433.989] (-2446.191) * (-2448.134) (-2431.443) (-2437.587) [-2425.736] -- 0:04:28
493500 -- (-2432.948) (-2440.929) (-2435.756) [-2436.219] * (-2435.451) (-2437.649) (-2436.615) [-2429.073] -- 0:04:27
494000 -- (-2447.135) (-2431.762) (-2435.279) [-2427.712] * [-2438.018] (-2426.649) (-2441.521) (-2429.332) -- 0:04:27
494500 -- (-2430.337) (-2433.455) [-2439.269] (-2439.963) * [-2432.972] (-2436.154) (-2445.536) (-2443.806) -- 0:04:27
495000 -- (-2443.400) [-2436.338] (-2433.595) (-2432.776) * [-2428.493] (-2435.598) (-2434.685) (-2437.487) -- 0:04:27
Average standard deviation of split frequencies: 0.011342
495500 -- (-2431.798) (-2432.447) [-2429.388] (-2425.602) * (-2433.058) [-2430.170] (-2442.592) (-2433.088) -- 0:04:26
496000 -- [-2434.440] (-2454.222) (-2422.844) (-2440.714) * (-2443.730) (-2438.338) (-2439.742) [-2427.393] -- 0:04:26
496500 -- (-2439.324) (-2442.141) [-2432.268] (-2440.776) * (-2434.686) (-2436.672) (-2447.473) [-2426.397] -- 0:04:26
497000 -- (-2437.398) (-2432.287) [-2429.862] (-2431.221) * (-2432.767) [-2431.526] (-2443.991) (-2431.088) -- 0:04:26
497500 -- (-2428.668) (-2438.901) [-2429.526] (-2441.169) * (-2433.747) (-2444.172) [-2434.992] (-2434.573) -- 0:04:25
498000 -- [-2430.948] (-2438.387) (-2433.116) (-2446.736) * (-2440.579) (-2453.585) [-2427.774] (-2431.903) -- 0:04:25
498500 -- (-2432.312) (-2434.238) (-2437.881) [-2440.003] * (-2438.492) [-2433.324] (-2435.539) (-2436.638) -- 0:04:25
499000 -- [-2422.811] (-2426.491) (-2428.598) (-2440.589) * (-2443.734) [-2437.744] (-2451.834) (-2445.362) -- 0:04:25
499500 -- (-2437.501) (-2432.935) [-2431.705] (-2438.536) * (-2440.613) (-2430.881) [-2430.789] (-2440.619) -- 0:04:24
500000 -- (-2443.551) (-2433.495) [-2427.904] (-2444.079) * (-2442.873) [-2429.955] (-2440.140) (-2434.865) -- 0:04:24
Average standard deviation of split frequencies: 0.012177
500500 -- [-2439.144] (-2435.450) (-2439.440) (-2429.862) * (-2444.738) (-2428.892) (-2428.980) [-2441.087] -- 0:04:24
501000 -- (-2449.073) [-2427.235] (-2438.285) (-2436.954) * (-2446.428) (-2448.768) (-2429.339) [-2432.330] -- 0:04:23
501500 -- (-2435.072) [-2428.099] (-2437.962) (-2446.209) * (-2454.075) (-2431.250) (-2434.799) [-2435.585] -- 0:04:23
502000 -- (-2445.378) [-2432.011] (-2439.607) (-2444.806) * (-2435.842) (-2430.341) (-2437.475) [-2429.929] -- 0:04:22
502500 -- (-2436.400) [-2436.555] (-2444.403) (-2444.247) * [-2440.697] (-2432.758) (-2449.077) (-2430.843) -- 0:04:23
503000 -- (-2431.739) [-2430.227] (-2440.506) (-2451.359) * (-2441.973) (-2433.410) (-2431.744) [-2433.990] -- 0:04:22
503500 -- [-2427.616] (-2436.119) (-2444.082) (-2443.586) * (-2439.393) (-2440.979) [-2443.536] (-2436.565) -- 0:04:22
504000 -- (-2430.543) [-2438.880] (-2436.397) (-2443.964) * (-2439.167) (-2440.489) (-2440.506) [-2437.879] -- 0:04:22
504500 -- [-2433.525] (-2432.418) (-2436.167) (-2432.414) * (-2439.731) (-2442.863) [-2437.211] (-2431.513) -- 0:04:22
505000 -- (-2440.768) (-2441.079) (-2437.291) [-2436.952] * (-2439.009) (-2433.616) (-2424.447) [-2435.424] -- 0:04:21
Average standard deviation of split frequencies: 0.012794
505500 -- (-2438.612) [-2435.757] (-2428.748) (-2436.124) * (-2438.581) (-2440.105) [-2432.083] (-2434.759) -- 0:04:21
506000 -- (-2432.918) (-2439.822) (-2428.847) [-2430.310] * (-2433.790) [-2434.204] (-2432.518) (-2432.358) -- 0:04:21
506500 -- (-2435.592) [-2434.980] (-2432.673) (-2442.517) * [-2432.857] (-2441.517) (-2437.454) (-2442.508) -- 0:04:21
507000 -- [-2428.294] (-2433.984) (-2441.195) (-2442.907) * [-2430.917] (-2437.342) (-2434.605) (-2441.005) -- 0:04:20
507500 -- [-2440.476] (-2440.895) (-2433.682) (-2440.483) * (-2439.570) [-2434.692] (-2431.852) (-2433.958) -- 0:04:20
508000 -- [-2437.396] (-2427.741) (-2430.476) (-2448.178) * (-2431.089) [-2428.738] (-2441.696) (-2432.598) -- 0:04:20
508500 -- (-2444.948) (-2437.085) (-2433.931) [-2438.597] * (-2432.222) (-2435.269) [-2430.827] (-2431.451) -- 0:04:20
509000 -- (-2430.601) (-2435.295) (-2427.649) [-2434.407] * [-2434.919] (-2435.075) (-2437.587) (-2438.658) -- 0:04:19
509500 -- (-2439.787) [-2433.912] (-2431.692) (-2440.543) * (-2435.836) (-2431.480) [-2432.757] (-2442.091) -- 0:04:18
510000 -- [-2431.210] (-2441.750) (-2430.807) (-2436.546) * [-2431.204] (-2441.756) (-2442.915) (-2435.198) -- 0:04:19
Average standard deviation of split frequencies: 0.012554
510500 -- (-2437.698) (-2438.608) [-2433.638] (-2436.356) * (-2433.369) [-2427.854] (-2431.722) (-2433.634) -- 0:04:18
511000 -- (-2434.915) (-2437.392) [-2431.638] (-2445.381) * (-2447.232) [-2431.443] (-2441.283) (-2437.663) -- 0:04:18
511500 -- (-2444.209) (-2444.555) [-2430.129] (-2443.491) * (-2441.947) (-2429.570) (-2433.625) [-2429.022] -- 0:04:17
512000 -- (-2423.931) (-2444.726) (-2437.872) [-2429.619] * [-2433.958] (-2434.115) (-2440.578) (-2431.384) -- 0:04:18
512500 -- (-2428.491) [-2429.558] (-2443.963) (-2437.971) * (-2435.654) [-2426.867] (-2434.605) (-2428.428) -- 0:04:17
513000 -- (-2440.624) (-2434.720) [-2436.217] (-2431.320) * [-2424.150] (-2431.562) (-2433.402) (-2435.894) -- 0:04:17
513500 -- (-2434.926) (-2442.806) [-2439.096] (-2443.658) * (-2434.775) (-2431.796) [-2429.367] (-2443.041) -- 0:04:17
514000 -- [-2436.180] (-2445.137) (-2446.961) (-2435.213) * (-2438.941) (-2433.636) [-2437.966] (-2434.626) -- 0:04:17
514500 -- (-2432.801) [-2432.168] (-2441.167) (-2444.903) * (-2433.662) (-2437.554) (-2441.350) [-2434.361] -- 0:04:16
515000 -- (-2432.517) [-2428.002] (-2438.972) (-2450.714) * (-2435.154) (-2439.823) (-2441.360) [-2436.062] -- 0:04:16
Average standard deviation of split frequencies: 0.011207
515500 -- (-2433.700) (-2438.001) (-2428.186) [-2432.495] * (-2440.269) (-2451.014) [-2431.782] (-2447.549) -- 0:04:16
516000 -- [-2431.601] (-2435.337) (-2434.291) (-2432.068) * (-2426.034) (-2451.824) (-2437.266) [-2438.045] -- 0:04:16
516500 -- (-2433.867) (-2435.046) [-2435.814] (-2438.120) * (-2440.139) (-2436.865) [-2427.460] (-2438.464) -- 0:04:15
517000 -- [-2428.882] (-2433.059) (-2439.011) (-2438.978) * (-2442.241) [-2433.021] (-2427.332) (-2439.616) -- 0:04:15
517500 -- (-2434.694) (-2430.432) [-2431.784] (-2440.469) * (-2432.127) [-2430.009] (-2437.111) (-2443.532) -- 0:04:15
518000 -- (-2446.741) [-2445.766] (-2441.365) (-2437.123) * [-2434.691] (-2433.833) (-2444.831) (-2444.550) -- 0:04:14
518500 -- [-2446.051] (-2430.006) (-2439.945) (-2436.418) * [-2429.477] (-2430.484) (-2438.467) (-2431.296) -- 0:04:14
519000 -- (-2444.497) (-2433.362) [-2435.995] (-2432.304) * (-2441.621) [-2433.003] (-2436.061) (-2435.576) -- 0:04:13
519500 -- (-2427.690) (-2440.709) [-2429.688] (-2434.329) * (-2440.353) [-2433.703] (-2439.665) (-2435.322) -- 0:04:14
520000 -- (-2437.497) (-2433.853) [-2436.973] (-2441.534) * (-2442.328) (-2447.623) [-2431.587] (-2431.654) -- 0:04:13
Average standard deviation of split frequencies: 0.010684
520500 -- (-2426.290) (-2432.680) [-2429.131] (-2437.875) * (-2444.780) [-2431.224] (-2429.921) (-2440.232) -- 0:04:13
521000 -- [-2429.117] (-2438.023) (-2440.345) (-2450.219) * (-2444.123) [-2431.885] (-2437.850) (-2426.493) -- 0:04:12
521500 -- (-2442.872) (-2434.035) [-2432.250] (-2434.276) * [-2432.865] (-2433.721) (-2439.538) (-2442.174) -- 0:04:13
522000 -- [-2437.787] (-2433.660) (-2442.469) (-2439.539) * (-2436.119) [-2435.616] (-2442.435) (-2444.992) -- 0:04:12
522500 -- (-2436.671) [-2425.115] (-2439.338) (-2440.853) * (-2438.058) [-2432.700] (-2435.849) (-2430.842) -- 0:04:12
523000 -- (-2437.533) [-2427.881] (-2430.839) (-2444.562) * (-2457.380) (-2442.240) [-2429.515] (-2444.115) -- 0:04:12
523500 -- (-2437.225) [-2431.641] (-2443.677) (-2441.335) * (-2432.977) (-2434.853) (-2437.419) [-2437.786] -- 0:04:12
524000 -- (-2433.613) [-2438.943] (-2435.828) (-2446.750) * [-2441.096] (-2438.991) (-2439.815) (-2443.705) -- 0:04:11
524500 -- (-2436.276) (-2428.097) [-2438.092] (-2447.854) * (-2437.962) [-2439.754] (-2454.179) (-2437.777) -- 0:04:11
525000 -- (-2431.460) [-2430.875] (-2437.065) (-2437.451) * (-2435.084) (-2432.099) [-2431.394] (-2432.245) -- 0:04:11
Average standard deviation of split frequencies: 0.009978
525500 -- [-2427.210] (-2443.200) (-2444.609) (-2440.030) * (-2436.336) [-2434.947] (-2437.339) (-2436.482) -- 0:04:11
526000 -- (-2439.845) [-2433.929] (-2437.826) (-2445.669) * (-2431.565) (-2425.044) [-2427.557] (-2445.564) -- 0:04:10
526500 -- (-2432.689) (-2430.789) (-2436.339) [-2442.722] * (-2431.506) (-2430.956) [-2434.968] (-2439.422) -- 0:04:10
527000 -- (-2433.195) (-2442.954) (-2429.442) [-2438.613] * (-2450.665) (-2432.056) [-2427.050] (-2428.652) -- 0:04:10
527500 -- (-2428.199) (-2437.978) [-2440.223] (-2440.164) * (-2435.110) (-2444.781) (-2430.891) [-2431.478] -- 0:04:09
528000 -- (-2445.744) [-2435.684] (-2429.420) (-2434.664) * (-2431.669) (-2432.627) [-2437.942] (-2435.748) -- 0:04:09
528500 -- [-2433.529] (-2446.986) (-2425.384) (-2437.140) * (-2441.437) (-2430.784) (-2439.403) [-2427.965] -- 0:04:08
529000 -- (-2430.812) (-2435.379) (-2440.598) [-2425.867] * (-2437.719) (-2433.056) (-2440.492) [-2432.728] -- 0:04:09
529500 -- (-2443.559) [-2435.738] (-2433.412) (-2427.029) * (-2438.088) (-2433.695) (-2429.632) [-2432.592] -- 0:04:08
530000 -- (-2441.302) [-2432.526] (-2431.093) (-2436.710) * (-2436.662) (-2436.182) [-2431.345] (-2427.454) -- 0:04:08
Average standard deviation of split frequencies: 0.010245
530500 -- (-2441.232) [-2429.334] (-2446.429) (-2438.745) * [-2429.024] (-2443.109) (-2443.462) (-2426.734) -- 0:04:07
531000 -- (-2438.558) [-2430.876] (-2437.580) (-2427.573) * [-2427.722] (-2446.496) (-2432.531) (-2438.825) -- 0:04:08
531500 -- (-2451.849) (-2430.056) (-2438.217) [-2435.472] * (-2432.891) (-2443.402) (-2433.147) [-2431.450] -- 0:04:07
532000 -- (-2429.736) (-2432.835) (-2453.707) [-2430.586] * (-2438.305) [-2434.065] (-2434.711) (-2431.374) -- 0:04:07
532500 -- (-2436.797) (-2430.791) (-2447.765) [-2431.320] * (-2442.952) (-2438.050) [-2435.206] (-2429.588) -- 0:04:07
533000 -- (-2433.919) (-2435.483) [-2432.022] (-2433.112) * (-2434.844) (-2440.058) (-2431.298) [-2427.323] -- 0:04:07
533500 -- (-2442.185) (-2432.678) (-2434.032) [-2432.434] * (-2435.481) (-2441.866) (-2433.886) [-2430.276] -- 0:04:06
534000 -- (-2443.299) (-2436.553) [-2424.871] (-2432.286) * (-2435.226) (-2442.567) (-2438.083) [-2438.364] -- 0:04:06
534500 -- [-2433.743] (-2444.531) (-2434.087) (-2429.664) * (-2438.265) [-2429.606] (-2431.757) (-2430.677) -- 0:04:06
535000 -- (-2439.297) (-2427.729) [-2433.501] (-2441.511) * [-2441.164] (-2431.446) (-2440.326) (-2441.056) -- 0:04:05
Average standard deviation of split frequencies: 0.010495
535500 -- (-2442.759) [-2432.233] (-2427.718) (-2449.337) * (-2433.723) (-2433.333) [-2425.127] (-2441.683) -- 0:04:05
536000 -- [-2436.037] (-2447.209) (-2433.614) (-2452.431) * (-2439.867) [-2433.766] (-2432.800) (-2447.655) -- 0:04:04
536500 -- (-2438.588) (-2435.524) [-2438.256] (-2440.420) * (-2440.759) [-2427.409] (-2430.313) (-2442.203) -- 0:04:05
537000 -- (-2449.287) (-2429.818) [-2438.604] (-2437.427) * (-2436.224) (-2427.653) [-2445.070] (-2437.911) -- 0:04:04
537500 -- (-2436.435) (-2435.110) (-2429.539) [-2434.374] * [-2431.244] (-2440.842) (-2433.364) (-2437.882) -- 0:04:04
538000 -- (-2442.026) [-2434.936] (-2443.177) (-2447.632) * (-2430.576) (-2441.871) (-2435.809) [-2434.893] -- 0:04:03
538500 -- (-2430.489) (-2433.763) (-2438.964) [-2439.646] * (-2429.738) (-2439.890) (-2443.779) [-2442.196] -- 0:04:04
539000 -- (-2436.550) (-2443.470) [-2428.543] (-2434.562) * (-2436.533) (-2436.332) (-2438.443) [-2425.526] -- 0:04:03
539500 -- (-2441.719) [-2441.467] (-2435.654) (-2449.813) * (-2435.203) (-2440.837) (-2440.285) [-2428.152] -- 0:04:03
540000 -- (-2436.096) (-2430.303) [-2436.648] (-2437.576) * (-2435.618) (-2436.837) (-2441.855) [-2435.040] -- 0:04:02
Average standard deviation of split frequencies: 0.010114
540500 -- [-2440.990] (-2440.526) (-2443.520) (-2432.946) * [-2428.448] (-2439.302) (-2438.783) (-2437.850) -- 0:04:03
541000 -- (-2441.095) (-2435.971) [-2434.546] (-2432.365) * [-2429.952] (-2444.399) (-2427.154) (-2431.235) -- 0:04:02
541500 -- [-2434.653] (-2443.905) (-2438.756) (-2433.021) * [-2433.576] (-2441.147) (-2430.080) (-2440.025) -- 0:04:02
542000 -- (-2431.906) (-2441.424) (-2433.888) [-2437.373] * (-2441.777) [-2437.759] (-2429.769) (-2430.703) -- 0:04:02
542500 -- (-2441.668) [-2439.647] (-2432.041) (-2443.270) * (-2436.827) (-2432.174) (-2442.277) [-2432.439] -- 0:04:02
543000 -- (-2437.704) [-2430.327] (-2425.870) (-2444.749) * (-2433.910) (-2439.408) (-2445.790) [-2433.447] -- 0:04:01
543500 -- (-2440.369) (-2434.908) [-2423.705] (-2434.537) * [-2439.728] (-2435.406) (-2439.854) (-2437.383) -- 0:04:01
544000 -- [-2428.906] (-2441.518) (-2435.021) (-2443.095) * (-2433.117) (-2440.157) (-2443.110) [-2430.313] -- 0:04:01
544500 -- (-2433.889) (-2436.377) [-2432.237] (-2429.685) * (-2434.316) (-2445.294) (-2437.534) [-2434.260] -- 0:04:00
545000 -- (-2448.523) (-2433.736) [-2431.669] (-2435.000) * [-2432.694] (-2434.600) (-2439.067) (-2442.476) -- 0:04:00
Average standard deviation of split frequencies: 0.009612
545500 -- (-2433.706) [-2429.613] (-2429.738) (-2430.648) * [-2428.430] (-2430.842) (-2431.872) (-2436.851) -- 0:03:59
546000 -- (-2437.685) (-2446.796) (-2438.653) [-2436.604] * (-2436.609) [-2432.215] (-2429.518) (-2445.739) -- 0:04:00
546500 -- (-2439.315) (-2444.498) (-2434.388) [-2432.080] * (-2432.757) [-2431.667] (-2434.085) (-2440.234) -- 0:03:59
547000 -- (-2443.905) (-2431.153) (-2433.620) [-2429.292] * [-2431.733] (-2436.751) (-2435.447) (-2435.544) -- 0:03:59
547500 -- [-2434.767] (-2444.799) (-2443.769) (-2435.581) * [-2432.613] (-2436.012) (-2446.366) (-2434.208) -- 0:03:58
548000 -- [-2432.226] (-2438.265) (-2432.022) (-2432.964) * (-2444.828) [-2432.238] (-2440.245) (-2435.177) -- 0:03:59
548500 -- [-2428.889] (-2445.825) (-2438.385) (-2434.473) * (-2428.126) [-2429.291] (-2437.609) (-2445.427) -- 0:03:58
549000 -- (-2431.785) [-2437.222] (-2443.309) (-2433.049) * (-2444.475) (-2435.171) (-2445.745) [-2434.750] -- 0:03:58
549500 -- (-2425.103) [-2430.584] (-2434.860) (-2439.051) * (-2440.155) [-2436.224] (-2435.024) (-2432.759) -- 0:03:58
550000 -- (-2438.237) [-2433.948] (-2439.100) (-2435.116) * (-2436.923) [-2440.356] (-2440.280) (-2442.173) -- 0:03:58
Average standard deviation of split frequencies: 0.009360
550500 -- (-2440.994) [-2440.330] (-2436.941) (-2446.419) * (-2442.189) (-2435.720) [-2440.413] (-2445.732) -- 0:03:57
551000 -- (-2436.703) (-2438.542) [-2438.521] (-2439.767) * (-2433.078) (-2436.224) [-2436.681] (-2442.488) -- 0:03:57
551500 -- (-2425.291) [-2433.109] (-2440.214) (-2454.355) * [-2438.511] (-2437.586) (-2425.813) (-2440.330) -- 0:03:57
552000 -- (-2430.363) [-2435.376] (-2440.559) (-2431.141) * (-2435.238) (-2441.519) [-2436.748] (-2436.777) -- 0:03:56
552500 -- (-2439.672) [-2432.377] (-2432.414) (-2435.544) * (-2435.854) [-2429.655] (-2432.818) (-2438.925) -- 0:03:56
553000 -- (-2428.170) (-2440.138) (-2433.838) [-2430.611] * (-2432.759) (-2437.581) [-2437.768] (-2437.020) -- 0:03:56
553500 -- [-2427.466] (-2439.236) (-2439.420) (-2432.748) * (-2440.659) (-2439.606) (-2433.492) [-2428.252] -- 0:03:56
554000 -- (-2437.921) (-2434.183) (-2438.701) [-2429.555] * (-2437.139) (-2450.426) [-2436.336] (-2432.649) -- 0:03:55
554500 -- (-2441.778) (-2432.350) [-2434.616] (-2438.439) * (-2433.188) (-2433.690) (-2434.268) [-2428.461] -- 0:03:55
555000 -- (-2441.436) (-2441.545) [-2425.369] (-2438.426) * (-2435.126) [-2430.730] (-2443.850) (-2427.822) -- 0:03:54
Average standard deviation of split frequencies: 0.010005
555500 -- (-2440.357) (-2442.360) (-2429.769) [-2430.376] * (-2437.178) [-2428.181] (-2440.451) (-2439.051) -- 0:03:55
556000 -- (-2438.954) (-2437.336) (-2439.739) [-2429.747] * (-2434.605) (-2427.439) [-2434.642] (-2432.486) -- 0:03:54
556500 -- (-2441.718) (-2439.898) (-2430.419) [-2425.174] * (-2430.766) [-2428.793] (-2440.208) (-2436.710) -- 0:03:54
557000 -- (-2442.986) (-2441.815) (-2436.786) [-2434.921] * (-2448.030) [-2437.024] (-2438.579) (-2442.416) -- 0:03:53
557500 -- (-2429.152) (-2436.588) [-2430.927] (-2436.212) * (-2434.200) [-2433.319] (-2439.020) (-2433.483) -- 0:03:54
558000 -- (-2438.530) [-2430.914] (-2436.939) (-2440.843) * (-2433.424) (-2436.709) [-2438.450] (-2442.234) -- 0:03:53
558500 -- (-2430.634) [-2433.501] (-2444.812) (-2432.753) * (-2449.834) (-2435.228) [-2432.542] (-2441.082) -- 0:03:53
559000 -- [-2431.047] (-2438.734) (-2441.729) (-2437.512) * (-2442.021) [-2434.467] (-2439.756) (-2435.387) -- 0:03:52
559500 -- (-2434.393) [-2435.169] (-2432.034) (-2438.625) * [-2434.845] (-2434.776) (-2433.368) (-2444.913) -- 0:03:53
560000 -- (-2443.021) (-2435.082) (-2432.480) [-2430.378] * [-2431.709] (-2432.940) (-2440.961) (-2439.898) -- 0:03:52
Average standard deviation of split frequencies: 0.009977
560500 -- [-2435.183] (-2439.440) (-2447.500) (-2436.183) * [-2439.012] (-2437.077) (-2435.502) (-2436.831) -- 0:03:52
561000 -- (-2428.243) (-2444.543) (-2435.008) [-2442.415] * (-2431.126) (-2428.317) (-2436.592) [-2433.251] -- 0:03:52
561500 -- (-2439.840) (-2443.203) [-2428.583] (-2439.528) * (-2431.319) (-2434.697) [-2434.533] (-2438.666) -- 0:03:51
562000 -- (-2439.072) [-2436.118] (-2437.356) (-2440.397) * [-2432.930] (-2434.033) (-2431.676) (-2437.398) -- 0:03:51
562500 -- (-2437.914) (-2436.856) [-2434.637] (-2439.585) * [-2434.239] (-2429.650) (-2430.439) (-2442.056) -- 0:03:51
563000 -- [-2431.635] (-2445.157) (-2436.732) (-2440.043) * (-2434.348) [-2429.494] (-2434.578) (-2438.401) -- 0:03:51
563500 -- (-2433.452) (-2438.415) [-2433.123] (-2443.056) * (-2428.455) (-2451.029) [-2439.975] (-2439.970) -- 0:03:50
564000 -- (-2438.860) [-2432.143] (-2429.625) (-2434.884) * (-2454.468) (-2437.421) [-2428.348] (-2435.449) -- 0:03:50
564500 -- (-2435.620) (-2438.301) (-2429.238) [-2440.757] * (-2446.861) (-2433.922) [-2429.927] (-2434.565) -- 0:03:49
565000 -- (-2445.445) (-2435.633) (-2432.123) [-2439.195] * (-2444.256) (-2435.832) [-2439.809] (-2437.615) -- 0:03:50
Average standard deviation of split frequencies: 0.009994
565500 -- (-2427.975) (-2440.782) [-2437.608] (-2437.059) * (-2446.686) [-2434.141] (-2436.238) (-2432.610) -- 0:03:49
566000 -- (-2444.281) [-2436.773] (-2435.218) (-2432.878) * (-2438.490) (-2439.021) (-2446.306) [-2434.313] -- 0:03:49
566500 -- [-2425.989] (-2433.371) (-2431.064) (-2435.401) * (-2432.716) (-2434.734) [-2434.139] (-2436.061) -- 0:03:48
567000 -- (-2436.091) [-2438.071] (-2437.672) (-2432.425) * (-2442.291) (-2428.633) (-2433.870) [-2434.597] -- 0:03:49
567500 -- (-2434.654) (-2432.583) [-2431.983] (-2435.565) * (-2438.602) [-2431.790] (-2432.824) (-2439.538) -- 0:03:48
568000 -- [-2432.646] (-2438.723) (-2432.266) (-2430.918) * (-2431.358) (-2431.710) (-2436.396) [-2431.465] -- 0:03:48
568500 -- [-2435.215] (-2438.636) (-2427.969) (-2437.307) * (-2431.991) (-2430.303) (-2440.455) [-2432.265] -- 0:03:47
569000 -- (-2435.812) (-2436.941) [-2425.905] (-2436.517) * (-2431.974) (-2444.608) (-2432.625) [-2432.668] -- 0:03:47
569500 -- (-2433.859) (-2440.118) [-2437.062] (-2432.236) * [-2433.584] (-2431.113) (-2443.217) (-2437.768) -- 0:03:47
570000 -- (-2433.100) (-2441.334) [-2430.402] (-2443.499) * (-2446.010) [-2432.130] (-2435.231) (-2436.991) -- 0:03:47
Average standard deviation of split frequencies: 0.009858
570500 -- (-2427.977) [-2428.255] (-2434.156) (-2432.957) * (-2431.963) (-2443.202) [-2429.379] (-2434.797) -- 0:03:47
571000 -- (-2423.332) (-2439.604) (-2441.824) [-2429.560] * [-2434.725] (-2431.755) (-2442.968) (-2434.401) -- 0:03:46
571500 -- [-2425.384] (-2430.247) (-2444.412) (-2433.381) * (-2437.121) [-2434.518] (-2428.378) (-2440.232) -- 0:03:46
572000 -- (-2438.075) (-2428.992) [-2431.920] (-2439.097) * [-2429.085] (-2431.412) (-2436.031) (-2431.972) -- 0:03:45
572500 -- (-2431.635) [-2433.433] (-2437.106) (-2439.694) * [-2432.575] (-2449.462) (-2435.539) (-2432.344) -- 0:03:46
573000 -- (-2432.626) (-2441.950) [-2433.241] (-2443.677) * (-2428.858) (-2439.247) (-2431.491) [-2431.960] -- 0:03:45
573500 -- (-2435.379) [-2437.260] (-2436.833) (-2441.970) * (-2432.357) (-2438.815) (-2425.857) [-2432.639] -- 0:03:45
574000 -- [-2435.742] (-2433.966) (-2443.861) (-2446.641) * (-2431.692) [-2430.066] (-2445.423) (-2431.350) -- 0:03:44
574500 -- (-2430.472) (-2430.118) (-2443.181) [-2435.063] * (-2434.620) [-2439.483] (-2442.982) (-2434.402) -- 0:03:45
575000 -- (-2440.917) (-2427.613) (-2438.998) [-2432.868] * (-2430.669) (-2438.387) (-2433.628) [-2432.946] -- 0:03:44
Average standard deviation of split frequencies: 0.009384
575500 -- (-2432.579) (-2434.723) (-2452.337) [-2431.996] * (-2443.443) (-2438.454) [-2427.548] (-2447.183) -- 0:03:44
576000 -- (-2433.289) (-2444.803) [-2435.832] (-2437.352) * (-2442.301) (-2447.775) (-2444.817) [-2436.388] -- 0:03:43
576500 -- [-2431.989] (-2436.396) (-2430.257) (-2434.612) * (-2439.892) (-2435.520) [-2433.014] (-2442.053) -- 0:03:44
577000 -- [-2433.715] (-2433.046) (-2443.438) (-2437.114) * (-2436.836) [-2428.699] (-2436.645) (-2441.527) -- 0:03:43
577500 -- (-2439.780) (-2441.932) (-2450.104) [-2435.893] * (-2456.203) (-2439.296) (-2442.883) [-2427.570] -- 0:03:43
578000 -- [-2436.698] (-2429.003) (-2439.039) (-2440.768) * (-2441.971) (-2437.599) [-2430.520] (-2435.704) -- 0:03:42
578500 -- (-2435.511) (-2440.608) (-2432.104) [-2432.150] * (-2440.975) (-2444.270) (-2432.590) [-2433.560] -- 0:03:42
579000 -- [-2428.301] (-2441.042) (-2448.597) (-2443.484) * [-2434.425] (-2437.311) (-2431.063) (-2447.929) -- 0:03:42
579500 -- (-2435.736) [-2427.116] (-2436.582) (-2429.309) * (-2442.496) (-2438.760) [-2424.353] (-2438.513) -- 0:03:42
580000 -- (-2434.331) (-2441.494) (-2434.805) [-2443.174] * (-2436.186) (-2436.591) [-2430.412] (-2443.003) -- 0:03:41
Average standard deviation of split frequencies: 0.008930
580500 -- (-2431.189) (-2446.600) (-2433.032) [-2433.195] * (-2438.372) (-2433.761) (-2438.571) [-2429.046] -- 0:03:41
581000 -- (-2435.380) (-2440.515) [-2436.461] (-2442.701) * (-2441.188) (-2436.712) [-2433.813] (-2441.794) -- 0:03:41
581500 -- (-2450.121) (-2431.464) [-2432.258] (-2433.629) * (-2430.288) [-2429.869] (-2446.418) (-2439.092) -- 0:03:40
582000 -- (-2435.026) (-2435.552) [-2446.702] (-2433.720) * (-2435.962) (-2436.619) [-2432.468] (-2444.006) -- 0:03:41
582500 -- (-2447.227) (-2442.271) (-2433.340) [-2434.017] * (-2433.322) (-2433.131) [-2430.610] (-2447.909) -- 0:03:40
583000 -- (-2429.154) (-2430.896) [-2438.166] (-2433.450) * [-2427.649] (-2440.134) (-2433.174) (-2442.452) -- 0:03:40
583500 -- [-2432.102] (-2434.619) (-2436.297) (-2430.390) * (-2452.744) [-2442.882] (-2425.384) (-2445.497) -- 0:03:39
584000 -- [-2428.932] (-2439.358) (-2437.118) (-2435.736) * (-2443.428) (-2431.276) [-2426.418] (-2436.970) -- 0:03:40
584500 -- (-2437.103) (-2441.344) (-2442.907) [-2429.266] * (-2438.209) (-2441.605) [-2430.352] (-2430.201) -- 0:03:39
585000 -- (-2444.935) (-2436.148) [-2438.724] (-2427.425) * (-2437.173) (-2440.074) (-2430.842) [-2424.788] -- 0:03:39
Average standard deviation of split frequencies: 0.009063
585500 -- (-2451.021) [-2435.356] (-2444.842) (-2432.827) * [-2441.005] (-2437.706) (-2427.625) (-2440.361) -- 0:03:38
586000 -- (-2435.750) (-2433.836) [-2433.918] (-2426.112) * (-2433.415) (-2436.282) [-2436.232] (-2439.114) -- 0:03:39
586500 -- (-2436.811) (-2441.768) (-2439.570) [-2420.771] * (-2429.409) [-2424.589] (-2447.359) (-2448.643) -- 0:03:38
587000 -- (-2440.738) (-2452.860) (-2435.005) [-2434.950] * (-2438.750) (-2432.926) [-2432.353] (-2432.541) -- 0:03:38
587500 -- (-2439.602) [-2439.978] (-2439.357) (-2437.252) * (-2441.320) (-2433.141) [-2427.618] (-2433.712) -- 0:03:37
588000 -- (-2445.790) (-2435.437) (-2431.868) [-2431.343] * [-2434.776] (-2429.651) (-2440.572) (-2441.963) -- 0:03:37
588500 -- [-2437.449] (-2437.428) (-2441.023) (-2441.721) * (-2435.905) (-2427.465) (-2432.998) [-2436.686] -- 0:03:37
589000 -- (-2440.734) (-2433.895) [-2441.608] (-2438.809) * (-2439.681) (-2426.171) (-2432.392) [-2438.250] -- 0:03:37
589500 -- [-2434.314] (-2437.128) (-2443.309) (-2444.033) * [-2425.078] (-2442.335) (-2424.049) (-2431.541) -- 0:03:36
590000 -- [-2427.107] (-2442.649) (-2434.024) (-2439.791) * (-2438.399) (-2431.605) (-2427.860) [-2433.275] -- 0:03:36
Average standard deviation of split frequencies: 0.009045
590500 -- (-2431.485) (-2437.761) (-2438.284) [-2428.552] * (-2435.807) [-2429.126] (-2429.349) (-2446.831) -- 0:03:36
591000 -- (-2429.316) (-2434.066) [-2441.338] (-2442.170) * (-2445.789) [-2428.208] (-2433.154) (-2438.167) -- 0:03:35
591500 -- (-2430.074) (-2435.422) (-2436.030) [-2433.578] * (-2437.502) [-2436.703] (-2424.078) (-2440.954) -- 0:03:36
592000 -- [-2430.762] (-2433.703) (-2447.486) (-2430.799) * (-2443.287) (-2439.573) [-2435.740] (-2428.834) -- 0:03:35
592500 -- [-2426.049] (-2438.618) (-2439.461) (-2435.734) * [-2434.660] (-2439.677) (-2435.679) (-2432.450) -- 0:03:35
593000 -- [-2431.792] (-2447.617) (-2441.256) (-2429.838) * (-2443.002) [-2429.364] (-2445.314) (-2432.661) -- 0:03:34
593500 -- (-2439.179) (-2433.989) (-2432.237) [-2436.627] * (-2435.272) (-2432.969) (-2432.634) [-2429.901] -- 0:03:35
594000 -- [-2430.960] (-2434.900) (-2436.500) (-2441.829) * (-2438.842) [-2428.943] (-2448.647) (-2436.934) -- 0:03:34
594500 -- (-2433.764) (-2433.922) (-2431.357) [-2427.265] * (-2430.222) [-2433.059] (-2441.500) (-2433.422) -- 0:03:34
595000 -- (-2426.549) (-2435.548) (-2443.821) [-2439.299] * (-2436.461) (-2429.340) [-2428.640] (-2432.279) -- 0:03:33
Average standard deviation of split frequencies: 0.008753
595500 -- (-2431.392) [-2431.700] (-2437.247) (-2443.295) * (-2433.813) [-2433.420] (-2430.239) (-2443.723) -- 0:03:33
596000 -- [-2429.530] (-2439.133) (-2437.733) (-2437.801) * (-2434.757) (-2429.533) [-2432.839] (-2445.043) -- 0:03:33
596500 -- (-2437.763) [-2431.378] (-2427.260) (-2443.270) * (-2455.246) (-2431.376) [-2431.691] (-2446.921) -- 0:03:33
597000 -- (-2437.125) (-2433.769) (-2431.434) [-2427.827] * (-2439.981) (-2436.418) [-2433.328] (-2433.510) -- 0:03:32
597500 -- (-2431.695) (-2437.277) (-2430.542) [-2430.675] * (-2449.251) (-2441.747) [-2428.617] (-2437.309) -- 0:03:32
598000 -- (-2449.424) [-2431.245] (-2429.990) (-2435.956) * (-2439.001) [-2429.608] (-2429.950) (-2432.586) -- 0:03:32
598500 -- (-2444.556) [-2428.761] (-2436.339) (-2440.834) * [-2435.726] (-2443.586) (-2434.131) (-2446.298) -- 0:03:31
599000 -- (-2440.179) (-2439.035) (-2434.626) [-2427.504] * (-2432.866) (-2437.474) [-2428.842] (-2440.701) -- 0:03:31
599500 -- (-2439.568) (-2432.746) (-2429.296) [-2426.047] * (-2440.400) (-2455.619) (-2434.371) [-2431.580] -- 0:03:31
600000 -- (-2431.580) (-2431.178) (-2441.482) [-2425.341] * (-2437.258) [-2429.922] (-2439.600) (-2433.328) -- 0:03:31
Average standard deviation of split frequencies: 0.007953
600500 -- (-2438.817) (-2432.551) (-2440.071) [-2436.053] * (-2430.187) (-2446.453) (-2439.906) [-2429.648] -- 0:03:30
601000 -- (-2449.412) [-2432.325] (-2430.021) (-2440.159) * (-2434.244) [-2440.364] (-2434.654) (-2435.150) -- 0:03:31
601500 -- (-2443.089) (-2431.999) (-2436.316) [-2439.448] * (-2433.271) [-2431.395] (-2440.088) (-2435.550) -- 0:03:30
602000 -- (-2437.528) [-2432.780] (-2431.886) (-2433.979) * (-2442.345) (-2440.097) (-2440.303) [-2437.797] -- 0:03:30
602500 -- (-2426.942) [-2433.103] (-2437.351) (-2433.035) * (-2432.325) (-2439.329) (-2431.301) [-2433.106] -- 0:03:29
603000 -- (-2433.320) (-2450.122) (-2443.211) [-2435.479] * (-2447.059) (-2440.416) [-2431.107] (-2434.902) -- 0:03:30
603500 -- (-2432.592) (-2435.543) [-2437.848] (-2437.682) * [-2437.265] (-2443.793) (-2438.032) (-2446.366) -- 0:03:29
604000 -- (-2430.728) [-2430.391] (-2436.251) (-2431.559) * (-2431.305) (-2439.570) [-2430.487] (-2432.161) -- 0:03:29
604500 -- (-2436.167) (-2435.876) (-2436.200) [-2426.782] * (-2442.175) (-2446.555) [-2430.091] (-2442.999) -- 0:03:28
605000 -- (-2431.331) (-2436.487) (-2433.505) [-2433.333] * (-2436.363) (-2443.035) (-2430.886) [-2429.105] -- 0:03:28
Average standard deviation of split frequencies: 0.007883
605500 -- [-2427.846] (-2443.462) (-2431.602) (-2431.368) * [-2437.811] (-2444.923) (-2434.482) (-2437.358) -- 0:03:28
606000 -- (-2440.472) (-2436.972) [-2437.861] (-2431.662) * (-2432.401) (-2437.167) (-2433.419) [-2434.783] -- 0:03:28
606500 -- (-2438.410) [-2435.469] (-2440.437) (-2441.974) * (-2425.885) (-2432.281) (-2438.488) [-2436.285] -- 0:03:27
607000 -- [-2433.517] (-2435.225) (-2435.428) (-2438.379) * (-2438.644) (-2433.341) (-2435.680) [-2432.320] -- 0:03:27
607500 -- (-2442.534) [-2434.291] (-2432.924) (-2433.440) * [-2437.973] (-2431.399) (-2428.508) (-2435.880) -- 0:03:27
608000 -- (-2430.481) [-2432.683] (-2431.054) (-2450.370) * (-2429.776) [-2435.155] (-2432.092) (-2431.076) -- 0:03:26
608500 -- (-2446.771) (-2429.651) [-2433.119] (-2433.854) * (-2438.285) (-2434.234) (-2437.213) [-2436.374] -- 0:03:26
609000 -- (-2446.133) [-2435.780] (-2439.450) (-2432.787) * (-2441.156) (-2433.342) [-2433.261] (-2438.308) -- 0:03:26
609500 -- [-2435.186] (-2434.122) (-2439.147) (-2430.946) * (-2439.838) (-2441.078) (-2434.568) [-2439.950] -- 0:03:26
610000 -- [-2439.899] (-2442.024) (-2446.541) (-2442.124) * (-2436.993) (-2433.014) (-2448.029) [-2441.887] -- 0:03:25
Average standard deviation of split frequencies: 0.008028
610500 -- (-2442.025) (-2434.799) [-2442.716] (-2438.304) * [-2434.686] (-2436.214) (-2435.217) (-2433.697) -- 0:03:26
611000 -- (-2433.606) [-2426.812] (-2445.486) (-2439.216) * (-2443.834) (-2440.065) [-2432.083] (-2435.526) -- 0:03:25
611500 -- (-2437.946) (-2435.920) (-2427.985) [-2440.319] * (-2445.849) [-2436.407] (-2432.349) (-2440.723) -- 0:03:25
612000 -- [-2430.476] (-2436.451) (-2441.150) (-2442.816) * (-2433.526) [-2438.192] (-2434.390) (-2439.919) -- 0:03:24
612500 -- (-2429.795) (-2437.985) [-2427.555] (-2427.922) * (-2434.763) (-2442.478) [-2432.856] (-2431.208) -- 0:03:24
613000 -- (-2434.214) [-2428.104] (-2439.600) (-2429.566) * [-2431.285] (-2442.866) (-2438.102) (-2436.864) -- 0:03:24
613500 -- (-2442.938) (-2430.980) (-2435.587) [-2423.074] * (-2432.205) (-2447.063) [-2434.736] (-2434.345) -- 0:03:24
614000 -- (-2449.730) (-2434.509) (-2437.947) [-2427.431] * [-2437.248] (-2443.465) (-2438.779) (-2440.036) -- 0:03:23
614500 -- [-2439.688] (-2433.508) (-2439.982) (-2442.424) * (-2439.508) [-2432.260] (-2444.721) (-2437.212) -- 0:03:23
615000 -- (-2432.062) (-2442.999) [-2433.099] (-2450.428) * (-2434.353) (-2433.344) (-2434.656) [-2437.628] -- 0:03:23
Average standard deviation of split frequencies: 0.008214
615500 -- (-2435.776) (-2436.217) (-2437.757) [-2439.683] * (-2435.119) (-2447.855) [-2444.180] (-2450.755) -- 0:03:23
616000 -- (-2435.186) (-2429.054) [-2440.760] (-2445.331) * (-2433.174) (-2442.305) (-2453.853) [-2433.742] -- 0:03:22
616500 -- (-2428.859) [-2427.445] (-2433.399) (-2441.620) * (-2429.492) (-2436.703) [-2425.724] (-2436.227) -- 0:03:22
617000 -- (-2436.454) (-2433.013) [-2431.096] (-2443.663) * (-2435.916) [-2435.558] (-2436.330) (-2435.433) -- 0:03:22
617500 -- (-2434.760) [-2430.897] (-2431.067) (-2438.874) * (-2440.417) [-2429.886] (-2434.636) (-2432.339) -- 0:03:21
618000 -- (-2437.178) (-2437.643) [-2429.123] (-2434.065) * (-2445.011) [-2428.471] (-2437.997) (-2436.696) -- 0:03:21
618500 -- (-2427.538) (-2445.754) [-2433.140] (-2438.123) * [-2430.917] (-2431.803) (-2428.154) (-2433.227) -- 0:03:21
619000 -- (-2433.087) (-2440.944) (-2437.551) [-2429.555] * (-2438.460) (-2438.340) [-2428.854] (-2431.302) -- 0:03:21
619500 -- (-2432.993) (-2445.816) (-2443.065) [-2436.644] * (-2437.288) (-2436.553) (-2433.923) [-2426.683] -- 0:03:20
620000 -- (-2438.168) (-2440.414) (-2446.072) [-2429.968] * (-2443.313) (-2433.611) [-2428.951] (-2431.401) -- 0:03:20
Average standard deviation of split frequencies: 0.008203
620500 -- (-2437.446) (-2427.922) (-2442.608) [-2436.545] * (-2452.293) [-2425.165] (-2441.233) (-2429.884) -- 0:03:20
621000 -- (-2431.733) (-2433.649) (-2445.230) [-2431.061] * (-2437.949) (-2436.355) (-2431.284) [-2434.917] -- 0:03:20
621500 -- (-2434.429) (-2433.643) [-2427.324] (-2442.778) * (-2433.806) (-2450.998) (-2440.266) [-2435.283] -- 0:03:19
622000 -- [-2436.902] (-2439.139) (-2427.561) (-2452.049) * (-2438.292) (-2445.679) (-2431.878) [-2433.305] -- 0:03:19
622500 -- (-2446.575) (-2439.591) [-2435.171] (-2439.513) * (-2433.035) (-2433.730) (-2428.712) [-2436.215] -- 0:03:19
623000 -- [-2435.007] (-2435.160) (-2430.900) (-2445.280) * (-2441.433) (-2423.660) [-2435.470] (-2445.271) -- 0:03:19
623500 -- [-2433.721] (-2431.161) (-2434.482) (-2434.593) * (-2439.817) [-2434.069] (-2431.725) (-2447.135) -- 0:03:18
624000 -- [-2435.786] (-2441.540) (-2455.763) (-2436.831) * (-2442.107) (-2435.689) (-2430.108) [-2434.716] -- 0:03:18
624500 -- [-2434.854] (-2446.325) (-2446.471) (-2448.696) * (-2432.311) (-2440.053) [-2432.140] (-2441.976) -- 0:03:18
625000 -- (-2444.908) (-2436.096) [-2434.178] (-2431.795) * (-2449.531) (-2429.983) (-2428.843) [-2436.513] -- 0:03:18
Average standard deviation of split frequencies: 0.008233
625500 -- [-2433.936] (-2432.440) (-2433.820) (-2443.201) * (-2440.327) (-2447.574) (-2437.633) [-2435.253] -- 0:03:17
626000 -- [-2435.417] (-2449.512) (-2447.884) (-2432.893) * (-2459.194) (-2433.072) (-2435.586) [-2435.082] -- 0:03:17
626500 -- (-2436.620) [-2435.513] (-2437.040) (-2437.493) * (-2430.334) (-2446.841) (-2429.120) [-2431.175] -- 0:03:17
627000 -- (-2452.367) (-2446.273) [-2431.758] (-2442.003) * (-2432.738) [-2425.381] (-2436.063) (-2432.128) -- 0:03:16
627500 -- [-2430.174] (-2452.937) (-2440.930) (-2438.498) * (-2441.244) (-2435.910) [-2433.735] (-2435.307) -- 0:03:16
628000 -- (-2435.660) (-2447.193) (-2442.355) [-2436.846] * (-2433.743) [-2437.410] (-2431.842) (-2440.868) -- 0:03:16
628500 -- [-2436.280] (-2439.131) (-2428.978) (-2439.289) * (-2438.619) [-2432.849] (-2445.881) (-2431.778) -- 0:03:16
629000 -- [-2431.786] (-2435.212) (-2435.368) (-2433.845) * (-2443.685) (-2440.201) (-2435.603) [-2429.612] -- 0:03:15
629500 -- (-2429.017) [-2433.884] (-2439.342) (-2436.337) * (-2431.324) [-2436.638] (-2442.389) (-2436.245) -- 0:03:15
630000 -- (-2431.609) [-2435.645] (-2439.279) (-2430.585) * (-2433.479) [-2430.412] (-2445.143) (-2436.315) -- 0:03:15
Average standard deviation of split frequencies: 0.007774
630500 -- [-2423.581] (-2434.074) (-2434.183) (-2441.235) * (-2435.245) (-2429.599) [-2433.031] (-2441.681) -- 0:03:15
631000 -- (-2448.860) (-2434.892) [-2437.189] (-2446.553) * (-2437.851) (-2442.963) (-2435.098) [-2440.329] -- 0:03:14
631500 -- (-2443.166) (-2435.972) [-2437.124] (-2440.076) * (-2427.862) [-2439.480] (-2432.730) (-2446.697) -- 0:03:14
632000 -- (-2431.522) [-2435.206] (-2435.633) (-2437.488) * [-2429.733] (-2435.292) (-2436.061) (-2432.713) -- 0:03:14
632500 -- (-2436.151) (-2434.689) [-2433.959] (-2439.723) * (-2446.445) (-2447.454) (-2436.965) [-2431.014] -- 0:03:14
633000 -- (-2435.206) (-2449.131) [-2437.173] (-2438.112) * (-2440.397) (-2439.617) [-2437.377] (-2432.691) -- 0:03:13
633500 -- (-2429.522) (-2443.112) [-2426.798] (-2439.133) * (-2434.502) (-2443.034) [-2435.431] (-2424.502) -- 0:03:13
634000 -- (-2439.357) [-2434.237] (-2433.925) (-2426.981) * (-2432.875) (-2442.414) (-2436.257) [-2427.898] -- 0:03:13
634500 -- [-2429.740] (-2429.538) (-2438.486) (-2430.588) * (-2438.412) [-2432.019] (-2437.754) (-2440.833) -- 0:03:12
635000 -- (-2437.329) [-2429.494] (-2433.233) (-2444.667) * (-2429.496) (-2439.531) [-2433.517] (-2433.473) -- 0:03:12
Average standard deviation of split frequencies: 0.007214
635500 -- [-2431.068] (-2447.441) (-2433.084) (-2437.100) * (-2436.936) (-2429.653) (-2431.977) [-2438.282] -- 0:03:12
636000 -- (-2442.144) [-2438.718] (-2438.398) (-2439.556) * (-2448.950) [-2429.701] (-2428.977) (-2436.346) -- 0:03:12
636500 -- (-2433.085) (-2445.623) (-2445.325) [-2433.441] * (-2442.918) (-2433.618) [-2433.485] (-2447.287) -- 0:03:11
637000 -- (-2433.207) [-2437.935] (-2439.624) (-2432.088) * (-2430.235) [-2427.580] (-2438.824) (-2434.253) -- 0:03:11
637500 -- [-2439.666] (-2434.751) (-2440.158) (-2436.566) * (-2436.220) [-2429.899] (-2441.833) (-2433.960) -- 0:03:11
638000 -- (-2441.255) [-2432.055] (-2429.572) (-2432.019) * (-2440.631) [-2430.663] (-2446.126) (-2436.682) -- 0:03:11
638500 -- [-2438.200] (-2440.030) (-2440.557) (-2433.235) * (-2446.706) (-2445.886) [-2429.616] (-2436.890) -- 0:03:10
639000 -- (-2439.039) [-2438.983] (-2447.825) (-2436.424) * (-2436.666) (-2435.164) (-2441.378) [-2441.706] -- 0:03:10
639500 -- [-2429.444] (-2434.771) (-2432.961) (-2431.963) * (-2438.185) [-2444.262] (-2436.086) (-2438.483) -- 0:03:10
640000 -- (-2453.008) (-2447.309) [-2430.932] (-2437.532) * (-2442.105) (-2437.154) [-2428.569] (-2436.461) -- 0:03:10
Average standard deviation of split frequencies: 0.007603
640500 -- (-2448.965) (-2432.666) (-2440.638) [-2429.305] * (-2453.996) [-2430.062] (-2432.034) (-2442.044) -- 0:03:09
641000 -- [-2430.604] (-2438.253) (-2445.793) (-2434.300) * [-2439.513] (-2431.480) (-2432.389) (-2441.597) -- 0:03:09
641500 -- (-2432.475) [-2425.028] (-2445.583) (-2434.574) * (-2427.824) (-2447.501) (-2443.498) [-2440.490] -- 0:03:09
642000 -- (-2442.260) (-2432.796) [-2441.439] (-2433.080) * [-2429.036] (-2436.879) (-2439.022) (-2428.284) -- 0:03:09
642500 -- (-2431.161) [-2429.294] (-2440.143) (-2434.120) * (-2435.821) [-2430.878] (-2442.005) (-2436.360) -- 0:03:08
643000 -- (-2450.269) (-2439.697) [-2435.409] (-2437.938) * [-2440.790] (-2435.940) (-2429.822) (-2435.423) -- 0:03:08
643500 -- (-2432.297) (-2444.018) (-2431.710) [-2435.687] * (-2435.851) [-2437.509] (-2433.650) (-2435.175) -- 0:03:08
644000 -- [-2423.599] (-2428.812) (-2443.339) (-2433.101) * [-2433.100] (-2435.726) (-2434.065) (-2435.490) -- 0:03:07
644500 -- [-2427.718] (-2432.251) (-2436.436) (-2435.701) * (-2439.674) [-2437.389] (-2441.999) (-2430.545) -- 0:03:07
645000 -- [-2438.263] (-2434.924) (-2448.284) (-2439.061) * (-2437.850) [-2432.574] (-2432.005) (-2443.768) -- 0:03:07
Average standard deviation of split frequencies: 0.007638
645500 -- (-2431.604) (-2435.666) [-2428.633] (-2444.110) * (-2437.058) [-2433.001] (-2445.299) (-2449.287) -- 0:03:07
646000 -- (-2446.010) (-2436.730) [-2426.641] (-2430.525) * (-2440.738) (-2438.917) (-2442.414) [-2431.729] -- 0:03:06
646500 -- (-2439.553) (-2429.094) [-2441.246] (-2432.702) * [-2424.970] (-2440.428) (-2435.292) (-2433.501) -- 0:03:06
647000 -- [-2432.866] (-2442.108) (-2446.026) (-2439.295) * (-2430.477) (-2455.685) (-2431.894) [-2435.844] -- 0:03:06
647500 -- (-2443.876) (-2448.353) (-2429.371) [-2436.800] * (-2436.194) (-2433.062) [-2434.586] (-2427.424) -- 0:03:06
648000 -- (-2427.210) (-2439.461) (-2444.951) [-2430.236] * (-2435.612) (-2441.217) (-2433.463) [-2423.482] -- 0:03:05
648500 -- (-2440.011) (-2443.203) (-2436.850) [-2432.733] * (-2435.181) (-2437.758) [-2431.727] (-2438.815) -- 0:03:05
649000 -- (-2431.603) (-2434.569) [-2435.262] (-2437.557) * [-2432.781] (-2453.028) (-2438.526) (-2435.558) -- 0:03:05
649500 -- [-2428.748] (-2442.380) (-2432.333) (-2439.686) * [-2431.653] (-2443.009) (-2439.025) (-2437.802) -- 0:03:05
650000 -- (-2434.566) (-2444.742) [-2430.758] (-2441.580) * (-2434.429) (-2437.734) [-2441.429] (-2439.775) -- 0:03:04
Average standard deviation of split frequencies: 0.007197
650500 -- (-2434.632) (-2434.913) [-2431.457] (-2436.258) * (-2433.817) (-2442.575) (-2440.228) [-2443.332] -- 0:03:04
651000 -- (-2435.522) (-2439.525) [-2440.191] (-2427.166) * [-2434.613] (-2438.731) (-2442.092) (-2438.414) -- 0:03:04
651500 -- (-2441.140) [-2431.556] (-2436.152) (-2437.445) * (-2434.224) (-2432.821) (-2440.306) [-2442.241] -- 0:03:04
652000 -- [-2432.062] (-2435.272) (-2430.804) (-2438.057) * [-2427.447] (-2439.085) (-2434.638) (-2424.297) -- 0:03:03
652500 -- (-2441.400) (-2441.957) [-2434.903] (-2437.868) * (-2430.892) (-2439.228) [-2434.472] (-2440.351) -- 0:03:03
653000 -- (-2438.678) (-2433.962) [-2437.886] (-2442.321) * [-2437.505] (-2434.182) (-2437.032) (-2435.140) -- 0:03:03
653500 -- (-2434.117) (-2436.397) [-2430.639] (-2437.792) * (-2436.876) [-2430.495] (-2440.945) (-2440.632) -- 0:03:02
654000 -- (-2444.034) (-2448.230) [-2432.202] (-2439.988) * (-2440.256) [-2436.583] (-2440.645) (-2434.669) -- 0:03:02
654500 -- (-2456.913) (-2435.466) (-2431.763) [-2438.283] * (-2428.831) [-2431.823] (-2436.149) (-2433.018) -- 0:03:02
655000 -- [-2424.372] (-2438.977) (-2431.839) (-2431.859) * (-2437.353) (-2438.291) [-2429.608] (-2439.802) -- 0:03:02
Average standard deviation of split frequencies: 0.007234
655500 -- [-2428.439] (-2442.257) (-2439.822) (-2433.076) * [-2437.404] (-2437.003) (-2443.432) (-2439.094) -- 0:03:01
656000 -- (-2434.787) (-2444.925) (-2444.348) [-2446.092] * (-2438.014) (-2440.709) [-2429.680] (-2434.580) -- 0:03:01
656500 -- (-2431.138) (-2442.158) (-2453.930) [-2435.114] * (-2433.375) (-2438.923) [-2426.156] (-2426.461) -- 0:03:01
657000 -- (-2439.996) (-2435.437) (-2438.822) [-2441.983] * [-2425.406] (-2434.495) (-2439.269) (-2434.899) -- 0:03:01
657500 -- (-2437.705) (-2441.253) (-2441.302) [-2432.747] * (-2431.051) (-2439.006) [-2428.327] (-2434.221) -- 0:03:00
658000 -- (-2435.557) (-2444.580) [-2426.472] (-2426.510) * (-2426.842) (-2435.730) [-2434.670] (-2434.213) -- 0:03:00
658500 -- (-2444.835) [-2430.357] (-2444.700) (-2430.674) * (-2432.528) (-2432.792) [-2426.278] (-2451.324) -- 0:03:00
659000 -- [-2436.576] (-2432.301) (-2447.806) (-2432.473) * [-2435.746] (-2439.275) (-2449.211) (-2438.230) -- 0:03:00
659500 -- [-2440.382] (-2431.082) (-2442.875) (-2436.190) * [-2434.188] (-2447.966) (-2432.307) (-2438.518) -- 0:02:59
660000 -- [-2430.961] (-2443.276) (-2438.515) (-2443.775) * (-2440.529) [-2432.878] (-2431.511) (-2435.027) -- 0:02:59
Average standard deviation of split frequencies: 0.007468
660500 -- (-2449.807) (-2441.201) (-2445.888) [-2428.274] * (-2436.171) (-2440.568) (-2445.008) [-2428.266] -- 0:02:59
661000 -- (-2425.945) [-2436.233] (-2429.775) (-2431.943) * (-2443.117) (-2436.702) (-2435.539) [-2433.023] -- 0:02:58
661500 -- (-2441.211) (-2430.820) (-2436.246) [-2434.928] * (-2442.634) [-2437.030] (-2435.767) (-2433.796) -- 0:02:58
662000 -- (-2433.847) [-2434.012] (-2439.322) (-2438.814) * [-2429.022] (-2434.366) (-2434.032) (-2435.458) -- 0:02:58
662500 -- (-2441.258) (-2442.719) [-2424.840] (-2432.529) * (-2428.276) (-2435.669) [-2434.558] (-2436.885) -- 0:02:58
663000 -- (-2438.106) [-2432.082] (-2436.094) (-2436.191) * [-2422.485] (-2440.040) (-2431.876) (-2438.773) -- 0:02:57
663500 -- (-2444.054) [-2427.660] (-2432.342) (-2432.928) * (-2441.728) (-2437.882) [-2441.018] (-2437.620) -- 0:02:57
664000 -- [-2425.973] (-2447.168) (-2438.015) (-2438.909) * (-2436.856) (-2434.417) (-2438.731) [-2431.043] -- 0:02:57
664500 -- (-2434.045) (-2431.379) (-2433.977) [-2430.611] * (-2432.819) [-2437.917] (-2454.779) (-2436.247) -- 0:02:57
665000 -- (-2438.742) (-2439.388) (-2442.635) [-2431.618] * [-2429.699] (-2433.762) (-2428.534) (-2436.692) -- 0:02:56
Average standard deviation of split frequencies: 0.007597
665500 -- (-2440.993) (-2439.556) [-2441.773] (-2438.425) * (-2454.335) (-2434.682) (-2433.914) [-2432.838] -- 0:02:56
666000 -- (-2438.716) [-2445.059] (-2431.618) (-2433.060) * (-2449.227) [-2430.785] (-2441.048) (-2440.439) -- 0:02:56
666500 -- (-2441.509) (-2449.769) (-2431.927) [-2433.916] * (-2440.132) (-2432.877) (-2445.589) [-2434.843] -- 0:02:56
667000 -- (-2431.459) (-2439.573) [-2429.747] (-2439.819) * (-2443.475) (-2435.767) [-2430.660] (-2442.511) -- 0:02:55
667500 -- (-2433.081) (-2446.317) [-2429.443] (-2434.086) * (-2452.081) (-2455.235) [-2428.515] (-2440.503) -- 0:02:55
668000 -- (-2441.616) [-2435.206] (-2432.825) (-2444.028) * (-2433.296) (-2435.060) (-2443.784) [-2429.257] -- 0:02:55
668500 -- [-2429.616] (-2434.960) (-2440.469) (-2439.253) * (-2452.305) [-2431.039] (-2430.972) (-2428.224) -- 0:02:55
669000 -- (-2445.795) (-2431.405) [-2430.791] (-2438.310) * (-2453.434) (-2429.007) [-2430.132] (-2436.335) -- 0:02:54
669500 -- (-2431.714) (-2443.075) [-2433.966] (-2440.573) * (-2427.615) (-2432.431) (-2442.378) [-2434.702] -- 0:02:54
670000 -- (-2432.423) [-2436.186] (-2433.493) (-2449.528) * [-2432.212] (-2440.502) (-2432.330) (-2433.640) -- 0:02:54
Average standard deviation of split frequencies: 0.007966
670500 -- (-2437.974) (-2434.740) [-2438.359] (-2444.458) * (-2441.610) [-2433.493] (-2427.763) (-2440.281) -- 0:02:53
671000 -- (-2441.468) [-2436.992] (-2432.851) (-2447.266) * (-2430.936) (-2440.715) [-2427.827] (-2432.367) -- 0:02:53
671500 -- [-2436.354] (-2437.667) (-2440.896) (-2438.348) * (-2438.050) [-2436.791] (-2439.664) (-2436.396) -- 0:02:53
672000 -- [-2436.442] (-2442.014) (-2441.517) (-2429.640) * (-2431.498) (-2436.367) [-2436.548] (-2439.112) -- 0:02:53
672500 -- [-2430.980] (-2439.727) (-2429.986) (-2434.782) * (-2435.137) (-2446.887) [-2434.875] (-2445.477) -- 0:02:52
673000 -- (-2434.844) [-2430.023] (-2429.023) (-2429.966) * (-2433.150) (-2436.282) [-2430.677] (-2430.656) -- 0:02:52
673500 -- (-2438.885) (-2433.527) (-2435.509) [-2432.004] * [-2444.060] (-2435.542) (-2447.935) (-2431.976) -- 0:02:52
674000 -- (-2445.264) [-2430.504] (-2440.149) (-2432.923) * (-2448.912) (-2439.444) [-2427.539] (-2433.156) -- 0:02:52
674500 -- [-2435.707] (-2434.682) (-2434.667) (-2439.107) * [-2442.306] (-2441.980) (-2436.111) (-2431.150) -- 0:02:51
675000 -- (-2439.052) [-2445.096] (-2431.020) (-2438.747) * [-2430.153] (-2439.175) (-2431.453) (-2438.260) -- 0:02:51
Average standard deviation of split frequencies: 0.009019
675500 -- (-2429.038) (-2432.307) (-2443.736) [-2428.901] * [-2429.208] (-2441.729) (-2437.000) (-2437.647) -- 0:02:51
676000 -- [-2443.602] (-2440.379) (-2441.262) (-2439.664) * (-2432.319) (-2438.656) [-2431.631] (-2436.037) -- 0:02:51
676500 -- [-2444.188] (-2435.490) (-2435.947) (-2430.444) * (-2437.984) (-2428.841) (-2440.238) [-2431.440] -- 0:02:50
677000 -- (-2438.246) (-2447.078) (-2437.974) [-2429.240] * (-2439.028) [-2436.459] (-2441.587) (-2441.319) -- 0:02:50
677500 -- (-2441.274) [-2441.965] (-2427.572) (-2439.310) * (-2442.625) (-2438.519) (-2441.260) [-2436.236] -- 0:02:50
678000 -- (-2443.771) (-2435.993) (-2438.545) [-2436.462] * (-2435.857) (-2436.464) [-2435.094] (-2431.945) -- 0:02:50
678500 -- (-2440.429) (-2429.217) [-2427.360] (-2434.063) * (-2434.205) (-2451.491) [-2426.904] (-2435.377) -- 0:02:49
679000 -- (-2442.650) (-2434.468) [-2428.112] (-2436.609) * [-2438.469] (-2433.456) (-2430.126) (-2441.162) -- 0:02:49
679500 -- (-2431.912) [-2441.806] (-2436.288) (-2438.256) * (-2429.275) (-2442.063) [-2442.184] (-2433.578) -- 0:02:49
680000 -- (-2428.799) (-2449.446) [-2432.794] (-2433.600) * (-2434.502) (-2448.235) [-2429.828] (-2434.877) -- 0:02:48
Average standard deviation of split frequencies: 0.009096
680500 -- (-2437.366) (-2442.628) [-2432.510] (-2434.880) * (-2440.692) (-2436.629) (-2433.714) [-2434.052] -- 0:02:48
681000 -- [-2428.862] (-2435.006) (-2442.565) (-2433.031) * (-2424.355) (-2433.134) (-2435.476) [-2429.512] -- 0:02:48
681500 -- [-2439.577] (-2430.310) (-2450.654) (-2446.586) * [-2440.251] (-2440.031) (-2428.448) (-2434.139) -- 0:02:48
682000 -- (-2443.991) [-2431.195] (-2452.747) (-2437.607) * (-2445.309) (-2430.759) (-2434.909) [-2434.745] -- 0:02:47
682500 -- [-2446.635] (-2432.361) (-2438.857) (-2433.766) * [-2432.761] (-2442.661) (-2424.253) (-2437.360) -- 0:02:47
683000 -- (-2447.358) [-2435.152] (-2441.942) (-2439.695) * (-2439.507) (-2434.620) (-2445.600) [-2424.875] -- 0:02:47
683500 -- (-2440.782) [-2430.143] (-2433.523) (-2445.420) * [-2440.566] (-2437.064) (-2442.481) (-2447.041) -- 0:02:47
684000 -- (-2435.464) (-2447.235) (-2445.604) [-2431.137] * (-2435.452) (-2436.394) (-2426.106) [-2438.023] -- 0:02:46
684500 -- [-2433.941] (-2441.439) (-2438.241) (-2450.386) * (-2438.168) [-2435.846] (-2445.844) (-2426.149) -- 0:02:46
685000 -- (-2426.603) [-2434.415] (-2433.678) (-2437.706) * (-2438.116) (-2437.539) (-2440.934) [-2428.374] -- 0:02:46
Average standard deviation of split frequencies: 0.008704
685500 -- (-2444.205) (-2440.605) (-2435.831) [-2429.243] * (-2434.570) (-2432.876) (-2436.119) [-2426.967] -- 0:02:46
686000 -- (-2445.496) (-2436.058) (-2434.264) [-2440.649] * (-2434.233) [-2427.958] (-2439.748) (-2437.826) -- 0:02:45
686500 -- (-2435.526) (-2428.614) [-2438.172] (-2429.364) * [-2435.214] (-2433.517) (-2439.248) (-2430.135) -- 0:02:45
687000 -- (-2439.388) (-2436.796) [-2437.027] (-2440.085) * (-2439.970) (-2429.266) [-2427.962] (-2440.675) -- 0:02:45
687500 -- (-2441.765) (-2431.979) (-2443.419) [-2430.676] * (-2440.746) (-2440.418) (-2437.737) [-2429.189] -- 0:02:45
688000 -- (-2435.587) (-2434.282) [-2434.748] (-2436.373) * (-2444.868) (-2436.566) (-2434.971) [-2442.078] -- 0:02:44
688500 -- (-2436.287) (-2435.784) (-2440.128) [-2431.891] * (-2442.856) (-2429.867) [-2422.745] (-2446.851) -- 0:02:44
689000 -- (-2434.709) [-2433.174] (-2439.315) (-2428.623) * (-2435.346) [-2433.451] (-2428.968) (-2446.066) -- 0:02:44
689500 -- (-2440.068) (-2438.744) (-2433.260) [-2434.640] * (-2432.220) [-2426.801] (-2433.396) (-2439.985) -- 0:02:43
690000 -- (-2435.095) (-2432.629) (-2441.115) [-2428.148] * (-2433.424) (-2439.727) (-2436.975) [-2436.849] -- 0:02:43
Average standard deviation of split frequencies: 0.010011
690500 -- (-2434.402) (-2441.664) [-2433.949] (-2422.642) * (-2446.646) (-2438.501) [-2431.128] (-2437.371) -- 0:02:43
691000 -- [-2435.405] (-2432.393) (-2437.543) (-2448.557) * (-2438.601) (-2435.582) [-2430.232] (-2426.477) -- 0:02:43
691500 -- (-2439.381) [-2433.431] (-2439.314) (-2442.368) * (-2450.851) (-2437.316) (-2426.274) [-2429.706] -- 0:02:42
692000 -- (-2446.536) (-2432.190) (-2445.819) [-2439.654] * (-2432.975) (-2436.296) (-2436.644) [-2436.001] -- 0:02:42
692500 -- (-2438.588) [-2428.870] (-2450.299) (-2437.047) * [-2438.346] (-2438.146) (-2439.497) (-2428.421) -- 0:02:42
693000 -- (-2441.142) [-2435.400] (-2436.781) (-2432.507) * (-2438.954) (-2435.916) (-2435.458) [-2430.503] -- 0:02:42
693500 -- [-2433.446] (-2443.898) (-2440.879) (-2436.282) * (-2438.002) (-2436.132) [-2436.827] (-2432.847) -- 0:02:41
694000 -- [-2437.937] (-2439.903) (-2434.585) (-2428.643) * (-2440.637) (-2449.042) (-2437.967) [-2436.983] -- 0:02:41
694500 -- (-2439.858) (-2432.141) [-2430.519] (-2437.769) * (-2446.820) (-2441.028) [-2430.607] (-2435.345) -- 0:02:41
695000 -- (-2426.089) (-2441.122) [-2427.270] (-2444.434) * (-2441.781) [-2429.993] (-2428.274) (-2443.731) -- 0:02:41
Average standard deviation of split frequencies: 0.011243
695500 -- [-2427.328] (-2437.392) (-2442.447) (-2440.697) * (-2439.817) (-2443.273) [-2430.880] (-2435.972) -- 0:02:40
696000 -- (-2438.308) (-2434.334) (-2430.921) [-2434.559] * (-2433.183) (-2434.237) [-2430.500] (-2446.833) -- 0:02:40
696500 -- (-2446.644) (-2443.590) [-2433.308] (-2440.349) * (-2431.847) (-2424.638) [-2435.259] (-2436.776) -- 0:02:40
697000 -- (-2447.831) (-2438.091) (-2432.810) [-2427.118] * (-2447.448) [-2433.956] (-2435.453) (-2434.615) -- 0:02:39
697500 -- [-2431.122] (-2444.251) (-2437.419) (-2436.149) * (-2440.013) (-2431.429) [-2438.216] (-2441.916) -- 0:02:39
698000 -- (-2442.164) (-2445.431) [-2429.958] (-2443.234) * (-2445.111) (-2438.019) (-2426.116) [-2442.067] -- 0:02:39
698500 -- (-2432.778) (-2448.952) (-2435.834) [-2434.216] * [-2434.773] (-2440.350) (-2431.139) (-2428.770) -- 0:02:39
699000 -- [-2439.331] (-2454.359) (-2443.127) (-2433.622) * (-2437.097) [-2436.051] (-2439.760) (-2435.429) -- 0:02:38
699500 -- [-2434.380] (-2437.213) (-2440.424) (-2438.884) * (-2443.673) [-2431.578] (-2436.503) (-2428.944) -- 0:02:38
700000 -- (-2432.537) [-2433.865] (-2438.560) (-2435.115) * [-2437.780] (-2436.358) (-2433.884) (-2429.409) -- 0:02:38
Average standard deviation of split frequencies: 0.010585
700500 -- (-2442.302) [-2444.949] (-2441.676) (-2433.324) * (-2456.594) (-2434.103) (-2436.202) [-2437.335] -- 0:02:38
701000 -- (-2444.069) (-2435.769) (-2439.980) [-2428.751] * (-2439.930) (-2433.613) [-2435.762] (-2430.166) -- 0:02:37
701500 -- (-2443.851) [-2425.599] (-2438.929) (-2431.447) * (-2435.760) [-2428.719] (-2438.081) (-2435.430) -- 0:02:37
702000 -- [-2435.680] (-2438.438) (-2444.906) (-2437.600) * (-2435.256) (-2434.435) (-2453.328) [-2441.089] -- 0:02:37
702500 -- (-2448.936) [-2432.992] (-2431.925) (-2438.892) * [-2439.957] (-2442.139) (-2442.924) (-2438.066) -- 0:02:37
703000 -- (-2434.858) [-2433.560] (-2446.182) (-2435.297) * (-2445.882) (-2446.524) (-2439.643) [-2431.454] -- 0:02:36
703500 -- (-2433.216) (-2434.150) [-2432.885] (-2434.621) * [-2433.110] (-2441.922) (-2434.821) (-2433.692) -- 0:02:36
704000 -- (-2430.480) [-2430.121] (-2439.975) (-2433.507) * [-2432.978] (-2429.366) (-2442.165) (-2439.038) -- 0:02:36
704500 -- [-2429.676] (-2434.669) (-2440.748) (-2443.200) * (-2431.674) (-2435.462) (-2435.048) [-2424.886] -- 0:02:36
705000 -- [-2436.108] (-2431.526) (-2437.284) (-2432.024) * (-2441.257) (-2444.710) (-2440.675) [-2431.587] -- 0:02:35
Average standard deviation of split frequencies: 0.010861
705500 -- (-2446.429) [-2435.264] (-2437.983) (-2439.093) * (-2435.580) [-2433.893] (-2433.839) (-2439.321) -- 0:02:35
706000 -- (-2445.652) (-2440.599) [-2439.094] (-2438.117) * [-2434.220] (-2438.071) (-2440.067) (-2438.488) -- 0:02:35
706500 -- (-2445.018) [-2429.761] (-2431.267) (-2452.094) * (-2441.089) (-2428.649) [-2440.625] (-2428.511) -- 0:02:34
707000 -- (-2447.932) [-2428.175] (-2434.035) (-2438.318) * (-2438.921) (-2433.649) (-2436.169) [-2440.056] -- 0:02:34
707500 -- (-2455.160) (-2439.845) (-2441.761) [-2438.738] * (-2431.016) [-2437.436] (-2437.400) (-2435.791) -- 0:02:34
708000 -- (-2435.444) [-2433.371] (-2435.238) (-2429.002) * (-2443.352) [-2444.691] (-2439.270) (-2432.629) -- 0:02:34
708500 -- (-2439.377) (-2429.114) (-2440.825) [-2435.403] * [-2437.993] (-2427.370) (-2438.225) (-2438.724) -- 0:02:33
709000 -- (-2446.376) (-2438.945) [-2432.596] (-2435.662) * (-2447.278) (-2433.613) [-2425.549] (-2438.768) -- 0:02:33
709500 -- (-2441.860) (-2437.998) (-2444.422) [-2432.967] * (-2439.058) [-2426.330] (-2434.295) (-2428.881) -- 0:02:33
710000 -- (-2455.935) (-2429.463) [-2435.977] (-2433.854) * (-2434.360) (-2423.869) (-2430.400) [-2427.400] -- 0:02:33
Average standard deviation of split frequencies: 0.010525
710500 -- (-2441.710) (-2434.594) [-2436.476] (-2435.317) * (-2437.090) [-2427.290] (-2434.446) (-2428.460) -- 0:02:32
711000 -- (-2441.727) [-2432.813] (-2428.222) (-2428.672) * [-2428.297] (-2430.505) (-2448.072) (-2436.755) -- 0:02:32
711500 -- (-2446.755) (-2445.829) [-2438.812] (-2438.076) * (-2424.999) (-2445.159) (-2434.840) [-2446.089] -- 0:02:32
712000 -- (-2444.036) (-2433.192) [-2440.281] (-2435.490) * (-2438.474) (-2437.581) (-2434.551) [-2435.865] -- 0:02:32
712500 -- [-2430.462] (-2443.338) (-2437.861) (-2435.146) * [-2431.988] (-2438.220) (-2434.517) (-2435.985) -- 0:02:31
713000 -- (-2439.773) [-2440.324] (-2433.831) (-2435.083) * (-2433.493) (-2439.002) (-2438.654) [-2437.162] -- 0:02:31
713500 -- [-2432.604] (-2444.750) (-2443.689) (-2448.191) * (-2433.182) [-2432.978] (-2441.142) (-2437.208) -- 0:02:31
714000 -- (-2426.411) [-2433.377] (-2437.092) (-2445.948) * [-2424.851] (-2431.167) (-2431.956) (-2437.032) -- 0:02:31
714500 -- (-2432.909) (-2451.087) [-2432.933] (-2446.909) * [-2427.007] (-2439.440) (-2439.208) (-2431.639) -- 0:02:30
715000 -- (-2440.460) (-2443.159) [-2438.166] (-2447.422) * (-2431.834) (-2444.642) (-2439.494) [-2432.148] -- 0:02:30
Average standard deviation of split frequencies: 0.010885
715500 -- (-2435.074) [-2426.938] (-2439.775) (-2434.517) * (-2430.970) [-2450.950] (-2440.909) (-2435.719) -- 0:02:30
716000 -- (-2442.828) [-2432.464] (-2435.294) (-2433.165) * [-2433.424] (-2439.297) (-2445.499) (-2443.968) -- 0:02:29
716500 -- (-2442.087) (-2429.690) [-2431.236] (-2442.996) * (-2436.629) [-2431.536] (-2443.389) (-2432.940) -- 0:02:29
717000 -- (-2438.375) [-2431.569] (-2432.208) (-2449.552) * [-2428.901] (-2431.605) (-2441.713) (-2437.941) -- 0:02:29
717500 -- (-2435.681) (-2430.938) [-2435.644] (-2432.144) * (-2434.426) (-2443.510) [-2429.471] (-2432.745) -- 0:02:29
718000 -- (-2435.020) (-2432.787) [-2429.520] (-2439.667) * [-2437.775] (-2445.194) (-2439.483) (-2439.291) -- 0:02:28
718500 -- (-2438.552) (-2428.108) [-2437.905] (-2443.651) * (-2443.860) (-2435.624) (-2431.991) [-2431.962] -- 0:02:28
719000 -- [-2427.115] (-2428.335) (-2437.677) (-2434.470) * (-2436.148) (-2443.425) [-2437.910] (-2437.959) -- 0:02:28
719500 -- (-2438.424) [-2430.493] (-2435.827) (-2430.970) * (-2434.431) [-2434.006] (-2431.666) (-2435.449) -- 0:02:28
720000 -- (-2435.759) (-2443.392) [-2435.931] (-2435.036) * (-2437.026) (-2437.161) [-2437.238] (-2439.478) -- 0:02:27
Average standard deviation of split frequencies: 0.010902
720500 -- (-2435.302) (-2433.474) [-2443.277] (-2430.775) * [-2432.722] (-2438.116) (-2439.964) (-2437.379) -- 0:02:27
721000 -- (-2442.253) [-2433.368] (-2433.334) (-2431.689) * [-2434.193] (-2441.606) (-2431.760) (-2432.600) -- 0:02:27
721500 -- (-2429.499) (-2432.034) (-2435.914) [-2436.870] * [-2429.910] (-2438.063) (-2435.281) (-2434.497) -- 0:02:27
722000 -- (-2433.513) (-2437.303) [-2428.348] (-2439.332) * [-2439.722] (-2427.427) (-2443.100) (-2433.273) -- 0:02:26
722500 -- (-2433.706) (-2449.254) [-2435.024] (-2432.769) * (-2439.660) [-2430.546] (-2440.997) (-2429.209) -- 0:02:26
723000 -- (-2438.482) (-2432.844) (-2436.359) [-2438.222] * (-2437.769) (-2441.842) [-2433.305] (-2436.952) -- 0:02:26
723500 -- (-2430.395) [-2436.950] (-2448.729) (-2442.567) * (-2430.294) (-2435.426) [-2430.242] (-2428.908) -- 0:02:25
724000 -- (-2428.406) [-2433.455] (-2444.397) (-2430.478) * (-2439.684) [-2447.914] (-2436.141) (-2453.293) -- 0:02:25
724500 -- (-2435.921) [-2439.240] (-2443.054) (-2438.665) * (-2436.823) (-2440.339) [-2436.146] (-2437.163) -- 0:02:25
725000 -- [-2428.282] (-2451.520) (-2445.125) (-2435.652) * (-2428.906) [-2432.250] (-2433.748) (-2437.490) -- 0:02:25
Average standard deviation of split frequencies: 0.010562
725500 -- (-2432.241) (-2433.933) (-2433.264) [-2433.850] * (-2430.806) (-2431.000) (-2438.280) [-2429.576] -- 0:02:24
726000 -- (-2431.457) [-2432.488] (-2437.108) (-2439.897) * (-2435.428) [-2432.610] (-2430.309) (-2436.290) -- 0:02:24
726500 -- [-2440.559] (-2437.672) (-2452.242) (-2433.341) * (-2431.255) (-2440.292) [-2432.585] (-2429.545) -- 0:02:24
727000 -- (-2436.088) [-2434.800] (-2441.896) (-2439.854) * (-2433.195) (-2447.362) [-2438.804] (-2432.296) -- 0:02:24
727500 -- (-2444.157) [-2429.695] (-2447.335) (-2425.799) * (-2438.313) (-2444.771) (-2440.014) [-2426.709] -- 0:02:23
728000 -- (-2440.315) (-2447.004) [-2427.683] (-2434.771) * (-2447.595) [-2429.856] (-2435.824) (-2443.032) -- 0:02:23
728500 -- (-2434.259) [-2445.342] (-2434.142) (-2438.112) * (-2430.069) [-2431.723] (-2426.450) (-2436.006) -- 0:02:23
729000 -- (-2429.779) (-2442.027) (-2439.465) [-2436.047] * (-2434.497) (-2437.621) (-2429.208) [-2430.202] -- 0:02:23
729500 -- [-2427.545] (-2439.291) (-2433.421) (-2447.020) * [-2434.280] (-2431.258) (-2441.378) (-2432.754) -- 0:02:22
730000 -- (-2429.860) (-2431.472) (-2430.361) [-2425.267] * (-2434.092) (-2438.331) [-2431.584] (-2438.531) -- 0:02:22
Average standard deviation of split frequencies: 0.010452
730500 -- [-2430.626] (-2438.073) (-2429.746) (-2433.137) * (-2436.834) [-2440.425] (-2428.710) (-2435.708) -- 0:02:22
731000 -- [-2435.730] (-2437.371) (-2428.532) (-2435.616) * [-2439.694] (-2434.023) (-2443.671) (-2429.699) -- 0:02:22
731500 -- [-2429.414] (-2434.843) (-2436.955) (-2430.752) * (-2431.271) (-2450.353) [-2437.297] (-2432.152) -- 0:02:22
732000 -- [-2432.226] (-2438.083) (-2442.633) (-2434.449) * [-2429.029] (-2434.461) (-2434.647) (-2439.835) -- 0:02:21
732500 -- (-2443.348) (-2431.004) [-2430.966] (-2429.833) * [-2421.360] (-2439.270) (-2437.073) (-2447.338) -- 0:02:21
733000 -- (-2436.302) (-2435.862) (-2435.733) [-2430.122] * (-2431.931) (-2439.957) (-2433.803) [-2430.321] -- 0:02:20
733500 -- (-2430.356) (-2441.286) (-2434.435) [-2425.563] * [-2429.059] (-2441.673) (-2437.140) (-2437.501) -- 0:02:20
734000 -- (-2432.323) [-2431.725] (-2442.271) (-2442.519) * [-2429.821] (-2446.223) (-2426.704) (-2436.041) -- 0:02:20
734500 -- (-2442.563) (-2445.388) [-2432.945] (-2430.761) * [-2431.626] (-2451.397) (-2433.202) (-2435.597) -- 0:02:20
735000 -- (-2447.438) [-2435.336] (-2434.373) (-2442.740) * (-2443.200) (-2430.192) [-2431.001] (-2436.381) -- 0:02:20
Average standard deviation of split frequencies: 0.010034
735500 -- (-2433.792) [-2429.831] (-2442.555) (-2440.832) * (-2433.539) (-2438.952) [-2437.841] (-2437.509) -- 0:02:19
736000 -- (-2428.356) [-2435.427] (-2448.606) (-2448.415) * (-2438.623) (-2438.264) [-2438.208] (-2436.982) -- 0:02:19
736500 -- (-2437.597) [-2440.126] (-2437.717) (-2443.957) * [-2436.086] (-2435.708) (-2440.820) (-2433.946) -- 0:02:19
737000 -- (-2435.460) [-2440.501] (-2447.479) (-2433.544) * (-2444.369) (-2433.060) (-2441.501) [-2430.169] -- 0:02:19
737500 -- (-2442.456) (-2437.959) (-2438.742) [-2429.580] * [-2436.010] (-2439.015) (-2443.390) (-2444.094) -- 0:02:18
738000 -- (-2436.276) (-2437.756) [-2432.396] (-2430.163) * [-2429.326] (-2440.607) (-2440.343) (-2438.995) -- 0:02:18
738500 -- (-2437.103) [-2436.266] (-2434.019) (-2442.346) * (-2439.105) [-2432.422] (-2433.519) (-2438.108) -- 0:02:18
739000 -- (-2436.178) (-2444.433) (-2431.351) [-2436.040] * (-2438.963) [-2435.587] (-2439.967) (-2439.470) -- 0:02:18
739500 -- (-2437.833) (-2437.096) [-2436.236] (-2439.831) * (-2431.915) (-2429.744) [-2439.091] (-2438.174) -- 0:02:17
740000 -- (-2437.432) (-2434.335) [-2437.325] (-2447.794) * [-2427.191] (-2429.039) (-2443.788) (-2432.154) -- 0:02:17
Average standard deviation of split frequencies: 0.010056
740500 -- (-2445.094) (-2445.002) [-2431.970] (-2430.981) * (-2428.213) [-2433.891] (-2430.167) (-2442.169) -- 0:02:17
741000 -- (-2435.392) (-2443.025) (-2441.006) [-2428.416] * [-2431.457] (-2428.638) (-2441.390) (-2433.840) -- 0:02:17
741500 -- (-2435.754) [-2442.071] (-2438.228) (-2434.818) * [-2433.205] (-2440.489) (-2434.095) (-2436.364) -- 0:02:16
742000 -- (-2444.968) (-2433.178) [-2441.575] (-2434.685) * (-2438.391) (-2440.261) [-2429.032] (-2438.144) -- 0:02:16
742500 -- (-2433.999) (-2450.582) [-2427.916] (-2440.169) * (-2441.074) (-2437.144) (-2435.987) [-2434.079] -- 0:02:15
743000 -- [-2433.874] (-2436.737) (-2443.635) (-2435.124) * (-2435.863) [-2431.179] (-2439.525) (-2435.296) -- 0:02:15
743500 -- [-2431.580] (-2438.950) (-2428.946) (-2436.873) * (-2431.142) (-2439.356) [-2434.418] (-2442.470) -- 0:02:15
744000 -- (-2431.631) (-2447.038) (-2446.430) [-2433.592] * (-2438.021) (-2436.695) [-2425.625] (-2445.972) -- 0:02:15
744500 -- (-2430.623) (-2441.736) [-2432.622] (-2445.293) * (-2447.043) (-2438.282) (-2434.702) [-2435.003] -- 0:02:15
745000 -- [-2435.506] (-2437.432) (-2437.672) (-2432.484) * (-2438.103) (-2440.188) [-2424.622] (-2439.155) -- 0:02:14
Average standard deviation of split frequencies: 0.008973
745500 -- (-2438.331) (-2438.072) [-2432.369] (-2440.907) * (-2441.160) (-2448.111) [-2433.116] (-2441.991) -- 0:02:14
746000 -- (-2430.918) (-2429.363) [-2423.685] (-2432.914) * (-2442.147) (-2441.932) [-2428.434] (-2433.727) -- 0:02:14
746500 -- [-2434.747] (-2438.967) (-2431.453) (-2428.690) * (-2433.045) (-2435.754) (-2435.448) [-2438.206] -- 0:02:14
747000 -- [-2433.207] (-2435.436) (-2429.302) (-2444.935) * (-2433.120) (-2440.258) [-2430.425] (-2445.098) -- 0:02:13
747500 -- (-2448.153) [-2434.124] (-2436.004) (-2433.062) * (-2450.150) (-2450.415) (-2436.128) [-2435.752] -- 0:02:13
748000 -- (-2457.915) (-2437.658) [-2433.490] (-2432.268) * (-2441.414) [-2436.612] (-2430.249) (-2453.551) -- 0:02:13
748500 -- (-2454.115) (-2438.448) (-2442.773) [-2438.189] * (-2432.188) (-2431.427) (-2440.522) [-2442.345] -- 0:02:13
749000 -- (-2450.623) [-2436.791] (-2435.202) (-2445.301) * (-2430.417) (-2431.382) [-2427.495] (-2447.901) -- 0:02:12
749500 -- (-2447.308) (-2443.605) [-2438.061] (-2434.430) * (-2432.730) (-2435.910) (-2441.957) [-2430.191] -- 0:02:12
750000 -- (-2445.637) [-2431.802] (-2434.121) (-2433.738) * [-2440.057] (-2447.158) (-2442.902) (-2432.983) -- 0:02:12
Average standard deviation of split frequencies: 0.009420
750500 -- (-2452.597) [-2429.554] (-2437.353) (-2433.189) * (-2430.021) (-2448.762) (-2444.677) [-2432.987] -- 0:02:11
751000 -- (-2445.406) [-2429.546] (-2436.879) (-2438.768) * (-2433.233) (-2438.537) [-2435.540] (-2428.239) -- 0:02:11
751500 -- (-2438.563) (-2430.719) [-2438.602] (-2442.032) * (-2437.938) (-2434.666) (-2432.277) [-2432.692] -- 0:02:11
752000 -- (-2436.525) [-2424.804] (-2440.784) (-2433.017) * (-2442.539) [-2435.045] (-2428.944) (-2436.245) -- 0:02:10
752500 -- (-2449.142) (-2440.491) (-2437.258) [-2440.399] * (-2439.539) (-2435.831) (-2449.273) [-2432.762] -- 0:02:10
753000 -- (-2447.577) (-2434.116) (-2452.135) [-2439.137] * (-2439.773) [-2434.508] (-2428.415) (-2433.133) -- 0:02:10
753500 -- (-2439.120) [-2436.468] (-2446.473) (-2444.226) * (-2434.688) [-2437.441] (-2429.633) (-2442.826) -- 0:02:10
754000 -- [-2436.490] (-2432.894) (-2441.644) (-2437.710) * (-2447.434) [-2432.837] (-2438.475) (-2443.986) -- 0:02:10
754500 -- (-2436.255) [-2427.644] (-2450.596) (-2437.019) * (-2436.205) (-2431.450) [-2425.683] (-2435.419) -- 0:02:09
755000 -- (-2434.294) (-2446.467) [-2437.570] (-2436.856) * (-2439.026) [-2431.666] (-2439.124) (-2429.443) -- 0:02:09
Average standard deviation of split frequencies: 0.010018
755500 -- [-2431.072] (-2440.997) (-2445.312) (-2442.327) * (-2440.105) (-2434.906) [-2434.936] (-2433.834) -- 0:02:09
756000 -- (-2436.615) (-2434.666) [-2432.937] (-2446.334) * [-2438.953] (-2435.167) (-2429.467) (-2439.977) -- 0:02:09
756500 -- [-2437.440] (-2439.480) (-2435.799) (-2440.568) * (-2439.490) (-2443.307) [-2428.976] (-2439.286) -- 0:02:08
757000 -- (-2433.142) (-2442.261) [-2435.581] (-2433.002) * (-2429.078) (-2429.860) [-2436.727] (-2433.404) -- 0:02:08
757500 -- [-2432.873] (-2436.182) (-2439.848) (-2436.641) * (-2442.008) [-2432.357] (-2435.004) (-2434.025) -- 0:02:08
758000 -- [-2435.516] (-2438.314) (-2433.829) (-2431.731) * (-2432.165) (-2439.145) (-2435.707) [-2441.118] -- 0:02:08
758500 -- (-2446.761) [-2429.837] (-2440.348) (-2435.231) * (-2431.280) (-2447.077) [-2433.245] (-2438.042) -- 0:02:07
759000 -- (-2434.185) (-2431.033) (-2438.311) [-2436.975] * (-2433.850) (-2437.287) [-2428.584] (-2435.439) -- 0:02:07
759500 -- (-2429.202) (-2443.814) [-2429.699] (-2436.337) * (-2440.413) (-2435.679) (-2438.149) [-2435.512] -- 0:02:06
760000 -- (-2438.153) [-2439.616] (-2430.521) (-2439.687) * (-2435.852) (-2431.693) [-2441.116] (-2433.444) -- 0:02:06
Average standard deviation of split frequencies: 0.008924
760500 -- [-2435.832] (-2438.443) (-2435.985) (-2440.423) * (-2433.072) [-2440.643] (-2440.116) (-2441.530) -- 0:02:06
761000 -- [-2427.885] (-2448.714) (-2436.991) (-2442.418) * (-2443.001) (-2446.215) [-2435.478] (-2441.164) -- 0:02:06
761500 -- (-2430.736) (-2441.876) [-2435.834] (-2436.527) * (-2440.648) (-2446.466) [-2425.829] (-2445.126) -- 0:02:05
762000 -- (-2424.856) (-2432.030) (-2427.911) [-2430.902] * (-2438.835) (-2440.878) [-2434.154] (-2428.450) -- 0:02:05
762500 -- [-2435.940] (-2428.164) (-2432.354) (-2444.162) * (-2433.705) (-2438.629) (-2440.880) [-2427.610] -- 0:02:05
763000 -- (-2446.524) (-2432.014) [-2430.409] (-2440.816) * (-2451.453) (-2436.629) [-2440.484] (-2436.000) -- 0:02:05
763500 -- (-2433.990) (-2434.536) [-2425.357] (-2432.650) * (-2438.514) (-2441.682) (-2434.628) [-2429.494] -- 0:02:05
764000 -- (-2441.377) (-2441.433) (-2436.479) [-2431.230] * (-2445.862) (-2441.917) [-2426.767] (-2439.242) -- 0:02:04
764500 -- (-2432.226) (-2443.647) (-2440.897) [-2430.749] * (-2439.816) (-2433.133) [-2426.763] (-2429.487) -- 0:02:04
765000 -- (-2436.358) (-2445.629) [-2433.083] (-2436.881) * (-2437.954) (-2445.740) [-2434.370] (-2437.141) -- 0:02:04
Average standard deviation of split frequencies: 0.009518
765500 -- (-2438.883) (-2440.792) [-2432.954] (-2445.284) * (-2437.917) (-2432.723) (-2432.522) [-2431.385] -- 0:02:04
766000 -- (-2434.589) (-2437.070) [-2435.443] (-2437.409) * (-2434.341) [-2427.891] (-2431.232) (-2443.653) -- 0:02:03
766500 -- (-2438.246) [-2433.781] (-2441.125) (-2451.737) * (-2436.999) [-2430.632] (-2437.177) (-2439.782) -- 0:02:03
767000 -- [-2433.141] (-2431.826) (-2435.757) (-2432.655) * (-2440.553) [-2432.353] (-2441.863) (-2437.033) -- 0:02:03
767500 -- (-2433.187) (-2426.312) (-2430.738) [-2426.756] * (-2443.101) [-2430.586] (-2437.768) (-2436.421) -- 0:02:02
768000 -- (-2427.529) [-2431.849] (-2435.744) (-2435.897) * (-2448.966) (-2444.571) (-2434.627) [-2429.863] -- 0:02:02
768500 -- (-2433.167) (-2433.687) (-2436.800) [-2431.970] * [-2440.989] (-2435.962) (-2442.125) (-2443.659) -- 0:02:02
769000 -- (-2432.654) (-2429.188) (-2435.484) [-2436.920] * (-2439.856) (-2428.980) [-2432.254] (-2436.886) -- 0:02:01
769500 -- (-2435.654) (-2439.409) (-2435.121) [-2429.791] * [-2431.575] (-2425.111) (-2433.250) (-2433.878) -- 0:02:01
770000 -- (-2434.197) [-2434.328] (-2447.559) (-2427.956) * (-2449.191) (-2430.566) (-2425.682) [-2448.397] -- 0:02:01
Average standard deviation of split frequencies: 0.009012
770500 -- (-2432.995) (-2445.184) (-2441.690) [-2431.748] * (-2448.793) [-2426.994] (-2430.629) (-2440.062) -- 0:02:01
771000 -- (-2434.765) (-2444.725) [-2434.576] (-2430.767) * [-2438.317] (-2438.765) (-2429.890) (-2448.445) -- 0:02:00
771500 -- (-2437.519) (-2448.481) [-2438.830] (-2435.811) * (-2441.138) [-2434.861] (-2425.506) (-2447.048) -- 0:02:00
772000 -- (-2438.894) (-2432.896) [-2430.707] (-2444.559) * (-2442.253) (-2433.835) [-2431.486] (-2442.130) -- 0:02:00
772500 -- (-2435.126) [-2433.539] (-2430.180) (-2429.860) * (-2440.737) (-2443.161) [-2430.943] (-2438.156) -- 0:02:00
773000 -- [-2434.023] (-2434.100) (-2443.212) (-2439.336) * (-2438.152) [-2449.850] (-2443.856) (-2434.208) -- 0:02:00
773500 -- [-2432.063] (-2439.879) (-2443.368) (-2441.429) * [-2430.976] (-2442.503) (-2437.864) (-2428.664) -- 0:01:59
774000 -- (-2432.558) [-2434.155] (-2448.541) (-2448.893) * (-2440.591) (-2434.035) (-2436.595) [-2431.895] -- 0:01:59
774500 -- (-2442.899) (-2435.645) [-2437.075] (-2441.136) * (-2447.148) [-2428.835] (-2436.729) (-2435.200) -- 0:01:59
775000 -- (-2441.149) [-2430.205] (-2431.822) (-2434.289) * (-2443.221) (-2442.797) (-2441.317) [-2434.332] -- 0:01:59
Average standard deviation of split frequencies: 0.008991
775500 -- (-2437.750) (-2445.198) (-2435.497) [-2427.146] * [-2434.127] (-2432.276) (-2432.557) (-2435.107) -- 0:01:58
776000 -- (-2433.756) (-2442.076) (-2443.894) [-2433.245] * (-2429.568) (-2435.247) (-2444.182) [-2431.618] -- 0:01:58
776500 -- (-2431.223) (-2425.991) (-2436.285) [-2424.875] * (-2433.985) [-2434.370] (-2447.217) (-2432.621) -- 0:01:58
777000 -- (-2436.377) (-2441.513) [-2426.201] (-2435.330) * [-2441.292] (-2437.725) (-2443.878) (-2443.022) -- 0:01:57
777500 -- (-2453.045) [-2436.844] (-2427.960) (-2437.415) * [-2443.867] (-2432.606) (-2434.071) (-2438.094) -- 0:01:57
778000 -- (-2444.644) (-2451.482) [-2425.006] (-2439.004) * [-2444.648] (-2454.731) (-2434.360) (-2433.528) -- 0:01:57
778500 -- (-2435.793) [-2437.392] (-2442.813) (-2435.699) * (-2445.523) (-2438.313) (-2439.600) [-2439.334] -- 0:01:56
779000 -- (-2434.079) (-2431.637) (-2444.135) [-2438.422] * (-2447.315) [-2427.493] (-2440.636) (-2438.032) -- 0:01:56
779500 -- [-2426.388] (-2443.117) (-2430.713) (-2450.689) * (-2437.258) [-2430.329] (-2440.190) (-2438.996) -- 0:01:56
780000 -- [-2427.038] (-2442.476) (-2437.582) (-2451.944) * [-2432.428] (-2447.032) (-2433.654) (-2438.563) -- 0:01:56
Average standard deviation of split frequencies: 0.008977
780500 -- (-2435.126) (-2442.070) [-2430.869] (-2434.658) * (-2452.551) (-2445.447) [-2428.184] (-2426.977) -- 0:01:55
781000 -- [-2436.457] (-2436.996) (-2434.401) (-2442.099) * [-2440.506] (-2444.936) (-2430.296) (-2437.290) -- 0:01:55
781500 -- [-2430.159] (-2431.117) (-2433.005) (-2448.094) * (-2433.170) (-2437.784) (-2434.030) [-2427.052] -- 0:01:55
782000 -- (-2430.844) (-2440.534) (-2431.545) [-2444.038] * (-2432.117) (-2439.536) (-2429.560) [-2432.695] -- 0:01:55
782500 -- (-2434.266) (-2438.633) [-2429.893] (-2443.416) * (-2440.732) [-2431.741] (-2431.682) (-2439.185) -- 0:01:55
783000 -- (-2433.693) (-2440.545) (-2438.279) [-2436.216] * [-2431.266] (-2447.120) (-2431.716) (-2438.150) -- 0:01:54
783500 -- (-2434.005) (-2435.060) [-2434.385] (-2440.084) * (-2440.302) (-2437.042) [-2432.039] (-2434.473) -- 0:01:54
784000 -- [-2433.403] (-2441.946) (-2442.121) (-2436.364) * (-2437.636) (-2434.090) (-2440.512) [-2435.308] -- 0:01:54
784500 -- [-2430.599] (-2441.970) (-2434.914) (-2438.920) * (-2447.851) [-2437.667] (-2429.669) (-2447.996) -- 0:01:53
785000 -- [-2448.336] (-2437.439) (-2430.849) (-2440.487) * (-2428.827) (-2455.905) (-2442.402) [-2427.339] -- 0:01:53
Average standard deviation of split frequencies: 0.008516
785500 -- [-2430.564] (-2438.254) (-2433.986) (-2430.733) * (-2433.970) (-2432.604) [-2431.619] (-2440.416) -- 0:01:53
786000 -- (-2431.587) [-2431.589] (-2438.969) (-2448.142) * (-2435.809) (-2443.300) [-2430.244] (-2434.697) -- 0:01:52
786500 -- [-2425.589] (-2434.643) (-2436.617) (-2436.755) * (-2436.011) (-2440.575) (-2433.032) [-2430.831] -- 0:01:52
787000 -- [-2429.396] (-2439.746) (-2434.467) (-2435.625) * [-2439.448] (-2438.627) (-2440.853) (-2431.681) -- 0:01:52
787500 -- (-2441.234) (-2447.275) (-2444.509) [-2441.950] * (-2428.512) (-2443.529) (-2431.194) [-2440.762] -- 0:01:52
788000 -- (-2446.065) (-2437.114) (-2443.342) [-2433.109] * [-2434.642] (-2438.892) (-2437.950) (-2437.824) -- 0:01:51
788500 -- (-2432.636) (-2431.441) [-2430.726] (-2435.737) * [-2434.198] (-2445.492) (-2435.136) (-2434.265) -- 0:01:51
789000 -- (-2433.557) (-2430.370) (-2432.372) [-2436.932] * (-2443.467) (-2437.236) (-2441.326) [-2427.019] -- 0:01:51
789500 -- (-2446.115) (-2433.138) (-2433.728) [-2434.831] * (-2437.331) (-2447.040) (-2437.332) [-2425.781] -- 0:01:51
790000 -- (-2439.295) (-2431.401) (-2435.758) [-2433.408] * (-2446.221) [-2441.520] (-2427.004) (-2446.168) -- 0:01:50
Average standard deviation of split frequencies: 0.008824
790500 -- (-2437.562) [-2428.450] (-2437.966) (-2447.324) * (-2431.774) (-2435.450) [-2432.982] (-2432.401) -- 0:01:50
791000 -- (-2439.543) (-2430.529) [-2434.385] (-2436.759) * (-2441.426) (-2434.556) [-2433.847] (-2454.236) -- 0:01:50
791500 -- (-2433.598) (-2439.186) [-2430.670] (-2437.791) * (-2443.517) (-2437.456) [-2435.810] (-2437.947) -- 0:01:50
792000 -- [-2428.739] (-2436.373) (-2434.739) (-2443.529) * (-2426.157) (-2449.638) [-2433.839] (-2436.920) -- 0:01:49
792500 -- (-2432.192) (-2426.861) [-2430.716] (-2445.034) * (-2435.151) (-2442.677) [-2440.774] (-2432.762) -- 0:01:49
793000 -- [-2425.466] (-2439.789) (-2436.594) (-2439.619) * [-2432.022] (-2447.128) (-2427.287) (-2438.014) -- 0:01:49
793500 -- [-2430.758] (-2439.441) (-2430.161) (-2444.928) * (-2434.545) [-2442.073] (-2441.429) (-2433.119) -- 0:01:49
794000 -- (-2429.558) (-2449.039) [-2433.500] (-2434.135) * [-2427.618] (-2431.724) (-2449.216) (-2442.255) -- 0:01:48
794500 -- (-2438.262) (-2448.189) [-2435.039] (-2442.669) * [-2429.109] (-2441.288) (-2430.450) (-2450.458) -- 0:01:48
795000 -- (-2433.601) (-2437.989) (-2433.761) [-2435.213] * [-2426.305] (-2439.586) (-2428.456) (-2441.701) -- 0:01:48
Average standard deviation of split frequencies: 0.008015
795500 -- [-2430.880] (-2441.274) (-2436.905) (-2431.716) * [-2428.976] (-2457.005) (-2436.544) (-2437.265) -- 0:01:47
796000 -- [-2431.788] (-2446.783) (-2440.194) (-2438.898) * (-2437.709) (-2439.738) (-2433.724) [-2432.001] -- 0:01:47
796500 -- (-2440.784) (-2435.626) (-2430.004) [-2424.209] * (-2444.915) (-2437.385) (-2439.118) [-2430.389] -- 0:01:47
797000 -- [-2442.344] (-2438.253) (-2427.348) (-2440.319) * (-2446.033) [-2432.946] (-2443.085) (-2424.801) -- 0:01:47
797500 -- (-2432.054) (-2434.621) [-2431.518] (-2445.109) * (-2439.110) (-2440.093) [-2430.622] (-2436.725) -- 0:01:46
798000 -- [-2435.606] (-2433.108) (-2437.141) (-2433.711) * (-2431.331) (-2441.825) (-2433.637) [-2432.426] -- 0:01:46
798500 -- (-2442.792) (-2440.342) (-2458.291) [-2433.547] * (-2432.766) (-2435.150) (-2434.026) [-2432.006] -- 0:01:46
799000 -- (-2446.356) [-2423.446] (-2439.149) (-2440.228) * (-2429.108) (-2432.509) (-2438.618) [-2423.342] -- 0:01:46
799500 -- (-2441.347) (-2437.434) [-2439.005] (-2429.003) * (-2437.810) (-2429.605) [-2432.055] (-2447.734) -- 0:01:45
800000 -- (-2444.884) (-2438.429) (-2443.292) [-2429.294] * [-2435.495] (-2437.722) (-2443.960) (-2437.200) -- 0:01:45
Average standard deviation of split frequencies: 0.007654
800500 -- (-2443.603) (-2428.013) (-2445.202) [-2429.723] * (-2433.757) [-2432.070] (-2438.626) (-2438.570) -- 0:01:45
801000 -- (-2431.248) (-2436.044) [-2436.094] (-2434.899) * (-2434.872) (-2434.651) (-2438.053) [-2444.647] -- 0:01:45
801500 -- (-2439.984) [-2433.204] (-2436.110) (-2435.146) * (-2441.946) (-2436.799) (-2435.335) [-2440.692] -- 0:01:44
802000 -- (-2432.860) (-2429.290) [-2440.503] (-2440.337) * [-2430.979] (-2447.003) (-2437.740) (-2445.972) -- 0:01:44
802500 -- (-2435.178) [-2430.758] (-2431.530) (-2441.576) * (-2435.561) (-2434.808) (-2431.245) [-2433.865] -- 0:01:44
803000 -- (-2432.739) [-2425.005] (-2425.094) (-2450.517) * (-2429.222) (-2438.930) (-2438.591) [-2433.770] -- 0:01:44
803500 -- [-2435.570] (-2438.551) (-2435.657) (-2437.259) * (-2439.914) (-2442.803) (-2428.986) [-2429.727] -- 0:01:43
804000 -- (-2446.259) (-2443.379) [-2427.089] (-2433.520) * (-2441.887) (-2435.080) [-2433.123] (-2439.503) -- 0:01:43
804500 -- (-2432.852) [-2429.915] (-2435.971) (-2430.828) * (-2432.406) [-2435.288] (-2433.550) (-2435.648) -- 0:01:43
805000 -- (-2434.674) (-2440.252) [-2434.183] (-2436.277) * [-2425.634] (-2435.836) (-2438.277) (-2436.145) -- 0:01:42
Average standard deviation of split frequencies: 0.007369
805500 -- (-2433.264) (-2444.092) [-2432.764] (-2440.767) * (-2455.670) (-2439.866) (-2443.421) [-2438.194] -- 0:01:42
806000 -- (-2433.199) [-2433.266] (-2431.319) (-2437.804) * (-2431.885) (-2431.142) (-2448.900) [-2437.034] -- 0:01:42
806500 -- (-2436.710) (-2439.456) [-2434.093] (-2435.519) * (-2435.687) [-2432.155] (-2435.001) (-2431.651) -- 0:01:42
807000 -- (-2427.503) (-2441.074) (-2429.679) [-2448.022] * (-2448.516) [-2430.546] (-2432.518) (-2438.258) -- 0:01:41
807500 -- (-2433.898) (-2431.191) (-2443.518) [-2430.687] * (-2445.697) (-2438.008) [-2436.903] (-2432.332) -- 0:01:41
808000 -- [-2437.250] (-2434.011) (-2439.195) (-2434.946) * (-2432.454) (-2442.505) [-2435.395] (-2432.210) -- 0:01:41
808500 -- (-2445.538) (-2449.759) [-2431.268] (-2443.006) * (-2439.490) (-2437.420) [-2433.097] (-2436.997) -- 0:01:41
809000 -- (-2433.187) (-2435.137) [-2428.346] (-2438.658) * (-2431.461) (-2437.809) [-2433.379] (-2436.974) -- 0:01:40
809500 -- (-2440.152) (-2433.499) (-2426.847) [-2433.442] * [-2438.732] (-2443.471) (-2442.583) (-2437.853) -- 0:01:40
810000 -- (-2442.451) (-2440.379) (-2431.439) [-2448.917] * [-2433.823] (-2437.920) (-2443.665) (-2440.951) -- 0:01:40
Average standard deviation of split frequencies: 0.007017
810500 -- (-2436.312) (-2436.691) (-2441.665) [-2430.724] * (-2430.984) (-2442.456) [-2439.037] (-2429.693) -- 0:01:40
811000 -- [-2445.605] (-2443.741) (-2436.113) (-2434.277) * [-2431.470] (-2433.626) (-2441.652) (-2433.534) -- 0:01:39
811500 -- (-2440.649) (-2441.380) [-2430.290] (-2433.719) * [-2439.497] (-2441.449) (-2437.588) (-2438.551) -- 0:01:39
812000 -- (-2441.375) [-2428.764] (-2437.484) (-2450.247) * (-2438.108) [-2440.141] (-2431.748) (-2432.727) -- 0:01:39
812500 -- (-2436.215) [-2437.112] (-2438.787) (-2438.573) * (-2430.049) [-2426.006] (-2429.388) (-2435.970) -- 0:01:39
813000 -- (-2440.834) (-2438.105) (-2430.627) [-2432.006] * (-2440.193) (-2435.928) [-2436.079] (-2437.098) -- 0:01:38
813500 -- [-2436.762] (-2435.947) (-2429.267) (-2439.491) * [-2428.009] (-2440.303) (-2433.951) (-2439.848) -- 0:01:38
814000 -- (-2432.973) (-2429.796) [-2434.034] (-2437.000) * (-2448.782) [-2436.169] (-2433.114) (-2442.688) -- 0:01:38
814500 -- (-2438.324) [-2430.403] (-2436.296) (-2441.901) * [-2443.949] (-2432.905) (-2443.606) (-2453.968) -- 0:01:37
815000 -- (-2442.674) (-2424.087) [-2433.216] (-2445.909) * (-2435.012) [-2435.267] (-2443.492) (-2439.048) -- 0:01:37
Average standard deviation of split frequencies: 0.007009
815500 -- (-2456.303) [-2436.138] (-2433.113) (-2450.500) * (-2441.102) [-2434.156] (-2439.359) (-2429.254) -- 0:01:37
816000 -- (-2446.592) (-2433.817) [-2436.800] (-2433.112) * (-2442.864) [-2443.129] (-2437.998) (-2432.207) -- 0:01:37
816500 -- (-2438.716) [-2425.072] (-2433.682) (-2438.945) * (-2438.252) [-2437.285] (-2441.322) (-2437.004) -- 0:01:36
817000 -- (-2438.221) (-2433.942) (-2441.167) [-2442.885] * [-2429.412] (-2429.003) (-2432.735) (-2432.920) -- 0:01:36
817500 -- (-2448.490) [-2429.366] (-2433.270) (-2438.651) * (-2436.281) (-2444.201) [-2436.779] (-2444.052) -- 0:01:36
818000 -- (-2440.921) (-2434.190) (-2432.169) [-2439.850] * (-2431.263) (-2432.565) [-2431.960] (-2442.307) -- 0:01:36
818500 -- [-2432.991] (-2437.418) (-2438.082) (-2446.957) * [-2432.803] (-2442.781) (-2435.091) (-2434.599) -- 0:01:36
819000 -- (-2432.651) (-2432.403) [-2426.032] (-2441.363) * (-2431.876) (-2448.098) [-2429.084] (-2433.417) -- 0:01:35
819500 -- [-2428.350] (-2437.791) (-2442.317) (-2436.779) * (-2433.952) (-2435.354) [-2433.434] (-2428.635) -- 0:01:35
820000 -- [-2430.261] (-2439.750) (-2435.669) (-2438.928) * (-2432.422) (-2444.752) [-2427.849] (-2440.214) -- 0:01:35
Average standard deviation of split frequencies: 0.007353
820500 -- [-2436.835] (-2435.732) (-2434.203) (-2442.134) * [-2433.284] (-2437.279) (-2431.613) (-2430.948) -- 0:01:34
821000 -- (-2438.847) (-2431.912) [-2434.851] (-2450.894) * (-2441.246) [-2437.209] (-2439.523) (-2437.335) -- 0:01:34
821500 -- [-2434.129] (-2439.358) (-2429.800) (-2438.928) * (-2437.332) (-2438.645) [-2435.686] (-2434.014) -- 0:01:34
822000 -- (-2431.632) (-2438.556) (-2444.425) [-2436.605] * (-2445.277) [-2431.348] (-2438.396) (-2441.932) -- 0:01:33
822500 -- (-2438.985) (-2439.799) (-2433.994) [-2433.157] * (-2431.605) (-2439.216) (-2440.768) [-2435.922] -- 0:01:33
823000 -- (-2433.530) [-2434.858] (-2446.505) (-2427.745) * [-2434.824] (-2438.030) (-2427.485) (-2446.633) -- 0:01:33
823500 -- [-2428.479] (-2428.897) (-2449.200) (-2436.365) * [-2431.569] (-2442.165) (-2434.581) (-2434.004) -- 0:01:33
824000 -- (-2431.330) [-2430.652] (-2445.647) (-2435.062) * (-2432.683) (-2431.980) (-2438.384) [-2428.907] -- 0:01:32
824500 -- (-2446.243) (-2446.008) (-2441.949) [-2430.065] * (-2438.268) (-2435.741) [-2428.768] (-2434.157) -- 0:01:32
825000 -- (-2445.349) [-2431.778] (-2436.056) (-2434.655) * (-2441.722) (-2440.542) [-2431.199] (-2439.538) -- 0:01:32
Average standard deviation of split frequencies: 0.007077
825500 -- (-2435.147) [-2434.003] (-2426.733) (-2431.061) * (-2443.062) (-2435.080) [-2433.360] (-2439.278) -- 0:01:32
826000 -- [-2432.678] (-2434.151) (-2443.677) (-2433.632) * (-2440.787) (-2444.812) [-2424.518] (-2437.278) -- 0:01:32
826500 -- (-2434.318) (-2435.818) (-2434.931) [-2432.849] * (-2439.341) (-2430.032) [-2435.723] (-2447.767) -- 0:01:31
827000 -- (-2434.967) (-2436.126) [-2446.321] (-2440.138) * (-2435.508) (-2436.016) (-2429.916) [-2428.065] -- 0:01:31
827500 -- (-2437.725) (-2430.719) (-2432.639) [-2429.381] * [-2437.897] (-2434.119) (-2424.556) (-2447.774) -- 0:01:31
828000 -- (-2444.785) (-2437.742) (-2438.846) [-2427.719] * (-2440.436) (-2436.641) (-2433.735) [-2440.061] -- 0:01:30
828500 -- (-2448.639) [-2424.110] (-2434.458) (-2428.379) * (-2440.323) (-2433.918) (-2438.698) [-2432.353] -- 0:01:30
829000 -- (-2443.785) [-2425.154] (-2437.709) (-2440.899) * (-2433.750) [-2427.963] (-2435.178) (-2439.019) -- 0:01:30
829500 -- (-2434.192) (-2434.910) (-2431.652) [-2438.799] * (-2427.587) [-2439.005] (-2438.781) (-2442.511) -- 0:01:30
830000 -- (-2436.890) (-2441.893) [-2434.024] (-2434.570) * (-2431.275) [-2435.197] (-2433.230) (-2435.556) -- 0:01:29
Average standard deviation of split frequencies: 0.006697
830500 -- (-2434.418) (-2434.471) (-2443.092) [-2431.620] * (-2434.918) (-2442.643) [-2435.643] (-2438.031) -- 0:01:29
831000 -- (-2428.704) (-2427.596) (-2432.040) [-2429.911] * (-2441.813) (-2443.122) (-2434.601) [-2426.853] -- 0:01:29
831500 -- (-2442.280) (-2442.225) [-2433.716] (-2438.675) * (-2441.068) (-2441.906) (-2439.296) [-2434.909] -- 0:01:28
832000 -- (-2433.612) (-2435.173) (-2434.762) [-2428.688] * (-2441.907) (-2438.008) [-2434.929] (-2427.571) -- 0:01:28
832500 -- [-2431.536] (-2427.756) (-2437.750) (-2430.356) * (-2437.604) (-2437.243) [-2432.382] (-2429.159) -- 0:01:28
833000 -- [-2429.454] (-2436.941) (-2439.677) (-2439.857) * [-2431.549] (-2451.260) (-2437.983) (-2430.096) -- 0:01:28
833500 -- (-2433.547) (-2436.280) [-2434.336] (-2432.435) * (-2433.758) (-2432.342) (-2436.436) [-2428.355] -- 0:01:28
834000 -- (-2434.689) [-2432.166] (-2434.154) (-2439.409) * (-2433.034) (-2437.053) [-2427.351] (-2445.748) -- 0:01:27
834500 -- (-2436.331) (-2446.369) [-2434.299] (-2440.147) * (-2433.067) (-2444.377) (-2431.972) [-2431.359] -- 0:01:27
835000 -- (-2436.141) (-2443.099) [-2434.485] (-2435.046) * (-2435.252) (-2440.687) (-2437.876) [-2437.703] -- 0:01:27
Average standard deviation of split frequencies: 0.006992
835500 -- (-2438.229) [-2431.836] (-2435.377) (-2428.551) * [-2439.756] (-2440.296) (-2433.667) (-2429.618) -- 0:01:27
836000 -- (-2425.556) (-2435.662) [-2438.837] (-2432.124) * (-2436.235) [-2433.306] (-2440.917) (-2444.260) -- 0:01:26
836500 -- [-2432.552] (-2438.665) (-2427.041) (-2433.032) * (-2433.113) (-2430.944) (-2437.986) [-2428.779] -- 0:01:26
837000 -- (-2429.954) [-2431.659] (-2444.280) (-2429.856) * (-2428.703) [-2441.527] (-2432.106) (-2440.358) -- 0:01:26
837500 -- (-2445.407) (-2435.712) [-2429.457] (-2445.164) * (-2432.316) (-2444.751) (-2438.686) [-2437.007] -- 0:01:25
838000 -- (-2430.997) (-2429.079) [-2434.372] (-2442.834) * (-2437.840) (-2436.670) (-2437.195) [-2428.193] -- 0:01:25
838500 -- (-2432.135) [-2428.713] (-2436.760) (-2440.237) * (-2443.488) (-2448.723) (-2429.443) [-2428.752] -- 0:01:25
839000 -- (-2437.539) (-2429.830) [-2429.027] (-2428.093) * (-2439.328) [-2432.100] (-2426.385) (-2436.108) -- 0:01:25
839500 -- (-2451.771) (-2431.968) [-2432.196] (-2440.410) * (-2436.700) (-2431.384) [-2430.496] (-2433.086) -- 0:01:24
840000 -- (-2446.217) (-2433.268) (-2428.610) [-2429.837] * (-2433.419) [-2432.082] (-2434.586) (-2430.117) -- 0:01:24
Average standard deviation of split frequencies: 0.006766
840500 -- (-2436.653) (-2450.495) (-2437.916) [-2434.456] * (-2442.540) (-2435.585) (-2431.920) [-2428.364] -- 0:01:24
841000 -- [-2438.867] (-2438.400) (-2443.300) (-2432.308) * (-2434.139) (-2444.186) [-2438.339] (-2428.561) -- 0:01:23
841500 -- (-2426.103) (-2430.556) (-2433.943) [-2434.464] * (-2437.206) (-2435.362) [-2430.347] (-2431.597) -- 0:01:23
842000 -- (-2434.709) (-2433.663) (-2439.594) [-2436.489] * [-2434.813] (-2436.637) (-2430.957) (-2436.783) -- 0:01:23
842500 -- (-2431.501) (-2440.923) [-2427.301] (-2438.632) * (-2439.470) (-2433.439) [-2431.659] (-2437.443) -- 0:01:23
843000 -- (-2444.038) [-2427.994] (-2439.496) (-2436.772) * [-2429.278] (-2432.951) (-2436.116) (-2441.130) -- 0:01:22
843500 -- (-2433.370) (-2434.980) (-2430.134) [-2437.547] * (-2433.492) (-2438.215) [-2435.480] (-2434.168) -- 0:01:22
844000 -- (-2437.575) (-2441.719) [-2432.898] (-2435.689) * (-2444.604) [-2434.544] (-2434.883) (-2445.826) -- 0:01:22
844500 -- [-2436.000] (-2430.438) (-2441.441) (-2442.786) * [-2432.819] (-2430.496) (-2442.981) (-2434.407) -- 0:01:22
845000 -- [-2430.194] (-2442.741) (-2430.790) (-2437.126) * (-2428.212) [-2430.397] (-2439.152) (-2443.645) -- 0:01:21
Average standard deviation of split frequencies: 0.006947
845500 -- (-2431.595) [-2430.801] (-2441.547) (-2424.841) * (-2435.682) (-2439.542) [-2432.708] (-2436.118) -- 0:01:21
846000 -- (-2437.019) (-2433.351) [-2430.129] (-2434.985) * (-2435.023) (-2433.864) [-2435.761] (-2441.137) -- 0:01:21
846500 -- (-2443.057) [-2432.824] (-2434.744) (-2437.221) * (-2435.178) (-2434.394) [-2436.676] (-2436.208) -- 0:01:21
847000 -- [-2439.564] (-2436.186) (-2442.605) (-2431.941) * (-2443.944) (-2434.936) [-2433.297] (-2431.714) -- 0:01:20
847500 -- (-2436.582) (-2437.491) (-2437.374) [-2430.550] * [-2431.264] (-2439.878) (-2433.260) (-2431.103) -- 0:01:20
848000 -- (-2438.917) (-2433.620) [-2436.213] (-2439.506) * [-2433.945] (-2430.310) (-2433.868) (-2433.541) -- 0:01:20
848500 -- (-2438.352) [-2439.713] (-2433.546) (-2438.270) * (-2440.355) [-2430.940] (-2428.124) (-2426.612) -- 0:01:19
849000 -- (-2434.897) (-2430.243) (-2431.483) [-2427.915] * [-2423.031] (-2443.422) (-2448.574) (-2432.740) -- 0:01:19
849500 -- (-2431.322) (-2446.814) [-2433.559] (-2432.104) * [-2432.008] (-2437.175) (-2434.692) (-2432.897) -- 0:01:19
850000 -- [-2437.511] (-2436.160) (-2440.554) (-2438.552) * (-2432.316) (-2447.351) [-2433.760] (-2432.343) -- 0:01:19
Average standard deviation of split frequencies: 0.006539
850500 -- (-2438.470) [-2430.079] (-2440.414) (-2453.390) * (-2433.537) (-2429.952) (-2430.967) [-2436.884] -- 0:01:18
851000 -- (-2439.148) (-2433.970) [-2433.116] (-2439.078) * [-2436.462] (-2436.101) (-2426.871) (-2436.969) -- 0:01:18
851500 -- (-2430.256) [-2437.254] (-2443.410) (-2446.333) * [-2428.979] (-2443.859) (-2423.362) (-2428.432) -- 0:01:18
852000 -- (-2426.594) (-2433.142) [-2432.743] (-2435.833) * [-2430.528] (-2432.414) (-2436.462) (-2442.943) -- 0:01:18
852500 -- (-2430.608) (-2438.370) (-2444.493) [-2440.168] * (-2442.801) (-2437.322) [-2433.059] (-2431.344) -- 0:01:17
853000 -- (-2436.871) [-2439.972] (-2433.181) (-2439.462) * (-2426.880) (-2440.853) [-2434.532] (-2429.818) -- 0:01:17
853500 -- (-2429.740) (-2441.545) [-2434.499] (-2433.497) * [-2434.546] (-2448.520) (-2431.051) (-2434.144) -- 0:01:17
854000 -- [-2428.611] (-2437.729) (-2440.254) (-2437.769) * (-2435.964) (-2445.614) (-2427.233) [-2429.790] -- 0:01:17
854500 -- (-2442.529) (-2433.489) (-2441.879) [-2436.344] * (-2440.144) (-2439.801) (-2446.082) [-2441.458] -- 0:01:16
855000 -- (-2442.809) [-2433.846] (-2433.173) (-2435.131) * (-2432.145) (-2442.949) [-2440.312] (-2453.020) -- 0:01:16
Average standard deviation of split frequencies: 0.007379
855500 -- (-2443.301) [-2432.536] (-2440.629) (-2435.779) * [-2431.928] (-2437.950) (-2436.915) (-2438.620) -- 0:01:16
856000 -- (-2436.839) (-2429.685) [-2437.124] (-2427.401) * (-2435.620) [-2428.229] (-2435.975) (-2447.851) -- 0:01:16
856500 -- [-2430.008] (-2440.786) (-2439.549) (-2426.347) * (-2432.358) (-2436.156) [-2443.543] (-2438.711) -- 0:01:15
857000 -- (-2442.537) (-2447.722) (-2442.198) [-2431.725] * (-2436.047) (-2427.326) [-2432.137] (-2442.738) -- 0:01:15
857500 -- (-2426.909) (-2450.087) (-2432.056) [-2438.986] * (-2442.820) [-2438.309] (-2438.539) (-2437.872) -- 0:01:15
858000 -- (-2437.759) (-2438.491) (-2438.801) [-2431.680] * (-2441.864) (-2440.959) [-2439.272] (-2443.038) -- 0:01:14
858500 -- [-2437.769] (-2437.056) (-2436.073) (-2430.565) * (-2436.768) [-2431.634] (-2438.461) (-2433.401) -- 0:01:14
859000 -- [-2428.519] (-2430.626) (-2430.806) (-2435.897) * (-2445.048) [-2424.980] (-2440.893) (-2430.136) -- 0:01:14
859500 -- (-2433.181) [-2431.504] (-2438.565) (-2430.938) * (-2430.883) [-2434.981] (-2432.035) (-2434.755) -- 0:01:14
860000 -- (-2431.746) (-2437.739) (-2431.936) [-2433.374] * [-2432.210] (-2442.288) (-2439.598) (-2441.005) -- 0:01:13
Average standard deviation of split frequencies: 0.007887
860500 -- (-2441.800) (-2443.314) [-2436.184] (-2431.206) * (-2450.271) (-2441.431) (-2439.691) [-2429.541] -- 0:01:13
861000 -- (-2434.557) [-2433.956] (-2433.853) (-2433.845) * [-2431.603] (-2436.479) (-2450.596) (-2439.612) -- 0:01:13
861500 -- (-2439.383) (-2435.902) [-2431.474] (-2437.951) * (-2438.771) [-2438.553] (-2438.905) (-2448.330) -- 0:01:13
862000 -- (-2440.723) (-2446.947) (-2432.849) [-2434.262] * [-2429.694] (-2432.104) (-2437.524) (-2433.708) -- 0:01:12
862500 -- (-2448.021) (-2433.598) [-2428.394] (-2435.281) * (-2434.032) [-2434.469] (-2431.680) (-2440.499) -- 0:01:12
863000 -- (-2435.796) (-2435.752) (-2446.353) [-2439.459] * [-2429.538] (-2431.040) (-2435.514) (-2433.568) -- 0:01:12
863500 -- (-2440.768) (-2431.763) (-2424.500) [-2429.947] * (-2433.184) (-2430.773) [-2434.568] (-2428.506) -- 0:01:12
864000 -- (-2438.553) [-2430.365] (-2436.779) (-2433.598) * [-2440.439] (-2430.261) (-2439.627) (-2437.422) -- 0:01:11
864500 -- (-2435.776) (-2437.544) [-2432.153] (-2441.036) * (-2441.415) [-2427.134] (-2436.795) (-2443.068) -- 0:01:11
865000 -- (-2434.959) (-2445.010) [-2429.150] (-2445.675) * (-2439.465) [-2435.449] (-2438.594) (-2437.895) -- 0:01:11
Average standard deviation of split frequencies: 0.008020
865500 -- (-2433.702) (-2437.836) [-2426.142] (-2435.174) * (-2440.228) (-2433.559) [-2438.751] (-2434.487) -- 0:01:11
866000 -- [-2440.411] (-2437.703) (-2436.364) (-2433.968) * (-2435.863) (-2433.069) (-2444.509) [-2432.860] -- 0:01:10
866500 -- (-2431.827) (-2438.394) [-2436.499] (-2433.163) * [-2430.321] (-2430.366) (-2448.001) (-2434.219) -- 0:01:10
867000 -- [-2437.355] (-2435.651) (-2429.166) (-2438.432) * (-2437.017) (-2435.598) (-2442.192) [-2427.893] -- 0:01:10
867500 -- (-2439.511) (-2434.221) [-2431.078] (-2439.540) * (-2423.639) (-2432.613) [-2429.401] (-2434.365) -- 0:01:09
868000 -- [-2429.938] (-2434.812) (-2435.477) (-2436.310) * (-2435.048) [-2428.224] (-2440.429) (-2437.121) -- 0:01:09
868500 -- (-2434.621) [-2434.487] (-2442.883) (-2451.324) * (-2435.518) (-2424.863) [-2435.019] (-2442.019) -- 0:01:09
869000 -- (-2436.202) (-2441.075) [-2429.884] (-2434.687) * (-2433.365) (-2434.231) [-2431.509] (-2433.609) -- 0:01:09
869500 -- (-2443.186) (-2440.476) [-2431.249] (-2433.109) * (-2448.371) (-2435.243) (-2434.868) [-2436.836] -- 0:01:08
870000 -- [-2446.227] (-2434.934) (-2427.582) (-2432.162) * (-2444.888) [-2433.278] (-2439.564) (-2438.180) -- 0:01:08
Average standard deviation of split frequencies: 0.008085
870500 -- (-2436.307) (-2434.115) [-2435.311] (-2435.700) * (-2441.057) [-2427.739] (-2442.025) (-2439.113) -- 0:01:08
871000 -- (-2440.874) (-2435.620) (-2431.568) [-2432.341] * [-2434.593] (-2429.606) (-2440.751) (-2440.693) -- 0:01:08
871500 -- (-2439.676) (-2441.607) (-2444.190) [-2432.266] * (-2434.238) (-2434.039) (-2443.596) [-2435.522] -- 0:01:07
872000 -- [-2434.709] (-2438.986) (-2434.281) (-2440.286) * (-2445.345) (-2438.082) [-2437.327] (-2440.460) -- 0:01:07
872500 -- (-2434.037) (-2430.333) [-2429.866] (-2437.895) * (-2439.722) [-2432.377] (-2435.384) (-2436.755) -- 0:01:07
873000 -- [-2440.077] (-2444.435) (-2438.161) (-2444.905) * [-2435.607] (-2436.691) (-2434.743) (-2441.944) -- 0:01:07
873500 -- (-2436.701) (-2444.117) [-2428.727] (-2434.895) * (-2428.694) (-2444.445) (-2447.473) [-2436.890] -- 0:01:06
874000 -- [-2444.460] (-2435.728) (-2437.184) (-2442.644) * [-2424.855] (-2445.030) (-2433.583) (-2428.416) -- 0:01:06
874500 -- (-2436.946) [-2427.466] (-2425.968) (-2434.328) * (-2434.719) (-2437.619) [-2429.617] (-2429.259) -- 0:01:06
875000 -- [-2434.477] (-2425.642) (-2437.954) (-2434.307) * [-2429.026] (-2440.339) (-2428.005) (-2442.309) -- 0:01:06
Average standard deviation of split frequencies: 0.007857
875500 -- (-2428.877) (-2443.603) (-2433.610) [-2430.689] * (-2444.381) [-2433.085] (-2429.506) (-2438.919) -- 0:01:05
876000 -- (-2432.130) (-2437.209) (-2430.548) [-2437.687] * (-2429.025) [-2435.973] (-2444.009) (-2430.479) -- 0:01:05
876500 -- (-2441.307) (-2435.760) [-2434.358] (-2440.135) * (-2434.294) (-2442.678) (-2456.193) [-2429.755] -- 0:01:05
877000 -- [-2436.365] (-2439.128) (-2442.494) (-2435.316) * (-2437.345) (-2443.722) (-2431.212) [-2436.641] -- 0:01:04
877500 -- (-2437.720) [-2435.606] (-2440.427) (-2443.098) * (-2436.332) (-2431.961) [-2432.951] (-2449.454) -- 0:01:04
878000 -- (-2436.382) (-2436.207) [-2435.204] (-2440.666) * (-2440.676) (-2441.142) (-2438.876) [-2433.669] -- 0:01:04
878500 -- (-2435.017) (-2439.340) [-2428.200] (-2441.283) * (-2428.058) (-2430.176) (-2434.030) [-2438.032] -- 0:01:04
879000 -- [-2430.098] (-2438.451) (-2433.959) (-2440.613) * (-2432.293) [-2438.140] (-2428.495) (-2432.130) -- 0:01:04
879500 -- [-2427.498] (-2441.322) (-2426.191) (-2443.690) * (-2434.866) (-2432.376) (-2436.225) [-2435.523] -- 0:01:03
880000 -- (-2428.214) (-2431.967) (-2441.073) [-2435.034] * (-2437.836) (-2436.632) (-2435.103) [-2431.457] -- 0:01:03
Average standard deviation of split frequencies: 0.006994
880500 -- [-2446.659] (-2428.056) (-2430.852) (-2432.295) * (-2441.144) (-2428.042) (-2433.741) [-2430.899] -- 0:01:03
881000 -- (-2436.629) (-2435.738) (-2447.903) [-2435.032] * [-2436.042] (-2427.293) (-2431.291) (-2438.939) -- 0:01:02
881500 -- (-2439.135) [-2441.218] (-2444.518) (-2444.968) * (-2431.373) (-2442.248) (-2443.200) [-2439.728] -- 0:01:02
882000 -- (-2449.584) (-2435.710) (-2434.866) [-2434.851] * (-2433.234) (-2430.846) (-2436.139) [-2440.892] -- 0:01:02
882500 -- (-2437.859) (-2433.654) (-2441.347) [-2434.049] * (-2443.652) (-2437.736) [-2440.999] (-2432.184) -- 0:01:02
883000 -- (-2437.029) (-2441.105) (-2442.854) [-2437.028] * (-2432.971) [-2436.595] (-2431.265) (-2431.655) -- 0:01:01
883500 -- (-2437.496) (-2441.510) (-2434.630) [-2439.916] * [-2437.204] (-2429.603) (-2430.257) (-2437.307) -- 0:01:01
884000 -- [-2442.438] (-2432.693) (-2444.048) (-2441.648) * (-2450.618) [-2437.189] (-2433.328) (-2435.980) -- 0:01:01
884500 -- (-2435.500) (-2441.061) (-2429.819) [-2434.120] * [-2433.815] (-2448.077) (-2432.496) (-2438.386) -- 0:01:00
885000 -- (-2433.675) [-2432.682] (-2443.938) (-2437.963) * (-2433.908) (-2437.357) (-2435.791) [-2438.720] -- 0:01:00
Average standard deviation of split frequencies: 0.006810
885500 -- [-2424.326] (-2437.277) (-2432.606) (-2431.339) * (-2435.093) (-2437.228) (-2437.480) [-2431.118] -- 0:01:00
886000 -- (-2425.961) (-2438.140) (-2441.838) [-2439.687] * [-2431.743] (-2438.954) (-2436.929) (-2445.506) -- 0:01:00
886500 -- (-2436.428) (-2431.965) (-2434.388) [-2443.009] * (-2431.425) (-2436.668) [-2427.718] (-2444.598) -- 0:00:59
887000 -- (-2437.411) [-2428.918] (-2431.104) (-2446.136) * (-2435.935) (-2440.218) (-2441.759) [-2441.765] -- 0:00:59
887500 -- (-2432.542) (-2433.436) (-2445.903) [-2435.587] * (-2434.947) (-2437.097) [-2436.130] (-2432.710) -- 0:00:59
888000 -- [-2436.687] (-2433.926) (-2449.476) (-2441.326) * (-2437.998) (-2458.801) [-2433.600] (-2436.269) -- 0:00:59
888500 -- [-2430.941] (-2431.188) (-2439.872) (-2447.743) * (-2441.991) (-2430.495) [-2433.193] (-2434.142) -- 0:00:58
889000 -- (-2451.442) [-2433.613] (-2431.876) (-2435.162) * (-2434.278) [-2439.462] (-2436.874) (-2431.234) -- 0:00:58
889500 -- (-2436.328) [-2433.837] (-2452.607) (-2445.385) * [-2440.329] (-2439.832) (-2427.731) (-2436.209) -- 0:00:58
890000 -- (-2447.661) [-2434.308] (-2448.685) (-2438.212) * (-2439.544) [-2433.450] (-2430.959) (-2437.446) -- 0:00:58
Average standard deviation of split frequencies: 0.006739
890500 -- (-2441.116) (-2432.872) [-2434.762] (-2448.430) * (-2440.366) (-2428.096) (-2439.809) [-2434.815] -- 0:00:57
891000 -- (-2441.784) (-2426.948) [-2439.843] (-2434.214) * [-2434.412] (-2431.643) (-2437.302) (-2436.108) -- 0:00:57
891500 -- [-2434.200] (-2440.417) (-2437.209) (-2425.515) * [-2434.935] (-2429.819) (-2441.294) (-2436.976) -- 0:00:57
892000 -- (-2449.873) (-2436.457) [-2435.041] (-2426.787) * (-2446.718) (-2435.891) (-2432.761) [-2438.963] -- 0:00:57
892500 -- (-2429.978) [-2431.912] (-2431.504) (-2443.532) * (-2445.406) [-2431.683] (-2432.206) (-2439.313) -- 0:00:56
893000 -- (-2435.226) (-2431.631) [-2423.400] (-2439.618) * (-2445.087) (-2432.484) [-2432.377] (-2430.667) -- 0:00:56
893500 -- (-2433.803) (-2442.183) (-2428.333) [-2428.161] * (-2432.993) [-2434.095] (-2431.195) (-2436.981) -- 0:00:56
894000 -- (-2430.598) [-2435.728] (-2446.178) (-2429.318) * (-2428.570) [-2438.529] (-2432.040) (-2429.911) -- 0:00:55
894500 -- [-2437.482] (-2434.090) (-2435.504) (-2431.997) * (-2431.436) (-2438.166) [-2432.632] (-2436.075) -- 0:00:55
895000 -- [-2428.132] (-2437.735) (-2433.184) (-2429.693) * (-2433.627) (-2433.919) (-2435.791) [-2428.610] -- 0:00:55
Average standard deviation of split frequencies: 0.006664
895500 -- [-2431.117] (-2440.952) (-2431.912) (-2437.604) * (-2442.083) (-2440.037) [-2430.793] (-2433.003) -- 0:00:55
896000 -- [-2437.520] (-2443.702) (-2432.498) (-2430.963) * (-2432.523) (-2436.743) (-2430.847) [-2436.454] -- 0:00:54
896500 -- (-2431.339) [-2434.076] (-2437.371) (-2445.903) * (-2444.167) (-2448.192) [-2422.113] (-2447.932) -- 0:00:54
897000 -- (-2430.559) [-2430.788] (-2439.513) (-2437.481) * (-2439.108) (-2436.969) [-2429.772] (-2448.917) -- 0:00:54
897500 -- (-2454.825) [-2426.189] (-2434.282) (-2450.941) * [-2439.957] (-2448.077) (-2431.466) (-2456.030) -- 0:00:54
898000 -- (-2437.173) [-2438.380] (-2432.708) (-2436.846) * [-2434.486] (-2436.856) (-2433.182) (-2441.797) -- 0:00:53
898500 -- [-2438.938] (-2443.561) (-2437.994) (-2426.388) * (-2445.149) [-2431.434] (-2441.742) (-2435.875) -- 0:00:53
899000 -- [-2430.429] (-2443.894) (-2437.244) (-2431.964) * (-2444.333) (-2425.599) (-2437.463) [-2436.709] -- 0:00:53
899500 -- (-2433.681) [-2430.934] (-2431.120) (-2433.703) * (-2432.889) [-2428.018] (-2441.402) (-2445.113) -- 0:00:53
900000 -- (-2445.573) [-2424.822] (-2432.716) (-2430.656) * (-2434.047) (-2429.842) (-2433.964) [-2432.999] -- 0:00:52
Average standard deviation of split frequencies: 0.006699
900500 -- (-2449.052) (-2433.544) (-2444.602) [-2428.098] * (-2439.681) [-2438.366] (-2438.230) (-2435.654) -- 0:00:52
901000 -- [-2433.970] (-2436.699) (-2440.671) (-2444.865) * (-2429.209) (-2443.313) [-2433.585] (-2443.077) -- 0:00:52
901500 -- (-2442.180) (-2436.647) (-2433.424) [-2435.800] * (-2445.055) (-2440.832) (-2427.223) [-2429.221] -- 0:00:52
902000 -- (-2429.629) [-2441.196] (-2437.127) (-2447.195) * (-2438.385) (-2439.066) (-2444.803) [-2441.792] -- 0:00:51
902500 -- (-2432.205) (-2434.386) [-2429.377] (-2431.675) * [-2438.474] (-2441.985) (-2430.035) (-2436.502) -- 0:00:51
903000 -- (-2436.604) (-2433.566) [-2429.660] (-2437.211) * (-2435.120) (-2445.666) [-2444.427] (-2432.547) -- 0:00:51
903500 -- [-2434.512] (-2433.159) (-2434.202) (-2442.085) * (-2434.876) [-2426.461] (-2439.759) (-2431.332) -- 0:00:50
904000 -- [-2431.342] (-2435.716) (-2438.200) (-2440.762) * (-2442.881) [-2432.971] (-2446.127) (-2441.243) -- 0:00:50
904500 -- (-2433.367) (-2426.789) [-2430.387] (-2443.968) * (-2431.497) (-2444.673) (-2433.010) [-2430.096] -- 0:00:50
905000 -- (-2435.690) [-2438.839] (-2445.511) (-2443.145) * [-2436.050] (-2438.578) (-2441.949) (-2430.057) -- 0:00:50
Average standard deviation of split frequencies: 0.006348
905500 -- (-2440.838) (-2432.904) [-2428.941] (-2427.815) * (-2430.831) (-2438.380) [-2444.449] (-2436.808) -- 0:00:49
906000 -- [-2427.827] (-2442.303) (-2434.857) (-2435.308) * [-2432.279] (-2436.504) (-2451.834) (-2432.647) -- 0:00:49
906500 -- (-2429.861) [-2434.276] (-2435.527) (-2435.511) * (-2430.297) (-2430.569) (-2436.053) [-2430.920] -- 0:00:49
907000 -- [-2434.272] (-2440.418) (-2437.383) (-2426.851) * (-2433.382) [-2432.309] (-2436.360) (-2438.551) -- 0:00:49
907500 -- (-2433.219) (-2436.281) [-2432.212] (-2433.177) * (-2430.866) (-2434.792) [-2432.010] (-2433.824) -- 0:00:48
908000 -- (-2431.964) (-2440.578) (-2436.701) [-2430.148] * (-2431.130) (-2427.515) [-2437.284] (-2428.249) -- 0:00:48
908500 -- (-2434.495) (-2433.473) (-2442.430) [-2425.391] * [-2432.120] (-2435.421) (-2443.867) (-2442.390) -- 0:00:48
909000 -- (-2433.121) (-2435.641) (-2437.938) [-2427.960] * (-2426.319) (-2443.979) [-2431.797] (-2440.911) -- 0:00:48
909500 -- (-2434.576) (-2456.083) [-2433.509] (-2437.509) * [-2430.233] (-2440.438) (-2433.165) (-2438.199) -- 0:00:47
910000 -- (-2440.234) [-2430.583] (-2439.057) (-2436.043) * [-2437.838] (-2433.505) (-2436.007) (-2434.599) -- 0:00:47
Average standard deviation of split frequencies: 0.006798
910500 -- (-2448.191) [-2436.704] (-2442.045) (-2439.496) * (-2426.184) (-2431.146) [-2427.756] (-2435.597) -- 0:00:47
911000 -- (-2438.705) (-2430.952) (-2444.945) [-2438.752] * (-2433.417) [-2437.990] (-2436.424) (-2437.451) -- 0:00:46
911500 -- [-2427.408] (-2437.341) (-2428.930) (-2435.285) * (-2435.820) (-2437.866) [-2426.874] (-2437.124) -- 0:00:46
912000 -- [-2426.796] (-2438.384) (-2433.810) (-2433.151) * (-2432.474) (-2444.230) [-2433.457] (-2442.913) -- 0:00:46
912500 -- (-2431.574) [-2434.269] (-2428.643) (-2434.355) * (-2427.246) (-2428.301) [-2428.621] (-2448.756) -- 0:00:46
913000 -- (-2435.465) (-2437.042) (-2437.743) [-2434.857] * (-2433.257) (-2445.954) [-2430.063] (-2438.079) -- 0:00:46
913500 -- (-2437.898) (-2434.043) (-2433.490) [-2435.601] * (-2453.988) (-2433.236) (-2436.724) [-2432.986] -- 0:00:45
914000 -- [-2431.884] (-2443.827) (-2438.343) (-2440.682) * [-2430.735] (-2432.492) (-2442.717) (-2431.276) -- 0:00:45
914500 -- (-2445.198) (-2440.781) [-2431.560] (-2444.432) * (-2438.309) (-2443.776) [-2436.231] (-2439.389) -- 0:00:45
915000 -- (-2444.891) (-2433.446) [-2439.023] (-2437.967) * (-2442.914) (-2432.889) (-2434.313) [-2430.050] -- 0:00:44
Average standard deviation of split frequencies: 0.006999
915500 -- (-2434.692) (-2440.222) (-2435.552) [-2427.507] * (-2449.455) (-2431.400) (-2439.142) [-2429.165] -- 0:00:44
916000 -- (-2430.827) (-2435.381) (-2434.978) [-2429.973] * [-2438.017] (-2437.298) (-2434.076) (-2443.633) -- 0:00:44
916500 -- (-2447.305) (-2442.841) (-2440.073) [-2432.035] * [-2429.720] (-2432.425) (-2434.225) (-2442.687) -- 0:00:44
917000 -- (-2427.901) (-2444.781) [-2430.077] (-2432.415) * (-2441.858) (-2445.854) [-2430.511] (-2435.475) -- 0:00:43
917500 -- (-2432.818) (-2433.334) (-2429.096) [-2430.711] * [-2425.405] (-2437.813) (-2428.803) (-2435.213) -- 0:00:43
918000 -- (-2440.333) (-2443.770) (-2440.953) [-2434.992] * (-2432.257) (-2442.775) (-2432.060) [-2428.322] -- 0:00:43
918500 -- (-2429.655) (-2433.033) (-2435.861) [-2429.516] * (-2431.857) (-2435.271) (-2425.534) [-2432.896] -- 0:00:43
919000 -- (-2446.065) (-2443.125) [-2437.341] (-2436.784) * [-2431.513] (-2438.420) (-2435.855) (-2432.480) -- 0:00:42
919500 -- (-2439.236) (-2439.731) (-2437.342) [-2437.110] * [-2429.773] (-2437.370) (-2442.360) (-2439.704) -- 0:00:42
920000 -- (-2445.389) (-2434.105) (-2433.439) [-2442.697] * [-2438.024] (-2438.061) (-2434.488) (-2431.691) -- 0:00:42
Average standard deviation of split frequencies: 0.007066
920500 -- (-2440.526) [-2437.735] (-2432.335) (-2431.616) * (-2447.429) [-2430.887] (-2445.330) (-2434.662) -- 0:00:41
921000 -- (-2442.162) (-2430.836) [-2430.930] (-2434.261) * (-2440.804) (-2433.480) (-2434.588) [-2429.965] -- 0:00:41
921500 -- (-2445.247) [-2433.815] (-2444.160) (-2433.237) * (-2435.073) [-2433.068] (-2433.369) (-2431.852) -- 0:00:41
922000 -- (-2433.603) [-2432.837] (-2428.710) (-2437.937) * (-2433.231) (-2433.295) [-2431.936] (-2427.803) -- 0:00:41
922500 -- [-2441.420] (-2430.760) (-2439.826) (-2448.504) * (-2435.962) [-2433.441] (-2435.063) (-2429.306) -- 0:00:40
923000 -- (-2437.599) [-2433.485] (-2436.686) (-2435.306) * (-2439.284) (-2435.560) [-2428.251] (-2431.895) -- 0:00:40
923500 -- (-2437.021) (-2434.829) [-2435.189] (-2438.175) * (-2434.497) (-2438.061) (-2437.276) [-2427.394] -- 0:00:40
924000 -- [-2429.385] (-2439.325) (-2428.930) (-2445.527) * [-2428.036] (-2438.114) (-2441.981) (-2431.283) -- 0:00:40
924500 -- (-2423.444) [-2429.045] (-2434.361) (-2449.641) * (-2436.223) (-2440.502) [-2429.907] (-2433.189) -- 0:00:39
925000 -- (-2428.083) (-2432.026) [-2426.423] (-2434.512) * (-2455.200) [-2427.970] (-2429.132) (-2439.892) -- 0:00:39
Average standard deviation of split frequencies: 0.006686
925500 -- (-2432.957) (-2437.880) [-2432.880] (-2437.518) * (-2433.856) (-2434.875) [-2429.244] (-2445.302) -- 0:00:39
926000 -- (-2442.992) (-2440.624) (-2428.280) [-2431.158] * [-2431.338] (-2436.267) (-2442.906) (-2436.814) -- 0:00:39
926500 -- [-2433.499] (-2434.092) (-2431.268) (-2436.905) * (-2428.916) [-2435.471] (-2431.917) (-2441.849) -- 0:00:38
927000 -- [-2430.588] (-2432.813) (-2431.205) (-2431.168) * (-2436.076) (-2446.832) (-2440.822) [-2429.493] -- 0:00:38
927500 -- (-2439.688) [-2437.086] (-2431.334) (-2425.726) * (-2438.805) (-2449.699) (-2441.394) [-2431.087] -- 0:00:38
928000 -- [-2431.750] (-2436.986) (-2439.519) (-2435.607) * (-2438.471) [-2435.008] (-2436.669) (-2433.363) -- 0:00:38
928500 -- (-2431.797) (-2438.179) [-2428.916] (-2432.864) * [-2429.516] (-2428.105) (-2438.666) (-2437.265) -- 0:00:37
929000 -- [-2426.975] (-2440.986) (-2438.861) (-2428.347) * (-2429.727) (-2440.242) (-2438.069) [-2434.409] -- 0:00:37
929500 -- (-2429.972) (-2435.651) (-2436.015) [-2437.597] * (-2432.202) (-2442.833) (-2441.393) [-2446.087] -- 0:00:37
930000 -- (-2436.977) [-2428.745] (-2438.307) (-2436.736) * (-2433.450) [-2439.023] (-2432.866) (-2435.852) -- 0:00:37
Average standard deviation of split frequencies: 0.006517
930500 -- (-2434.706) (-2435.222) (-2443.445) [-2433.661] * (-2436.386) [-2439.903] (-2439.182) (-2447.911) -- 0:00:36
931000 -- (-2438.692) (-2456.546) (-2441.967) [-2433.265] * [-2429.589] (-2438.612) (-2437.875) (-2435.446) -- 0:00:36
931500 -- (-2447.292) (-2446.971) [-2433.582] (-2436.906) * [-2439.109] (-2437.588) (-2432.532) (-2432.409) -- 0:00:36
932000 -- [-2435.616] (-2440.628) (-2444.842) (-2429.991) * (-2437.151) (-2446.064) (-2443.748) [-2431.737] -- 0:00:35
932500 -- (-2431.894) [-2432.383] (-2455.049) (-2434.148) * (-2445.558) [-2432.834] (-2439.254) (-2431.466) -- 0:00:35
933000 -- (-2429.911) [-2429.643] (-2448.151) (-2430.719) * (-2437.668) [-2429.823] (-2438.514) (-2440.890) -- 0:00:35
933500 -- [-2434.346] (-2430.921) (-2444.836) (-2439.481) * (-2436.019) (-2431.503) (-2442.500) [-2437.348] -- 0:00:35
934000 -- (-2428.998) (-2445.332) (-2440.254) [-2438.245] * (-2437.133) (-2442.222) (-2442.196) [-2427.653] -- 0:00:34
934500 -- (-2434.532) [-2436.515] (-2435.111) (-2443.608) * (-2429.275) [-2426.324] (-2441.013) (-2439.780) -- 0:00:34
935000 -- [-2435.215] (-2439.767) (-2432.853) (-2436.379) * (-2440.409) [-2436.736] (-2432.260) (-2439.281) -- 0:00:34
Average standard deviation of split frequencies: 0.006111
935500 -- (-2446.837) (-2436.492) [-2445.951] (-2443.800) * (-2439.298) (-2444.192) (-2436.961) [-2439.863] -- 0:00:34
936000 -- [-2429.809] (-2444.963) (-2425.488) (-2438.781) * (-2431.805) (-2446.605) (-2442.236) [-2438.965] -- 0:00:33
936500 -- (-2435.723) (-2436.216) [-2432.632] (-2446.192) * (-2440.909) [-2433.060] (-2434.740) (-2427.868) -- 0:00:33
937000 -- (-2436.905) (-2437.266) [-2435.796] (-2431.819) * (-2431.946) [-2425.180] (-2436.249) (-2445.288) -- 0:00:33
937500 -- [-2429.197] (-2446.010) (-2445.895) (-2428.024) * (-2440.284) [-2432.166] (-2442.354) (-2435.032) -- 0:00:33
938000 -- (-2436.515) (-2431.284) (-2445.154) [-2429.569] * (-2438.793) (-2433.989) (-2433.300) [-2441.074] -- 0:00:32
938500 -- (-2438.354) (-2435.524) (-2443.949) [-2431.028] * (-2432.724) (-2431.047) (-2445.206) [-2440.160] -- 0:00:32
939000 -- (-2429.775) (-2439.386) [-2434.344] (-2431.231) * (-2441.893) [-2436.990] (-2429.210) (-2434.728) -- 0:00:32
939500 -- (-2432.590) (-2432.489) [-2429.205] (-2447.425) * (-2431.768) [-2438.909] (-2441.103) (-2438.039) -- 0:00:31
940000 -- [-2430.933] (-2439.141) (-2434.598) (-2444.819) * [-2426.968] (-2429.846) (-2444.049) (-2432.360) -- 0:00:31
Average standard deviation of split frequencies: 0.006415
940500 -- (-2442.459) (-2436.111) [-2440.462] (-2435.010) * [-2438.399] (-2434.753) (-2442.096) (-2438.359) -- 0:00:31
941000 -- (-2432.760) (-2437.250) [-2425.740] (-2433.182) * (-2442.450) [-2435.594] (-2443.138) (-2449.101) -- 0:00:31
941500 -- (-2444.730) (-2434.338) [-2431.204] (-2430.970) * (-2437.378) [-2441.446] (-2444.670) (-2431.889) -- 0:00:30
942000 -- (-2433.225) (-2439.134) (-2440.730) [-2428.028] * (-2435.619) (-2433.301) [-2439.482] (-2437.333) -- 0:00:30
942500 -- (-2439.042) (-2431.793) [-2437.972] (-2437.737) * (-2444.708) (-2443.312) [-2434.726] (-2427.788) -- 0:00:30
943000 -- (-2448.513) (-2438.244) [-2434.174] (-2433.531) * (-2436.785) [-2428.457] (-2432.587) (-2435.853) -- 0:00:30
943500 -- (-2451.125) [-2429.486] (-2436.525) (-2433.299) * (-2445.701) [-2431.369] (-2443.065) (-2440.824) -- 0:00:29
944000 -- (-2433.884) [-2437.804] (-2437.002) (-2430.026) * (-2429.822) [-2429.897] (-2435.179) (-2449.921) -- 0:00:29
944500 -- (-2436.166) (-2433.101) (-2440.650) [-2433.596] * (-2437.000) (-2441.351) (-2447.034) [-2430.064] -- 0:00:29
945000 -- (-2435.809) (-2442.811) (-2434.483) [-2428.608] * [-2429.158] (-2435.355) (-2442.500) (-2435.106) -- 0:00:29
Average standard deviation of split frequencies: 0.006478
945500 -- [-2423.168] (-2440.920) (-2428.122) (-2436.087) * [-2437.257] (-2441.979) (-2435.796) (-2444.742) -- 0:00:28
946000 -- (-2435.427) [-2430.768] (-2425.799) (-2451.712) * [-2431.164] (-2433.597) (-2435.472) (-2442.631) -- 0:00:28
946500 -- (-2434.353) [-2427.672] (-2445.995) (-2449.354) * (-2437.839) (-2430.884) (-2441.148) [-2435.384] -- 0:00:28
947000 -- [-2433.127] (-2435.851) (-2442.321) (-2432.915) * (-2431.719) (-2439.283) (-2439.926) [-2425.721] -- 0:00:27
947500 -- (-2440.053) (-2434.601) [-2441.742] (-2432.178) * (-2434.691) (-2438.669) [-2433.624] (-2434.882) -- 0:00:27
948000 -- (-2431.118) (-2448.567) (-2444.514) [-2435.967] * (-2436.190) [-2439.761] (-2442.553) (-2434.590) -- 0:00:27
948500 -- (-2434.007) (-2446.865) (-2450.959) [-2428.767] * [-2434.627] (-2446.044) (-2432.555) (-2433.687) -- 0:00:27
949000 -- [-2433.632] (-2440.717) (-2440.441) (-2434.452) * (-2438.257) [-2440.032] (-2437.858) (-2435.809) -- 0:00:26
949500 -- [-2427.013] (-2433.513) (-2438.622) (-2429.888) * [-2431.704] (-2437.282) (-2449.633) (-2443.529) -- 0:00:26
950000 -- (-2445.604) (-2441.657) [-2432.096] (-2435.617) * (-2431.024) (-2436.678) (-2444.487) [-2431.272] -- 0:00:26
Average standard deviation of split frequencies: 0.006843
950500 -- (-2447.463) (-2440.987) (-2435.614) [-2430.196] * (-2434.498) (-2433.935) (-2437.742) [-2433.003] -- 0:00:26
951000 -- (-2434.520) (-2431.065) (-2428.157) [-2433.111] * (-2438.362) (-2431.958) (-2448.324) [-2427.172] -- 0:00:25
951500 -- (-2444.901) [-2428.964] (-2432.007) (-2430.139) * (-2437.907) (-2432.819) (-2447.954) [-2426.285] -- 0:00:25
952000 -- (-2443.282) [-2436.135] (-2432.415) (-2439.489) * [-2428.035] (-2427.235) (-2433.633) (-2432.478) -- 0:00:25
952500 -- (-2432.675) [-2437.924] (-2430.117) (-2441.622) * (-2451.115) (-2446.215) (-2438.041) [-2436.840] -- 0:00:25
953000 -- (-2436.787) (-2444.039) (-2434.754) [-2427.790] * (-2436.964) (-2429.228) (-2437.266) [-2435.785] -- 0:00:24
953500 -- (-2432.926) (-2441.825) (-2434.870) [-2431.440] * [-2435.734] (-2433.867) (-2434.763) (-2443.951) -- 0:00:24
954000 -- (-2450.702) [-2433.403] (-2444.902) (-2432.187) * (-2442.883) [-2436.575] (-2442.317) (-2448.502) -- 0:00:24
954500 -- (-2438.164) [-2425.992] (-2436.932) (-2427.206) * (-2439.156) (-2432.733) [-2433.488] (-2447.819) -- 0:00:24
955000 -- (-2437.228) (-2455.757) (-2439.894) [-2436.879] * [-2429.014] (-2433.643) (-2437.018) (-2430.193) -- 0:00:23
Average standard deviation of split frequencies: 0.006706
955500 -- (-2431.359) [-2427.368] (-2435.083) (-2436.935) * [-2431.074] (-2435.511) (-2426.866) (-2447.588) -- 0:00:23
956000 -- [-2430.296] (-2437.761) (-2428.641) (-2439.997) * (-2438.616) [-2430.801] (-2433.048) (-2436.896) -- 0:00:23
956500 -- [-2438.497] (-2435.717) (-2436.738) (-2443.064) * [-2434.124] (-2432.906) (-2438.278) (-2428.124) -- 0:00:22
957000 -- (-2441.000) [-2430.444] (-2435.169) (-2436.082) * (-2440.285) (-2436.563) [-2428.318] (-2425.202) -- 0:00:22
957500 -- (-2434.707) [-2429.571] (-2429.262) (-2436.453) * (-2446.700) [-2435.035] (-2431.647) (-2438.024) -- 0:00:22
958000 -- (-2444.058) (-2437.127) (-2432.052) [-2430.987] * [-2429.734] (-2440.992) (-2434.271) (-2426.546) -- 0:00:22
958500 -- (-2439.746) [-2427.265] (-2435.851) (-2424.874) * [-2427.707] (-2435.050) (-2439.322) (-2445.045) -- 0:00:21
959000 -- (-2430.413) (-2437.279) (-2439.314) [-2435.422] * (-2437.377) [-2441.287] (-2441.672) (-2432.789) -- 0:00:21
959500 -- (-2443.426) (-2426.904) (-2433.992) [-2432.167] * (-2431.921) (-2439.232) [-2435.979] (-2435.807) -- 0:00:21
960000 -- (-2438.201) [-2427.556] (-2433.016) (-2437.436) * [-2430.975] (-2435.539) (-2434.369) (-2431.769) -- 0:00:21
Average standard deviation of split frequencies: 0.006674
960500 -- [-2437.401] (-2434.522) (-2442.504) (-2443.147) * (-2434.257) (-2434.962) [-2428.086] (-2428.062) -- 0:00:20
961000 -- (-2437.913) (-2436.047) [-2434.996] (-2445.785) * (-2436.308) [-2432.025] (-2427.776) (-2438.097) -- 0:00:20
961500 -- [-2432.174] (-2440.975) (-2427.963) (-2442.678) * (-2444.456) (-2440.865) [-2431.072] (-2445.960) -- 0:00:20
962000 -- (-2438.871) [-2432.410] (-2435.540) (-2439.745) * (-2440.119) [-2429.816] (-2433.020) (-2434.233) -- 0:00:20
962500 -- (-2445.453) [-2433.226] (-2442.006) (-2439.044) * [-2430.686] (-2437.662) (-2440.841) (-2432.680) -- 0:00:19
963000 -- (-2440.494) (-2433.285) [-2431.955] (-2438.425) * (-2440.083) (-2435.158) (-2440.280) [-2433.745] -- 0:00:19
963500 -- (-2431.872) (-2442.932) (-2445.059) [-2440.813] * (-2431.885) (-2440.499) [-2438.599] (-2435.174) -- 0:00:19
964000 -- (-2434.601) (-2444.386) (-2446.233) [-2437.162] * (-2430.805) (-2443.061) (-2444.600) [-2429.462] -- 0:00:19
964500 -- (-2439.093) [-2431.242] (-2439.295) (-2451.905) * (-2439.727) (-2430.457) [-2443.898] (-2438.014) -- 0:00:18
965000 -- (-2435.394) [-2439.283] (-2432.754) (-2452.437) * (-2438.256) [-2429.846] (-2446.817) (-2428.221) -- 0:00:18
Average standard deviation of split frequencies: 0.007840
965500 -- (-2438.678) [-2431.102] (-2435.185) (-2442.969) * [-2439.403] (-2432.324) (-2438.298) (-2432.890) -- 0:00:18
966000 -- (-2437.081) [-2439.369] (-2436.216) (-2438.843) * (-2430.476) (-2437.164) (-2434.572) [-2442.860] -- 0:00:17
966500 -- (-2440.214) (-2429.967) [-2430.308] (-2452.828) * (-2446.920) [-2428.391] (-2437.809) (-2434.093) -- 0:00:17
967000 -- [-2430.747] (-2432.473) (-2440.976) (-2455.972) * (-2438.286) (-2441.020) (-2434.981) [-2424.298] -- 0:00:17
967500 -- [-2431.652] (-2436.359) (-2435.930) (-2438.511) * (-2442.831) [-2439.486] (-2446.904) (-2433.935) -- 0:00:17
968000 -- (-2437.272) (-2441.956) [-2434.748] (-2436.423) * (-2434.232) (-2432.511) [-2433.928] (-2432.861) -- 0:00:16
968500 -- (-2436.734) [-2426.014] (-2435.628) (-2441.217) * (-2436.056) (-2438.272) [-2428.931] (-2434.999) -- 0:00:16
969000 -- (-2452.579) (-2433.061) [-2434.121] (-2435.057) * (-2440.326) [-2439.825] (-2436.971) (-2438.444) -- 0:00:16
969500 -- (-2444.587) (-2440.483) (-2432.133) [-2432.176] * (-2438.018) (-2441.843) (-2441.396) [-2431.922] -- 0:00:16
970000 -- (-2441.774) (-2440.255) (-2435.089) [-2431.965] * (-2438.043) [-2424.832] (-2434.612) (-2427.715) -- 0:00:15
Average standard deviation of split frequencies: 0.007641
970500 -- (-2439.235) (-2444.875) (-2433.413) [-2434.393] * (-2449.370) (-2431.641) [-2427.649] (-2433.726) -- 0:00:15
971000 -- (-2429.138) (-2444.434) (-2441.467) [-2431.116] * [-2436.432] (-2443.015) (-2430.783) (-2436.954) -- 0:00:15
971500 -- (-2423.923) (-2455.748) (-2431.492) [-2428.417] * (-2432.137) (-2438.957) [-2438.662] (-2442.967) -- 0:00:15
972000 -- (-2441.370) (-2439.565) (-2442.354) [-2430.878] * (-2451.532) (-2438.523) (-2437.500) [-2435.720] -- 0:00:14
972500 -- (-2425.090) (-2435.979) (-2439.750) [-2425.895] * (-2445.283) (-2442.565) (-2436.101) [-2437.345] -- 0:00:14
973000 -- (-2438.693) (-2446.233) [-2435.165] (-2431.603) * (-2437.678) (-2441.059) (-2438.230) [-2429.535] -- 0:00:14
973500 -- (-2435.588) (-2428.775) (-2437.780) [-2430.383] * (-2431.360) (-2450.714) [-2434.174] (-2433.075) -- 0:00:13
974000 -- [-2435.575] (-2442.538) (-2441.593) (-2435.358) * (-2435.564) [-2427.570] (-2438.512) (-2433.292) -- 0:00:13
974500 -- (-2434.284) (-2442.126) [-2444.967] (-2447.599) * (-2427.326) [-2433.721] (-2441.638) (-2431.573) -- 0:00:13
975000 -- (-2440.832) (-2434.775) [-2432.634] (-2441.435) * (-2442.747) [-2427.080] (-2430.116) (-2436.669) -- 0:00:13
Average standard deviation of split frequencies: 0.006923
975500 -- (-2434.018) (-2443.184) (-2433.428) [-2433.471] * (-2434.336) (-2438.780) (-2442.592) [-2430.055] -- 0:00:12
976000 -- (-2444.537) (-2432.620) (-2429.092) [-2434.283] * (-2439.674) [-2436.235] (-2439.536) (-2438.289) -- 0:00:12
976500 -- [-2442.081] (-2432.026) (-2442.151) (-2444.772) * (-2433.137) [-2438.952] (-2431.076) (-2431.416) -- 0:00:12
977000 -- (-2446.599) (-2439.707) (-2431.448) [-2441.939] * (-2429.041) [-2428.990] (-2426.335) (-2438.273) -- 0:00:12
977500 -- [-2439.168] (-2430.219) (-2438.645) (-2430.518) * (-2435.838) (-2437.833) (-2442.076) [-2433.340] -- 0:00:11
978000 -- (-2430.870) [-2429.475] (-2436.488) (-2441.825) * (-2444.215) (-2441.381) (-2440.994) [-2430.724] -- 0:00:11
978500 -- (-2442.581) (-2432.799) (-2440.171) [-2432.349] * (-2431.343) (-2440.440) (-2432.152) [-2435.117] -- 0:00:11
979000 -- (-2443.784) (-2444.424) (-2449.077) [-2435.655] * (-2435.157) [-2435.114] (-2433.649) (-2431.201) -- 0:00:11
979500 -- (-2441.891) (-2439.334) (-2436.675) [-2431.571] * (-2432.179) (-2438.577) (-2435.056) [-2429.436] -- 0:00:10
980000 -- (-2437.125) (-2425.327) (-2445.661) [-2423.220] * [-2430.304] (-2441.150) (-2452.565) (-2439.356) -- 0:00:10
Average standard deviation of split frequencies: 0.007114
980500 -- (-2439.565) [-2437.963] (-2437.636) (-2435.348) * [-2431.028] (-2430.888) (-2436.735) (-2434.896) -- 0:00:10
981000 -- (-2435.635) [-2434.447] (-2437.369) (-2438.230) * (-2439.169) [-2438.589] (-2445.416) (-2432.267) -- 0:00:10
981500 -- (-2444.882) (-2439.675) (-2429.706) [-2436.972] * (-2444.197) (-2434.519) [-2431.269] (-2438.989) -- 0:00:09
982000 -- (-2447.775) [-2443.048] (-2431.206) (-2436.327) * (-2446.426) (-2427.272) [-2428.633] (-2435.526) -- 0:00:09
982500 -- (-2441.805) (-2437.263) [-2428.890] (-2440.229) * (-2438.704) (-2427.508) [-2430.242] (-2446.517) -- 0:00:09
983000 -- (-2445.708) (-2435.307) (-2452.490) [-2438.066] * [-2432.739] (-2436.362) (-2428.636) (-2442.420) -- 0:00:08
983500 -- (-2442.053) (-2433.563) [-2442.777] (-2438.323) * (-2434.576) (-2433.261) (-2434.129) [-2442.206] -- 0:00:08
984000 -- (-2440.294) [-2434.623] (-2426.486) (-2453.008) * [-2429.446] (-2431.852) (-2441.791) (-2444.539) -- 0:00:08
984500 -- (-2437.117) [-2439.818] (-2426.666) (-2437.493) * [-2439.984] (-2437.957) (-2439.689) (-2431.390) -- 0:00:08
985000 -- (-2431.501) (-2436.594) [-2433.878] (-2439.879) * (-2436.120) (-2436.810) (-2432.568) [-2426.020] -- 0:00:07
Average standard deviation of split frequencies: 0.006821
985500 -- [-2426.383] (-2443.148) (-2436.834) (-2428.916) * (-2427.031) (-2437.213) (-2434.340) [-2432.247] -- 0:00:07
986000 -- (-2444.727) (-2437.534) [-2432.425] (-2435.941) * (-2434.557) [-2435.640] (-2432.447) (-2440.353) -- 0:00:07
986500 -- (-2437.479) (-2438.340) (-2449.676) [-2431.297] * [-2435.165] (-2445.552) (-2427.709) (-2442.698) -- 0:00:07
987000 -- [-2437.232] (-2449.750) (-2435.525) (-2429.041) * (-2439.529) [-2431.178] (-2428.194) (-2438.352) -- 0:00:06
987500 -- (-2433.736) (-2436.036) [-2432.179] (-2428.824) * (-2434.322) (-2427.802) [-2431.886] (-2440.213) -- 0:00:06
988000 -- [-2423.631] (-2445.120) (-2436.716) (-2456.355) * (-2438.570) (-2430.440) [-2431.544] (-2440.056) -- 0:00:06
988500 -- (-2427.978) (-2435.971) [-2432.333] (-2441.474) * (-2428.518) (-2435.574) (-2430.384) [-2427.643] -- 0:00:06
989000 -- (-2440.775) (-2439.327) [-2435.632] (-2445.324) * (-2441.881) (-2433.793) (-2439.798) [-2433.075] -- 0:00:05
989500 -- [-2437.375] (-2431.557) (-2435.031) (-2444.376) * (-2425.819) (-2437.051) [-2431.655] (-2431.868) -- 0:00:05
990000 -- (-2431.285) (-2430.507) (-2453.993) [-2427.760] * (-2437.665) (-2432.988) (-2429.440) [-2437.660] -- 0:00:05
Average standard deviation of split frequencies: 0.007043
990500 -- (-2444.006) (-2439.196) (-2440.341) [-2426.887] * [-2432.241] (-2427.082) (-2445.573) (-2450.728) -- 0:00:05
991000 -- (-2435.595) [-2430.748] (-2439.280) (-2428.432) * (-2433.998) (-2432.269) [-2437.317] (-2434.443) -- 0:00:04
991500 -- (-2438.246) (-2436.582) (-2445.412) [-2425.418] * (-2440.858) [-2426.211] (-2446.667) (-2430.802) -- 0:00:04
992000 -- (-2439.802) (-2434.017) [-2431.405] (-2440.538) * [-2429.816] (-2433.312) (-2432.424) (-2438.260) -- 0:00:04
992500 -- (-2431.718) (-2430.928) [-2427.108] (-2429.383) * (-2433.481) (-2434.359) [-2430.336] (-2440.266) -- 0:00:03
993000 -- [-2434.527] (-2436.011) (-2432.568) (-2440.744) * [-2431.092] (-2435.252) (-2432.510) (-2436.444) -- 0:00:03
993500 -- (-2436.486) (-2434.834) (-2447.810) [-2433.594] * [-2429.728] (-2437.347) (-2435.606) (-2428.057) -- 0:00:03
994000 -- (-2438.044) (-2436.443) (-2438.775) [-2426.721] * (-2435.282) (-2444.432) (-2442.248) [-2445.970] -- 0:00:03
994500 -- (-2437.146) (-2430.489) [-2444.050] (-2434.738) * (-2439.205) (-2434.191) (-2438.933) [-2432.427] -- 0:00:02
995000 -- (-2429.505) [-2431.291] (-2437.592) (-2441.775) * (-2441.762) (-2444.557) [-2436.555] (-2434.432) -- 0:00:02
Average standard deviation of split frequencies: 0.007226
995500 -- [-2436.032] (-2454.409) (-2432.886) (-2444.461) * (-2435.038) [-2436.738] (-2443.270) (-2433.404) -- 0:00:02
996000 -- (-2441.036) (-2436.024) [-2434.001] (-2435.023) * [-2437.004] (-2436.093) (-2440.423) (-2436.906) -- 0:00:02
996500 -- (-2439.541) (-2449.081) [-2436.478] (-2437.470) * (-2449.189) [-2433.891] (-2445.475) (-2432.623) -- 0:00:01
997000 -- (-2435.258) (-2435.839) [-2434.552] (-2431.983) * (-2445.153) (-2431.655) (-2430.183) [-2433.055] -- 0:00:01
997500 -- (-2439.486) (-2443.634) [-2432.454] (-2432.732) * (-2437.603) (-2432.767) [-2432.505] (-2444.343) -- 0:00:01
998000 -- (-2441.594) [-2436.248] (-2442.463) (-2444.865) * [-2425.554] (-2431.527) (-2440.742) (-2431.869) -- 0:00:01
998500 -- (-2437.490) [-2428.409] (-2438.345) (-2432.022) * (-2425.977) (-2435.039) (-2430.130) [-2437.616] -- 0:00:00
999000 -- [-2430.354] (-2430.821) (-2442.857) (-2431.251) * (-2425.719) [-2442.262] (-2433.374) (-2429.345) -- 0:00:00
999500 -- [-2435.299] (-2439.914) (-2436.950) (-2434.266) * (-2434.928) (-2432.066) [-2429.239] (-2437.594) -- 0:00:00
1000000 -- [-2429.247] (-2435.277) (-2459.580) (-2432.208) * (-2437.144) (-2440.665) (-2430.212) [-2432.030] -- 0:00:00
Average standard deviation of split frequencies: 0.007318
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -2429.247260 -- 19.269901
Chain 1 -- -2429.247263 -- 19.269901
Chain 2 -- -2435.277496 -- 19.588782
Chain 2 -- -2435.277497 -- 19.588782
Chain 3 -- -2459.579966 -- 23.549288
Chain 3 -- -2459.579970 -- 23.549288
Chain 4 -- -2432.208198 -- 15.491621
Chain 4 -- -2432.208198 -- 15.491621
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -2437.144291 -- 19.273557
Chain 1 -- -2437.144284 -- 19.273557
Chain 2 -- -2440.664837 -- 23.850090
Chain 2 -- -2440.664823 -- 23.850090
Chain 3 -- -2430.211670 -- 19.180163
Chain 3 -- -2430.211699 -- 19.180163
Chain 4 -- -2432.029896 -- 20.546370
Chain 4 -- -2432.029884 -- 20.546370
Analysis completed in 8 mins 49 seconds
Analysis used 528.16 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -2419.73
Likelihood of best state for "cold" chain of run 2 was -2419.97
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
43.5 % ( 23 %) Dirichlet(Revmat{all})
59.8 % ( 48 %) Slider(Revmat{all})
25.7 % ( 24 %) Dirichlet(Pi{all})
27.4 % ( 27 %) Slider(Pi{all})
29.9 % ( 29 %) Multiplier(Alpha{1,2})
42.0 % ( 26 %) Multiplier(Alpha{3})
43.9 % ( 27 %) Slider(Pinvar{all})
9.7 % ( 9 %) ExtSPR(Tau{all},V{all})
3.0 % ( 3 %) ExtTBR(Tau{all},V{all})
12.7 % ( 13 %) NNI(Tau{all},V{all})
12.1 % ( 12 %) ParsSPR(Tau{all},V{all})
26.5 % ( 22 %) Multiplier(V{all})
40.2 % ( 43 %) Nodeslider(V{all})
25.2 % ( 20 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
43.0 % ( 23 %) Dirichlet(Revmat{all})
58.4 % ( 50 %) Slider(Revmat{all})
25.5 % ( 22 %) Dirichlet(Pi{all})
27.9 % ( 28 %) Slider(Pi{all})
30.0 % ( 32 %) Multiplier(Alpha{1,2})
41.7 % ( 30 %) Multiplier(Alpha{3})
43.8 % ( 25 %) Slider(Pinvar{all})
9.6 % ( 7 %) ExtSPR(Tau{all},V{all})
2.9 % ( 1 %) ExtTBR(Tau{all},V{all})
12.7 % ( 10 %) NNI(Tau{all},V{all})
12.0 % ( 9 %) ParsSPR(Tau{all},V{all})
26.5 % ( 28 %) Multiplier(V{all})
40.3 % ( 40 %) Nodeslider(V{all})
25.2 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.75 0.53 0.37
2 | 166759 0.76 0.56
3 | 166958 165965 0.78
4 | 166949 166872 166497
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.74 0.53 0.37
2 | 166943 0.76 0.56
3 | 166657 165899 0.78
4 | 166833 167013 166655
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/59/CG13024-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/59/CG13024-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/59/CG13024-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -2431.00
| 2 2 2 |
| |
| 2 2 1 1 |
| 1 1 1 1 1 2 * 1|
|2 2 11 1 1 2 2 1 |
| 1 21 1 1 2 * 2 2 |
| 1 2 21 2 1 2 2 2 2*21 1 * 1 |
| 12 1 1 1 2 2 12 1 1 1 2|
| 2 2 1 2 11 12 2 1 2 2 |
|11 21 2 121 221 1 1 1 1 2 1 2 2 1 |
| 2 2 1* 1 1 2 |
| 2 1 22 2 2 2 |
| 2 2 |
| 2 * 1 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2435.53
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/59/CG13024-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/59/CG13024-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/59/CG13024-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2426.96 -2443.86
2 -2427.10 -2444.07
--------------------------------------
TOTAL -2427.03 -2443.97
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/59/CG13024-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/59/CG13024-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/59/CG13024-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.004648 0.012456 0.806620 1.234269 0.996298 1217.83 1320.82 1.000
r(A<->C){all} 0.089564 0.000428 0.050870 0.129398 0.087875 915.11 998.83 1.000
r(A<->G){all} 0.210864 0.001282 0.141135 0.280922 0.208585 839.39 864.07 1.000
r(A<->T){all} 0.101494 0.000852 0.047083 0.160701 0.099267 1020.98 1057.71 1.000
r(C<->G){all} 0.084672 0.000297 0.051391 0.118019 0.083938 802.53 954.78 1.000
r(C<->T){all} 0.464835 0.002383 0.370195 0.559038 0.465560 624.50 681.68 1.000
r(G<->T){all} 0.048571 0.000370 0.012783 0.085004 0.046742 994.58 1075.27 1.000
pi(A){all} 0.244072 0.000236 0.213065 0.273137 0.243804 681.79 849.37 1.000
pi(C){all} 0.318011 0.000238 0.288030 0.347349 0.317587 1174.18 1208.64 1.000
pi(G){all} 0.262192 0.000232 0.232789 0.291849 0.262020 992.08 1079.31 1.000
pi(T){all} 0.175725 0.000163 0.149717 0.199258 0.175639 1051.85 1153.16 1.000
alpha{1,2} 0.124867 0.000373 0.089709 0.162963 0.123570 1280.41 1339.82 1.003
alpha{3} 2.846692 0.792181 1.321923 4.649449 2.735073 1240.40 1355.95 1.000
pinvar{all} 0.454350 0.002338 0.353485 0.541223 0.456702 1040.04 1199.42 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/59/CG13024-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/59/CG13024-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/59/CG13024-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/59/CG13024-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
10 -- C10
11 -- C11
12 -- C12
Key to taxon bipartitions (saved to file "/opt/ADOPS/59/CG13024-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------------
1 -- .***********
2 -- .*..........
3 -- ..*.........
4 -- ...*........
5 -- ....*.......
6 -- .....*......
7 -- ......*.....
8 -- .......*....
9 -- ........*...
10 -- .........*..
11 -- ..........*.
12 -- ...........*
13 -- .....*******
14 -- ...*********
15 -- .**.........
16 -- ...**.......
17 -- .....**.....
18 -- .....****...
19 -- .....***....
20 -- .....*****..
21 -- .....*****.*
22 -- ..........**
23 -- .........***
24 -- .....***.*..
25 -- ......*..*..
26 -- .......**...
27 -- .........*.*
------------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/59/CG13024-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
13 3002 1.000000 0.000000 1.000000 1.000000 2
14 3002 1.000000 0.000000 1.000000 1.000000 2
15 2937 0.978348 0.004240 0.975350 0.981346 2
16 2870 0.956029 0.000000 0.956029 0.956029 2
17 2447 0.815123 0.009893 0.808128 0.822119 2
18 2245 0.747835 0.007066 0.742838 0.752831 2
19 2054 0.684211 0.016017 0.672885 0.695536 2
20 1878 0.625583 0.001884 0.624250 0.626915 2
21 1615 0.537975 0.013662 0.528314 0.547635 2
22 799 0.266156 0.028737 0.245836 0.286476 2
23 630 0.209860 0.002827 0.207861 0.211859 2
24 599 0.199534 0.004240 0.196536 0.202532 2
25 472 0.157229 0.011306 0.149234 0.165223 2
26 460 0.153231 0.001884 0.151899 0.154564 2
27 339 0.112925 0.008009 0.107262 0.118588 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/59/CG13024-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.051785 0.000185 0.027535 0.079161 0.050463 1.000 2
length{all}[2] 0.011533 0.000035 0.002013 0.023008 0.010495 1.000 2
length{all}[3] 0.009519 0.000030 0.001199 0.020713 0.008435 1.000 2
length{all}[4] 0.041724 0.000176 0.017595 0.067145 0.040415 1.000 2
length{all}[5] 0.040245 0.000171 0.017109 0.065887 0.038964 1.000 2
length{all}[6] 0.074416 0.000460 0.034261 0.113571 0.071826 1.000 2
length{all}[7] 0.073869 0.000422 0.037930 0.115559 0.072144 1.001 2
length{all}[8] 0.022372 0.000119 0.004003 0.044327 0.020886 1.000 2
length{all}[9] 0.090213 0.000514 0.049268 0.135660 0.088088 1.000 2
length{all}[10] 0.150928 0.001094 0.093540 0.217187 0.147584 1.001 2
length{all}[11] 0.055891 0.000391 0.021536 0.096204 0.053847 1.000 2
length{all}[12] 0.085180 0.000515 0.044454 0.130527 0.082507 1.000 2
length{all}[13] 0.114876 0.000819 0.062837 0.171197 0.112448 1.000 2
length{all}[14] 0.028888 0.000150 0.008633 0.054207 0.027300 1.000 2
length{all}[15] 0.012827 0.000051 0.001290 0.026663 0.011576 1.001 2
length{all}[16] 0.019964 0.000116 0.001975 0.040905 0.018416 1.000 2
length{all}[17] 0.031432 0.000215 0.004947 0.059342 0.029958 1.000 2
length{all}[18] 0.027307 0.000209 0.001381 0.054714 0.025168 1.000 2
length{all}[19] 0.022921 0.000147 0.002136 0.047233 0.021374 1.000 2
length{all}[20] 0.024328 0.000257 0.000114 0.054534 0.021574 0.999 2
length{all}[21] 0.025039 0.000211 0.001192 0.052664 0.022367 0.999 2
length{all}[22] 0.021149 0.000243 0.000055 0.051387 0.017652 1.001 2
length{all}[23] 0.022078 0.000157 0.000692 0.046132 0.020411 0.999 2
length{all}[24] 0.024126 0.000188 0.000956 0.049552 0.022449 0.998 2
length{all}[25] 0.036135 0.000265 0.005829 0.063915 0.034180 0.998 2
length{all}[26] 0.016927 0.000094 0.000314 0.034653 0.015734 1.001 2
length{all}[27] 0.010534 0.000078 0.000012 0.028027 0.008562 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007318
Maximum standard deviation of split frequencies = 0.028737
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.001
Clade credibility values:
/---------------------------------------------------------------------- C1 (1)
|
| /--------- C4 (4)
| /-------------------------96------------------------+
| | \--------- C5 (5)
| |
| | /--------- C6 (6)
| | /---82--+
| | | \--------- C7 (7)
| | /---68---+
|---100--+ | \----------------- C8 (8)
+ | /---75---+
| | | \-------------------------- C9 (9)
| | /---63---+
| | | \----------------------------------- C10 (10)
| | /---54--+
| | | \-------------------------------------------- C12 (12)
| \---100--+
| \---------------------------------------------------- C11 (11)
|
| /--------- C2 (2)
\-----------------------------98-----------------------------+
\--------- C3 (3)
Phylogram (based on average branch lengths):
/----------- C1 (1)
|
| /-------- C4 (4)
| /---+
| | \-------- C5 (5)
| |
| | /--------------- C6 (6)
| | /-----+
| | | \--------------- C7 (7)
| | /----+
|-----+ | \---- C8 (8)
+ | /----+
| | | \------------------- C9 (9)
| | /----+
| | | \------------------------------- C10 (10)
| | /---+
| | | \------------------ C12 (12)
| \-----------------------+
| \----------- C11 (11)
|
| /--- C2 (2)
\-+
\-- C3 (3)
|---------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (191 trees sampled):
50 % credible set contains 6 trees
90 % credible set contains 46 trees
95 % credible set contains 84 trees
99 % credible set contains 161 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 12 ls = 774
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Reading seq #11: C11
Reading seq #12: C12
Sites with gaps or missing data are removed.
69 ambiguity characters in seq. 1
69 ambiguity characters in seq. 2
69 ambiguity characters in seq. 3
63 ambiguity characters in seq. 4
69 ambiguity characters in seq. 5
54 ambiguity characters in seq. 6
60 ambiguity characters in seq. 7
60 ambiguity characters in seq. 8
60 ambiguity characters in seq. 9
51 ambiguity characters in seq. 10
87 ambiguity characters in seq. 11
75 ambiguity characters in seq. 12
30 sites are removed. 50 51 52 53 54 55 56 57 60 61 62 131 149 150 161 162 163 164 247 248 249 250 251 252 253 254 255 256 257 258
Sequences read..
Counting site patterns.. 0:00
156 patterns at 228 / 228 sites (100.0%), 0:00
Counting codons..
NG distances for seqs.:
1 2 3 4 5 6 7 8 9 10 11 12
528 bytes for distance
152256 bytes for conP
21216 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, ((4, 5), ((((((6, 7), 8), 9), 10), 12), 11)), (2, 3)); MP score: 234
1 0.054011
2 0.020630
3 0.018232
4 0.018197
5 0.018195
6 0.018195
7 0.018195
761280 bytes for conP, adjusted
0.072743 0.037784 0.028110 0.045709 0.054766 0.104700 0.006394 0.023692 0.000000 0.023759 0.019172 0.070163 0.063848 0.035681 0.122450 0.157944 0.110585 0.091865 0.012331 0.012594 0.019302 0.300000 1.300000
ntime & nrate & np: 21 2 23
Bounds (np=23):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 23
lnL0 = -2544.390187
Iterating by ming2
Initial: fx= 2544.390187
x= 0.07274 0.03778 0.02811 0.04571 0.05477 0.10470 0.00639 0.02369 0.00000 0.02376 0.01917 0.07016 0.06385 0.03568 0.12245 0.15794 0.11059 0.09187 0.01233 0.01259 0.01930 0.30000 1.30000
1 h-m-p 0.0000 0.0003 2013.8061 +YYCCCC 2534.042541 5 0.0000 37 | 0/23
2 h-m-p 0.0001 0.0003 432.5606 +CYYYCCCCC 2499.251240 8 0.0003 77 | 0/23
3 h-m-p 0.0000 0.0000 6289.0883 +CYCCC 2483.514660 4 0.0000 111 | 0/23
4 h-m-p 0.0000 0.0002 2868.5608 +YCCCC 2460.003386 4 0.0001 145 | 0/23
5 h-m-p 0.0001 0.0005 735.6352 +CYCCC 2405.425073 4 0.0005 180 | 0/23
6 h-m-p 0.0000 0.0000 17452.6382 +YYYYC 2397.133358 4 0.0000 211 | 0/23
7 h-m-p 0.0000 0.0001 2357.8779 ++ 2366.707038 m 0.0001 237 | 0/23
8 h-m-p 0.0000 0.0001 1637.8062 +YYYCCCC 2350.840839 6 0.0001 273 | 0/23
9 h-m-p 0.0000 0.0001 745.1416 ++ 2339.356155 m 0.0001 299 | 0/23
10 h-m-p 0.0000 0.0000 5457.9149
h-m-p: 7.10111569e-21 3.55055785e-20 5.45791494e+03 2339.356155
.. | 0/23
11 h-m-p 0.0000 0.0002 3113.5181 YYCCCC 2325.497489 5 0.0000 356 | 0/23
12 h-m-p 0.0000 0.0002 489.6803 +CYCYCCC 2286.085656 6 0.0002 393 | 0/23
13 h-m-p 0.0000 0.0000 3787.3769 +YYYYYC 2278.177525 5 0.0000 425 | 0/23
14 h-m-p 0.0000 0.0000 3566.1720 +YCYCCC 2263.781112 5 0.0000 460 | 0/23
15 h-m-p 0.0000 0.0001 1490.0004 +CYCCC 2249.342783 4 0.0000 494 | 0/23
16 h-m-p 0.0000 0.0000 2493.7611 +CYCCC 2238.555710 4 0.0000 528 | 0/23
17 h-m-p 0.0000 0.0000 2839.3273 +YYYYYC 2216.681217 5 0.0000 560 | 0/23
18 h-m-p 0.0000 0.0000 4983.8921 +YYYCCC 2199.342166 5 0.0000 594 | 0/23
19 h-m-p 0.0000 0.0000 4967.8220 +YYYCCCCC 2180.453856 7 0.0000 632 | 0/23
20 h-m-p 0.0000 0.0000 2900.5764 +YYCYCCC 2160.217217 6 0.0000 668 | 0/23
21 h-m-p 0.0000 0.0001 574.4350 CCCCC 2159.401145 4 0.0000 702 | 0/23
22 h-m-p 0.0000 0.0002 142.1640 YCCCC 2158.488650 4 0.0001 735 | 0/23
23 h-m-p 0.0001 0.0008 299.8248 CYCC 2157.611204 3 0.0001 766 | 0/23
24 h-m-p 0.0003 0.0024 67.1718 CC 2156.794186 1 0.0005 794 | 0/23
25 h-m-p 0.0003 0.0021 102.0707 CCC 2156.284565 2 0.0003 824 | 0/23
26 h-m-p 0.0004 0.0044 64.4859 +YYCCCCC 2154.172232 6 0.0018 861 | 0/23
27 h-m-p 0.0002 0.0014 701.5608 +CCCC 2146.363722 3 0.0007 894 | 0/23
28 h-m-p 0.0002 0.0009 1193.0321 YCCC 2141.124019 3 0.0003 925 | 0/23
29 h-m-p 0.0006 0.0029 325.0848 CCCCC 2136.852959 4 0.0008 959 | 0/23
30 h-m-p 0.0009 0.0046 118.5885 YCCC 2136.104528 3 0.0005 990 | 0/23
31 h-m-p 0.0015 0.0074 32.7634 YC 2135.836850 1 0.0007 1017 | 0/23
32 h-m-p 0.0190 0.2790 1.2725 +CYCCCC 2131.412644 5 0.1258 1053 | 0/23
33 h-m-p 0.0006 0.0029 193.4827 CYCCC 2125.511975 4 0.0011 1086 | 0/23
34 h-m-p 0.0023 0.0117 12.7896 CC 2125.397140 1 0.0008 1114 | 0/23
35 h-m-p 0.0059 0.2874 1.7735 ++YCYC 2109.283123 3 0.1511 1146 | 0/23
36 h-m-p 0.3630 1.8148 0.3611 CCC 2105.145534 2 0.3969 1176 | 0/23
37 h-m-p 0.8035 5.7782 0.1784 +YCCC 2096.346253 3 2.1354 1231 | 0/23
38 h-m-p 0.8707 4.3536 0.0717 CCCC 2092.721328 3 1.2742 1286 | 0/23
39 h-m-p 0.4489 5.0236 0.2034 +YCCC 2090.167035 3 1.1731 1341 | 0/23
40 h-m-p 1.6000 8.0000 0.0734 CYC 2088.612695 2 1.6943 1393 | 0/23
41 h-m-p 1.6000 8.0000 0.0127 CCC 2087.892866 2 2.5144 1446 | 0/23
42 h-m-p 1.6000 8.0000 0.0100 +YC 2086.946277 1 4.5189 1497 | 0/23
43 h-m-p 1.6000 8.0000 0.0202 CCC 2086.513549 2 1.6161 1550 | 0/23
44 h-m-p 1.6000 8.0000 0.0050 YCCC 2086.222835 3 3.4186 1604 | 0/23
45 h-m-p 1.6000 8.0000 0.0079 +YC 2085.851749 1 4.3118 1655 | 0/23
46 h-m-p 1.6000 8.0000 0.0132 CCC 2085.596640 2 2.2624 1708 | 0/23
47 h-m-p 1.6000 8.0000 0.0084 CCC 2085.435405 2 2.1058 1761 | 0/23
48 h-m-p 1.6000 8.0000 0.0044 YCC 2085.315662 2 2.9983 1813 | 0/23
49 h-m-p 1.3300 8.0000 0.0099 YC 2085.243657 1 2.4689 1863 | 0/23
50 h-m-p 1.6000 8.0000 0.0023 CC 2085.222446 1 2.0644 1914 | 0/23
51 h-m-p 1.6000 8.0000 0.0028 +YC 2085.192141 1 4.1968 1965 | 0/23
52 h-m-p 1.6000 8.0000 0.0019 CC 2085.159181 1 2.5264 2016 | 0/23
53 h-m-p 1.1522 8.0000 0.0041 YC 2085.154275 1 1.9243 2066 | 0/23
54 h-m-p 1.6000 8.0000 0.0007 +YC 2085.150411 1 4.2088 2117 | 0/23
55 h-m-p 1.6000 8.0000 0.0011 YC 2085.145879 1 3.1522 2167 | 0/23
56 h-m-p 1.6000 8.0000 0.0007 CC 2085.144288 1 1.8359 2218 | 0/23
57 h-m-p 1.6000 8.0000 0.0005 C 2085.144027 0 1.9881 2267 | 0/23
58 h-m-p 1.6000 8.0000 0.0001 +YC 2085.143658 1 4.4349 2318 | 0/23
59 h-m-p 1.3659 8.0000 0.0004 C 2085.143530 0 1.9279 2367 | 0/23
60 h-m-p 1.6000 8.0000 0.0001 C 2085.143515 0 1.5362 2416 | 0/23
61 h-m-p 1.6000 8.0000 0.0000 +Y 2085.143506 0 4.7456 2466 | 0/23
62 h-m-p 1.6000 8.0000 0.0000 Y 2085.143499 0 2.9314 2515 | 0/23
63 h-m-p 1.1542 8.0000 0.0001 C 2085.143498 0 1.4783 2564 | 0/23
64 h-m-p 1.6000 8.0000 0.0000 C 2085.143498 0 1.3627 2613 | 0/23
65 h-m-p 1.6000 8.0000 0.0000 C 2085.143498 0 1.6000 2662 | 0/23
66 h-m-p 1.6000 8.0000 0.0000 +Y 2085.143498 0 4.5340 2712 | 0/23
67 h-m-p 0.6980 8.0000 0.0000 +C 2085.143498 0 2.7921 2762 | 0/23
68 h-m-p 1.6000 8.0000 0.0000 C 2085.143498 0 1.6000 2811 | 0/23
69 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 0/23
70 h-m-p 0.0160 8.0000 0.0004 ------------- | 0/23
71 h-m-p 0.0160 8.0000 0.0004 -------------
Out..
lnL = -2085.143498
2995 lfun, 2995 eigenQcodon, 62895 P(t)
Time used: 0:25
Model 1: NearlyNeutral
TREE # 1
(1, ((4, 5), ((((((6, 7), 8), 9), 10), 12), 11)), (2, 3)); MP score: 234
1 0.113718
2 0.042522
3 0.039197
4 0.038664
5 0.038540
6 0.038510
7 0.038506
8 0.038505
9 0.038505
10 0.038505
11 0.038505
0.071485 0.034972 0.026132 0.040610 0.061336 0.096997 0.012787 0.037776 0.000000 0.024692 0.018169 0.074723 0.056624 0.041237 0.111718 0.140942 0.107901 0.093554 0.027224 0.010847 0.016027 2.206726 0.630989 0.207592
ntime & nrate & np: 21 2 24
Bounds (np=24):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 6.771226
np = 24
lnL0 = -2232.181227
Iterating by ming2
Initial: fx= 2232.181227
x= 0.07149 0.03497 0.02613 0.04061 0.06134 0.09700 0.01279 0.03778 0.00000 0.02469 0.01817 0.07472 0.05662 0.04124 0.11172 0.14094 0.10790 0.09355 0.02722 0.01085 0.01603 2.20673 0.63099 0.20759
1 h-m-p 0.0000 0.0008 960.8858 +++YCYYYYCCCC 2166.872754 10 0.0007 70 | 0/24
2 h-m-p 0.0000 0.0001 408.9988 YCYCCC 2164.335139 5 0.0000 129 | 0/24
3 h-m-p 0.0000 0.0007 283.4928 +YCYCCC 2154.091800 5 0.0004 189 | 0/24
4 h-m-p 0.0001 0.0004 204.5220 +YYYCCC 2149.849417 5 0.0003 248 | 0/24
5 h-m-p 0.0001 0.0004 302.3434 +YCCC 2145.653135 3 0.0003 305 | 0/24
6 h-m-p 0.0001 0.0003 140.5845 ++ 2143.812957 m 0.0003 356 | 1/24
7 h-m-p 0.0002 0.0008 118.0307 CCC 2143.456546 2 0.0001 411 | 1/24
8 h-m-p 0.0003 0.0013 55.3977 YYC 2143.229498 2 0.0002 463 | 1/24
9 h-m-p 0.0006 0.0042 21.7967 CC 2143.113553 1 0.0005 515 | 1/24
10 h-m-p 0.0004 0.0020 17.1153 CCCC 2143.032306 3 0.0005 571 | 1/24
11 h-m-p 0.0007 0.0121 13.3863 YCCC 2142.842362 3 0.0015 626 | 1/24
12 h-m-p 0.0011 0.0081 18.9217 CCC 2142.576135 2 0.0013 680 | 1/24
13 h-m-p 0.0014 0.0130 17.6339 CCCC 2142.106686 3 0.0022 736 | 1/24
14 h-m-p 0.0008 0.0040 30.0485 CYC 2141.891478 2 0.0007 789 | 1/24
15 h-m-p 0.0005 0.0026 29.9394 CCC 2141.767720 2 0.0005 843 | 1/24
16 h-m-p 0.0005 0.0036 28.7718 YC 2141.719895 1 0.0003 894 | 1/24
17 h-m-p 0.0013 0.0243 6.1447 CC 2141.691237 1 0.0012 946 | 1/24
18 h-m-p 0.0011 0.0489 6.2605 +CCC 2141.558572 2 0.0044 1001 | 1/24
19 h-m-p 0.0007 0.0065 37.5720 CCC 2141.374960 2 0.0009 1055 | 1/24
20 h-m-p 0.0012 0.0185 28.3780 +YCCC 2140.818329 3 0.0032 1111 | 1/24
21 h-m-p 0.0010 0.0097 91.1626 CCC 2139.978426 2 0.0015 1165 | 1/24
22 h-m-p 0.0012 0.0277 114.2026 +YCCCC 2131.740574 4 0.0107 1223 | 1/24
23 h-m-p 0.0006 0.0029 375.1198 CCCCC 2129.538602 4 0.0008 1281 | 1/24
24 h-m-p 0.0116 0.0582 2.2236 YCCC 2128.037619 3 0.0260 1336 | 1/24
25 h-m-p 0.0015 0.0110 39.4980 +YCCCCC 2098.264100 5 0.0095 1397 | 0/24
26 h-m-p 0.0000 0.0000 2129.4380 YCCCC 2097.161565 4 0.0000 1454 | 0/24
27 h-m-p 0.0194 0.0970 0.3762 YCCC 2096.024761 3 0.0344 1510 | 0/24
28 h-m-p 0.0037 1.1839 3.4833 +++CYCCCC 2082.876230 5 0.4390 1573 | 0/24
29 h-m-p 0.1808 0.9041 1.4448 YCCCC 2079.305354 4 0.4162 1631 | 0/24
30 h-m-p 0.1194 0.5970 0.5967 +YYCCC 2077.367383 4 0.3750 1689 | 0/24
31 h-m-p 0.2703 1.3517 0.1544 CCC 2076.242262 2 0.3551 1744 | 0/24
32 h-m-p 0.4754 2.3771 0.0748 CCCC 2075.876281 3 0.5078 1801 | 0/24
33 h-m-p 1.6000 8.0000 0.0089 YCC 2075.701441 2 1.1925 1855 | 0/24
34 h-m-p 1.2053 8.0000 0.0088 CC 2075.520325 1 1.9342 1908 | 0/24
35 h-m-p 1.4317 8.0000 0.0119 YC 2075.453471 1 0.7039 1960 | 0/24
36 h-m-p 1.6000 8.0000 0.0052 YC 2075.431276 1 0.9508 2012 | 0/24
37 h-m-p 1.6000 8.0000 0.0029 CC 2075.413971 1 1.8708 2065 | 0/24
38 h-m-p 1.2503 8.0000 0.0043 YC 2075.393758 1 2.4570 2117 | 0/24
39 h-m-p 0.7316 8.0000 0.0143 CC 2075.383642 1 1.1498 2170 | 0/24
40 h-m-p 1.6000 8.0000 0.0052 YC 2075.381421 1 0.9286 2222 | 0/24
41 h-m-p 1.6000 8.0000 0.0005 YC 2075.381071 1 1.0015 2274 | 0/24
42 h-m-p 1.6000 8.0000 0.0002 Y 2075.381042 0 0.9188 2325 | 0/24
43 h-m-p 1.6000 8.0000 0.0001 Y 2075.381039 0 0.8351 2376 | 0/24
44 h-m-p 1.6000 8.0000 0.0000 Y 2075.381039 0 1.0329 2427 | 0/24
45 h-m-p 1.6000 8.0000 0.0000 Y 2075.381039 0 0.7776 2478 | 0/24
46 h-m-p 1.6000 8.0000 0.0000 Y 2075.381039 0 0.9969 2529 | 0/24
47 h-m-p 1.6000 8.0000 0.0000 Y 2075.381039 0 0.7751 2580 | 0/24
48 h-m-p 1.6000 8.0000 0.0000 C 2075.381039 0 0.4000 2631 | 0/24
49 h-m-p 0.7444 8.0000 0.0000 C 2075.381039 0 0.7444 2682 | 0/24
50 h-m-p 1.1657 8.0000 0.0000 -------------Y 2075.381039 0 0.0000 2746
Out..
lnL = -2075.381039
2747 lfun, 8241 eigenQcodon, 115374 P(t)
Time used: 1:09
Model 2: PositiveSelection
TREE # 1
(1, ((4, 5), ((((((6, 7), 8), 9), 10), 12), 11)), (2, 3)); MP score: 234
1 0.099956
2 0.026801
3 0.021545
4 0.021303
5 0.021295
6 0.021295
7 0.021294
8 0.021294
initial w for M2:NSpselection reset.
0.074864 0.038686 0.028314 0.046887 0.053293 0.104359 0.006005 0.025651 0.000000 0.026507 0.020402 0.070500 0.063681 0.036782 0.121853 0.155038 0.107737 0.093173 0.011823 0.014305 0.018658 2.222566 1.237723 0.153992 0.218428 2.873198
ntime & nrate & np: 21 3 26
Bounds (np=26):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 4.630106
np = 26
lnL0 = -2280.414116
Iterating by ming2
Initial: fx= 2280.414116
x= 0.07486 0.03869 0.02831 0.04689 0.05329 0.10436 0.00600 0.02565 0.00000 0.02651 0.02040 0.07050 0.06368 0.03678 0.12185 0.15504 0.10774 0.09317 0.01182 0.01430 0.01866 2.22257 1.23772 0.15399 0.21843 2.87320
1 h-m-p 0.0000 0.0011 1597.2334 ++YYYYCCCC 2252.100888 7 0.0002 69 | 0/26
2 h-m-p 0.0001 0.0007 369.1176 ++ 2174.143924 m 0.0007 124 | 1/26
3 h-m-p 0.0003 0.0015 197.9769 +YYCCC 2160.308011 4 0.0011 186 | 0/26
4 h-m-p 0.0000 0.0000 9598.6764 +YYCCC 2156.570440 4 0.0000 247 | 0/26
5 h-m-p 0.0000 0.0001 2588.4835 YCCC 2151.531601 3 0.0000 307 | 0/26
6 h-m-p 0.0007 0.0033 112.9100 +YYYYC 2139.306701 4 0.0026 367 | 0/26
7 h-m-p 0.0004 0.0020 215.9246 +CYC 2129.331724 2 0.0015 426 | 0/26
8 h-m-p 0.0005 0.0023 202.8063 +YYCCCC 2119.659555 5 0.0015 490 | 0/26
9 h-m-p 0.0004 0.0019 202.7692 YCCC 2116.167641 3 0.0008 550 | 0/26
10 h-m-p 0.0010 0.0049 78.4684 CCCC 2114.203575 3 0.0014 611 | 0/26
11 h-m-p 0.0005 0.0026 52.5898 CCCC 2113.569680 3 0.0009 672 | 0/26
12 h-m-p 0.0011 0.0060 43.2745 CCC 2113.053833 2 0.0012 731 | 0/26
13 h-m-p 0.0022 0.0176 22.3726 YC 2112.751820 1 0.0018 787 | 0/26
14 h-m-p 0.0020 0.0209 19.7112 CCC 2112.457844 2 0.0022 846 | 0/26
15 h-m-p 0.0016 0.0100 27.0115 CCCC 2112.010969 3 0.0023 907 | 0/26
16 h-m-p 0.0019 0.0094 31.5763 YCCC 2111.159925 3 0.0034 967 | 0/26
17 h-m-p 0.0011 0.0082 100.3642 +YCCC 2108.911132 3 0.0029 1028 | 0/26
18 h-m-p 0.0013 0.0064 124.7311 +YCCCC 2104.459978 4 0.0040 1091 | 0/26
19 h-m-p 0.0008 0.0039 347.4093 +YCYCCC 2096.970735 5 0.0022 1155 | 0/26
20 h-m-p 0.0004 0.0018 306.6383 YCCCC 2095.132918 4 0.0007 1217 | 0/26
21 h-m-p 0.0010 0.0048 61.5134 CYC 2094.730260 2 0.0009 1275 | 0/26
22 h-m-p 0.0028 0.0203 18.4017 YCC 2094.594874 2 0.0012 1333 | 0/26
23 h-m-p 0.0008 0.0310 27.8548 ++YCCCC 2092.153366 4 0.0126 1397 | 0/26
24 h-m-p 0.0005 0.0024 177.8031 YCYCCC 2090.652993 5 0.0012 1460 | 0/26
25 h-m-p 0.0055 0.0277 16.1847 CYC 2090.543513 2 0.0016 1518 | 0/26
26 h-m-p 0.0036 0.4673 7.0733 +++YYC 2084.728937 2 0.1938 1578 | 0/26
27 h-m-p 0.6054 3.0269 1.3928 CCCC 2082.016434 3 0.5148 1639 | 0/26
28 h-m-p 0.2354 1.1770 1.2103 CCCCC 2080.826015 4 0.2943 1702 | 0/26
29 h-m-p 0.1043 0.5213 2.1623 CCCC 2079.765243 3 0.1696 1763 | 0/26
30 h-m-p 0.2991 1.8263 1.2260 +YCCCC 2078.068880 4 0.8830 1826 | 0/26
31 h-m-p 0.6232 4.8143 1.7371 CYC 2077.163238 2 0.6605 1884 | 0/26
32 h-m-p 0.5286 2.6432 1.2658 YYCC 2076.772531 3 0.4859 1943 | 0/26
33 h-m-p 0.5221 5.8788 1.1780 CCCC 2076.466118 3 0.6603 2004 | 0/26
34 h-m-p 0.7624 4.5154 1.0203 YYC 2076.261830 2 0.6020 2061 | 0/26
35 h-m-p 0.5329 5.6327 1.1525 CCC 2076.078030 2 0.5134 2120 | 0/26
36 h-m-p 0.4556 3.1712 1.2989 CCC 2075.886914 2 0.5718 2179 | 0/26
37 h-m-p 0.5052 6.1188 1.4702 CCC 2075.671730 2 0.8322 2238 | 0/26
38 h-m-p 0.9383 6.1836 1.3039 YC 2075.603071 1 0.4149 2294 | 0/26
39 h-m-p 0.8302 8.0000 0.6516 CY 2075.551364 1 0.8399 2351 | 0/26
40 h-m-p 0.6954 8.0000 0.7871 YC 2075.506130 1 1.1358 2407 | 0/26
41 h-m-p 1.1371 8.0000 0.7863 CCC 2075.467765 2 1.0534 2466 | 0/26
42 h-m-p 0.8552 8.0000 0.9685 CC 2075.447087 1 0.7014 2523 | 0/26
43 h-m-p 0.6792 8.0000 1.0001 CC 2075.435541 1 0.5699 2580 | 0/26
44 h-m-p 0.6224 8.0000 0.9156 CC 2075.426673 1 0.6855 2637 | 0/26
45 h-m-p 0.5364 8.0000 1.1701 YC 2075.409361 1 1.2264 2693 | 0/26
46 h-m-p 1.2652 8.0000 1.1342 CC 2075.396738 1 1.1531 2750 | 0/26
47 h-m-p 1.4154 8.0000 0.9241 YC 2075.392870 1 0.9333 2806 | 0/26
48 h-m-p 1.0899 8.0000 0.7913 CC 2075.389123 1 1.6066 2863 | 0/26
49 h-m-p 0.8543 8.0000 1.4881 CC 2075.385624 1 1.0836 2920 | 0/26
50 h-m-p 1.3037 8.0000 1.2369 C 2075.382837 0 1.4096 2975 | 0/26
51 h-m-p 1.6000 8.0000 0.8573 YC 2075.382253 1 0.8465 3031 | 0/26
52 h-m-p 0.9363 8.0000 0.7751 C 2075.381931 0 1.2667 3086 | 0/26
53 h-m-p 1.4618 8.0000 0.6716 C 2075.381702 0 1.7732 3141 | 0/26
54 h-m-p 1.2269 8.0000 0.9707 CC 2075.381417 1 1.7604 3198 | 0/26
55 h-m-p 1.4260 8.0000 1.1983 C 2075.381229 0 1.2430 3253 | 0/26
56 h-m-p 1.2958 8.0000 1.1494 C 2075.381129 0 1.2903 3308 | 0/26
57 h-m-p 1.6000 8.0000 0.8669 Y 2075.381099 0 1.2310 3363 | 0/26
58 h-m-p 1.1137 8.0000 0.9582 Y 2075.381073 0 1.8326 3418 | 0/26
59 h-m-p 1.5658 8.0000 1.1215 C 2075.381056 0 1.5218 3473 | 0/26
60 h-m-p 1.4460 8.0000 1.1802 C 2075.381048 0 1.1679 3528 | 0/26
61 h-m-p 1.3341 8.0000 1.0332 C 2075.381044 0 1.7574 3583 | 0/26
62 h-m-p 1.6000 8.0000 1.0395 C 2075.381041 0 1.9374 3638 | 0/26
63 h-m-p 1.6000 8.0000 1.0280 C 2075.381040 0 1.7941 3693 | 0/26
64 h-m-p 1.6000 8.0000 0.9943 C 2075.381039 0 2.2821 3748 | 0/26
65 h-m-p 1.6000 8.0000 1.0020 C 2075.381039 0 2.2865 3803 | 0/26
66 h-m-p 1.6000 8.0000 1.0770 Y 2075.381039 0 2.7273 3858 | 0/26
67 h-m-p 1.6000 8.0000 1.3121 C 2075.381039 0 2.3116 3913 | 0/26
68 h-m-p 1.4346 8.0000 2.1143 Y 2075.381039 0 2.4747 3968 | 0/26
69 h-m-p 0.5474 8.0000 9.5584 Y 2075.381039 0 1.0651 4023 | 0/26
70 h-m-p 0.0001 0.0020 88841.2711 -----C 2075.381039 0 0.0000 4083 | 0/26
71 h-m-p 0.0459 8.0000 0.0769 ++C 2075.381039 0 1.1622 4140 | 0/26
72 h-m-p 0.6818 8.0000 0.1311 -Y 2075.381039 0 0.0426 4196 | 0/26
73 h-m-p 0.1197 8.0000 0.0466 Y 2075.381039 0 0.0299 4251 | 0/26
74 h-m-p 0.0164 8.0000 0.0852 -------C 2075.381039 0 0.0000 4313 | 0/26
75 h-m-p 0.0160 8.0000 0.0000 -----Y 2075.381039 0 0.0000 4373 | 0/26
76 h-m-p 0.0160 8.0000 0.0020 -C 2075.381039 0 0.0010 4429 | 0/26
77 h-m-p 1.2963 8.0000 0.0000 +C 2075.381039 0 5.0203 4485 | 0/26
78 h-m-p 1.6000 8.0000 0.0000 -C 2075.381039 0 0.1000 4541
Out..
lnL = -2075.381039
4542 lfun, 18168 eigenQcodon, 286146 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -2098.940699 S = -2049.785221 -41.036632
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 156 patterns 2:58
did 20 / 156 patterns 2:59
did 30 / 156 patterns 2:59
did 40 / 156 patterns 2:59
did 50 / 156 patterns 2:59
did 60 / 156 patterns 2:59
did 70 / 156 patterns 2:59
did 80 / 156 patterns 2:59
did 90 / 156 patterns 2:59
did 100 / 156 patterns 2:59
did 110 / 156 patterns 2:59
did 120 / 156 patterns 2:59
did 130 / 156 patterns 2:59
did 140 / 156 patterns 2:59
did 150 / 156 patterns 2:59
did 156 / 156 patterns 2:59
Time used: 2:59
Model 3: discrete
TREE # 1
(1, ((4, 5), ((((((6, 7), 8), 9), 10), 12), 11)), (2, 3)); MP score: 234
1 0.198587
2 0.091320
3 0.075176
4 0.072022
5 0.071485
6 0.071358
7 0.071341
8 0.071340
9 0.071339
10 0.071339
0.081263 0.051442 0.035280 0.048358 0.060681 0.092601 0.015783 0.034793 0.000000 0.038995 0.015945 0.059459 0.061524 0.037691 0.120051 0.148835 0.109995 0.086193 0.011173 0.013196 0.033748 2.222565 0.387814 0.891300 0.016352 0.037255 0.068017
ntime & nrate & np: 21 4 27
Bounds (np=27):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 16.768149
np = 27
lnL0 = -2094.868328
Iterating by ming2
Initial: fx= 2094.868328
x= 0.08126 0.05144 0.03528 0.04836 0.06068 0.09260 0.01578 0.03479 0.00000 0.03899 0.01595 0.05946 0.06152 0.03769 0.12005 0.14884 0.11000 0.08619 0.01117 0.01320 0.03375 2.22257 0.38781 0.89130 0.01635 0.03725 0.06802
1 h-m-p 0.0000 0.0002 401.2897 ++ 2083.227033 m 0.0002 59 | 1/27
2 h-m-p 0.0001 0.0004 184.6948 +YCCCC 2079.047359 4 0.0003 124 | 1/27
3 h-m-p 0.0000 0.0001 387.5093 +CCC 2077.859601 2 0.0001 185 | 1/27
4 h-m-p 0.0001 0.0003 174.8259 +CCC 2076.161924 2 0.0002 246 | 1/27
5 h-m-p 0.0002 0.0009 49.8691 CCCC 2075.964115 3 0.0002 308 | 1/27
6 h-m-p 0.0000 0.0002 49.1897 +CC 2075.878333 1 0.0001 367 | 1/27
7 h-m-p 0.0001 0.0004 16.9031 +CC 2075.846467 1 0.0003 426 | 0/27
8 h-m-p 0.0004 0.0064 13.3169 YC 2075.836087 1 0.0002 483 | 0/27
9 h-m-p 0.0000 0.0000 20.5657 ++ 2075.831653 m 0.0000 540 | 1/27
10 h-m-p 0.0000 0.0028 31.0868 +YC 2075.826082 1 0.0001 599 | 1/27
11 h-m-p 0.0007 0.0121 2.2955 YC 2075.824688 1 0.0005 656 | 1/27
12 h-m-p 0.0007 0.0903 1.7026 CC 2075.823943 1 0.0006 714 | 1/27
13 h-m-p 0.0008 0.0811 1.3481 YC 2075.823440 1 0.0006 771 | 1/27
14 h-m-p 0.0006 0.1334 1.3274 +C 2075.821353 0 0.0024 828 | 1/27
15 h-m-p 0.0003 0.0550 10.8704 +CC 2075.808730 1 0.0018 887 | 1/27
16 h-m-p 0.0005 0.0241 36.8142 +YC 2075.773224 1 0.0014 945 | 1/27
17 h-m-p 0.0006 0.0193 87.1507 +YC 2075.668733 1 0.0018 1003 | 1/27
18 h-m-p 0.0006 0.0089 248.8294 CCC 2075.502840 2 0.0010 1063 | 1/27
19 h-m-p 0.0018 0.0090 114.7590 CC 2075.465269 1 0.0005 1121 | 1/27
20 h-m-p 0.0040 0.0391 14.1706 YC 2075.459638 1 0.0006 1178 | 1/27
21 h-m-p 0.0015 0.0786 5.6283 YC 2075.456379 1 0.0009 1235 | 1/27
22 h-m-p 0.0007 0.1772 7.3161 ++CC 2075.410031 1 0.0094 1295 | 1/27
23 h-m-p 0.0006 0.0212 111.7241 +CC 2075.220496 1 0.0025 1354 | 1/27
24 h-m-p 0.0024 0.0118 85.1163 CC 2075.192230 1 0.0005 1412 | 1/27
25 h-m-p 0.0021 0.0318 20.1108 C 2075.185561 0 0.0005 1468 | 1/27
26 h-m-p 0.0051 0.0825 1.9440 -CC 2075.184940 1 0.0005 1527 | 0/27
27 h-m-p 0.0023 1.1250 3.6142 --CC 2075.184550 1 0.0001 1587 | 0/27
28 h-m-p 0.0040 2.0031 0.3325 +++CCC 2074.896610 2 0.3877 1651 | 0/27
29 h-m-p 0.3635 8.0000 0.3545 +YCCC 2074.480914 3 2.2822 1714 | 0/27
30 h-m-p 1.4659 8.0000 0.5519 CCCCC 2074.101210 4 2.1531 1779 | 0/27
31 h-m-p 0.1687 0.8433 0.9341 ++ 2073.763349 m 0.8433 1836 | 1/27
32 h-m-p 0.1331 4.1487 5.9200 CC 2073.746653 1 0.0350 1895 | 1/27
33 h-m-p 0.0721 4.8789 2.8718 +CCC 2073.547488 2 0.3247 1956 | 1/27
34 h-m-p 1.6000 8.0000 0.1414 CCC 2073.430798 2 1.9109 2016 | 1/27
35 h-m-p 1.6000 8.0000 0.0527 +YCCC 2073.197978 3 4.6252 2078 | 1/27
36 h-m-p 1.6000 8.0000 0.1325 YC 2072.836007 1 3.6216 2135 | 1/27
37 h-m-p 1.6000 8.0000 0.1827 YYC 2072.726707 2 1.3295 2193 | 1/27
38 h-m-p 0.4909 8.0000 0.4947 CC 2072.692575 1 0.6929 2251 | 1/27
39 h-m-p 1.6000 8.0000 0.0504 CC 2072.679676 1 1.5747 2309 | 1/27
40 h-m-p 1.6000 8.0000 0.0158 CC 2072.677039 1 2.1186 2367 | 1/27
41 h-m-p 1.6000 8.0000 0.0080 ++ 2072.669003 m 8.0000 2423 | 1/27
42 h-m-p 1.5328 8.0000 0.0419 C 2072.665815 0 1.6331 2479 | 1/27
43 h-m-p 1.6000 8.0000 0.0041 Y 2072.665673 0 1.2249 2535 | 1/27
44 h-m-p 1.6000 8.0000 0.0019 Y 2072.665669 0 1.1455 2591 | 1/27
45 h-m-p 1.6000 8.0000 0.0003 Y 2072.665669 0 1.0258 2647 | 1/27
46 h-m-p 1.6000 8.0000 0.0000 Y 2072.665669 0 1.1816 2703 | 1/27
47 h-m-p 1.6000 8.0000 0.0000 Y 2072.665669 0 1.1103 2759 | 1/27
48 h-m-p 1.6000 8.0000 0.0000 C 2072.665669 0 1.6000 2815 | 1/27
49 h-m-p 1.6000 8.0000 0.0000 ---------------Y 2072.665669 0 0.0000 2886
Out..
lnL = -2072.665669
2887 lfun, 11548 eigenQcodon, 181881 P(t)
Time used: 4:09
Model 7: beta
TREE # 1
(1, ((4, 5), ((((((6, 7), 8), 9), 10), 12), 11)), (2, 3)); MP score: 234
1 0.030245
2 0.024909
3 0.023747
4 0.023642
5 0.023642
6 0.023642
7 0.023642
0.074563 0.036480 0.027836 0.053792 0.049935 0.097485 0.010390 0.028662 0.000000 0.022036 0.020223 0.069537 0.061562 0.036380 0.114421 0.152352 0.109904 0.087320 0.019397 0.011578 0.023829 2.207012 0.275304 1.140227
ntime & nrate & np: 21 1 24
Bounds (np=24):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 11.235897
np = 24
lnL0 = -2131.092558
Iterating by ming2
Initial: fx= 2131.092558
x= 0.07456 0.03648 0.02784 0.05379 0.04994 0.09748 0.01039 0.02866 0.00000 0.02204 0.02022 0.06954 0.06156 0.03638 0.11442 0.15235 0.10990 0.08732 0.01940 0.01158 0.02383 2.20701 0.27530 1.14023
1 h-m-p 0.0000 0.0004 702.8641 ++CYCC 2113.718761 3 0.0002 60 | 0/24
2 h-m-p 0.0001 0.0006 282.5503 +YCYCCC 2090.615444 5 0.0005 120 | 0/24
3 h-m-p 0.0000 0.0001 2103.1143 CCCCC 2085.712057 4 0.0000 179 | 0/24
4 h-m-p 0.0001 0.0003 241.4814 YCCCC 2083.634712 4 0.0001 237 | 0/24
5 h-m-p 0.0001 0.0006 89.2098 CYCCC 2082.955234 4 0.0002 295 | 0/24
6 h-m-p 0.0002 0.0014 107.9603 YC 2082.616950 1 0.0001 347 | 0/24
7 h-m-p 0.0004 0.0045 38.8864 CCC 2082.459370 2 0.0003 402 | 0/24
8 h-m-p 0.0003 0.0020 36.1117 CCCC 2082.312965 3 0.0004 459 | 0/24
9 h-m-p 0.0003 0.0039 44.4097 YC 2082.092679 1 0.0006 511 | 0/24
10 h-m-p 0.0008 0.0119 37.1447 YC 2081.660386 1 0.0018 563 | 0/24
11 h-m-p 0.0006 0.0055 115.0097 +YCCC 2080.582965 3 0.0015 620 | 0/24
12 h-m-p 0.0005 0.0024 189.5010 CCCC 2079.672792 3 0.0008 677 | 0/24
13 h-m-p 0.0006 0.0030 112.9955 YCC 2079.413081 2 0.0004 731 | 0/24
14 h-m-p 0.0017 0.0130 27.3382 YCC 2079.313676 2 0.0008 785 | 0/24
15 h-m-p 0.0017 0.0126 12.4891 CC 2079.297297 1 0.0004 838 | 0/24
16 h-m-p 0.0016 0.0516 3.2079 YC 2079.293568 1 0.0007 890 | 0/24
17 h-m-p 0.0011 0.0770 1.9356 YC 2079.290879 1 0.0008 942 | 0/24
18 h-m-p 0.0014 0.1647 1.1342 +CC 2079.263095 1 0.0065 996 | 0/24
19 h-m-p 0.0004 0.0248 17.9601 +YC 2078.922901 1 0.0041 1049 | 0/24
20 h-m-p 0.0005 0.0068 142.6186 +YYC 2077.693998 2 0.0018 1103 | 0/24
21 h-m-p 0.0004 0.0020 365.3826 CCCC 2076.649619 3 0.0006 1160 | 0/24
22 h-m-p 0.0008 0.0039 47.8132 YCC 2076.521923 2 0.0006 1214 | 0/24
23 h-m-p 0.0043 0.0214 5.3487 CC 2076.502101 1 0.0009 1267 | 0/24
24 h-m-p 0.0006 0.0786 9.0540 +++YCCC 2075.632415 3 0.0263 1326 | 0/24
25 h-m-p 0.0012 0.0062 83.8810 YCCC 2075.483109 3 0.0005 1382 | 0/24
26 h-m-p 0.4227 5.9175 0.1055 YCCC 2074.808261 3 1.0463 1438 | 0/24
27 h-m-p 1.6000 8.0000 0.0304 YCC 2074.726720 2 1.0102 1492 | 0/24
28 h-m-p 0.9840 8.0000 0.0313 CC 2074.698787 1 1.0463 1545 | 0/24
29 h-m-p 1.6000 8.0000 0.0102 YC 2074.689185 1 1.2091 1597 | 0/24
30 h-m-p 0.8858 8.0000 0.0139 +YC 2074.684634 1 2.2177 1650 | 0/24
31 h-m-p 1.6000 8.0000 0.0143 CC 2074.681571 1 1.8446 1703 | 0/24
32 h-m-p 1.3699 8.0000 0.0193 CC 2074.678791 1 2.1044 1756 | 0/24
33 h-m-p 1.6000 8.0000 0.0248 YC 2074.673754 1 3.6729 1808 | 0/24
34 h-m-p 1.6000 8.0000 0.0353 C 2074.671112 0 1.5062 1859 | 0/24
35 h-m-p 1.6000 8.0000 0.0059 YC 2074.670978 1 0.9195 1911 | 0/24
36 h-m-p 1.6000 8.0000 0.0010 Y 2074.670976 0 0.9588 1962 | 0/24
37 h-m-p 1.6000 8.0000 0.0001 Y 2074.670976 0 0.9483 2013 | 0/24
38 h-m-p 1.6000 8.0000 0.0000 Y 2074.670976 0 0.8456 2064 | 0/24
39 h-m-p 1.6000 8.0000 0.0000 Y 2074.670976 0 1.6000 2115 | 0/24
40 h-m-p 1.6000 8.0000 0.0000 Y 2074.670976 0 0.4000 2166 | 0/24
41 h-m-p 0.5674 8.0000 0.0000 ---------------Y 2074.670976 0 0.0000 2232
Out..
lnL = -2074.670976
2233 lfun, 24563 eigenQcodon, 468930 P(t)
Time used: 7:07
Model 8: beta&w>1
TREE # 1
(1, ((4, 5), ((((((6, 7), 8), 9), 10), 12), 11)), (2, 3)); MP score: 234
1 0.074830
2 0.031809
3 0.027260
4 0.026163
5 0.026150
6 0.026148
7 0.026148
initial w for M8:NSbetaw>1 reset.
0.073467 0.043049 0.030594 0.046563 0.053581 0.104810 0.010320 0.023341 0.000000 0.025833 0.018691 0.073098 0.062101 0.040751 0.121358 0.153685 0.105820 0.092031 0.011497 0.013530 0.018801 2.215045 0.900000 1.017971 1.440735 2.095350
ntime & nrate & np: 21 2 26
Bounds (np=26):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 6.114443
np = 26
lnL0 = -2242.531186
Iterating by ming2
Initial: fx= 2242.531186
x= 0.07347 0.04305 0.03059 0.04656 0.05358 0.10481 0.01032 0.02334 0.00000 0.02583 0.01869 0.07310 0.06210 0.04075 0.12136 0.15369 0.10582 0.09203 0.01150 0.01353 0.01880 2.21504 0.90000 1.01797 1.44073 2.09535
1 h-m-p 0.0000 0.0003 1239.4127 ++YCCCC 2222.504814 4 0.0001 66 | 0/26
2 h-m-p 0.0001 0.0003 314.4239 ++ 2203.230860 m 0.0003 121 | 1/26
3 h-m-p 0.0002 0.0008 226.4093 +YYCCCC 2194.497311 5 0.0005 185 | 1/26
4 h-m-p 0.0000 0.0002 1336.2238 +YYCCC 2184.603149 4 0.0001 246 | 1/26
5 h-m-p 0.0000 0.0001 1948.3413 +CYCCC 2167.598207 4 0.0001 308 | 1/26
6 h-m-p 0.0000 0.0001 5340.3947 ++ 2131.076493 m 0.0001 362 | 1/26
7 h-m-p 0.0000 0.0000 6475.1805 YCYCCC 2124.274858 5 0.0000 424 | 1/26
8 h-m-p 0.0000 0.0001 245.9314 YCCC 2123.699831 3 0.0001 483 | 0/26
9 h-m-p 0.0000 0.0001 417.2900 YCCC 2122.072048 3 0.0000 542 | 0/26
10 h-m-p 0.0002 0.0009 85.4360 YYC 2121.663555 2 0.0002 599 | 0/26
11 h-m-p 0.0001 0.0005 151.3169 +YCC 2120.083722 2 0.0004 658 | 0/26
12 h-m-p 0.0000 0.0002 541.1934 CC 2119.597939 1 0.0000 715 | 0/26
13 h-m-p 0.0001 0.0008 360.9177 +YCCCC 2117.215292 4 0.0003 778 | 0/26
14 h-m-p 0.0002 0.0010 325.5579 CYCCC 2116.357612 4 0.0002 840 | 0/26
15 h-m-p 0.0002 0.0009 193.5227 YCCC 2115.119887 3 0.0003 900 | 0/26
16 h-m-p 0.0004 0.0021 185.4185 CCCC 2113.164344 3 0.0006 961 | 0/26
17 h-m-p 0.0004 0.0023 316.9114 +YCCC 2107.832362 3 0.0010 1022 | 0/26
18 h-m-p 0.0002 0.0010 739.7278 YCC 2104.166297 2 0.0003 1080 | 0/26
19 h-m-p 0.0001 0.0006 162.1687 CYCCC 2103.656217 4 0.0002 1142 | 0/26
20 h-m-p 0.0002 0.0021 140.1106 CCC 2103.139881 2 0.0003 1201 | 0/26
21 h-m-p 0.0006 0.0042 65.1107 CCC 2102.797729 2 0.0005 1260 | 0/26
22 h-m-p 0.0007 0.0034 44.4351 YCC 2102.644054 2 0.0004 1318 | 0/26
23 h-m-p 0.0030 0.0392 5.7979 YCC 2102.578281 2 0.0023 1376 | 0/26
24 h-m-p 0.0025 0.2199 5.3610 ++YCCC 2098.744007 3 0.1013 1438 | 0/26
25 h-m-p 0.0010 0.0049 130.8454 +CYCC 2095.233903 3 0.0036 1499 | 0/26
26 h-m-p 0.0036 0.0178 8.5676 ++ 2093.335067 m 0.0178 1554 | 0/26
27 h-m-p -0.0000 -0.0000 0.8685
h-m-p: -0.00000000e+00 -0.00000000e+00 8.68473598e-01 2093.335067
.. | 0/26
28 h-m-p 0.0000 0.0003 418.5441 ++CC 2084.169448 1 0.0001 1665 | 0/26
29 h-m-p 0.0002 0.0009 179.1146 YCC 2080.300935 2 0.0003 1723 | 0/26
30 h-m-p 0.0001 0.0004 231.4558 +YCYCCC 2076.422860 5 0.0003 1787 | 0/26
31 h-m-p 0.0001 0.0003 197.1574 +YCCC 2074.837977 3 0.0002 1848 | 0/26
32 h-m-p 0.0001 0.0007 109.9695 CCCC 2074.270969 3 0.0002 1909 | 0/26
33 h-m-p 0.0006 0.0032 31.4819 CC 2074.187259 1 0.0002 1966 | 0/26
34 h-m-p 0.0004 0.0030 18.9012 YC 2074.158344 1 0.0002 2022 | 0/26
35 h-m-p 0.0004 0.0275 9.7154 C 2074.142716 0 0.0004 2077 | 0/26
36 h-m-p 0.0004 0.0068 12.2916 CC 2074.132538 1 0.0003 2134 | 0/26
37 h-m-p 0.0006 0.0127 6.1136 YC 2074.128037 1 0.0004 2190 | 0/26
38 h-m-p 0.0003 0.0143 8.4052 CC 2074.122659 1 0.0004 2247 | 0/26
39 h-m-p 0.0002 0.0181 16.1282 +CC 2074.104341 1 0.0007 2305 | 0/26
40 h-m-p 0.0003 0.0165 39.3814 +YC 2074.045011 1 0.0010 2362 | 0/26
41 h-m-p 0.0005 0.0192 71.2431 +YCC 2073.851807 2 0.0018 2421 | 0/26
42 h-m-p 0.0006 0.0040 224.8784 YCC 2073.691917 2 0.0005 2479 | 0/26
43 h-m-p 0.0012 0.0064 87.3024 CC 2073.628574 1 0.0005 2536 | 0/26
44 h-m-p 0.0009 0.0116 46.1262 YC 2073.600190 1 0.0004 2592 | 0/26
45 h-m-p 0.0057 0.0439 3.4031 -CC 2073.597999 1 0.0005 2650 | 0/26
46 h-m-p 0.0009 0.1337 2.0170 CC 2073.596134 1 0.0008 2707 | 0/26
47 h-m-p 0.0007 0.0311 2.1168 CC 2073.592478 1 0.0011 2764 | 0/26
48 h-m-p 0.0003 0.0754 6.9332 +++YC 2073.421984 1 0.0142 2823 | 0/26
49 h-m-p 0.0003 0.0016 188.4844 CYCCC 2073.213486 4 0.0006 2885 | 0/26
50 h-m-p 0.0022 0.0112 29.4679 YC 2073.193308 1 0.0004 2941 | 0/26
51 h-m-p 0.0071 0.0911 1.7164 -YC 2073.192123 1 0.0008 2998 | 0/26
52 h-m-p 0.0012 0.4070 1.0475 YC 2073.189920 1 0.0027 3054 | 0/26
53 h-m-p 0.0005 0.0632 5.5408 +++YC 2073.075304 1 0.0261 3113 | 0/26
54 h-m-p 0.3997 8.0000 0.3623 YCC 2073.005779 2 0.8652 3171 | 0/26
55 h-m-p 1.1466 8.0000 0.2734 CC 2072.956839 1 1.2942 3228 | 0/26
56 h-m-p 1.4889 8.0000 0.2376 YCC 2072.905919 2 2.9703 3286 | 0/26
57 h-m-p 1.4590 7.2949 0.3364 CC 2072.877904 1 1.4774 3343 | 0/26
58 h-m-p 1.6000 8.0000 0.1935 C 2072.870454 0 1.6000 3398 | 0/26
59 h-m-p 1.6000 8.0000 0.0867 CC 2072.869060 1 1.3120 3455 | 0/26
60 h-m-p 1.6000 8.0000 0.0101 C 2072.868943 0 1.3182 3510 | 0/26
61 h-m-p 1.6000 8.0000 0.0034 C 2072.868931 0 1.3648 3565 | 0/26
62 h-m-p 1.6000 8.0000 0.0011 C 2072.868930 0 1.4743 3620 | 0/26
63 h-m-p 1.6000 8.0000 0.0005 Y 2072.868930 0 1.2581 3675 | 0/26
64 h-m-p 1.6000 8.0000 0.0003 Y 2072.868930 0 0.8718 3730 | 0/26
65 h-m-p 1.6000 8.0000 0.0001 C 2072.868930 0 0.4000 3785 | 0/26
66 h-m-p 0.6177 8.0000 0.0001 C 2072.868930 0 0.1476 3840 | 0/26
67 h-m-p 0.1762 8.0000 0.0001 ---------N 2072.868930 0 0.0000 3904
Out..
lnL = -2072.868930
3905 lfun, 46860 eigenQcodon, 902055 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -2108.034744 S = -2050.202740 -49.550240
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 156 patterns 12:52
did 20 / 156 patterns 12:52
did 30 / 156 patterns 12:52
did 40 / 156 patterns 12:52
did 50 / 156 patterns 12:52
did 60 / 156 patterns 12:53
did 70 / 156 patterns 12:53
did 80 / 156 patterns 12:53
did 90 / 156 patterns 12:53
did 100 / 156 patterns 12:53
did 110 / 156 patterns 12:54
did 120 / 156 patterns 12:54
did 130 / 156 patterns 12:54
did 140 / 156 patterns 12:54
did 150 / 156 patterns 12:54
did 156 / 156 patterns 12:54
Time used: 12:55
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=12, Len=258
D_melanogaster_CG13024-PB MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNTS-
D_sechellia_CG13024-PB MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSG-
D_simulans_CG13024-PB MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSS-
D_yakuba_CG13024-PB MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSS-
D_erecta_CG13024-PB MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSS-
D_takahashii_CG13024-PB MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSS-
D_biarmipes_CG13024-PB MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSS
D_suzukii_CG13024-PB MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSN
D_eugracilis_CG13024-PB MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSN
D_ficusphila_CG13024-PB MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSN
D_rhopaloa_CG13024-PB MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSDSS-
D_elegans_CG13024-PB MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSN
**********************************************::.
D_melanogaster_CG13024-PB --SIHNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
D_sechellia_CG13024-PB --SINNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
D_simulans_CG13024-PB --SINNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
D_yakuba_CG13024-PB --SINNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
D_erecta_CG13024-PB --NINNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
D_takahashii_CG13024-PB --HMNNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
D_biarmipes_CG13024-PB SHITNNNSN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
D_suzukii_CG13024-PB INNNNNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
D_eugracilis_CG13024-PB ANNNNNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
D_ficusphila_CG13024-PB VNNVNNNSNNNNTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
D_rhopaloa_CG13024-PB -------NN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
D_elegans_CG13024-PB ----TNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
.* **************************************
D_melanogaster_CG13024-PB SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLAIGSG--
D_sechellia_CG13024-PB SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLSLGSG--
D_simulans_CG13024-PB SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLALGSG--
D_yakuba_CG13024-PB SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLTLASG--
D_erecta_CG13024-PB SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSTSNYNANLTLASG--
D_takahashii_CG13024-PB SGSLLLTAANLERFAEIHKKQERHNKMLMPPSNPSSSNYNANLTLATSGN
D_biarmipes_CG13024-PB SGSLLLTAANLERFAEIHKKQERHNKMLMP-GHPTSSNYNANLTLASG--
D_suzukii_CG13024-PB SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLTLASG--
D_eugracilis_CG13024-PB SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLTLASG--
D_ficusphila_CG13024-PB SGSLLLTAANLERFAEIHKKQERHNKMLMP-GHPSSSNYNANLTLATG--
D_rhopaloa_CG13024-PB SGSLLLTAANLERFAEIHKKQERNNKMLMP-SNPSSSNYNANLTLASG--
D_elegans_CG13024-PB SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLTLASG--
***********************:****** .:*::*******::.:.
D_melanogaster_CG13024-PB KDAVIAIEGQQP--ADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
D_sechellia_CG13024-PB KDAVIAIEGQQP--ADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
D_simulans_CG13024-PB KDAVIAIEGQQP--ADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
D_yakuba_CG13024-PB KDAVIAIEGQQSSAADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
D_erecta_CG13024-PB KDAVIAIEGQ--QPGDVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
D_takahashii_CG13024-PB KDAVIAIEGQQQPAAEMDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
D_biarmipes_CG13024-PB KDAVIAIEGQ--PPAEVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
D_suzukii_CG13024-PB KDAVIAIEGQ--QPAEVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
D_eugracilis_CG13024-PB KDAVIAIEGQ--QPNEVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
D_ficusphila_CG13024-PB QDAVITIDGQ--QPSEVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
D_rhopaloa_CG13024-PB KDAVIAIEGE---PADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
D_elegans_CG13024-PB KDAVIAIEGQ---PEDVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
:****:*:*: ::*********************************
D_melanogaster_CG13024-PB KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooo
D_sechellia_CG13024-PB KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooo
D_simulans_CG13024-PB KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooo
D_yakuba_CG13024-PB KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooo
D_erecta_CG13024-PB KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooo
D_takahashii_CG13024-PB KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSo---
D_biarmipes_CG13024-PB KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSooo-
D_suzukii_CG13024-PB KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSooo-
D_eugracilis_CG13024-PB KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSooo-
D_ficusphila_CG13024-PB KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKS----
D_rhopaloa_CG13024-PB KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooo
D_elegans_CG13024-PB KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooo
**********************************************
D_melanogaster_CG13024-PB oo------
D_sechellia_CG13024-PB oo------
D_simulans_CG13024-PB oo------
D_yakuba_CG13024-PB --------
D_erecta_CG13024-PB oo------
D_takahashii_CG13024-PB --------
D_biarmipes_CG13024-PB --------
D_suzukii_CG13024-PB --------
D_eugracilis_CG13024-PB --------
D_ficusphila_CG13024-PB --------
D_rhopaloa_CG13024-PB oooooooo
D_elegans_CG13024-PB oooo----
>D_melanogaster_CG13024-PB ATGCAGGACTATTGGCACATTCCCCGCGCCTCGCTGGCATCCTCCTCGAG CTCGGCCATTAGTTCGGCCAGCTCGTCCAAGTCCTCGAACAAATCGCACT CCAATCCACCTACCCTAAACCAACGCAGTTCGCCCAGTAACACTAGC--- ------AGCATTCACAATAACAATAAT---------ACAAGTGCTGCAGT AACTGCGGCAGCAGCGGCCGCTGTTCTGGCGGCTGCCAAGAGGGGATCGA GGAGCTCCCAGGGCTCCAGCGACAGTAACAACAGCACGCGGAGCGCTGCT TCCGGCTCACTGCTGTTGACGGCAGCGAATCTGGAACGCTTTGCGGAGAT CCACAAGAAGCAGGAGCGACACAACAAGATGCTGATGCCC---AGTAATC CCTCCTCGTCAAACTATAATGCCAACCTGGCCATCGGCAGCGGC------ AAGGATGCGGTTATCGCCATCGAGGGTCAGCAGCCA------GCCGACGT CGATCCCAACTTGCAGTATGTGAAAACCAAAGACCTGGATACCGTATCCA TCGCTAGCTCTATGCACTTCACGATGGTCAATGGAGAGGGTGGTCCACCG AAGAAACCGAAGCGCGGTCTATGCGATCGGGGGCGCCAGGTCACCGTGTT GATAGTCAGCATGAGTACCATCTTCATGCTGCTCATCATGGGCATGGTCT ATGCGCTGGAGATGCGCGCCCGTGACATGCCCAAGAGC------------ ------------------------ >D_sechellia_CG13024-PB ATGCAGGACTATTGGCACATTCCCCGCGCCTCGCTGGCATCCTCCTCGAG CTCGGCCATCAGTTCGGCCAGCTCCTCCAAGTCCTCGAACAAATCGCACT CGAATCCGCCTACCCTAAACCAGCGCAGTTCGCCCAGTAACAGTGGC--- ------AGCATTAACAATAACAATAAT---------ACAAGTGCTGCAGT AACTGCGGCAGCAGCGGCGGCTGTTCTGGCGGCAGCCAAGAGGGGATCGA GGAGCTCCCAGGGCTCCAGCGACAGTAACAACAGCACGCGGAGCGCTGCT TCCGGCTCACTGCTGTTGACGGCAGCGAATCTGGAACGCTTTGCGGAGAT CCACAAGAAGCAGGAGCGCCACAACAAGATGCTGATGCCC---AGCAATC CCTCCTCGTCCAACTATAATGCCAACCTGTCCCTCGGCAGCGGC------ AAGGATGCGGTTATCGCCATCGAGGGTCAGCAGCCG------GCCGACGT CGATCCCAATTTGCAGTATGTGAAAACCAAAGACCTGGATACCGTATCCA TCGCTAGCTCCATGCACTTCACGATGGTCAATGGAGAGGGTGGTCCGCCA AAGAAACCGAAGCGTGGTCTATGCGATCGCGGACGCCAGGTCACCGTGTT GATAGTCAGCATGAGTACCATCTTCATGCTGCTCATCATGGGCATGGTCT ATGCGCTGGAGATGCGCGCCCGTGACATGCCCAAGAGC------------ ------------------------ >D_simulans_CG13024-PB ATGCAGGACTATTGGCACATTCCCCGCGCCTCGCTGGCATCCTCCTCGAG CTCGGCCATCAGTTCGGCCAGCTCCTCCAAGTCCTCGAACAAATCGCACT CGAATCCGCCTACCCTAAACCAGCGCAGTTCGCCCAGTAACAGTAGC--- ------AGCATTAACAATAACAATAAT---------ACAAGTGCTGCAGT AACTGCGGCAGCAGCGGCGGCTGTTCTGGCGGCAGCCAAGAGGGGATCGA GGAGCTCCCAGGGCTCCAGCGACAGTAACAACAGCACGCGGAGCGCTGCT TCCGGCTCACTGCTGTTGACGGCAGCGAATCTGGAACGCTTTGCGGAGAT CCACAAGAAGCAGGAGCGCCACAACAAGATGCTGATGCCC---AGCAATC CCTCCTCGTCAAACTATAATGCTAACCTGGCCCTCGGCAGCGGC------ AAGGATGCGGTTATCGCCATCGAGGGTCAGCAGCCG------GCCGACGT CGATCCCAATTTGCAGTATGTGAAAACCAAAGACCTGGATACCGTATCCA TCGCTAGCTCCATGCACTTCACGATGGTCAATGGAGAGGGTGGTCCGCCA AAGAAACCGAAGCGTGGTCTATGCGATCGCGGACGCCAGGTCACCGTGTT GATTGTCAGCATGAGTACCATCTTCATGCTGCTCATCATGGGCATGGTCT ATGCGCTGGAGATGCGCGCCCGCGACATGCCCAAGAGC------------ ------------------------ >D_yakuba_CG13024-PB ATGCAGGACTACTGGCACATTCCCCGCGCCTCGCTGGCATCCTCCTCGAG CTCGGCCATCAGTTCGGCCAGCTCCTCCAAGTCCTCCAACAAATCGCATT CGAATCCGCCTACCCTGAACCAGCGCAGTTCGCCCAGTAACAGTAGC--- ------AGCATTAACAATAACAACAAT---------ACAAGTGCTGCTGT AACTGCGGCAGCAGCGGCGGCTGTTCTGGCTGCTGCCAAGAGGGGATCGA GGAGTTCCCAGGGCTCCAGCGACAGTAACAACAGCACGCGGAGCGCTGCT TCCGGCTCACTGCTGTTGACGGCAGCGAATCTGGAACGCTTTGCGGAGAT CCACAAGAAGCAGGAGCGCCACAACAAGATGCTGATGCCC---AGCAATC CCTCCTCCTCAAACTACAACGCCAACCTGACCCTCGCTAGCGGC------ AAGGATGCAGTTATCGCCATCGAGGGTCAGCAGTCGTCAGCGGCCGACGT GGATCCCAACTTGCAGTATGTGAAAACCAAAGACCTGGATACCGTATCCA TTGCTAGCTCCATGCACTTCACGATGGTCAATGGAGAGGGTGGTCCGCCG AAGAAGCCGAAGCGCGGTCTCTGCGATCGGGGACGCCAGGTCACCGTATT GATAGTCAGCATGAGTACCATCTTCATGCTGCTCATCATGGGCATGGTCT ATGCGCTAGAGATGCGCGCCCGCGACATGCCCAAGAGC------------ ------------------------ >D_erecta_CG13024-PB ATGCAGGACTATTGGCACATTCCCCGCGCCTCGCTGGCATCCTCCTCGAG CTCGGCCATCAGTTCGGCCAGCTCCTCCAAGTCCTCAAACAAATCGCATT CGAATCCGCCCACACTGAACCAGCGCAGTTCGCCCAGTAACAGTAGC--- ------AACATTAACAATAACAATAAT---------ACAAGTGCTGCAGT AACTGCGGCAGCAGCGGCGGCTGTTCTGGCTGCTGCCAAGAGGGGATCGA GGAGTTCCCAGGGCTCCAGCGACAGTAACAACAGCACGCGGAGCGCTGCT TCCGGCTCACTGCTGTTGACGGCAGCGAATCTGGAACGCTTTGCGGAGAT CCACAAGAAGCAGGAGCGCCACAACAAGATGCTGATGCCC---AGCAATC CCTCCACTTCAAACTACAACGCCAACCTGACTCTCGCCAGTGGC------ AAGGATGCGGTTATTGCCATCGAGGGTCAG------CAGCCGGGTGACGT GGATCCCAACTTGCAGTATGTGAAAACCAAAGACCTGGATACCGTATCCA TTGCTAGCTCCATGCATTTTACGATGGTCAATGGAGAGGGTGGTCCGCCG AAGAAACCGAAGCGTGGTCTCTGCGATCGGGGACGCCAGGTCACCGTGTT GATAGTCAGCATGAGTACCATCTTCATGCTGCTCATCATGGGCATGGTCT ATGCGCTGGAGATGCGCGCCCGCGACATGCCCAAGAGC------------ ------------------------ >D_takahashii_CG13024-PB ATGCAGGACTATTGGCACATTCCACGCGCCTCGCTGGCCTCCTCCTCGAG CTCGGCCATCAGTTCGGCCAGCTCCTCAAAGTCCTCGAACAAATCGCACT CGAATCCACCCACCCTCAACCAGCGCAGTTCGCCCAGCAACAGTAGC--- ------CATATGAATAACAACAATAAT---------ACAAGTGCTGCTGT TACGGCGGCGGCGGCGGCTGCGGTTCTGGCGGCCGCCAAGCGGGGATCGA GGAGTTCGCAGGGCTCCAGCGACAGCAACAACAGCACACGGAGCGCTGCT TCCGGCTCACTGCTGCTAACGGCAGCGAATCTGGAACGCTTCGCGGAGAT CCACAAGAAGCAGGAGCGCCACAACAAGATGCTGATGCCGCCCAGCAATC CCTCGTCGTCCAACTACAATGCCAACCTGACGCTGGCAACGAGCGGCAAC AAGGATGCGGTAATCGCCATCGAGGGCCAGCAGCAGCCGGCGGCCGAGAT GGATCCCAATTTGCAGTATGTGAAAACCAAAGACCTGGACACCGTGTCCA TCGCTAGCTCCATGCACTTTACGATGGTCAACGGAGAGGGCGGTCCGCCC AAGAAACCGAAGCGCGGCCTCTGCGATCGGGGACGCCAGGTCACCGTGTT GATAGTGAGCATGAGCACCATCTTTATGCTGCTCATCATGGGCATGGTCT ATGCGCTGGAGATGCGCGCCCGCGACATGCCCAAGAGC------------ ------------------------ >D_biarmipes_CG13024-PB ATGCAGGACTATTGGCACATTCCACGCGCCTCGCTGGCCTCCTCGTCGAG CTCGGCCATCAGTTCGGCCAGCTCCTCGAAGTCCTCGAACAAATCGCACT CGAATCCGCCCACCCTTAACCAGCGCAGTTCGCCCAGCAACAGTAGCAGC AGCCATATTACCAACAATAATAGCAAT---------ACCAGTGCTGCTGT TACGGCGGCGGCAGCGGCGGCGGTTCTGGCGGCCGCCAAGCGGGGATCGA GGAGTTCGCAGGGCTCCAGCGACAGCAACAACAGCACACGGAGCGCTGCT TCCGGCTCACTGCTGCTGACGGCAGCGAATCTGGAACGCTTTGCGGAGAT CCACAAGAAGCAGGAGCGGCACAACAAGATGCTGATGCCC---GGCCATC CCACGTCGTCCAACTACAATGCCAACCTGACGCTGGCCAGCGGC------ AAGGATGCGGTCATCGCCATCGAGGGCCAG------CCGCCGGCCGAGGT GGATCCCAATTTGCAGTACGTGAAAACCAAAGACCTGGACACCGTGTCCA TCGCCAGCTCCATGCACTTTACGATGGTCAACGGCGAGGGTGGTCCGCCC AAGAAGCCCAAGCGCGGCCTCTGCGATCGGGGACGCCAGGTCACCGTGTT GATAGTGAGCATGAGCACCATCTTCATGCTGCTCATCATGGGCATGGTCT ATGCGCTGGAGATGCGCGCCCGCGACATGCCCAAGAGC------------ ------------------------ >D_suzukii_CG13024-PB ATGCAGGACTATTGGCACATTCCACGCGCCTCGCTGGCCTCATCCTCGAG CTCGGCCATCAGTTCGGCCAGCTCCTCGAAGTCCTCGAACAAATCGCACT CGAATCCGCCCACCCTCAACCAGCGCAGTTCGCCCAGCAACAGTAGCAAT ATTAACAACAACAATAATAATAATAAT---------ACAAGTGCTGCTGT TACGGCGGCGGCAGCGGCAGCGGTACTGGCGGCTGCCAAGCGGGGATCGA GGAGTTCGCAGGGCTCCAGCGACAGTAACAACAGCACACGGAGCGCTGCT TCCGGCTCACTGCTGCTGACGGCAGCGAATCTGGAACGCTTCGCCGAGAT CCACAAGAAGCAGGAGCGCCACAACAAGATGCTGATGCCC---AGCAATC CCTCGTCGTCCAACTACAATGCCAATCTGACGCTGGCCAGCGGC------ AAGGATGCGGTGATCGCCATCGAGGGTCAG------CAGCCGGCCGAGGT GGATCCCAATTTGCAGTATGTGAAAACCAAAGACCTGGACACCGTATCCA TCGCCAGCTCCATGCACTTCACGATGGTCAACGGCGAGGGTGGTCCGCCC AAGAAGCCGAAGCGCGGTCTCTGCGATCGGGGACGCCAGGTCACCGTGTT GATAGTGAGCATGAGCACCATCTTTATGCTGCTCATCATGGGCATGGTCT ATGCGCTGGAGATGCGCGCCCGCGACATGCCCAAGAGC------------ ------------------------ >D_eugracilis_CG13024-PB ATGCAGGACTACTGGCACATTCCCCGCGCCTCTCTGGCCTCATCCTCAAG CTCGGCCATCAGTTCGGCCAGCTCCTCAAAGTCCTCGAACAAATCGCACT CGAATCCGCCCACCCTCAACCAGCGGAGTTCGCCCAGCAACAGCAGCAAT GCAAATAATAATAATAATAATAATAAT---------ACAAGTGCTGCTGT TACGGCGGCGGCTGCGGCAGCGGTACTGGCTGCTGCCAAGCGGGGATCGA GGAGTTCGCAGGGCTCCAGCGACAGTAACAACAGCACACGGAGCGCTGCT TCCGGCTCACTGCTGTTGACGGCAGCGAATCTGGAACGCTTCGCGGAGAT CCACAAGAAGCAGGAGCGCCACAACAAGATGCTGATGCCC---AGTAATC CTTCGTCGTCCAACTACAATGCCAATCTGACGCTAGCCAGCGGC------ AAGGATGCGGTTATCGCCATCGAGGGCCAA------CAGCCGAACGAAGT GGATCCCAATTTGCAGTACGTGAAAACCAAAGACCTGGACACCGTATCCA TTGCGAGCTCTATGCACTTCACGATGGTCAATGGAGAAGGTGGTCCCCCG AAGAAACCGAAGCGTGGTCTCTGCGATCGTGGACGCCAGGTCACCGTGTT GATAGTGAGCATGAGCACCATCTTTATGCTGCTCATCATGGGCATGGTCT ATGCGCTGGAGATGCGCGCCCGCGACATGCCCAAGAGC------------ ------------------------ >D_ficusphila_CG13024-PB ATGCAGGACTATTGGCACATTCCCCGCGCCTCGCTGGCCTCCTCCTCGAG CTCGGCCATCAGTTCGGCCAGCTCCTCAAAGTCCTCAAACAAGTCGCACT CGAATCCGCCCACCCTCAACCAGCGCAGTTCCCCAAGCAACAGTAGCAAT GTTAATAATGTTAACAACAACAGCAACAACAATAATACAAGTGCTGCTGT GACAGCGGCGGCAGCGGCAGCGGTACTAGCAGCTGCCAAGCGGGGATCGA GGAGTTCCCAGGGCTCCAGCGACAGCAACAACAGCACACGGAGCGCTGCT TCCGGCTCACTGCTGCTGACGGCAGCGAATCTGGAACGCTTCGCGGAGAT CCACAAGAAGCAGGAGCGGCACAACAAGATGCTGATGCCC---GGCCATC CATCTTCGTCCAACTACAATGCCAACCTAACGCTCGCCACTGGC------ CAGGATGCGGTGATCACCATCGATGGCCAG------CAGCCATCGGAAGT GGATCCCAACTTGCAGTATGTGAAAACCAAAGACCTGGACACCGTATCCA TTGCCAGCTCGATGCACTTTACGATGGTCAACGGCGAGGGTGGTCCGCCC AAGAAGCCCAAGCGCGGTCTCTGCGATCGAGGACGCCAGGTCACCGTGTT GATTGTGAGCATGAGTACCATCTTCATGCTCCTCATCATGGGCATGGTCT ATGCGCTGGAGATGCGCGCCCGCGACATGCCCAAGAGC------------ ------------------------ >D_rhopaloa_CG13024-PB ATGCAGGACTATTGGCACATTCCCCGCGCCTCGCTGGCCTCTTCCTCGAG CTCAGCCATTAGTTCGGCTAGCTCCTCAAAGTCCTCGAACAAATCGCACT CGAATCCGCCTACCCTGAACCAGCGCAGTTCGCCTAGCGACAGTAGC--- ---------------------AATAAT---------ACAAGTGCTGCTGT GACAGCAGCGGCAGCGGCGGCGGTACTGGCGGCTGCCAAGCGGGGATCGA GGAGTTCGCAGGGCTCCAGCGACAGCAACAACAGCACACGGAGCGCTGCT TCCGGCTCACTGCTGTTGACGGCAGCGAATCTGGAACGCTTCGCGGAGAT CCACAAGAAGCAGGAGCGGAACAACAAGATGCTGATGCCC---AGCAATC CCTCATCGTCCAACTACAATGCCAACCTGACGCTCGCCAGCGGC------ AAGGATGCGGTCATCGCCATCGAGGGCGAG---------CCGGCCGATGT GGATCCCAATTTGCAGTATGTGAAAACCAAAGACCTGGATACCGTATCCA TTGCCAGTTCCATGCACTTCACGATGGTCAATGGAGAGGGTGGTCCGCCC AAGAAACCGAAGCGCGGTCTCTGCGATCGGGGACGCCAGGTCACCGTGTT GATTGTCAGCATGAGCACCATTTTCATGCTGCTCATTATGGGCATGGTCT ATGCGCTGGAGATGCGCGCCCGTGACATGCCCAAGAGC------------ ------------------------ >D_elegans_CG13024-PB ATGCAGGACTATTGGCACATTCCCCGCGCCTCGCTGGCCTCTTCCTCGAG CTCGGCCATCAGTTCGGCGAGCTCCTCCAAGTCCTCGAACAAATCACACT CGAATCCGCCCACCCTGAACCAACGTAGTTCGCCCAGCAACAGTAGCAAT ------------ACTAACAACAATAAT---------ACAAGTGCCGCAGT GACGGCCGCAGCAGCGGCAGCAGTACTGGCGGCCGCCAAGCGGGGATCGA GAAGTTCGCAGGGCTCCAGCGACAGCAACAACAGCACACGGAGCGCTGCT TCCGGCTCACTGCTGTTGACGGCAGCGAATCTGGAACGCTTTGCGGAGAT CCACAAGAAGCAGGAGCGGCACAACAAGATGCTGATGCCC---AGCAATC CCTCGTCGTCCAACTACAATGCCAACCTAACGCTCGCCAGCGGC------ AAGGATGCGGTGATCGCCATCGAGGGCCAG---------CCGGAAGATGT TGATCCCAATTTGCAGTATGTGAAAACCAAAGACCTGGACACCGTATCCA TCGCCAGCTCCATGCACTTCACGATGGTCAATGGGGAGGGTGGTCCGCCC AAGAAACCGAAGCGCGGTCTCTGCGATCGGGGACGCCAGGTCACCGTGTT GATTGTGAGCATGAGCACCATCTTTATGCTGCTCATTATGGGAATGGTCT ATGCGCTGGAGATGCGCGCCCGTGACATGCCCAAGAGC------------ ------------------------
>D_melanogaster_CG13024-PB MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNTS- --SIHNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLAIGSG-- KDAVIAIEGQQP--ADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKS >D_sechellia_CG13024-PB MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSG- --SINNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLSLGSG-- KDAVIAIEGQQP--ADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKS >D_simulans_CG13024-PB MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSS- --SINNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLALGSG-- KDAVIAIEGQQP--ADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKS >D_yakuba_CG13024-PB MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSS- --SINNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLTLASG-- KDAVIAIEGQQSSAADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKS >D_erecta_CG13024-PB MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSS- --NINNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSTSNYNANLTLASG-- KDAVIAIEGQ--QPGDVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKS >D_takahashii_CG13024-PB MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSS- --HMNNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA SGSLLLTAANLERFAEIHKKQERHNKMLMPPSNPSSSNYNANLTLATSGN KDAVIAIEGQQQPAAEMDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKS >D_biarmipes_CG13024-PB MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSS SHITNNNSN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA SGSLLLTAANLERFAEIHKKQERHNKMLMP-GHPTSSNYNANLTLASG-- KDAVIAIEGQ--PPAEVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKS >D_suzukii_CG13024-PB MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSN INNNNNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLTLASG-- KDAVIAIEGQ--QPAEVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKS >D_eugracilis_CG13024-PB MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSN ANNNNNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLTLASG-- KDAVIAIEGQ--QPNEVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKS >D_ficusphila_CG13024-PB MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSN VNNVNNNSNNNNTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA SGSLLLTAANLERFAEIHKKQERHNKMLMP-GHPSSSNYNANLTLATG-- QDAVITIDGQ--QPSEVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKS >D_rhopaloa_CG13024-PB MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSDSS- -------NN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA SGSLLLTAANLERFAEIHKKQERNNKMLMP-SNPSSSNYNANLTLASG-- KDAVIAIEGE---PADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKS >D_elegans_CG13024-PB MQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSSPSNSSN ----TNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA SGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLTLASG-- KDAVIAIEGQ---PEDVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKS
#NEXUS
[ID: 4785386002]
begin taxa;
dimensions ntax=12;
taxlabels
D_melanogaster_CG13024-PB
D_sechellia_CG13024-PB
D_simulans_CG13024-PB
D_yakuba_CG13024-PB
D_erecta_CG13024-PB
D_takahashii_CG13024-PB
D_biarmipes_CG13024-PB
D_suzukii_CG13024-PB
D_eugracilis_CG13024-PB
D_ficusphila_CG13024-PB
D_rhopaloa_CG13024-PB
D_elegans_CG13024-PB
;
end;
begin trees;
translate
1 D_melanogaster_CG13024-PB,
2 D_sechellia_CG13024-PB,
3 D_simulans_CG13024-PB,
4 D_yakuba_CG13024-PB,
5 D_erecta_CG13024-PB,
6 D_takahashii_CG13024-PB,
7 D_biarmipes_CG13024-PB,
8 D_suzukii_CG13024-PB,
9 D_eugracilis_CG13024-PB,
10 D_ficusphila_CG13024-PB,
11 D_rhopaloa_CG13024-PB,
12 D_elegans_CG13024-PB
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.05046326,((4:0.04041524,5:0.03896444)0.956:0.01841567,((((((6:0.07182648,7:0.07214443)0.815:0.02995765,8:0.02088566)0.684:0.0213738,9:0.08808819)0.748:0.02516764,10:0.1475842)0.626:0.02157355,12:0.08250745)0.538:0.02236669,11:0.05384738)1.000:0.1124477)1.000:0.02730008,(2:0.01049459,3:0.008435478)0.978:0.0115755);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.05046326,((4:0.04041524,5:0.03896444):0.01841567,((((((6:0.07182648,7:0.07214443):0.02995765,8:0.02088566):0.0213738,9:0.08808819):0.02516764,10:0.1475842):0.02157355,12:0.08250745):0.02236669,11:0.05384738):0.1124477):0.02730008,(2:0.01049459,3:0.008435478):0.0115755);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/59/CG13024-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/59/CG13024-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/59/CG13024-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2426.96 -2443.86
2 -2427.10 -2444.07
--------------------------------------
TOTAL -2427.03 -2443.97
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/59/CG13024-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/59/CG13024-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/59/CG13024-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.004648 0.012456 0.806620 1.234269 0.996298 1217.83 1320.82 1.000
r(A<->C){all} 0.089564 0.000428 0.050870 0.129398 0.087875 915.11 998.83 1.000
r(A<->G){all} 0.210864 0.001282 0.141135 0.280922 0.208585 839.39 864.07 1.000
r(A<->T){all} 0.101494 0.000852 0.047083 0.160701 0.099267 1020.98 1057.71 1.000
r(C<->G){all} 0.084672 0.000297 0.051391 0.118019 0.083938 802.53 954.78 1.000
r(C<->T){all} 0.464835 0.002383 0.370195 0.559038 0.465560 624.50 681.68 1.000
r(G<->T){all} 0.048571 0.000370 0.012783 0.085004 0.046742 994.58 1075.27 1.000
pi(A){all} 0.244072 0.000236 0.213065 0.273137 0.243804 681.79 849.37 1.000
pi(C){all} 0.318011 0.000238 0.288030 0.347349 0.317587 1174.18 1208.64 1.000
pi(G){all} 0.262192 0.000232 0.232789 0.291849 0.262020 992.08 1079.31 1.000
pi(T){all} 0.175725 0.000163 0.149717 0.199258 0.175639 1051.85 1153.16 1.000
alpha{1,2} 0.124867 0.000373 0.089709 0.162963 0.123570 1280.41 1339.82 1.003
alpha{3} 2.846692 0.792181 1.321923 4.649449 2.735073 1240.40 1355.95 1.000
pinvar{all} 0.454350 0.002338 0.353485 0.541223 0.456702 1040.04 1199.42 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/59/CG13024-PB/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 12 ls = 228
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 2 2 | Ser TCT 1 0 0 0 0 0 | Tyr TAT 4 4 4 2 3 3 | Cys TGT 0 0 0 0 0 0
TTC 2 2 2 2 1 1 | TCC 10 13 11 13 11 9 | TAC 0 0 0 2 1 1 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 2 1 2 2 3 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 2 | TCG 10 10 10 8 8 12 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 1 1 1 1 0 0 | His CAT 0 0 0 1 2 0 | Arg CGT 1 2 1 0 1 0
CTC 1 2 2 3 3 3 | CCC 6 6 6 6 7 6 | CAC 5 5 5 4 3 5 | CGC 6 7 8 8 7 8
CTA 2 2 2 1 0 1 | CCA 2 1 1 0 0 2 | Gln CAA 1 0 0 0 0 0 | CGA 1 0 0 0 0 0
CTG 10 10 10 10 11 11 | CCG 2 3 3 4 4 3 | CAG 6 7 7 7 7 7 | CGG 2 1 1 2 2 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 1 2 2 3 1 | Thr ACT 2 1 1 1 3 0 | Asn AAT 7 8 8 5 6 7 | Ser AGT 7 7 7 8 9 5
ATC 7 7 7 6 5 7 | ACC 5 5 5 6 4 5 | AAC 9 8 8 11 10 9 | AGC 11 11 12 11 10 14
ATA 1 1 0 1 1 1 | ACA 1 1 1 1 2 2 | Lys AAA 4 4 4 3 4 4 | Arg AGA 0 0 0 0 0 0
Met ATG 11 11 11 11 11 12 | ACG 3 3 3 3 3 5 | AAG 9 9 9 10 9 9 | AGG 2 2 2 2 2 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 6 5 6 9 7 6 | Asp GAT 4 4 4 4 4 3 | Gly GGT 4 4 4 4 5 1
GTC 5 5 5 4 4 3 | GCC 10 8 8 8 8 10 | GAC 5 5 5 5 5 5 | GGC 5 6 5 4 4 6
GTA 2 2 2 3 2 1 | GCA 5 6 6 5 5 2 | Glu GAA 1 1 1 1 1 1 | GGA 2 3 3 3 3 3
GTG 2 2 2 2 3 4 | GCG 7 8 8 6 7 10 | GAG 5 5 5 5 5 6 | GGG 1 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 1 1 1 0 2 | Ser TCT 0 0 2 1 1 1 | Tyr TAT 2 3 1 3 3 3 | Cys TGT 0 0 0 0 0 0
TTC 1 2 2 2 3 1 | TCC 8 8 7 10 8 9 | TAC 2 1 3 1 1 1 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 1 2 4 3 4 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 3 2 3 3 | TCG 13 13 10 10 10 11 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 0 0 0 0 0 | Pro CCT 0 0 1 0 2 0 | His CAT 1 0 0 1 0 0 | Arg CGT 0 0 2 0 1 2
CTC 2 3 3 5 3 3 | CCC 8 7 7 7 6 8 | CAC 5 5 5 5 4 5 | CGC 7 8 6 7 6 5
CTA 0 0 1 2 0 1 | CCA 1 1 0 2 0 0 | Gln CAA 0 0 1 0 0 1 | CGA 0 0 0 1 0 0
CTG 12 12 10 8 11 10 | CCG 2 3 3 2 3 3 | CAG 7 7 6 8 6 6 | CGG 4 3 3 3 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 2 3 6 3 | Thr ACT 0 0 0 1 0 0 | Asn AAT 5 8 9 3 8 8 | Ser AGT 5 6 6 6 6 5
ATC 7 7 6 6 3 6 | ACC 6 5 5 6 5 5 | AAC 9 8 8 11 8 8 | AGC 14 13 13 12 13 14
ATA 1 1 1 0 0 0 | ACA 1 2 2 3 3 2 | Lys AAA 3 3 4 2 4 4 | Arg AGA 0 0 0 0 0 1
Met ATG 11 11 11 11 11 11 | ACG 5 4 4 3 3 4 | AAG 10 10 9 10 9 9 | AGG 1 1 1 1 1 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 1 2 0 0 1 | Ala GCT 4 5 7 5 6 2 | Asp GAT 3 3 3 4 5 4 | Gly GGT 2 4 3 3 3 3
GTC 4 3 3 3 5 3 | GCC 12 12 9 9 10 12 | GAC 5 5 5 5 5 5 | GGC 8 5 5 7 5 4
GTA 0 2 2 2 2 2 | GCA 2 3 2 4 3 6 | Glu GAA 1 1 3 2 1 2 | GGA 2 2 3 2 3 3
GTG 5 5 4 6 4 5 | GCG 10 8 9 8 9 7 | GAG 6 6 4 4 6 5 | GGG 0 0 0 0 0 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_CG13024-PB
position 1: T:0.15351 C:0.20175 A:0.35526 G:0.28947
position 2: T:0.22368 C:0.32018 A:0.26316 G:0.19298
position 3: T:0.18421 C:0.38596 A:0.10526 G:0.32456
Average T:0.18713 C:0.30263 A:0.24123 G:0.26901
#2: D_sechellia_CG13024-PB
position 1: T:0.15789 C:0.20614 A:0.34649 G:0.28947
position 2: T:0.22368 C:0.31579 A:0.26316 G:0.19737
position 3: T:0.17544 C:0.39912 A:0.09649 G:0.32895
Average T:0.18567 C:0.30702 A:0.23538 G:0.27193
#3: D_simulans_CG13024-PB
position 1: T:0.15351 C:0.20614 A:0.35088 G:0.28947
position 2: T:0.22368 C:0.31579 A:0.26316 G:0.19737
position 3: T:0.17982 C:0.39474 A:0.09649 G:0.32895
Average T:0.18567 C:0.30556 A:0.23684 G:0.27193
#4: D_yakuba_CG13024-PB
position 1: T:0.15351 C:0.20614 A:0.35526 G:0.28509
position 2: T:0.22368 C:0.32018 A:0.26316 G:0.19298
position 3: T:0.17544 C:0.41228 A:0.08772 G:0.32456
Average T:0.18421 C:0.31287 A:0.23538 G:0.26754
#5: D_erecta_CG13024-PB
position 1: T:0.14912 C:0.20614 A:0.35965 G:0.28509
position 2: T:0.22368 C:0.31579 A:0.26316 G:0.19737
position 3: T:0.20614 C:0.36842 A:0.09211 G:0.33333
Average T:0.19298 C:0.29678 A:0.23830 G:0.27193
#6: D_takahashii_CG13024-PB
position 1: T:0.14912 C:0.21491 A:0.35965 G:0.27632
position 2: T:0.22368 C:0.32456 A:0.26316 G:0.18860
position 3: T:0.13158 C:0.40789 A:0.08333 G:0.37719
Average T:0.16813 C:0.31579 A:0.23538 G:0.28070
#7: D_biarmipes_CG13024-PB
position 1: T:0.14474 C:0.21930 A:0.34649 G:0.28947
position 2: T:0.22368 C:0.32018 A:0.25877 G:0.19737
position 3: T:0.12281 C:0.43421 A:0.05263 G:0.39035
Average T:0.16374 C:0.32456 A:0.21930 G:0.29240
#8: D_suzukii_CG13024-PB
position 1: T:0.14912 C:0.21491 A:0.35088 G:0.28509
position 2: T:0.22368 C:0.32018 A:0.26316 G:0.19298
position 3: T:0.14035 C:0.40789 A:0.07456 G:0.37719
Average T:0.17105 C:0.31433 A:0.22953 G:0.28509
#9: D_eugracilis_CG13024-PB
position 1: T:0.15351 C:0.21053 A:0.35526 G:0.28070
position 2: T:0.22368 C:0.31579 A:0.26754 G:0.19298
position 3: T:0.17105 C:0.38596 A:0.10088 G:0.34211
Average T:0.18275 C:0.30409 A:0.24123 G:0.27193
#10: D_ficusphila_CG13024-PB
position 1: T:0.15351 C:0.22368 A:0.34211 G:0.28070
position 2: T:0.22368 C:0.32456 A:0.25877 G:0.19298
position 3: T:0.13596 C:0.42544 A:0.10088 G:0.33772
Average T:0.17105 C:0.32456 A:0.23392 G:0.27047
#11: D_rhopaloa_CG13024-PB
position 1: T:0.15351 C:0.20175 A:0.35088 G:0.29386
position 2: T:0.22368 C:0.32018 A:0.26316 G:0.19298
position 3: T:0.17982 C:0.37719 A:0.08772 G:0.35526
Average T:0.18567 C:0.29971 A:0.23392 G:0.28070
#12: D_elegans_CG13024-PB
position 1: T:0.15351 C:0.21053 A:0.35088 G:0.28509
position 2: T:0.22368 C:0.31579 A:0.26754 G:0.19298
position 3: T:0.14912 C:0.39474 A:0.10526 G:0.35088
Average T:0.17544 C:0.30702 A:0.24123 G:0.27632
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 15 | Ser S TCT 6 | Tyr Y TAT 35 | Cys C TGT 0
TTC 21 | TCC 117 | TAC 13 | TGC 12
Leu L TTA 0 | TCA 28 | *** * TAA 0 | *** * TGA 0
TTG 32 | TCG 125 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 1 | Pro P CCT 7 | His H CAT 5 | Arg R CGT 10
CTC 33 | CCC 80 | CAC 56 | CGC 83
CTA 12 | CCA 10 | Gln Q CAA 3 | CGA 2
CTG 125 | CCG 35 | CAG 81 | CGG 32
------------------------------------------------------------------------------
Ile I ATT 27 | Thr T ACT 9 | Asn N AAT 82 | Ser S AGT 77
ATC 74 | ACC 62 | AAC 107 | AGC 148
ATA 8 | ACA 21 | Lys K AAA 43 | Arg R AGA 1
Met M ATG 133 | ACG 43 | AAG 112 | AGG 16
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 68 | Asp D GAT 45 | Gly G GGT 40
GTC 47 | GCC 116 | GAC 60 | GGC 64
GTA 22 | GCA 49 | Glu E GAA 16 | GGA 32
GTG 44 | GCG 97 | GAG 62 | GGG 2
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.15205 C:0.21016 A:0.35197 G:0.28582
position 2: T:0.22368 C:0.31908 A:0.26316 G:0.19408
position 3: T:0.16265 C:0.39949 A:0.09028 G:0.34759
Average T:0.17946 C:0.30958 A:0.23514 G:0.27583
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_CG13024-PB
D_sechellia_CG13024-PB 0.0703 (0.0078 0.1103)
D_simulans_CG13024-PB 0.0310 (0.0039 0.1247) 0.1570 (0.0039 0.0246)
D_yakuba_CG13024-PB 0.0359 (0.0078 0.2157) 0.0328 (0.0058 0.1768) 0.0218 (0.0039 0.1771)
D_erecta_CG13024-PB 0.0521 (0.0117 0.2237) 0.0574 (0.0097 0.1691) 0.0457 (0.0077 0.1694) 0.0309 (0.0039 0.1252)
D_takahashii_CG13024-PB 0.0439 (0.0186 0.4223) 0.0449 (0.0156 0.3474) 0.0370 (0.0136 0.3676) 0.0211 (0.0087 0.4138) 0.0322 (0.0126 0.3928)
D_biarmipes_CG13024-PB 0.0422 (0.0186 0.4404) 0.0453 (0.0156 0.3449) 0.0374 (0.0136 0.3649) 0.0259 (0.0097 0.3750) 0.0345 (0.0136 0.3949) 0.1032 (0.0146 0.1418)
D_suzukii_CG13024-PB 0.0275 (0.0107 0.3896) 0.0251 (0.0078 0.3088) 0.0177 (0.0058 0.3278) 0.0056 (0.0019 0.3470) 0.0159 (0.0058 0.3662) 0.0454 (0.0068 0.1496) 0.0564 (0.0078 0.1377)
D_eugracilis_CG13024-PB 0.0303 (0.0136 0.4495) 0.0301 (0.0117 0.3870) 0.0237 (0.0097 0.4084) 0.0142 (0.0058 0.4087) 0.0190 (0.0077 0.4084) 0.0371 (0.0107 0.2876) 0.0358 (0.0117 0.3262) 0.0187 (0.0039 0.2069)
D_ficusphila_CG13024-PB 0.0497 (0.0256 0.5139) 0.0527 (0.0236 0.4466) 0.0482 (0.0215 0.4475) 0.0423 (0.0176 0.4157) 0.0557 (0.0219 0.3931) 0.0540 (0.0176 0.3260) 0.0447 (0.0117 0.2619) 0.0615 (0.0156 0.2543) 0.0487 (0.0181 0.3716)
D_rhopaloa_CG13024-PB 0.0364 (0.0136 0.3748) 0.0378 (0.0117 0.3090) 0.0296 (0.0097 0.3280) 0.0163 (0.0058 0.3569) 0.0258 (0.0097 0.3763) 0.0510 (0.0146 0.2866) 0.0594 (0.0156 0.2630) 0.0326 (0.0078 0.2386) 0.0367 (0.0117 0.3182) 0.0816 (0.0236 0.2889)
D_elegans_CG13024-PB 0.0260 (0.0107 0.4116) 0.0255 (0.0087 0.3425) 0.0187 (0.0068 0.3626) 0.0063 (0.0029 0.4569) 0.0114 (0.0048 0.4239) 0.0427 (0.0126 0.2963) 0.0458 (0.0127 0.2766) 0.0206 (0.0048 0.2351) 0.0167 (0.0058 0.3475) 0.0568 (0.0196 0.3447) 0.0399 (0.0087 0.2189)
Model 0: one-ratio
TREE # 1: (1, ((4, 5), ((((((6, 7), 8), 9), 10), 12), 11)), (2, 3)); MP score: 234
check convergence..
lnL(ntime: 21 np: 23): -2085.143498 +0.000000
13..1 13..14 14..15 15..4 15..5 14..16 16..17 17..18 18..19 19..20 20..21 21..6 21..7 20..8 19..9 18..10 17..12 16..11 13..22 22..2 22..3
0.067823 0.041707 0.025587 0.046401 0.059002 0.142308 0.027262 0.028047 0.030426 0.022840 0.037110 0.067896 0.090968 0.026747 0.121271 0.189493 0.105057 0.066482 0.017900 0.014214 0.013303 2.206726 0.032704
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.24184
(1: 0.067823, ((4: 0.046401, 5: 0.059002): 0.025587, ((((((6: 0.067896, 7: 0.090968): 0.037110, 8: 0.026747): 0.022840, 9: 0.121271): 0.030426, 10: 0.189493): 0.028047, 12: 0.105057): 0.027262, 11: 0.066482): 0.142308): 0.041707, (2: 0.014214, 3: 0.013303): 0.017900);
(D_melanogaster_CG13024-PB: 0.067823, ((D_yakuba_CG13024-PB: 0.046401, D_erecta_CG13024-PB: 0.059002): 0.025587, ((((((D_takahashii_CG13024-PB: 0.067896, D_biarmipes_CG13024-PB: 0.090968): 0.037110, D_suzukii_CG13024-PB: 0.026747): 0.022840, D_eugracilis_CG13024-PB: 0.121271): 0.030426, D_ficusphila_CG13024-PB: 0.189493): 0.028047, D_elegans_CG13024-PB: 0.105057): 0.027262, D_rhopaloa_CG13024-PB: 0.066482): 0.142308): 0.041707, (D_sechellia_CG13024-PB: 0.014214, D_simulans_CG13024-PB: 0.013303): 0.017900);
Detailed output identifying parameters
kappa (ts/tv) = 2.20673
omega (dN/dS) = 0.03270
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.068 536.9 147.1 0.0327 0.0031 0.0939 1.6 13.8
13..14 0.042 536.9 147.1 0.0327 0.0019 0.0577 1.0 8.5
14..15 0.026 536.9 147.1 0.0327 0.0012 0.0354 0.6 5.2
15..4 0.046 536.9 147.1 0.0327 0.0021 0.0642 1.1 9.5
15..5 0.059 536.9 147.1 0.0327 0.0027 0.0817 1.4 12.0
14..16 0.142 536.9 147.1 0.0327 0.0064 0.1970 3.5 29.0
16..17 0.027 536.9 147.1 0.0327 0.0012 0.0377 0.7 5.6
17..18 0.028 536.9 147.1 0.0327 0.0013 0.0388 0.7 5.7
18..19 0.030 536.9 147.1 0.0327 0.0014 0.0421 0.7 6.2
19..20 0.023 536.9 147.1 0.0327 0.0010 0.0316 0.6 4.7
20..21 0.037 536.9 147.1 0.0327 0.0017 0.0514 0.9 7.6
21..6 0.068 536.9 147.1 0.0327 0.0031 0.0940 1.7 13.8
21..7 0.091 536.9 147.1 0.0327 0.0041 0.1260 2.2 18.5
20..8 0.027 536.9 147.1 0.0327 0.0012 0.0370 0.7 5.4
19..9 0.121 536.9 147.1 0.0327 0.0055 0.1679 2.9 24.7
18..10 0.189 536.9 147.1 0.0327 0.0086 0.2624 4.6 38.6
17..12 0.105 536.9 147.1 0.0327 0.0048 0.1455 2.6 21.4
16..11 0.066 536.9 147.1 0.0327 0.0030 0.0920 1.6 13.5
13..22 0.018 536.9 147.1 0.0327 0.0008 0.0248 0.4 3.6
22..2 0.014 536.9 147.1 0.0327 0.0006 0.0197 0.3 2.9
22..3 0.013 536.9 147.1 0.0327 0.0006 0.0184 0.3 2.7
tree length for dN: 0.0562
tree length for dS: 1.7194
Time used: 0:25
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, ((4, 5), ((((((6, 7), 8), 9), 10), 12), 11)), (2, 3)); MP score: 234
lnL(ntime: 21 np: 24): -2075.381039 +0.000000
13..1 13..14 14..15 15..4 15..5 14..16 16..17 17..18 18..19 19..20 20..21 21..6 21..7 20..8 19..9 18..10 17..12 16..11 13..22 22..2 22..3
0.067689 0.041210 0.025846 0.046196 0.059414 0.142228 0.027057 0.027943 0.030139 0.023048 0.037154 0.067869 0.090800 0.026648 0.121335 0.192224 0.105480 0.066317 0.017941 0.014111 0.013329 2.222566 0.985747 0.023466
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.24398
(1: 0.067689, ((4: 0.046196, 5: 0.059414): 0.025846, ((((((6: 0.067869, 7: 0.090800): 0.037154, 8: 0.026648): 0.023048, 9: 0.121335): 0.030139, 10: 0.192224): 0.027943, 12: 0.105480): 0.027057, 11: 0.066317): 0.142228): 0.041210, (2: 0.014111, 3: 0.013329): 0.017941);
(D_melanogaster_CG13024-PB: 0.067689, ((D_yakuba_CG13024-PB: 0.046196, D_erecta_CG13024-PB: 0.059414): 0.025846, ((((((D_takahashii_CG13024-PB: 0.067869, D_biarmipes_CG13024-PB: 0.090800): 0.037154, D_suzukii_CG13024-PB: 0.026648): 0.023048, D_eugracilis_CG13024-PB: 0.121335): 0.030139, D_ficusphila_CG13024-PB: 0.192224): 0.027943, D_elegans_CG13024-PB: 0.105480): 0.027057, D_rhopaloa_CG13024-PB: 0.066317): 0.142228): 0.041210, (D_sechellia_CG13024-PB: 0.014111, D_simulans_CG13024-PB: 0.013329): 0.017941);
Detailed output identifying parameters
kappa (ts/tv) = 2.22257
dN/dS (w) for site classes (K=2)
p: 0.98575 0.01425
w: 0.02347 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.068 536.8 147.2 0.0374 0.0034 0.0923 1.9 13.6
13..14 0.041 536.8 147.2 0.0374 0.0021 0.0562 1.1 8.3
14..15 0.026 536.8 147.2 0.0374 0.0013 0.0352 0.7 5.2
15..4 0.046 536.8 147.2 0.0374 0.0024 0.0630 1.3 9.3
15..5 0.059 536.8 147.2 0.0374 0.0030 0.0810 1.6 11.9
14..16 0.142 536.8 147.2 0.0374 0.0072 0.1939 3.9 28.5
16..17 0.027 536.8 147.2 0.0374 0.0014 0.0369 0.7 5.4
17..18 0.028 536.8 147.2 0.0374 0.0014 0.0381 0.8 5.6
18..19 0.030 536.8 147.2 0.0374 0.0015 0.0411 0.8 6.0
19..20 0.023 536.8 147.2 0.0374 0.0012 0.0314 0.6 4.6
20..21 0.037 536.8 147.2 0.0374 0.0019 0.0506 1.0 7.5
21..6 0.068 536.8 147.2 0.0374 0.0035 0.0925 1.9 13.6
21..7 0.091 536.8 147.2 0.0374 0.0046 0.1238 2.5 18.2
20..8 0.027 536.8 147.2 0.0374 0.0014 0.0363 0.7 5.3
19..9 0.121 536.8 147.2 0.0374 0.0062 0.1654 3.3 24.3
18..10 0.192 536.8 147.2 0.0374 0.0098 0.2620 5.3 38.6
17..12 0.105 536.8 147.2 0.0374 0.0054 0.1438 2.9 21.2
16..11 0.066 536.8 147.2 0.0374 0.0034 0.0904 1.8 13.3
13..22 0.018 536.8 147.2 0.0374 0.0009 0.0245 0.5 3.6
22..2 0.014 536.8 147.2 0.0374 0.0007 0.0192 0.4 2.8
22..3 0.013 536.8 147.2 0.0374 0.0007 0.0182 0.4 2.7
Time used: 1:09
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, ((4, 5), ((((((6, 7), 8), 9), 10), 12), 11)), (2, 3)); MP score: 234
lnL(ntime: 21 np: 26): -2075.381039 +0.000000
13..1 13..14 14..15 15..4 15..5 14..16 16..17 17..18 18..19 19..20 20..21 21..6 21..7 20..8 19..9 18..10 17..12 16..11 13..22 22..2 22..3
0.067689 0.041210 0.025846 0.046196 0.059414 0.142228 0.027057 0.027943 0.030139 0.023048 0.037154 0.067869 0.090800 0.026648 0.121335 0.192224 0.105480 0.066317 0.017941 0.014111 0.013329 2.222565 0.985747 0.014253 0.023466 60.476650
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.24398
(1: 0.067689, ((4: 0.046196, 5: 0.059414): 0.025846, ((((((6: 0.067869, 7: 0.090800): 0.037154, 8: 0.026648): 0.023048, 9: 0.121335): 0.030139, 10: 0.192224): 0.027943, 12: 0.105480): 0.027057, 11: 0.066317): 0.142228): 0.041210, (2: 0.014111, 3: 0.013329): 0.017941);
(D_melanogaster_CG13024-PB: 0.067689, ((D_yakuba_CG13024-PB: 0.046196, D_erecta_CG13024-PB: 0.059414): 0.025846, ((((((D_takahashii_CG13024-PB: 0.067869, D_biarmipes_CG13024-PB: 0.090800): 0.037154, D_suzukii_CG13024-PB: 0.026648): 0.023048, D_eugracilis_CG13024-PB: 0.121335): 0.030139, D_ficusphila_CG13024-PB: 0.192224): 0.027943, D_elegans_CG13024-PB: 0.105480): 0.027057, D_rhopaloa_CG13024-PB: 0.066317): 0.142228): 0.041210, (D_sechellia_CG13024-PB: 0.014111, D_simulans_CG13024-PB: 0.013329): 0.017941);
Detailed output identifying parameters
kappa (ts/tv) = 2.22257
dN/dS (w) for site classes (K=3)
p: 0.98575 0.01425 0.00000
w: 0.02347 1.00000 60.47665
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.068 536.8 147.2 0.0374 0.0034 0.0923 1.9 13.6
13..14 0.041 536.8 147.2 0.0374 0.0021 0.0562 1.1 8.3
14..15 0.026 536.8 147.2 0.0374 0.0013 0.0352 0.7 5.2
15..4 0.046 536.8 147.2 0.0374 0.0024 0.0630 1.3 9.3
15..5 0.059 536.8 147.2 0.0374 0.0030 0.0810 1.6 11.9
14..16 0.142 536.8 147.2 0.0374 0.0072 0.1939 3.9 28.5
16..17 0.027 536.8 147.2 0.0374 0.0014 0.0369 0.7 5.4
17..18 0.028 536.8 147.2 0.0374 0.0014 0.0381 0.8 5.6
18..19 0.030 536.8 147.2 0.0374 0.0015 0.0411 0.8 6.0
19..20 0.023 536.8 147.2 0.0374 0.0012 0.0314 0.6 4.6
20..21 0.037 536.8 147.2 0.0374 0.0019 0.0506 1.0 7.5
21..6 0.068 536.8 147.2 0.0374 0.0035 0.0925 1.9 13.6
21..7 0.091 536.8 147.2 0.0374 0.0046 0.1238 2.5 18.2
20..8 0.027 536.8 147.2 0.0374 0.0014 0.0363 0.7 5.3
19..9 0.121 536.8 147.2 0.0374 0.0062 0.1654 3.3 24.3
18..10 0.192 536.8 147.2 0.0374 0.0098 0.2620 5.3 38.6
17..12 0.105 536.8 147.2 0.0374 0.0054 0.1438 2.9 21.2
16..11 0.066 536.8 147.2 0.0374 0.0034 0.0904 1.8 13.3
13..22 0.018 536.8 147.2 0.0374 0.0009 0.0245 0.5 3.6
22..2 0.014 536.8 147.2 0.0374 0.0007 0.0192 0.4 2.8
22..3 0.013 536.8 147.2 0.0374 0.0007 0.0182 0.4 2.7
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG13024-PB)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.336 0.129 0.083 0.070 0.066 0.064 0.063 0.063 0.063 0.062
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
sum of density on p0-p1 = 1.000000
Time used: 2:59
Model 3: discrete (3 categories)
TREE # 1: (1, ((4, 5), ((((((6, 7), 8), 9), 10), 12), 11)), (2, 3)); MP score: 234
lnL(ntime: 21 np: 27): -2072.665669 +0.000000
13..1 13..14 14..15 15..4 15..5 14..16 16..17 17..18 18..19 19..20 20..21 21..6 21..7 20..8 19..9 18..10 17..12 16..11 13..22 22..2 22..3
0.067476 0.041310 0.025710 0.046248 0.059252 0.142331 0.027161 0.027851 0.030188 0.023094 0.037069 0.067733 0.090828 0.026600 0.121246 0.192723 0.105597 0.066238 0.017844 0.014085 0.013244 2.207012 0.742889 0.251307 0.000001 0.107428 1.265264
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.24383
(1: 0.067476, ((4: 0.046248, 5: 0.059252): 0.025710, ((((((6: 0.067733, 7: 0.090828): 0.037069, 8: 0.026600): 0.023094, 9: 0.121246): 0.030188, 10: 0.192723): 0.027851, 12: 0.105597): 0.027161, 11: 0.066238): 0.142331): 0.041310, (2: 0.014085, 3: 0.013244): 0.017844);
(D_melanogaster_CG13024-PB: 0.067476, ((D_yakuba_CG13024-PB: 0.046248, D_erecta_CG13024-PB: 0.059252): 0.025710, ((((((D_takahashii_CG13024-PB: 0.067733, D_biarmipes_CG13024-PB: 0.090828): 0.037069, D_suzukii_CG13024-PB: 0.026600): 0.023094, D_eugracilis_CG13024-PB: 0.121246): 0.030188, D_ficusphila_CG13024-PB: 0.192723): 0.027851, D_elegans_CG13024-PB: 0.105597): 0.027161, D_rhopaloa_CG13024-PB: 0.066238): 0.142331): 0.041310, (D_sechellia_CG13024-PB: 0.014085, D_simulans_CG13024-PB: 0.013244): 0.017844);
Detailed output identifying parameters
kappa (ts/tv) = 2.20701
dN/dS (w) for site classes (K=3)
p: 0.74289 0.25131 0.00580
w: 0.00000 0.10743 1.26526
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.067 536.9 147.1 0.0343 0.0032 0.0929 1.7 13.7
13..14 0.041 536.9 147.1 0.0343 0.0020 0.0569 1.0 8.4
14..15 0.026 536.9 147.1 0.0343 0.0012 0.0354 0.7 5.2
15..4 0.046 536.9 147.1 0.0343 0.0022 0.0637 1.2 9.4
15..5 0.059 536.9 147.1 0.0343 0.0028 0.0816 1.5 12.0
14..16 0.142 536.9 147.1 0.0343 0.0067 0.1960 3.6 28.8
16..17 0.027 536.9 147.1 0.0343 0.0013 0.0374 0.7 5.5
17..18 0.028 536.9 147.1 0.0343 0.0013 0.0384 0.7 5.6
18..19 0.030 536.9 147.1 0.0343 0.0014 0.0416 0.8 6.1
19..20 0.023 536.9 147.1 0.0343 0.0011 0.0318 0.6 4.7
20..21 0.037 536.9 147.1 0.0343 0.0018 0.0511 0.9 7.5
21..6 0.068 536.9 147.1 0.0343 0.0032 0.0933 1.7 13.7
21..7 0.091 536.9 147.1 0.0343 0.0043 0.1251 2.3 18.4
20..8 0.027 536.9 147.1 0.0343 0.0013 0.0366 0.7 5.4
19..9 0.121 536.9 147.1 0.0343 0.0057 0.1670 3.1 24.6
18..10 0.193 536.9 147.1 0.0343 0.0091 0.2654 4.9 39.0
17..12 0.106 536.9 147.1 0.0343 0.0050 0.1454 2.7 21.4
16..11 0.066 536.9 147.1 0.0343 0.0031 0.0912 1.7 13.4
13..22 0.018 536.9 147.1 0.0343 0.0008 0.0246 0.5 3.6
22..2 0.014 536.9 147.1 0.0343 0.0007 0.0194 0.4 2.9
22..3 0.013 536.9 147.1 0.0343 0.0006 0.0182 0.3 2.7
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG13024-PB)
Pr(w>1) post mean +- SE for w
147 A 0.993** 1.257
Time used: 4:09
Model 7: beta (10 categories)
TREE # 1: (1, ((4, 5), ((((((6, 7), 8), 9), 10), 12), 11)), (2, 3)); MP score: 234
lnL(ntime: 21 np: 24): -2074.670976 +0.000000
13..1 13..14 14..15 15..4 15..5 14..16 16..17 17..18 18..19 19..20 20..21 21..6 21..7 20..8 19..9 18..10 17..12 16..11 13..22 22..2 22..3
0.067846 0.041337 0.025823 0.046293 0.059127 0.142677 0.027404 0.027783 0.030557 0.022921 0.037346 0.068076 0.091307 0.026786 0.121892 0.191877 0.105583 0.066458 0.017981 0.014153 0.013351 2.215045 0.104051 2.484540
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.24658
(1: 0.067846, ((4: 0.046293, 5: 0.059127): 0.025823, ((((((6: 0.068076, 7: 0.091307): 0.037346, 8: 0.026786): 0.022921, 9: 0.121892): 0.030557, 10: 0.191877): 0.027783, 12: 0.105583): 0.027404, 11: 0.066458): 0.142677): 0.041337, (2: 0.014153, 3: 0.013351): 0.017981);
(D_melanogaster_CG13024-PB: 0.067846, ((D_yakuba_CG13024-PB: 0.046293, D_erecta_CG13024-PB: 0.059127): 0.025823, ((((((D_takahashii_CG13024-PB: 0.068076, D_biarmipes_CG13024-PB: 0.091307): 0.037346, D_suzukii_CG13024-PB: 0.026786): 0.022921, D_eugracilis_CG13024-PB: 0.121892): 0.030557, D_ficusphila_CG13024-PB: 0.191877): 0.027783, D_elegans_CG13024-PB: 0.105583): 0.027404, D_rhopaloa_CG13024-PB: 0.066458): 0.142677): 0.041337, (D_sechellia_CG13024-PB: 0.014153, D_simulans_CG13024-PB: 0.013351): 0.017981);
Detailed output identifying parameters
kappa (ts/tv) = 2.21504
Parameters in M7 (beta):
p = 0.10405 q = 2.48454
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00001 0.00014 0.00095 0.00475 0.01915 0.06807 0.25283
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.068 536.8 147.2 0.0346 0.0032 0.0933 1.7 13.7
13..14 0.041 536.8 147.2 0.0346 0.0020 0.0569 1.1 8.4
14..15 0.026 536.8 147.2 0.0346 0.0012 0.0355 0.7 5.2
15..4 0.046 536.8 147.2 0.0346 0.0022 0.0637 1.2 9.4
15..5 0.059 536.8 147.2 0.0346 0.0028 0.0813 1.5 12.0
14..16 0.143 536.8 147.2 0.0346 0.0068 0.1963 3.6 28.9
16..17 0.027 536.8 147.2 0.0346 0.0013 0.0377 0.7 5.5
17..18 0.028 536.8 147.2 0.0346 0.0013 0.0382 0.7 5.6
18..19 0.031 536.8 147.2 0.0346 0.0015 0.0420 0.8 6.2
19..20 0.023 536.8 147.2 0.0346 0.0011 0.0315 0.6 4.6
20..21 0.037 536.8 147.2 0.0346 0.0018 0.0514 1.0 7.6
21..6 0.068 536.8 147.2 0.0346 0.0032 0.0937 1.7 13.8
21..7 0.091 536.8 147.2 0.0346 0.0043 0.1256 2.3 18.5
20..8 0.027 536.8 147.2 0.0346 0.0013 0.0369 0.7 5.4
19..9 0.122 536.8 147.2 0.0346 0.0058 0.1677 3.1 24.7
18..10 0.192 536.8 147.2 0.0346 0.0091 0.2640 4.9 38.8
17..12 0.106 536.8 147.2 0.0346 0.0050 0.1453 2.7 21.4
16..11 0.066 536.8 147.2 0.0346 0.0032 0.0914 1.7 13.5
13..22 0.018 536.8 147.2 0.0346 0.0009 0.0247 0.5 3.6
22..2 0.014 536.8 147.2 0.0346 0.0007 0.0195 0.4 2.9
22..3 0.013 536.8 147.2 0.0346 0.0006 0.0184 0.3 2.7
Time used: 7:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, ((4, 5), ((((((6, 7), 8), 9), 10), 12), 11)), (2, 3)); MP score: 234
lnL(ntime: 21 np: 26): -2072.868930 +0.000000
13..1 13..14 14..15 15..4 15..5 14..16 16..17 17..18 18..19 19..20 20..21 21..6 21..7 20..8 19..9 18..10 17..12 16..11 13..22 22..2 22..3
0.067484 0.041259 0.025729 0.046219 0.059247 0.142287 0.027134 0.027852 0.030172 0.023078 0.037070 0.067733 0.090802 0.026595 0.121236 0.192664 0.105550 0.066230 0.017850 0.014079 0.013252 2.207680 0.994144 0.184120 5.859180 1.248917
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.24352
(1: 0.067484, ((4: 0.046219, 5: 0.059247): 0.025729, ((((((6: 0.067733, 7: 0.090802): 0.037070, 8: 0.026595): 0.023078, 9: 0.121236): 0.030172, 10: 0.192664): 0.027852, 12: 0.105550): 0.027134, 11: 0.066230): 0.142287): 0.041259, (2: 0.014079, 3: 0.013252): 0.017850);
(D_melanogaster_CG13024-PB: 0.067484, ((D_yakuba_CG13024-PB: 0.046219, D_erecta_CG13024-PB: 0.059247): 0.025729, ((((((D_takahashii_CG13024-PB: 0.067733, D_biarmipes_CG13024-PB: 0.090802): 0.037070, D_suzukii_CG13024-PB: 0.026595): 0.023078, D_eugracilis_CG13024-PB: 0.121236): 0.030172, D_ficusphila_CG13024-PB: 0.192664): 0.027852, D_elegans_CG13024-PB: 0.105550): 0.027134, D_rhopaloa_CG13024-PB: 0.066230): 0.142287): 0.041259, (D_sechellia_CG13024-PB: 0.014079, D_simulans_CG13024-PB: 0.013252): 0.017850);
Detailed output identifying parameters
kappa (ts/tv) = 2.20768
Parameters in M8 (beta&w>1):
p0 = 0.99414 p = 0.18412 q = 5.85918
(p1 = 0.00586) w = 1.24892
dN/dS (w) for site classes (K=11)
p: 0.09941 0.09941 0.09941 0.09941 0.09941 0.09941 0.09941 0.09941 0.09941 0.09941 0.00586
w: 0.00000 0.00000 0.00006 0.00040 0.00156 0.00469 0.01196 0.02771 0.06256 0.16245 1.24892
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.067 536.9 147.1 0.0343 0.0032 0.0930 1.7 13.7
13..14 0.041 536.9 147.1 0.0343 0.0019 0.0568 1.0 8.4
14..15 0.026 536.9 147.1 0.0343 0.0012 0.0354 0.7 5.2
15..4 0.046 536.9 147.1 0.0343 0.0022 0.0637 1.2 9.4
15..5 0.059 536.9 147.1 0.0343 0.0028 0.0816 1.5 12.0
14..16 0.142 536.9 147.1 0.0343 0.0067 0.1960 3.6 28.8
16..17 0.027 536.9 147.1 0.0343 0.0013 0.0374 0.7 5.5
17..18 0.028 536.9 147.1 0.0343 0.0013 0.0384 0.7 5.6
18..19 0.030 536.9 147.1 0.0343 0.0014 0.0416 0.8 6.1
19..20 0.023 536.9 147.1 0.0343 0.0011 0.0318 0.6 4.7
20..21 0.037 536.9 147.1 0.0343 0.0018 0.0511 0.9 7.5
21..6 0.068 536.9 147.1 0.0343 0.0032 0.0933 1.7 13.7
21..7 0.091 536.9 147.1 0.0343 0.0043 0.1251 2.3 18.4
20..8 0.027 536.9 147.1 0.0343 0.0013 0.0366 0.7 5.4
19..9 0.121 536.9 147.1 0.0343 0.0057 0.1670 3.1 24.6
18..10 0.193 536.9 147.1 0.0343 0.0091 0.2654 4.9 39.0
17..12 0.106 536.9 147.1 0.0343 0.0050 0.1454 2.7 21.4
16..11 0.066 536.9 147.1 0.0343 0.0031 0.0912 1.7 13.4
13..22 0.018 536.9 147.1 0.0343 0.0008 0.0246 0.5 3.6
22..2 0.014 536.9 147.1 0.0343 0.0007 0.0194 0.4 2.9
22..3 0.013 536.9 147.1 0.0343 0.0006 0.0183 0.3 2.7
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG13024-PB)
Pr(w>1) post mean +- SE for w
147 A 0.980* 1.227
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG13024-PB)
Pr(w>1) post mean +- SE for w
147 A 0.631 1.545 +- 1.157
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.000 0.000 0.000 0.004 0.034 0.193 0.768
ws: 0.505 0.158 0.074 0.049 0.040 0.037 0.035 0.034 0.034 0.033
Time used: 12:55
Model 1: NearlyNeutral -2075.381039 Model 2: PositiveSelection -2075.381039 Model 0: one-ratio -2085.143498 Model 3: discrete -2072.665669 Model 7: beta -2074.670976 Model 8: beta&w>1 -2072.86893 Model 0 vs 1 19.52491800000007 Model 2 vs 1 0.0 Model 8 vs 7 3.604091999999582
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
