--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Tue Nov 29 16:16:25 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/59/CG13022-PB/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/59/CG13022-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/59/CG13022-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/59/CG13022-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1383.16 -1392.46
2 -1383.16 -1395.53
--------------------------------------
TOTAL -1383.16 -1394.88
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/59/CG13022-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/59/CG13022-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/59/CG13022-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.243180 0.001154 0.182205 0.312728 0.240276 1453.05 1477.02 1.000
r(A<->C){all} 0.107085 0.001244 0.042878 0.174052 0.104374 839.81 855.15 1.001
r(A<->G){all} 0.264706 0.002911 0.164727 0.369796 0.260424 549.52 791.40 1.000
r(A<->T){all} 0.116909 0.001412 0.048832 0.190788 0.113173 824.24 891.24 1.000
r(C<->G){all} 0.093312 0.001074 0.029985 0.152797 0.090665 994.19 997.83 1.000
r(C<->T){all} 0.266609 0.003103 0.155766 0.371185 0.262406 826.46 886.53 1.000
r(G<->T){all} 0.151379 0.001758 0.072492 0.232150 0.147984 955.15 1025.42 1.001
pi(A){all} 0.253749 0.000271 0.223848 0.286440 0.253493 1313.62 1333.47 1.000
pi(C){all} 0.263861 0.000280 0.230819 0.296913 0.263651 1352.26 1369.02 1.000
pi(G){all} 0.262425 0.000280 0.228771 0.294624 0.262249 1178.46 1296.39 1.000
pi(T){all} 0.219964 0.000261 0.189470 0.252169 0.219840 1196.86 1204.01 1.000
alpha{1,2} 0.127184 0.013124 0.000102 0.336323 0.101083 890.39 1073.06 1.000
alpha{3} 1.310203 0.445173 0.302480 2.582717 1.178156 1501.00 1501.00 1.000
pinvar{all} 0.254025 0.018564 0.001211 0.487918 0.249926 1061.47 1104.20 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1332.932331
Model 2: PositiveSelection -1325.865209
Model 0: one-ratio -1348.683768
Model 3: discrete -1325.609963
Model 7: beta -1332.973292
Model 8: beta&w>1 -1325.723554
Model 0 vs 1 31.502874000000247
Model 2 vs 1 14.134243999999853
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG13022-PB)
Pr(w>1) post mean +- SE for w
5 F 0.946 9.424
43 K 0.983* 9.752
91 A 0.941 9.374
95 L 0.970* 9.631
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG13022-PB)
Pr(w>1) post mean +- SE for w
5 F 0.966* 7.298 +- 2.324
43 K 0.986* 7.429 +- 2.164
91 A 0.963* 7.276 +- 2.350
95 L 0.973* 7.354 +- 2.271
Model 8 vs 7 14.499475999999959
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG13022-PB)
Pr(w>1) post mean +- SE for w
5 F 0.965* 9.320
43 K 0.990* 9.532
91 A 0.962* 9.288
95 L 0.979* 9.437
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG13022-PB)
Pr(w>1) post mean +- SE for w
5 F 0.988* 6.716 +- 2.122
10 I 0.554 3.875 +- 3.260
43 K 0.995** 6.757 +- 2.070
91 A 0.987* 6.709 +- 2.130
95 L 0.988* 6.721 +- 2.123
>C1
MLVLFIASLIVSCAQGAQVYMQFNGQGYSYNTDGDRLDRSVVKPSFGASS
LDSFGPLNFVHQSLRTRQNPLSRISYNTQDNLAVATSSLSAGYQLASTNH
LKHRQSQQNFDFSTDQMSHAQHTDEAGNVLGKYSYYDEAGYHELSYKAGA
GIGFVVMGGNLAKATTAAEPHSEIEIGNGIQTNALTSLQELHKYRGYTo
>C2
MLVLWIASLIVSCAQGAQVYMQFNGQGYSYNTDGDRLDRSVVTPTFGASS
LDSFAPLNFVHQALRTRQNPLARISYNTQNNLAVATSSLSRGYQIAATNH
LKPLQSHQNFDFSTDQMSHAQHTDEAGNVLGKYSYYDEAGYHELSYKAGA
GIGFVVMGGNLAKATAAEPHSEIEIGNGIQTNALTSLQELHKYRGYToo
>C3
MLVLLIASLIVSCAHGAQVYMQFNGQGYSYNTDGDRLDRSVVSPRFGASS
LDSFGPLNFVHQALRTRQNPLARISYNTQDNLAVATSSLSGGYQLAPTNH
LKPLQSHQNFDFSTDQMSHAQHTDEAGNVLGKYSYYDEAGYHELSYKAGA
GIGFVVMGGNLAKATAAEPHSEIEIGNGIQTNALTSLQELHKYRGYToo
>C4
MLVLGIALLAVSCAQGAQVYMQFNGQGYSYNTDGDRLDRSVVSPSFRASS
LDSFGPLNFVQQALRTRHSPLPRISYNPAQDNLAEATSLLSRGYQVAPTN
QLKPLQSHRNFDFSTDQMSHAQHTDEAGNVLGKYSYYDEAGYHELSYKAG
AGIGFVVMGGNLAKATAAEPHSEIEIGNGIQTNALTGLQELHKYRGYTo
>C5
MLLLWMALLTVSCAQGAQVYMQFNGQGYSYNTDGDRLDRSVVAPSFVASS
LDAFGPLNFVQQALRTRHHPLPRISYNAQDNLAEATSLLSSGYQAAPTNQ
LKPLQRHQNFDFSTDQMSHAQHTDEAGNVLGKYSYYDEAGYHELSYKAGA
GIGFVVMGGNLAKASAAEPHSEIGIGIGNGIHTNALTSLPELHKYRGYT
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=203
C1 MLVLFIASLIVSCAQGAQVYMQFNGQGYSYNTDGDRLDRSVVKPSFGASS
C2 MLVLWIASLIVSCAQGAQVYMQFNGQGYSYNTDGDRLDRSVVTPTFGASS
C3 MLVLLIASLIVSCAHGAQVYMQFNGQGYSYNTDGDRLDRSVVSPRFGASS
C4 MLVLGIALLAVSCAQGAQVYMQFNGQGYSYNTDGDRLDRSVVSPSFRASS
C5 MLLLWMALLTVSCAQGAQVYMQFNGQGYSYNTDGDRLDRSVVAPSFVASS
**:* :* * ****:*************************** * * ***
C1 LDSFGPLNFVHQSLRTRQNPLSRISYN-TQDNLAVATSSLSAGYQLASTN
C2 LDSFAPLNFVHQALRTRQNPLARISYN-TQNNLAVATSSLSRGYQIAATN
C3 LDSFGPLNFVHQALRTRQNPLARISYN-TQDNLAVATSSLSGGYQLAPTN
C4 LDSFGPLNFVQQALRTRHSPLPRISYNPAQDNLAEATSLLSRGYQVAPTN
C5 LDAFGPLNFVQQALRTRHHPLPRISYN-AQDNLAEATSLLSSGYQAAPTN
**:*.*****:*:****: **.***** :*:*** *** ** *** *.**
C1 HLKHRQSQQNFDFSTDQMSHAQHTDEAGNVLGKYSYYDEAGYHELSYKAG
C2 HLKPLQSHQNFDFSTDQMSHAQHTDEAGNVLGKYSYYDEAGYHELSYKAG
C3 HLKPLQSHQNFDFSTDQMSHAQHTDEAGNVLGKYSYYDEAGYHELSYKAG
C4 QLKPLQSHRNFDFSTDQMSHAQHTDEAGNVLGKYSYYDEAGYHELSYKAG
C5 QLKPLQRHQNFDFSTDQMSHAQHTDEAGNVLGKYSYYDEAGYHELSYKAG
:** * ::*****************************************
C1 AGIGFVVMGGNLAKATTAAEPHSEIEIG--NGIQTNALTSLQELHKYRGY
C2 AGIGFVVMGGNLAKAT-AAEPHSEIEIG--NGIQTNALTSLQELHKYRGY
C3 AGIGFVVMGGNLAKAT-AAEPHSEIEIG--NGIQTNALTSLQELHKYRGY
C4 AGIGFVVMGGNLAKAT-AAEPHSEIEIG--NGIQTNALTGLQELHKYRGY
C5 AGIGFVVMGGNLAKAS-AAEPHSEIGIGIGNGIHTNALTSLPELHKYRGY
***************: ******** ** ***:*****.* ********
C1 To-
C2 Too
C3 Too
C4 To-
C5 T--
*
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 199 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 199 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4128]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [4128]--->[4110]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/59/CG13022-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.272 Mb, Max= 30.515 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MLVLFIASLIVSCAQGAQVYMQFNGQGYSYNTDGDRLDRSVVKPSFGASS
LDSFGPLNFVHQSLRTRQNPLSRISYN-TQDNLAVATSSLSAGYQLASTN
HLKHRQSQQNFDFSTDQMSHAQHTDEAGNVLGKYSYYDEAGYHELSYKAG
AGIGFVVMGGNLAKATTAAEPHSEIEIG--NGIQTNALTSLQELHKYRGY
To-
>C2
MLVLWIASLIVSCAQGAQVYMQFNGQGYSYNTDGDRLDRSVVTPTFGASS
LDSFAPLNFVHQALRTRQNPLARISYN-TQNNLAVATSSLSRGYQIAATN
HLKPLQSHQNFDFSTDQMSHAQHTDEAGNVLGKYSYYDEAGYHELSYKAG
AGIGFVVMGGNLAKAT-AAEPHSEIEIG--NGIQTNALTSLQELHKYRGY
Too
>C3
MLVLLIASLIVSCAHGAQVYMQFNGQGYSYNTDGDRLDRSVVSPRFGASS
LDSFGPLNFVHQALRTRQNPLARISYN-TQDNLAVATSSLSGGYQLAPTN
HLKPLQSHQNFDFSTDQMSHAQHTDEAGNVLGKYSYYDEAGYHELSYKAG
AGIGFVVMGGNLAKAT-AAEPHSEIEIG--NGIQTNALTSLQELHKYRGY
Too
>C4
MLVLGIALLAVSCAQGAQVYMQFNGQGYSYNTDGDRLDRSVVSPSFRASS
LDSFGPLNFVQQALRTRHSPLPRISYNPAQDNLAEATSLLSRGYQVAPTN
QLKPLQSHRNFDFSTDQMSHAQHTDEAGNVLGKYSYYDEAGYHELSYKAG
AGIGFVVMGGNLAKAT-AAEPHSEIEIG--NGIQTNALTGLQELHKYRGY
To-
>C5
MLLLWMALLTVSCAQGAQVYMQFNGQGYSYNTDGDRLDRSVVAPSFVASS
LDAFGPLNFVQQALRTRHHPLPRISYN-AQDNLAEATSLLSSGYQAAPTN
QLKPLQRHQNFDFSTDQMSHAQHTDEAGNVLGKYSYYDEAGYHELSYKAG
AGIGFVVMGGNLAKAS-AAEPHSEIGIGIGNGIHTNALTSLPELHKYRGY
T--
FORMAT of file /tmp/tmp213526514223090635aln Not Supported[FATAL:T-COFFEE]
>C1
MLVLFIASLIVSCAQGAQVYMQFNGQGYSYNTDGDRLDRSVVKPSFGASS
LDSFGPLNFVHQSLRTRQNPLSRISYN-TQDNLAVATSSLSAGYQLASTN
HLKHRQSQQNFDFSTDQMSHAQHTDEAGNVLGKYSYYDEAGYHELSYKAG
AGIGFVVMGGNLAKATTAAEPHSEIEIG--NGIQTNALTSLQELHKYRGY
To-
>C2
MLVLWIASLIVSCAQGAQVYMQFNGQGYSYNTDGDRLDRSVVTPTFGASS
LDSFAPLNFVHQALRTRQNPLARISYN-TQNNLAVATSSLSRGYQIAATN
HLKPLQSHQNFDFSTDQMSHAQHTDEAGNVLGKYSYYDEAGYHELSYKAG
AGIGFVVMGGNLAKAT-AAEPHSEIEIG--NGIQTNALTSLQELHKYRGY
Too
>C3
MLVLLIASLIVSCAHGAQVYMQFNGQGYSYNTDGDRLDRSVVSPRFGASS
LDSFGPLNFVHQALRTRQNPLARISYN-TQDNLAVATSSLSGGYQLAPTN
HLKPLQSHQNFDFSTDQMSHAQHTDEAGNVLGKYSYYDEAGYHELSYKAG
AGIGFVVMGGNLAKAT-AAEPHSEIEIG--NGIQTNALTSLQELHKYRGY
Too
>C4
MLVLGIALLAVSCAQGAQVYMQFNGQGYSYNTDGDRLDRSVVSPSFRASS
LDSFGPLNFVQQALRTRHSPLPRISYNPAQDNLAEATSLLSRGYQVAPTN
QLKPLQSHRNFDFSTDQMSHAQHTDEAGNVLGKYSYYDEAGYHELSYKAG
AGIGFVVMGGNLAKAT-AAEPHSEIEIG--NGIQTNALTGLQELHKYRGY
To-
>C5
MLLLWMALLTVSCAQGAQVYMQFNGQGYSYNTDGDRLDRSVVAPSFVASS
LDAFGPLNFVQQALRTRHHPLPRISYN-AQDNLAEATSLLSSGYQAAPTN
QLKPLQRHQNFDFSTDQMSHAQHTDEAGNVLGKYSYYDEAGYHELSYKAG
AGIGFVVMGGNLAKAS-AAEPHSEIGIGIGNGIHTNALTSLPELHKYRGY
T--
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:203 S:98 BS:203
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES
BOT 0 1 93.43 C1 C2 93.43
TOP 1 0 93.43 C2 C1 93.43
BOT 0 2 94.44 C1 C3 94.44
TOP 2 0 94.44 C3 C1 94.44
BOT 0 3 88.89 C1 C4 88.89
TOP 3 0 88.89 C4 C1 88.89
BOT 0 4 85.79 C1 C5 85.79
TOP 4 0 85.79 C5 C1 85.79
BOT 1 2 95.48 C2 C3 95.48
TOP 2 1 95.48 C3 C2 95.48
BOT 1 3 89.90 C2 C4 89.90
TOP 3 1 89.90 C4 C2 89.90
BOT 1 4 86.80 C2 C5 86.80
TOP 4 1 86.80 C5 C2 86.80
BOT 2 3 90.91 C3 C4 90.91
TOP 3 2 90.91 C4 C3 90.91
BOT 2 4 87.31 C3 C5 87.31
TOP 4 2 87.31 C5 C3 87.31
BOT 3 4 91.37 C4 C5 91.37
TOP 4 3 91.37 C5 C4 91.37
AVG 0 C1 * 90.64
AVG 1 C2 * 91.40
AVG 2 C3 * 92.04
AVG 3 C4 * 90.27
AVG 4 C5 * 87.82
TOT TOT * 90.43
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTTGGTGCTTTTCATTGCTTCGCTGATAGTTTCCTGTGCTCAAGGAGC
C2 ATGTTGGTGCTTTGGATTGCTTCGCTGATAGTTTCCTGTGCTCAAGGAGC
C3 ATGTTGGTGCTTTTGATTGCTTCGCTGATAGTTTCCTGTGCTCATGGAGC
C4 ATGCTGGTGCTCGGGATTGCATTGCTGGCAGTTTCCTGTGCTCAAGGAGC
C5 ATGCTGCTGCTTTGGATGGCATTGCTGACAGTTTCCTGCGCTCAAGGCGC
*** ** **** ** **:* ****. ********* *****:**.**
C1 GCAAGTGTATATGCAGTTCAATGGACAAGGATACTCCTACAACACGGATG
C2 GCAAGTGTATATGCAGTTCAATGGACAAGGATACTCCTACAACACGGATG
C3 GCAAGTGTATATGCAGTTCAATGGACAAGGATACTCCTACAACACGGATG
C4 GCAAGTGTACATGCAGTTCAATGGACAAGGGTACTCCTACAACACGGATG
C5 GCAAGTGTATATGCAGTTCAATGGGCAAGGATACTCCTACAACACGGATG
********* **************.*****.*******************
C1 GCGATAGATTGGATAGGAGTGTCGTTAAGCCTAGTTTTGGGGCATCTTCT
C2 GCGATAGATTGGATAGGAGTGTCGTTACTCCTACTTTTGGGGCATCTTCT
C3 GCGATAGATTGGATAGGAGTGTCGTTTCCCCTAGATTTGGGGCATCTTCT
C4 GCGATAGATTGGACAGGAGTGTCGTTTCCCCCAGCTTTAGGGCATCTTCT
C5 GCGATAGATTGGATAGGAGTGTCGTTGCCCCCAGCTTTGTGGCATCTTCT
************* ************ . ** * ***. **********
C1 CTGGATTCCTTTGGTCCGCTGAACTTTGTGCATCAATCTCTGAGGACAAG
C2 CTGGATTCCTTTGCTCCGCTGAACTTTGTGCATCAGGCTCTGAGAACAAG
C3 CTGGATTCCTTTGGTCCGCTGAACTTTGTGCATCAGGCTCTGAGAACAAG
C4 CTGGATTCCTTTGGGCCACTAAACTTTGTGCAGCAGGCCTTGAGGACAAG
C5 CTGGATGCCTTTGGTCCACTGAACTTTGTGCAGCAGGCCTTGAGGACAAG
****** ****** **.**.*********** **. * ****.*****
C1 ACAGAATCCACTTTCCCGGATTTCCTACAAT---ACACAGGATAACCTAG
C2 GCAAAATCCGCTTGCCAGAATTTCCTACAAC---ACACAGAATAATCTAG
C3 GCAAAATCCGCTTGCCAGAATTTCCTACAAC---ACACAGGATAATCTAG
C4 ACACAGTCCACTTCCCAGGATTTCCTACAATCCTGCACAGGATAATCTGG
C5 GCACCATCCACTGCCCAGGATTTCCTACAAT---GCGCAGGATAATCTGG
.** ..***.** **.*.*********** .*.***.**** **.*
C1 CAGTGGCAACATCTTCGCTGAGTGCGGGCTACCAATTAGCATCGACCAAC
C2 CAGTGGCAACATCCTCGCTAAGTAGGGGCTACCAAATTGCAGCGACCAAC
C3 CAGTGGCAACATCCTCGCTGAGTGGGGGCTACCAACTAGCGCCGACCAAC
C4 CAGAGGCAACTTCCTTGCTGAGTAGAGGCTACCAAGTAGCACCGACCAAT
C5 CGGAGGCAACTTCCTTGCTGAGTAGCGGCTACCAAGCAGCACCGACCAAC
*.*:******:** * ***.***. ********* :**. *******
C1 CACCTGAAGCACCGGCAAAGCCAGCAAAACTTTGATTTCAGCACCGACCA
C2 CACCTGAAGCCCCTGCAAAGCCATCAAAACTTTGATTTCAGCACCGACCA
C3 CACCTGAAGCCCCTGCAAAGCCATCAAAACTTTGATTTCAGCACCGACCA
C4 CAACTGAAGCCGCTGCAAAGCCACCGAAACTTTGATTTCAGCACCGACCA
C5 CAACTGAAGCCCCTGCAAAGACACCAAAACTTTGATTTCAGCACCGACCA
**.*******. * ******.** *.************************
C1 GATGTCGCATGCCCAGCACACCGATGAGGCGGGAAATGTTTTGGGCAAGT
C2 GATGTCGCATGCCCAGCACACCGATGAGGCGGGAAATGTTTTGGGCAAGT
C3 GATGTCGCATGCCCAGCACACCGATGAGGCGGGAAATGTTTTGGGCAAGT
C4 GATGTCGCATGCCCAGCACACCGATGAGGCGGGAAATGTGTTGGGCAAGT
C5 GATGTCGCATGCCCAGCACACCGATGAGGCGGGAAATGTTTTGGGCAAGT
*************************************** **********
C1 ACTCCTACTACGATGAGGCTGGCTACCATGAGCTGAGCTACAAGGCGGGC
C2 ACTCCTACTACGATGAGGCTGGCTACCATGAGCTGAGCTACAAGGCGGGC
C3 ACTCCTACTACGATGAGGCTGGCTACCATGAGCTCAGCTACAAGGCGGGC
C4 ACTCCTACTACGATGAGGCTGGCTACCATGAGCTGAGCTACAAGGCGGGC
C5 ACTCCTACTACGATGAGGCTGGCTACCACGAGCTGAGCTACAAGGCGGGC
**************************** ***** ***************
C1 GCCGGCATCGGATTCGTGGTCATGGGTGGCAATTTGGCCAAGGCCACCAC
C2 GCCGGCATCGGATTCGTGGTCATGGGTGGCAATTTGGCCAAGGCCACC--
C3 GCCGGCATCGGATTCGTGGTCATGGGTGGCAATTTGGCCAAGGCCACC--
C4 GCCGGCATCGGATTCGTGGTCATGGGTGGCAATTTGGCCAAGGCCACC--
C5 GCCGGCATCGGATTCGTGGTCATGGGTGGCAATTTGGCCAAGGCCTCC--
*********************************************:**
C1 CGCCGCTGAACCGCACTCGGAAATCGAAATCGGA------AACGGAATCC
C2 -GCCGCTGAACCGCACTCGGAAATCGAAATCGGA------AACGGAATCC
C3 -GCCGCTGAACCGCACTCGGAAATCGAAATCGGA------AACGGAATCC
C4 -GCCGCCGAACCGCACTCGGAAATAGAAATCGGA------AACGGAATCC
C5 -GCTGCTGAACCGCACTCGGAAATCGGAATCGGAATCGGAAACGGAATCC
** ** *****************.*.******* **********
C1 AAACAAATGCCTTGACTAGCCTGCAAGAGTTGCATAAATATCGTGGCTAC
C2 AAACAAATGCCTTGACAAGCCTGCAAGAGTTGCATAAATATCGTGGCTAC
C3 AAACAAATGCCTTGACAAGCCTGCAAGAGTTGCATAAATATCGTGGCTAC
C4 AAACAAATGCCTTGACAGGCCTGCAAGAGTTGCATAAATATCGTGGCTAC
C5 ACACAAATGCCTTGACTAGCCTGCCAGAGTTGCATAAATATCGTGGCTAC
*.**************:.******.*************************
C1 ACG------
C2 ACG------
C3 ACG------
C4 ACG------
C5 ACG------
***
>C1
ATGTTGGTGCTTTTCATTGCTTCGCTGATAGTTTCCTGTGCTCAAGGAGC
GCAAGTGTATATGCAGTTCAATGGACAAGGATACTCCTACAACACGGATG
GCGATAGATTGGATAGGAGTGTCGTTAAGCCTAGTTTTGGGGCATCTTCT
CTGGATTCCTTTGGTCCGCTGAACTTTGTGCATCAATCTCTGAGGACAAG
ACAGAATCCACTTTCCCGGATTTCCTACAAT---ACACAGGATAACCTAG
CAGTGGCAACATCTTCGCTGAGTGCGGGCTACCAATTAGCATCGACCAAC
CACCTGAAGCACCGGCAAAGCCAGCAAAACTTTGATTTCAGCACCGACCA
GATGTCGCATGCCCAGCACACCGATGAGGCGGGAAATGTTTTGGGCAAGT
ACTCCTACTACGATGAGGCTGGCTACCATGAGCTGAGCTACAAGGCGGGC
GCCGGCATCGGATTCGTGGTCATGGGTGGCAATTTGGCCAAGGCCACCAC
CGCCGCTGAACCGCACTCGGAAATCGAAATCGGA------AACGGAATCC
AAACAAATGCCTTGACTAGCCTGCAAGAGTTGCATAAATATCGTGGCTAC
ACG------
>C2
ATGTTGGTGCTTTGGATTGCTTCGCTGATAGTTTCCTGTGCTCAAGGAGC
GCAAGTGTATATGCAGTTCAATGGACAAGGATACTCCTACAACACGGATG
GCGATAGATTGGATAGGAGTGTCGTTACTCCTACTTTTGGGGCATCTTCT
CTGGATTCCTTTGCTCCGCTGAACTTTGTGCATCAGGCTCTGAGAACAAG
GCAAAATCCGCTTGCCAGAATTTCCTACAAC---ACACAGAATAATCTAG
CAGTGGCAACATCCTCGCTAAGTAGGGGCTACCAAATTGCAGCGACCAAC
CACCTGAAGCCCCTGCAAAGCCATCAAAACTTTGATTTCAGCACCGACCA
GATGTCGCATGCCCAGCACACCGATGAGGCGGGAAATGTTTTGGGCAAGT
ACTCCTACTACGATGAGGCTGGCTACCATGAGCTGAGCTACAAGGCGGGC
GCCGGCATCGGATTCGTGGTCATGGGTGGCAATTTGGCCAAGGCCACC--
-GCCGCTGAACCGCACTCGGAAATCGAAATCGGA------AACGGAATCC
AAACAAATGCCTTGACAAGCCTGCAAGAGTTGCATAAATATCGTGGCTAC
ACG------
>C3
ATGTTGGTGCTTTTGATTGCTTCGCTGATAGTTTCCTGTGCTCATGGAGC
GCAAGTGTATATGCAGTTCAATGGACAAGGATACTCCTACAACACGGATG
GCGATAGATTGGATAGGAGTGTCGTTTCCCCTAGATTTGGGGCATCTTCT
CTGGATTCCTTTGGTCCGCTGAACTTTGTGCATCAGGCTCTGAGAACAAG
GCAAAATCCGCTTGCCAGAATTTCCTACAAC---ACACAGGATAATCTAG
CAGTGGCAACATCCTCGCTGAGTGGGGGCTACCAACTAGCGCCGACCAAC
CACCTGAAGCCCCTGCAAAGCCATCAAAACTTTGATTTCAGCACCGACCA
GATGTCGCATGCCCAGCACACCGATGAGGCGGGAAATGTTTTGGGCAAGT
ACTCCTACTACGATGAGGCTGGCTACCATGAGCTCAGCTACAAGGCGGGC
GCCGGCATCGGATTCGTGGTCATGGGTGGCAATTTGGCCAAGGCCACC--
-GCCGCTGAACCGCACTCGGAAATCGAAATCGGA------AACGGAATCC
AAACAAATGCCTTGACAAGCCTGCAAGAGTTGCATAAATATCGTGGCTAC
ACG------
>C4
ATGCTGGTGCTCGGGATTGCATTGCTGGCAGTTTCCTGTGCTCAAGGAGC
GCAAGTGTACATGCAGTTCAATGGACAAGGGTACTCCTACAACACGGATG
GCGATAGATTGGACAGGAGTGTCGTTTCCCCCAGCTTTAGGGCATCTTCT
CTGGATTCCTTTGGGCCACTAAACTTTGTGCAGCAGGCCTTGAGGACAAG
ACACAGTCCACTTCCCAGGATTTCCTACAATCCTGCACAGGATAATCTGG
CAGAGGCAACTTCCTTGCTGAGTAGAGGCTACCAAGTAGCACCGACCAAT
CAACTGAAGCCGCTGCAAAGCCACCGAAACTTTGATTTCAGCACCGACCA
GATGTCGCATGCCCAGCACACCGATGAGGCGGGAAATGTGTTGGGCAAGT
ACTCCTACTACGATGAGGCTGGCTACCATGAGCTGAGCTACAAGGCGGGC
GCCGGCATCGGATTCGTGGTCATGGGTGGCAATTTGGCCAAGGCCACC--
-GCCGCCGAACCGCACTCGGAAATAGAAATCGGA------AACGGAATCC
AAACAAATGCCTTGACAGGCCTGCAAGAGTTGCATAAATATCGTGGCTAC
ACG------
>C5
ATGCTGCTGCTTTGGATGGCATTGCTGACAGTTTCCTGCGCTCAAGGCGC
GCAAGTGTATATGCAGTTCAATGGGCAAGGATACTCCTACAACACGGATG
GCGATAGATTGGATAGGAGTGTCGTTGCCCCCAGCTTTGTGGCATCTTCT
CTGGATGCCTTTGGTCCACTGAACTTTGTGCAGCAGGCCTTGAGGACAAG
GCACCATCCACTGCCCAGGATTTCCTACAAT---GCGCAGGATAATCTGG
CGGAGGCAACTTCCTTGCTGAGTAGCGGCTACCAAGCAGCACCGACCAAC
CAACTGAAGCCCCTGCAAAGACACCAAAACTTTGATTTCAGCACCGACCA
GATGTCGCATGCCCAGCACACCGATGAGGCGGGAAATGTTTTGGGCAAGT
ACTCCTACTACGATGAGGCTGGCTACCACGAGCTGAGCTACAAGGCGGGC
GCCGGCATCGGATTCGTGGTCATGGGTGGCAATTTGGCCAAGGCCTCC--
-GCTGCTGAACCGCACTCGGAAATCGGAATCGGAATCGGAAACGGAATCC
ACACAAATGCCTTGACTAGCCTGCCAGAGTTGCATAAATATCGTGGCTAC
ACG------
>C1
MLVLFIASLIVSCAQGAQVYMQFNGQGYSYNTDGDRLDRSVVKPSFGASS
LDSFGPLNFVHQSLRTRQNPLSRISYNoTQDNLAVATSSLSAGYQLASTN
HLKHRQSQQNFDFSTDQMSHAQHTDEAGNVLGKYSYYDEAGYHELSYKAG
AGIGFVVMGGNLAKATTAAEPHSEIEIGooNGIQTNALTSLQELHKYRGY
T
>C2
MLVLWIASLIVSCAQGAQVYMQFNGQGYSYNTDGDRLDRSVVTPTFGASS
LDSFAPLNFVHQALRTRQNPLARISYNoTQNNLAVATSSLSRGYQIAATN
HLKPLQSHQNFDFSTDQMSHAQHTDEAGNVLGKYSYYDEAGYHELSYKAG
AGIGFVVMGGNLAKAToAAEPHSEIEIGooNGIQTNALTSLQELHKYRGY
T
>C3
MLVLLIASLIVSCAHGAQVYMQFNGQGYSYNTDGDRLDRSVVSPRFGASS
LDSFGPLNFVHQALRTRQNPLARISYNoTQDNLAVATSSLSGGYQLAPTN
HLKPLQSHQNFDFSTDQMSHAQHTDEAGNVLGKYSYYDEAGYHELSYKAG
AGIGFVVMGGNLAKAToAAEPHSEIEIGooNGIQTNALTSLQELHKYRGY
T
>C4
MLVLGIALLAVSCAQGAQVYMQFNGQGYSYNTDGDRLDRSVVSPSFRASS
LDSFGPLNFVQQALRTRHSPLPRISYNPAQDNLAEATSLLSRGYQVAPTN
QLKPLQSHRNFDFSTDQMSHAQHTDEAGNVLGKYSYYDEAGYHELSYKAG
AGIGFVVMGGNLAKAToAAEPHSEIEIGooNGIQTNALTGLQELHKYRGY
T
>C5
MLLLWMALLTVSCAQGAQVYMQFNGQGYSYNTDGDRLDRSVVAPSFVASS
LDAFGPLNFVQQALRTRHHPLPRISYNoAQDNLAEATSLLSSGYQAAPTN
QLKPLQRHQNFDFSTDQMSHAQHTDEAGNVLGKYSYYDEAGYHELSYKAG
AGIGFVVMGGNLAKASoAAEPHSEIGIGIGNGIHTNALTSLPELHKYRGY
T
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/59/CG13022-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 5 taxa and 609 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1480435917
Setting output file names to "/opt/ADOPS/59/CG13022-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 977574674
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 4006675645
Seed = 1723513880
Swapseed = 1480435917
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 27 unique site patterns
Division 2 has 22 unique site patterns
Division 3 has 48 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1559.502910 -- -25.624409
Chain 2 -- -1630.159736 -- -25.624409
Chain 3 -- -1632.152190 -- -25.624409
Chain 4 -- -1621.095210 -- -25.624409
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1631.615814 -- -25.624409
Chain 2 -- -1605.248586 -- -25.624409
Chain 3 -- -1637.045428 -- -25.624409
Chain 4 -- -1620.111754 -- -25.624409
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1559.503] (-1630.160) (-1632.152) (-1621.095) * [-1631.616] (-1605.249) (-1637.045) (-1620.112)
500 -- (-1398.376) (-1395.638) [-1396.439] (-1401.080) * [-1400.887] (-1399.110) (-1400.085) (-1401.856) -- 0:00:00
1000 -- (-1396.098) (-1397.746) [-1388.389] (-1392.388) * (-1395.381) (-1399.598) (-1395.481) [-1395.230] -- 0:00:00
1500 -- [-1389.128] (-1393.683) (-1385.930) (-1392.779) * (-1392.299) (-1393.171) [-1395.095] (-1392.038) -- 0:00:00
2000 -- [-1382.459] (-1396.423) (-1389.437) (-1391.636) * (-1393.459) (-1390.250) (-1387.864) [-1386.894] -- 0:00:00
2500 -- (-1390.168) (-1386.974) (-1386.138) [-1390.799] * (-1392.353) (-1389.702) (-1390.086) [-1383.250] -- 0:00:00
3000 -- (-1389.768) [-1385.309] (-1390.630) (-1391.263) * (-1390.978) (-1388.025) (-1385.658) [-1383.675] -- 0:00:00
3500 -- [-1391.115] (-1385.493) (-1393.719) (-1393.586) * (-1396.820) [-1384.164] (-1390.122) (-1388.596) -- 0:00:00
4000 -- [-1392.315] (-1385.924) (-1391.917) (-1389.436) * (-1391.326) [-1390.879] (-1396.787) (-1386.533) -- 0:00:00
4500 -- (-1392.066) (-1388.277) (-1386.202) [-1385.202] * [-1385.260] (-1382.270) (-1396.681) (-1384.835) -- 0:03:41
5000 -- (-1392.365) (-1392.999) [-1383.724] (-1388.998) * (-1390.894) [-1382.881] (-1390.182) (-1388.525) -- 0:03:19
Average standard deviation of split frequencies: 0.000000
5500 -- (-1394.655) [-1386.464] (-1382.633) (-1395.064) * (-1387.169) [-1380.597] (-1386.426) (-1388.752) -- 0:03:00
6000 -- [-1384.842] (-1385.523) (-1383.041) (-1393.557) * (-1391.032) (-1384.080) [-1387.219] (-1391.885) -- 0:02:45
6500 -- (-1383.966) [-1384.217] (-1384.878) (-1395.923) * (-1386.751) (-1380.891) [-1384.673] (-1387.884) -- 0:02:32
7000 -- (-1382.945) [-1383.847] (-1386.861) (-1388.139) * [-1389.813] (-1388.669) (-1384.867) (-1385.628) -- 0:02:21
7500 -- [-1382.841] (-1381.340) (-1382.794) (-1387.754) * [-1384.441] (-1390.115) (-1383.923) (-1388.087) -- 0:02:12
8000 -- (-1381.695) (-1385.152) [-1387.190] (-1390.146) * (-1388.146) (-1382.600) (-1387.606) [-1383.574] -- 0:02:04
8500 -- (-1386.972) (-1391.960) (-1383.373) [-1387.086] * [-1385.066] (-1384.275) (-1383.974) (-1383.238) -- 0:01:56
9000 -- [-1382.150] (-1390.445) (-1389.077) (-1386.208) * (-1386.604) (-1383.700) [-1388.152] (-1391.954) -- 0:01:50
9500 -- (-1392.556) (-1391.899) [-1385.721] (-1392.104) * (-1386.030) (-1386.362) (-1390.090) [-1386.478] -- 0:03:28
10000 -- (-1388.091) (-1393.304) [-1385.808] (-1387.541) * (-1388.241) (-1387.510) (-1389.312) [-1382.347] -- 0:03:18
Average standard deviation of split frequencies: 0.000000
10500 -- (-1387.034) (-1385.117) [-1386.313] (-1388.611) * (-1385.267) (-1384.953) (-1395.713) [-1382.698] -- 0:03:08
11000 -- (-1386.272) (-1384.803) (-1384.315) [-1388.873] * (-1383.748) (-1387.243) (-1391.755) [-1383.532] -- 0:02:59
11500 -- (-1385.755) (-1381.524) [-1384.991] (-1387.521) * (-1390.617) (-1384.559) (-1390.341) [-1385.474] -- 0:02:51
12000 -- (-1385.238) (-1383.972) [-1387.786] (-1392.931) * [-1381.779] (-1385.237) (-1394.409) (-1385.248) -- 0:02:44
12500 -- (-1387.124) (-1392.794) (-1386.025) [-1384.889] * (-1386.245) [-1386.155] (-1400.152) (-1383.656) -- 0:02:38
13000 -- (-1389.016) (-1385.746) (-1399.485) [-1386.548] * (-1386.617) [-1389.049] (-1389.318) (-1385.558) -- 0:02:31
13500 -- (-1390.662) (-1383.925) [-1383.199] (-1394.041) * (-1387.023) [-1387.081] (-1389.984) (-1384.568) -- 0:02:26
14000 -- [-1386.800] (-1391.793) (-1389.186) (-1386.051) * (-1392.558) [-1389.730] (-1389.587) (-1387.558) -- 0:02:20
14500 -- (-1392.077) [-1384.191] (-1392.859) (-1393.789) * [-1385.760] (-1384.861) (-1390.131) (-1390.021) -- 0:03:23
15000 -- [-1382.855] (-1388.105) (-1389.179) (-1386.475) * (-1386.510) (-1381.641) [-1384.118] (-1388.197) -- 0:03:17
Average standard deviation of split frequencies: 0.000000
15500 -- (-1388.082) [-1387.604] (-1386.811) (-1389.605) * [-1387.668] (-1386.330) (-1389.401) (-1382.177) -- 0:03:10
16000 -- (-1386.836) (-1393.486) (-1392.227) [-1384.012] * (-1383.030) [-1385.868] (-1395.336) (-1384.345) -- 0:03:04
16500 -- (-1385.303) [-1386.995] (-1391.559) (-1382.218) * (-1387.548) [-1385.388] (-1385.114) (-1384.566) -- 0:02:58
17000 -- (-1390.700) [-1389.116] (-1387.893) (-1383.174) * [-1386.560] (-1385.604) (-1388.417) (-1387.467) -- 0:02:53
17500 -- (-1385.650) (-1381.034) (-1390.007) [-1385.731] * [-1385.415] (-1385.262) (-1387.530) (-1384.677) -- 0:02:48
18000 -- (-1385.695) (-1381.363) (-1393.276) [-1385.273] * (-1388.175) (-1384.377) (-1385.015) [-1385.906] -- 0:02:43
18500 -- (-1393.491) (-1383.829) (-1389.172) [-1391.299] * (-1388.743) [-1387.247] (-1391.136) (-1389.372) -- 0:02:39
19000 -- (-1388.085) (-1384.423) (-1393.660) [-1394.518] * [-1389.026] (-1388.600) (-1389.980) (-1387.762) -- 0:02:34
19500 -- (-1389.054) [-1380.731] (-1397.437) (-1385.549) * (-1388.617) (-1397.841) (-1385.284) [-1385.362] -- 0:03:21
20000 -- (-1389.006) (-1385.162) [-1388.461] (-1382.888) * (-1393.991) (-1391.089) (-1384.367) [-1381.803] -- 0:03:16
Average standard deviation of split frequencies: 0.011405
20500 -- (-1384.643) [-1383.854] (-1393.150) (-1387.470) * (-1393.496) (-1387.533) [-1382.851] (-1392.137) -- 0:03:11
21000 -- (-1389.927) (-1386.229) (-1390.111) [-1384.868] * [-1388.651] (-1387.424) (-1387.930) (-1388.994) -- 0:03:06
21500 -- (-1385.340) [-1383.103] (-1382.321) (-1384.807) * [-1384.150] (-1385.156) (-1386.012) (-1388.697) -- 0:03:02
22000 -- (-1388.887) (-1387.097) (-1388.612) [-1384.840] * (-1394.744) (-1387.392) (-1387.441) [-1385.204] -- 0:02:57
22500 -- (-1383.639) (-1387.456) [-1381.681] (-1382.663) * [-1393.039] (-1390.471) (-1384.878) (-1386.072) -- 0:02:53
23000 -- (-1391.847) (-1383.215) (-1389.952) [-1384.862] * [-1394.637] (-1390.121) (-1382.971) (-1387.295) -- 0:02:49
23500 -- [-1385.415] (-1386.004) (-1389.644) (-1387.802) * (-1387.803) (-1386.192) [-1387.183] (-1389.646) -- 0:02:46
24000 -- (-1385.109) (-1385.093) (-1385.174) [-1387.051] * (-1391.601) (-1385.280) (-1386.734) [-1389.829] -- 0:02:42
24500 -- (-1383.392) (-1392.354) (-1385.042) [-1386.614] * [-1395.218] (-1385.671) (-1392.748) (-1385.997) -- 0:03:19
25000 -- (-1386.692) (-1390.116) (-1392.260) [-1383.893] * (-1386.136) (-1386.568) (-1392.395) [-1391.135] -- 0:03:15
Average standard deviation of split frequencies: 0.000000
25500 -- [-1386.681] (-1387.693) (-1387.133) (-1384.240) * [-1384.530] (-1389.637) (-1388.201) (-1387.300) -- 0:03:11
26000 -- (-1389.102) (-1386.264) (-1386.992) [-1382.608] * [-1384.586] (-1387.201) (-1383.278) (-1387.116) -- 0:03:07
26500 -- [-1389.464] (-1391.926) (-1382.152) (-1389.683) * (-1383.084) (-1389.354) (-1385.230) [-1389.864] -- 0:03:03
27000 -- [-1383.607] (-1391.918) (-1386.006) (-1385.226) * [-1382.003] (-1391.269) (-1392.111) (-1386.121) -- 0:03:00
27500 -- (-1381.567) (-1392.976) [-1385.143] (-1386.849) * [-1380.256] (-1389.624) (-1389.607) (-1383.369) -- 0:02:56
28000 -- [-1388.062] (-1395.872) (-1386.976) (-1387.627) * [-1382.334] (-1386.120) (-1390.481) (-1386.086) -- 0:02:53
28500 -- (-1386.238) (-1391.826) (-1381.588) [-1386.052] * (-1388.864) (-1383.794) (-1390.001) [-1385.752] -- 0:02:50
29000 -- (-1386.827) (-1405.108) (-1381.668) [-1385.995] * (-1384.995) (-1389.906) [-1387.317] (-1393.859) -- 0:02:47
29500 -- [-1381.017] (-1385.558) (-1388.989) (-1381.738) * [-1383.641] (-1388.340) (-1389.362) (-1390.917) -- 0:03:17
30000 -- (-1387.562) [-1386.443] (-1381.678) (-1390.630) * (-1386.690) (-1393.322) (-1394.576) [-1385.292] -- 0:03:14
Average standard deviation of split frequencies: 0.000000
30500 -- [-1385.611] (-1392.660) (-1383.145) (-1387.261) * (-1384.592) (-1386.476) (-1382.582) [-1385.932] -- 0:03:10
31000 -- (-1383.285) (-1385.235) [-1386.197] (-1393.131) * [-1385.129] (-1396.479) (-1390.806) (-1391.123) -- 0:03:07
31500 -- (-1383.534) [-1388.221] (-1387.948) (-1388.097) * (-1381.930) (-1388.272) [-1385.115] (-1395.377) -- 0:03:04
32000 -- (-1382.607) [-1387.079] (-1389.316) (-1386.915) * [-1383.554] (-1384.299) (-1390.027) (-1389.461) -- 0:03:01
32500 -- (-1384.116) (-1387.087) [-1391.185] (-1390.176) * (-1385.458) [-1383.818] (-1387.615) (-1391.236) -- 0:02:58
33000 -- (-1384.867) (-1384.569) (-1388.147) [-1388.889] * (-1383.585) (-1385.298) (-1384.926) [-1390.218] -- 0:02:55
33500 -- (-1387.555) (-1381.613) (-1386.906) [-1389.488] * [-1391.798] (-1387.276) (-1389.244) (-1396.895) -- 0:02:53
34000 -- [-1387.087] (-1382.398) (-1384.831) (-1382.914) * (-1391.696) (-1385.833) (-1392.288) [-1385.399] -- 0:02:50
34500 -- (-1388.432) (-1384.600) [-1383.686] (-1384.448) * (-1385.671) [-1385.188] (-1387.269) (-1384.931) -- 0:03:15
35000 -- (-1391.093) (-1385.317) [-1387.103] (-1390.730) * (-1390.275) (-1388.073) (-1383.797) [-1384.425] -- 0:03:13
Average standard deviation of split frequencies: 0.006547
35500 -- [-1390.703] (-1386.191) (-1389.310) (-1385.454) * (-1385.115) (-1382.969) (-1390.391) [-1381.751] -- 0:03:10
36000 -- (-1384.353) [-1380.749] (-1386.789) (-1385.412) * (-1390.318) (-1388.076) (-1388.918) [-1381.990] -- 0:03:07
36500 -- (-1383.580) [-1385.091] (-1388.047) (-1384.990) * (-1389.727) (-1396.602) [-1384.718] (-1384.644) -- 0:03:04
37000 -- (-1384.495) (-1390.731) [-1383.409] (-1385.974) * (-1389.404) (-1381.831) (-1386.397) [-1388.250] -- 0:03:02
37500 -- [-1387.371] (-1393.286) (-1392.656) (-1383.802) * (-1392.176) (-1386.870) [-1383.413] (-1396.237) -- 0:02:59
38000 -- (-1385.054) (-1390.331) (-1391.129) [-1388.892] * (-1388.047) (-1392.151) [-1386.097] (-1393.050) -- 0:02:57
38500 -- (-1389.424) (-1389.440) (-1381.599) [-1380.995] * (-1386.056) (-1384.228) (-1387.178) [-1386.502] -- 0:02:54
39000 -- [-1387.228] (-1386.318) (-1384.323) (-1386.983) * (-1387.434) (-1393.950) (-1391.902) [-1388.473] -- 0:02:52
39500 -- (-1387.525) (-1387.655) [-1380.025] (-1386.643) * (-1389.524) (-1385.189) [-1382.092] (-1384.923) -- 0:03:14
40000 -- (-1398.121) (-1385.967) (-1382.244) [-1385.301] * (-1388.384) (-1386.073) [-1386.539] (-1384.246) -- 0:03:12
Average standard deviation of split frequencies: 0.011592
40500 -- (-1384.410) (-1387.430) (-1385.473) [-1385.997] * (-1391.137) (-1386.528) (-1385.234) [-1382.939] -- 0:03:09
41000 -- (-1389.794) (-1391.861) (-1390.807) [-1382.360] * (-1389.404) (-1391.924) (-1390.301) [-1384.427] -- 0:03:07
41500 -- (-1392.169) (-1389.507) (-1390.047) [-1385.758] * (-1388.935) (-1388.686) (-1382.355) [-1382.686] -- 0:03:04
42000 -- (-1390.684) (-1389.964) (-1383.049) [-1383.507] * (-1387.784) (-1392.095) (-1386.991) [-1381.784] -- 0:03:02
42500 -- (-1394.408) [-1383.112] (-1387.326) (-1382.732) * [-1383.694] (-1394.862) (-1386.653) (-1388.622) -- 0:03:00
43000 -- [-1384.844] (-1389.624) (-1384.870) (-1384.489) * (-1384.826) (-1393.045) [-1385.412] (-1386.425) -- 0:02:58
43500 -- (-1391.145) (-1386.916) [-1379.688] (-1388.063) * [-1385.320] (-1386.189) (-1385.681) (-1384.709) -- 0:02:55
44000 -- [-1387.676] (-1389.216) (-1383.137) (-1391.780) * (-1392.842) (-1391.434) (-1387.393) [-1380.580] -- 0:02:53
44500 -- (-1387.112) (-1393.798) (-1386.259) [-1386.652] * (-1389.691) (-1390.473) [-1385.373] (-1388.868) -- 0:03:13
45000 -- (-1395.478) (-1389.699) [-1388.718] (-1383.454) * [-1383.931] (-1385.539) (-1388.438) (-1387.175) -- 0:03:11
Average standard deviation of split frequencies: 0.010248
45500 -- (-1388.136) (-1385.990) (-1388.976) [-1389.781] * (-1389.622) (-1389.720) (-1388.163) [-1391.054] -- 0:03:08
46000 -- (-1391.602) (-1388.945) (-1389.740) [-1385.642] * [-1387.742] (-1393.690) (-1384.627) (-1386.386) -- 0:03:06
46500 -- [-1389.786] (-1390.796) (-1384.707) (-1383.968) * (-1399.499) [-1391.676] (-1384.989) (-1391.657) -- 0:03:04
47000 -- [-1388.086] (-1393.055) (-1390.228) (-1389.264) * (-1385.490) (-1392.400) (-1387.229) [-1386.844] -- 0:03:02
47500 -- [-1386.325] (-1391.598) (-1383.098) (-1390.432) * (-1391.879) (-1389.962) (-1390.238) [-1383.374] -- 0:03:00
48000 -- [-1389.214] (-1387.781) (-1382.523) (-1389.521) * (-1388.610) (-1385.248) [-1388.042] (-1386.046) -- 0:02:58
48500 -- [-1382.953] (-1392.510) (-1383.819) (-1389.300) * (-1390.064) (-1385.412) [-1390.363] (-1385.061) -- 0:02:56
49000 -- [-1389.211] (-1384.642) (-1386.630) (-1382.850) * (-1387.200) [-1384.298] (-1396.578) (-1385.878) -- 0:02:54
49500 -- [-1387.877] (-1393.568) (-1387.140) (-1383.300) * (-1388.343) (-1397.778) (-1390.850) [-1389.257] -- 0:03:12
50000 -- (-1380.886) (-1390.221) [-1383.661] (-1382.759) * (-1389.947) (-1394.287) (-1394.863) [-1380.865] -- 0:03:10
Average standard deviation of split frequencies: 0.027912
50500 -- [-1391.364] (-1387.458) (-1390.751) (-1382.121) * [-1380.670] (-1383.604) (-1385.024) (-1381.664) -- 0:03:08
51000 -- (-1388.049) [-1381.632] (-1387.139) (-1387.108) * (-1384.170) [-1386.290] (-1385.398) (-1392.688) -- 0:03:06
51500 -- (-1387.337) (-1383.629) (-1381.749) [-1386.363] * (-1381.947) (-1389.371) (-1389.737) [-1385.935] -- 0:03:04
52000 -- (-1384.015) (-1387.095) [-1382.058] (-1386.631) * [-1383.251] (-1384.618) (-1390.946) (-1390.543) -- 0:03:02
52500 -- (-1384.238) (-1384.990) (-1383.712) [-1385.774] * (-1384.890) [-1395.640] (-1387.716) (-1389.296) -- 0:03:00
53000 -- [-1385.908] (-1389.503) (-1385.275) (-1387.678) * (-1388.229) (-1391.061) [-1387.660] (-1385.392) -- 0:02:58
53500 -- [-1385.560] (-1385.321) (-1384.675) (-1389.788) * (-1388.976) (-1388.820) (-1383.659) [-1389.038] -- 0:02:56
54000 -- (-1383.503) [-1388.550] (-1391.241) (-1389.544) * (-1385.874) (-1390.387) (-1388.436) [-1386.359] -- 0:02:55
54500 -- (-1390.077) (-1390.939) (-1388.290) [-1386.755] * (-1385.911) (-1387.184) (-1388.416) [-1392.280] -- 0:03:10
55000 -- (-1384.782) (-1387.096) [-1384.750] (-1389.807) * (-1387.050) [-1384.135] (-1393.422) (-1383.522) -- 0:03:09
Average standard deviation of split frequencies: 0.021045
55500 -- (-1388.567) (-1388.568) [-1385.976] (-1389.090) * (-1387.980) [-1385.648] (-1395.120) (-1390.537) -- 0:03:07
56000 -- (-1383.823) (-1383.457) [-1383.906] (-1390.823) * (-1384.582) [-1393.945] (-1387.171) (-1384.161) -- 0:03:05
56500 -- (-1394.837) (-1382.014) (-1383.480) [-1382.564] * [-1386.015] (-1392.607) (-1387.419) (-1383.000) -- 0:03:03
57000 -- (-1382.273) (-1385.614) (-1385.166) [-1387.329] * (-1391.257) (-1384.507) (-1387.079) [-1381.860] -- 0:03:01
57500 -- [-1389.701] (-1384.937) (-1387.742) (-1388.534) * (-1397.441) (-1385.520) (-1388.452) [-1385.778] -- 0:03:00
58000 -- [-1380.899] (-1388.267) (-1382.273) (-1387.141) * (-1388.894) (-1392.575) [-1384.638] (-1382.358) -- 0:02:58
58500 -- (-1384.668) (-1392.774) (-1384.158) [-1383.419] * (-1387.375) (-1387.439) (-1386.904) [-1382.507] -- 0:02:57
59000 -- (-1387.231) (-1387.983) (-1395.894) [-1386.721] * (-1389.203) (-1389.879) (-1383.777) [-1382.609] -- 0:02:55
59500 -- (-1382.444) (-1391.443) (-1385.392) [-1385.581] * (-1386.115) (-1383.987) (-1385.343) [-1383.719] -- 0:03:09
60000 -- (-1387.403) (-1390.053) [-1383.467] (-1386.417) * (-1390.907) (-1389.031) (-1387.342) [-1388.572] -- 0:03:08
Average standard deviation of split frequencies: 0.019426
60500 -- [-1391.565] (-1392.924) (-1382.832) (-1384.677) * (-1392.128) (-1384.886) [-1383.577] (-1390.346) -- 0:03:06
61000 -- (-1392.511) (-1391.256) [-1381.096] (-1392.008) * [-1386.739] (-1388.276) (-1387.723) (-1391.313) -- 0:03:04
61500 -- (-1390.009) (-1393.081) [-1383.642] (-1383.465) * (-1387.572) (-1393.755) (-1386.300) [-1383.873] -- 0:03:03
62000 -- (-1388.216) (-1391.736) (-1387.809) [-1387.758] * (-1389.425) (-1388.924) (-1383.142) [-1388.199] -- 0:03:01
62500 -- (-1385.910) [-1389.101] (-1384.274) (-1384.067) * (-1384.931) [-1392.951] (-1390.103) (-1393.386) -- 0:03:00
63000 -- (-1386.129) (-1387.841) (-1384.601) [-1383.556] * (-1388.442) (-1391.397) [-1383.685] (-1390.975) -- 0:02:58
63500 -- (-1383.121) (-1394.910) [-1382.962] (-1385.978) * (-1387.090) (-1393.427) (-1397.106) [-1382.140] -- 0:02:56
64000 -- (-1391.141) [-1380.026] (-1385.195) (-1388.785) * (-1387.159) (-1385.012) (-1385.730) [-1384.229] -- 0:02:55
64500 -- (-1387.931) (-1382.473) (-1396.320) [-1384.647] * [-1383.184] (-1389.482) (-1384.040) (-1386.992) -- 0:03:08
65000 -- (-1393.432) (-1390.187) [-1391.320] (-1384.241) * (-1380.776) (-1387.287) (-1382.418) [-1383.552] -- 0:03:07
Average standard deviation of split frequencies: 0.017856
65500 -- (-1388.708) (-1382.075) (-1383.452) [-1383.060] * [-1385.114] (-1384.701) (-1382.573) (-1383.410) -- 0:03:05
66000 -- [-1393.995] (-1386.038) (-1386.325) (-1381.457) * (-1385.596) (-1387.811) (-1384.530) [-1386.812] -- 0:03:03
66500 -- (-1388.095) (-1386.228) [-1385.029] (-1384.865) * [-1382.786] (-1385.402) (-1386.790) (-1386.695) -- 0:03:02
67000 -- (-1391.386) (-1384.222) (-1383.258) [-1381.896] * (-1383.337) (-1389.867) (-1383.420) [-1381.715] -- 0:03:01
67500 -- (-1390.230) (-1393.044) (-1385.904) [-1385.877] * [-1385.050] (-1387.344) (-1402.674) (-1388.054) -- 0:02:59
68000 -- (-1385.784) (-1389.175) (-1383.007) [-1387.038] * [-1386.686] (-1384.466) (-1383.387) (-1388.335) -- 0:02:58
68500 -- (-1391.051) (-1385.445) [-1381.787] (-1387.572) * (-1384.927) (-1387.334) [-1385.286] (-1383.164) -- 0:02:56
69000 -- (-1394.168) (-1389.278) (-1381.751) [-1393.676] * (-1386.351) [-1398.072] (-1385.657) (-1384.958) -- 0:02:55
69500 -- (-1393.627) (-1386.503) [-1382.640] (-1391.789) * (-1382.304) (-1390.691) [-1384.654] (-1383.489) -- 0:03:07
70000 -- (-1390.232) (-1384.307) [-1386.401] (-1385.831) * [-1380.706] (-1396.890) (-1386.898) (-1384.451) -- 0:03:06
Average standard deviation of split frequencies: 0.020012
70500 -- (-1385.347) (-1386.982) (-1384.392) [-1388.770] * (-1387.310) [-1386.910] (-1387.776) (-1385.432) -- 0:03:04
71000 -- [-1383.948] (-1384.299) (-1385.507) (-1383.565) * (-1382.211) (-1383.437) (-1392.192) [-1386.237] -- 0:03:03
71500 -- (-1385.796) (-1384.728) [-1386.991] (-1386.530) * [-1381.492] (-1391.357) (-1388.746) (-1384.438) -- 0:03:01
72000 -- [-1380.770] (-1393.596) (-1388.524) (-1389.730) * (-1382.029) (-1384.855) (-1390.507) [-1389.135] -- 0:03:00
72500 -- (-1384.280) (-1386.571) [-1385.123] (-1390.470) * (-1386.203) [-1381.263] (-1392.735) (-1380.893) -- 0:02:59
73000 -- [-1387.836] (-1394.910) (-1391.848) (-1388.985) * [-1387.364] (-1389.018) (-1396.606) (-1389.414) -- 0:02:57
73500 -- (-1391.097) [-1382.212] (-1395.463) (-1395.005) * (-1386.775) [-1385.253] (-1387.777) (-1382.802) -- 0:02:56
74000 -- (-1384.625) (-1383.578) (-1384.669) [-1386.900] * (-1387.756) (-1389.001) [-1386.327] (-1386.756) -- 0:02:55
74500 -- (-1387.188) (-1382.532) (-1389.903) [-1389.725] * [-1386.923] (-1384.661) (-1390.517) (-1384.596) -- 0:03:06
75000 -- (-1382.462) [-1387.720] (-1390.308) (-1388.828) * (-1386.397) (-1383.780) [-1385.993] (-1387.736) -- 0:03:05
Average standard deviation of split frequencies: 0.015507
75500 -- [-1387.196] (-1383.492) (-1392.901) (-1388.010) * (-1394.348) [-1384.442] (-1388.870) (-1385.400) -- 0:03:03
76000 -- (-1387.168) [-1387.906] (-1391.222) (-1389.132) * (-1386.270) (-1387.728) [-1387.429] (-1387.409) -- 0:03:02
76500 -- [-1380.599] (-1394.168) (-1385.027) (-1389.057) * (-1394.062) [-1388.503] (-1384.449) (-1385.195) -- 0:03:01
77000 -- [-1385.328] (-1389.763) (-1387.802) (-1381.788) * (-1385.157) (-1384.555) (-1383.304) [-1381.406] -- 0:02:59
77500 -- (-1388.407) (-1392.139) [-1384.244] (-1390.293) * (-1386.910) (-1384.111) (-1384.774) [-1387.103] -- 0:02:58
78000 -- [-1383.846] (-1390.557) (-1386.690) (-1386.480) * [-1388.579] (-1387.192) (-1384.280) (-1381.864) -- 0:02:57
78500 -- (-1388.826) (-1388.559) [-1390.376] (-1385.200) * (-1384.963) (-1395.350) [-1386.508] (-1382.824) -- 0:02:56
79000 -- (-1393.923) (-1385.095) (-1383.716) [-1388.431] * [-1386.741] (-1386.232) (-1387.781) (-1386.510) -- 0:02:54
79500 -- (-1393.581) (-1387.234) (-1383.953) [-1383.676] * (-1385.749) [-1386.229] (-1389.674) (-1387.451) -- 0:03:05
80000 -- (-1383.479) (-1389.758) (-1385.341) [-1384.700] * (-1387.574) (-1390.277) [-1383.994] (-1385.847) -- 0:03:04
Average standard deviation of split frequencies: 0.011688
80500 -- (-1389.440) (-1385.117) (-1384.087) [-1388.495] * [-1384.963] (-1392.103) (-1385.307) (-1388.728) -- 0:03:02
81000 -- (-1389.368) (-1392.817) (-1397.340) [-1385.193] * (-1388.515) (-1384.781) (-1387.745) [-1382.513] -- 0:03:01
81500 -- (-1384.124) [-1385.793] (-1387.677) (-1387.281) * [-1389.166] (-1384.596) (-1385.194) (-1383.500) -- 0:03:00
82000 -- (-1384.012) (-1386.259) [-1388.831] (-1383.974) * (-1383.021) (-1385.258) (-1389.035) [-1382.161] -- 0:02:59
82500 -- (-1382.906) (-1383.442) [-1382.072] (-1386.081) * (-1387.604) [-1381.941] (-1384.374) (-1384.402) -- 0:02:57
83000 -- (-1388.446) (-1389.314) (-1387.398) [-1386.886] * (-1384.679) [-1386.717] (-1385.455) (-1387.532) -- 0:02:56
83500 -- (-1386.227) (-1392.578) (-1389.486) [-1384.057] * (-1387.472) [-1384.625] (-1386.223) (-1383.206) -- 0:02:55
84000 -- (-1387.717) (-1389.335) (-1385.068) [-1390.330] * [-1386.349] (-1386.244) (-1382.974) (-1384.351) -- 0:02:54
84500 -- (-1382.861) (-1389.133) (-1384.585) [-1382.031] * (-1385.691) (-1385.099) [-1388.270] (-1388.971) -- 0:03:04
85000 -- (-1381.592) (-1395.888) [-1384.056] (-1384.915) * (-1385.586) (-1387.653) [-1386.778] (-1386.008) -- 0:03:03
Average standard deviation of split frequencies: 0.005481
85500 -- [-1386.579] (-1385.258) (-1384.736) (-1386.289) * (-1384.156) (-1392.686) (-1391.121) [-1381.833] -- 0:03:01
86000 -- (-1380.972) (-1387.964) [-1386.611] (-1392.641) * (-1381.295) (-1393.619) (-1387.578) [-1381.862] -- 0:03:00
86500 -- [-1381.686] (-1389.565) (-1385.239) (-1388.040) * (-1386.027) (-1399.261) [-1393.640] (-1382.887) -- 0:02:59
87000 -- [-1381.736] (-1383.990) (-1386.593) (-1393.461) * [-1381.795] (-1386.145) (-1392.244) (-1386.238) -- 0:02:58
87500 -- (-1384.965) [-1388.532] (-1390.082) (-1392.152) * (-1386.341) [-1387.434] (-1384.193) (-1386.252) -- 0:02:57
88000 -- [-1384.122] (-1384.602) (-1384.783) (-1387.233) * (-1391.032) [-1387.331] (-1382.977) (-1383.502) -- 0:02:56
88500 -- (-1386.300) [-1387.019] (-1381.591) (-1389.832) * (-1385.290) [-1389.997] (-1392.863) (-1393.248) -- 0:02:55
89000 -- (-1386.424) (-1386.644) [-1384.758] (-1385.522) * [-1385.638] (-1387.614) (-1388.702) (-1388.486) -- 0:02:54
89500 -- [-1382.539] (-1385.204) (-1388.995) (-1393.218) * (-1389.288) [-1391.374] (-1386.628) (-1389.463) -- 0:03:03
90000 -- (-1383.690) (-1399.026) [-1386.565] (-1385.439) * (-1388.698) (-1392.030) (-1383.191) [-1388.410] -- 0:03:02
Average standard deviation of split frequencies: 0.005199
90500 -- (-1383.268) (-1393.753) (-1388.244) [-1383.523] * (-1397.560) (-1393.154) [-1388.392] (-1390.506) -- 0:03:00
91000 -- (-1384.581) [-1389.594] (-1387.214) (-1389.536) * (-1395.889) (-1387.691) [-1385.896] (-1385.816) -- 0:02:59
91500 -- [-1381.105] (-1389.853) (-1387.979) (-1389.592) * (-1389.313) (-1389.961) (-1384.320) [-1385.881] -- 0:02:58
92000 -- (-1388.029) (-1392.811) [-1383.314] (-1388.165) * (-1392.191) (-1387.082) (-1387.370) [-1389.529] -- 0:02:57
92500 -- (-1383.777) (-1395.152) (-1385.434) [-1389.221] * (-1391.921) [-1386.194] (-1387.496) (-1389.625) -- 0:02:56
93000 -- (-1380.172) (-1390.211) [-1386.121] (-1385.925) * (-1387.424) (-1382.956) [-1389.474] (-1387.652) -- 0:02:55
93500 -- [-1389.230] (-1388.667) (-1388.337) (-1390.051) * [-1386.996] (-1385.222) (-1385.378) (-1389.086) -- 0:02:54
94000 -- (-1387.005) (-1392.159) (-1386.731) [-1388.112] * (-1389.666) (-1384.958) (-1387.725) [-1389.719] -- 0:02:53
94500 -- (-1385.625) (-1393.912) (-1391.624) [-1392.631] * (-1392.117) (-1387.731) [-1385.532] (-1391.089) -- 0:03:02
95000 -- (-1384.287) (-1385.904) [-1388.819] (-1402.227) * (-1399.606) [-1382.873] (-1388.716) (-1387.762) -- 0:03:01
Average standard deviation of split frequencies: 0.009821
95500 -- [-1386.132] (-1387.352) (-1386.868) (-1395.686) * (-1388.775) (-1388.823) (-1382.913) [-1381.181] -- 0:02:59
96000 -- (-1387.104) (-1386.561) [-1393.598] (-1390.337) * (-1386.093) [-1384.284] (-1386.106) (-1383.344) -- 0:02:58
96500 -- (-1385.684) [-1385.262] (-1391.036) (-1401.292) * (-1386.891) [-1382.879] (-1387.031) (-1385.050) -- 0:02:57
97000 -- (-1392.499) (-1385.058) [-1385.450] (-1397.507) * (-1389.873) (-1380.945) [-1384.540] (-1388.535) -- 0:02:56
97500 -- (-1387.668) [-1385.862] (-1387.123) (-1392.352) * (-1389.237) (-1390.229) (-1382.926) [-1392.141] -- 0:02:55
98000 -- (-1383.077) (-1385.305) (-1391.809) [-1389.564] * (-1388.608) [-1384.089] (-1391.606) (-1390.826) -- 0:02:54
98500 -- [-1388.464] (-1388.387) (-1386.527) (-1386.306) * (-1388.247) [-1388.448] (-1394.104) (-1381.665) -- 0:02:53
99000 -- (-1384.341) [-1382.734] (-1388.723) (-1390.630) * (-1383.181) (-1384.759) (-1391.211) [-1382.301] -- 0:02:52
99500 -- (-1385.545) [-1383.479] (-1384.276) (-1384.439) * (-1389.059) [-1386.461] (-1393.763) (-1385.102) -- 0:03:01
100000 -- (-1391.340) (-1382.496) (-1386.094) [-1391.599] * [-1381.725] (-1384.362) (-1386.320) (-1385.877) -- 0:03:00
Average standard deviation of split frequencies: 0.007024
100500 -- (-1388.950) (-1382.109) (-1387.877) [-1380.589] * [-1383.325] (-1386.510) (-1388.297) (-1384.324) -- 0:02:59
101000 -- (-1390.985) (-1381.431) [-1386.607] (-1383.733) * (-1387.814) [-1386.799] (-1386.278) (-1386.022) -- 0:02:58
101500 -- (-1390.726) (-1383.208) [-1389.578] (-1381.660) * (-1386.719) (-1393.271) (-1383.703) [-1383.780] -- 0:02:57
102000 -- (-1385.741) (-1384.172) (-1391.781) [-1384.792] * [-1383.593] (-1388.815) (-1390.022) (-1388.494) -- 0:02:56
102500 -- [-1389.371] (-1390.301) (-1388.223) (-1394.417) * (-1392.747) (-1388.967) [-1383.922] (-1385.678) -- 0:02:55
103000 -- [-1388.555] (-1389.683) (-1386.865) (-1385.319) * [-1388.067] (-1384.656) (-1386.719) (-1392.965) -- 0:02:54
103500 -- (-1389.812) [-1382.836] (-1387.128) (-1384.001) * [-1387.200] (-1392.160) (-1386.184) (-1390.769) -- 0:02:53
104000 -- (-1385.084) (-1380.885) (-1391.706) [-1383.411] * (-1386.223) (-1383.610) (-1388.660) [-1391.561] -- 0:02:52
104500 -- (-1387.577) [-1384.489] (-1390.019) (-1382.676) * (-1390.490) [-1385.940] (-1383.668) (-1390.657) -- 0:02:59
105000 -- (-1389.950) (-1389.085) [-1386.702] (-1383.033) * [-1393.965] (-1390.252) (-1387.143) (-1386.217) -- 0:02:59
Average standard deviation of split frequencies: 0.008894
105500 -- (-1385.912) (-1388.127) (-1389.485) [-1387.298] * (-1388.663) [-1383.281] (-1385.193) (-1389.049) -- 0:02:58
106000 -- (-1393.150) (-1387.925) (-1390.222) [-1387.433] * [-1387.683] (-1384.852) (-1385.635) (-1392.884) -- 0:02:57
106500 -- [-1389.737] (-1390.087) (-1386.224) (-1386.571) * (-1389.067) (-1383.986) [-1387.776] (-1388.657) -- 0:02:56
107000 -- [-1389.261] (-1391.298) (-1385.369) (-1391.456) * (-1388.118) (-1382.583) [-1388.517] (-1391.940) -- 0:02:55
107500 -- [-1387.887] (-1383.948) (-1389.694) (-1386.046) * (-1391.162) (-1386.036) (-1385.159) [-1388.565] -- 0:02:54
108000 -- [-1390.536] (-1384.023) (-1385.639) (-1382.794) * (-1385.396) [-1387.284] (-1382.430) (-1387.207) -- 0:02:53
108500 -- (-1387.562) [-1379.421] (-1383.911) (-1383.871) * (-1382.829) [-1391.348] (-1384.389) (-1385.911) -- 0:02:52
109000 -- (-1385.807) [-1382.093] (-1385.655) (-1383.505) * [-1380.011] (-1385.922) (-1389.501) (-1384.640) -- 0:02:59
109500 -- (-1395.152) [-1384.107] (-1389.799) (-1391.228) * (-1383.025) (-1383.515) (-1385.214) [-1381.110] -- 0:02:58
110000 -- (-1384.591) (-1387.910) (-1385.181) [-1384.152] * (-1382.356) [-1384.977] (-1389.249) (-1380.554) -- 0:02:58
Average standard deviation of split frequencies: 0.002130
110500 -- (-1387.158) [-1387.054] (-1389.417) (-1386.403) * (-1385.735) (-1385.071) (-1387.029) [-1382.075] -- 0:02:57
111000 -- (-1387.150) (-1388.394) (-1391.704) [-1386.422] * (-1380.827) (-1385.086) [-1387.138] (-1381.764) -- 0:02:56
111500 -- (-1391.202) (-1394.816) (-1384.404) [-1385.569] * [-1381.150] (-1383.569) (-1383.781) (-1391.263) -- 0:02:55
112000 -- (-1383.562) (-1388.083) (-1385.574) [-1385.173] * (-1389.168) [-1383.085] (-1387.300) (-1386.481) -- 0:02:54
112500 -- (-1385.091) (-1385.613) [-1385.464] (-1388.021) * (-1386.725) (-1389.050) (-1386.387) [-1383.134] -- 0:02:53
113000 -- [-1382.738] (-1382.907) (-1383.313) (-1388.055) * (-1384.989) (-1387.217) (-1385.554) [-1381.714] -- 0:02:52
113500 -- [-1381.258] (-1387.000) (-1386.527) (-1398.658) * [-1384.680] (-1385.074) (-1385.728) (-1388.836) -- 0:02:51
114000 -- [-1382.337] (-1389.025) (-1387.456) (-1397.433) * (-1389.357) [-1388.468] (-1388.013) (-1394.333) -- 0:02:58
114500 -- (-1389.464) [-1389.884] (-1385.239) (-1387.925) * (-1390.065) (-1392.761) (-1389.392) [-1385.726] -- 0:02:57
115000 -- (-1387.833) [-1391.242] (-1387.459) (-1385.829) * (-1387.123) [-1393.488] (-1389.173) (-1384.296) -- 0:02:57
Average standard deviation of split frequencies: 0.004064
115500 -- (-1387.283) [-1382.628] (-1386.177) (-1388.487) * (-1382.288) (-1391.002) (-1387.754) [-1387.751] -- 0:02:56
116000 -- (-1384.393) (-1399.048) (-1393.582) [-1389.946] * (-1391.395) (-1387.800) [-1392.255] (-1387.338) -- 0:02:55
116500 -- [-1391.215] (-1383.707) (-1391.349) (-1394.233) * (-1389.002) [-1385.162] (-1384.714) (-1388.807) -- 0:02:54
117000 -- (-1392.137) (-1387.441) (-1396.958) [-1388.902] * [-1388.940] (-1383.053) (-1389.858) (-1386.544) -- 0:02:53
117500 -- (-1389.987) (-1380.778) (-1403.616) [-1383.821] * [-1393.314] (-1388.949) (-1386.568) (-1388.580) -- 0:02:52
118000 -- (-1384.703) [-1380.128] (-1400.202) (-1390.617) * [-1387.932] (-1387.478) (-1383.825) (-1392.844) -- 0:02:51
118500 -- (-1386.729) (-1387.616) (-1390.366) [-1389.164] * (-1385.059) [-1387.068] (-1387.942) (-1389.812) -- 0:02:51
119000 -- [-1383.420] (-1389.046) (-1388.601) (-1385.796) * [-1383.468] (-1385.155) (-1387.773) (-1385.078) -- 0:02:57
119500 -- (-1381.961) [-1384.638] (-1385.479) (-1383.730) * (-1386.012) [-1381.736] (-1388.865) (-1385.903) -- 0:02:56
120000 -- [-1381.916] (-1388.694) (-1385.175) (-1389.680) * (-1388.058) [-1390.230] (-1386.165) (-1385.346) -- 0:02:56
Average standard deviation of split frequencies: 0.003907
120500 -- (-1382.310) [-1382.960] (-1383.251) (-1384.456) * (-1387.114) (-1387.782) (-1392.724) [-1386.417] -- 0:02:55
121000 -- (-1384.831) (-1389.421) [-1380.720] (-1388.789) * (-1389.728) (-1385.524) [-1386.540] (-1394.410) -- 0:02:54
121500 -- (-1385.544) [-1381.278] (-1387.237) (-1388.904) * [-1388.403] (-1384.413) (-1387.808) (-1386.903) -- 0:02:53
122000 -- (-1384.675) (-1387.144) [-1382.454] (-1387.370) * (-1382.933) (-1392.517) [-1382.772] (-1385.596) -- 0:02:52
122500 -- (-1383.549) [-1386.853] (-1381.135) (-1390.757) * [-1382.483] (-1391.728) (-1384.112) (-1384.372) -- 0:02:51
123000 -- (-1386.854) (-1384.578) [-1383.017] (-1387.656) * (-1386.791) (-1389.037) [-1389.389] (-1387.881) -- 0:02:51
123500 -- [-1384.593] (-1382.805) (-1391.175) (-1383.277) * [-1381.068] (-1388.448) (-1384.251) (-1397.343) -- 0:02:50
124000 -- (-1384.120) (-1386.858) [-1385.509] (-1383.374) * (-1383.008) (-1385.149) (-1390.010) [-1387.946] -- 0:02:56
124500 -- (-1388.301) [-1383.789] (-1384.696) (-1385.747) * (-1382.198) (-1384.419) [-1384.493] (-1391.496) -- 0:02:55
125000 -- [-1384.696] (-1383.324) (-1385.358) (-1389.683) * (-1383.310) (-1388.428) (-1383.944) [-1386.368] -- 0:02:55
Average standard deviation of split frequencies: 0.003741
125500 -- [-1389.531] (-1384.916) (-1388.445) (-1383.220) * (-1391.078) (-1389.391) [-1383.070] (-1388.031) -- 0:02:54
126000 -- (-1384.707) (-1388.091) [-1383.147] (-1387.246) * (-1388.044) [-1382.685] (-1384.279) (-1384.014) -- 0:02:53
126500 -- (-1389.404) (-1392.918) (-1387.495) [-1387.414] * (-1386.530) (-1383.523) [-1383.139] (-1389.704) -- 0:02:52
127000 -- (-1389.210) (-1383.090) (-1387.687) [-1381.899] * (-1385.601) [-1385.393] (-1394.811) (-1388.203) -- 0:02:51
127500 -- (-1391.945) [-1385.969] (-1386.533) (-1385.833) * (-1387.795) [-1384.162] (-1387.826) (-1387.240) -- 0:02:51
128000 -- (-1395.080) (-1389.349) (-1385.344) [-1385.456] * [-1384.044] (-1385.411) (-1384.669) (-1393.133) -- 0:02:50
128500 -- (-1391.016) (-1384.839) [-1381.284] (-1387.837) * (-1384.519) [-1383.622] (-1383.071) (-1384.412) -- 0:02:49
129000 -- (-1392.413) (-1386.736) (-1384.637) [-1382.747] * (-1388.957) (-1388.384) (-1389.383) [-1385.999] -- 0:02:55
129500 -- [-1389.306] (-1392.830) (-1390.145) (-1388.490) * (-1389.249) (-1384.881) (-1384.809) [-1387.732] -- 0:02:54
130000 -- (-1392.883) [-1384.229] (-1388.311) (-1382.894) * (-1394.536) [-1384.445] (-1387.855) (-1384.610) -- 0:02:54
Average standard deviation of split frequencies: 0.003608
130500 -- (-1386.076) (-1383.749) (-1384.437) [-1382.564] * (-1389.076) (-1390.121) [-1395.370] (-1391.214) -- 0:02:53
131000 -- (-1385.247) (-1388.571) [-1383.051] (-1386.599) * (-1387.707) (-1387.164) (-1393.345) [-1382.836] -- 0:02:52
131500 -- (-1389.157) (-1395.269) [-1384.128] (-1383.515) * (-1388.010) (-1396.652) [-1386.126] (-1382.068) -- 0:02:51
132000 -- [-1392.085] (-1388.156) (-1391.322) (-1384.714) * (-1382.094) (-1395.407) [-1389.109] (-1397.756) -- 0:02:50
132500 -- (-1385.723) (-1396.526) [-1383.156] (-1378.817) * (-1386.843) (-1393.520) [-1382.242] (-1388.928) -- 0:02:50
133000 -- [-1384.683] (-1392.256) (-1386.135) (-1385.717) * (-1388.891) [-1383.171] (-1386.847) (-1387.529) -- 0:02:49
133500 -- [-1382.587] (-1397.079) (-1383.758) (-1385.410) * (-1392.830) (-1382.376) [-1385.086] (-1387.515) -- 0:02:48
134000 -- (-1383.539) (-1383.939) (-1381.959) [-1387.932] * (-1385.395) (-1384.640) [-1385.343] (-1385.360) -- 0:02:48
134500 -- [-1386.310] (-1386.776) (-1385.987) (-1384.088) * (-1392.770) (-1394.254) [-1387.561] (-1383.613) -- 0:02:53
135000 -- [-1384.543] (-1388.787) (-1384.985) (-1383.389) * (-1396.735) (-1393.017) (-1387.290) [-1382.736] -- 0:02:53
Average standard deviation of split frequencies: 0.001733
135500 -- [-1389.075] (-1391.555) (-1388.589) (-1385.395) * (-1390.361) (-1386.513) [-1387.357] (-1382.983) -- 0:02:52
136000 -- (-1390.620) (-1386.592) [-1384.920] (-1389.408) * (-1388.729) (-1387.591) (-1399.996) [-1383.239] -- 0:02:51
136500 -- [-1382.868] (-1386.357) (-1387.782) (-1384.774) * (-1386.710) [-1389.427] (-1392.388) (-1387.618) -- 0:02:50
137000 -- (-1388.831) (-1385.931) (-1390.885) [-1384.732] * (-1389.264) (-1388.280) [-1389.214] (-1385.327) -- 0:02:50
137500 -- (-1386.262) (-1387.795) [-1386.680] (-1390.018) * (-1390.244) (-1384.170) [-1386.054] (-1386.406) -- 0:02:49
138000 -- [-1381.865] (-1382.045) (-1390.286) (-1386.823) * (-1391.191) (-1384.133) (-1387.939) [-1386.165] -- 0:02:48
138500 -- [-1379.895] (-1383.966) (-1384.346) (-1387.180) * (-1391.293) (-1383.844) (-1389.864) [-1386.288] -- 0:02:47
139000 -- (-1385.713) (-1384.981) (-1384.339) [-1387.956] * [-1387.765] (-1384.030) (-1387.612) (-1386.050) -- 0:02:47
139500 -- (-1384.094) (-1387.102) [-1384.467] (-1388.697) * (-1392.142) [-1384.563] (-1385.124) (-1382.725) -- 0:02:52
140000 -- (-1389.077) [-1383.495] (-1385.714) (-1386.668) * (-1391.969) (-1390.544) [-1383.313] (-1386.490) -- 0:02:52
Average standard deviation of split frequencies: 0.001676
140500 -- [-1383.835] (-1382.935) (-1391.803) (-1393.202) * (-1388.184) (-1393.741) [-1384.368] (-1389.507) -- 0:02:51
141000 -- (-1385.245) (-1383.768) [-1384.245] (-1384.034) * (-1390.139) (-1391.974) [-1387.124] (-1385.386) -- 0:02:50
141500 -- (-1391.815) (-1391.838) (-1384.339) [-1393.002] * (-1386.210) [-1388.253] (-1384.509) (-1389.410) -- 0:02:49
142000 -- (-1388.784) (-1393.210) (-1386.729) [-1386.593] * (-1382.497) (-1385.320) [-1386.702] (-1391.244) -- 0:02:49
142500 -- (-1392.480) [-1393.851] (-1388.003) (-1387.079) * (-1380.358) (-1383.943) (-1386.483) [-1388.226] -- 0:02:48
143000 -- (-1394.264) [-1387.843] (-1401.723) (-1389.240) * (-1384.280) [-1386.913] (-1394.077) (-1386.772) -- 0:02:47
143500 -- (-1389.111) (-1389.685) (-1389.018) [-1385.781] * (-1388.827) [-1386.947] (-1382.399) (-1392.475) -- 0:02:47
144000 -- (-1385.577) [-1383.249] (-1388.681) (-1383.556) * [-1384.707] (-1389.373) (-1382.402) (-1390.074) -- 0:02:46
144500 -- (-1383.084) (-1397.240) [-1386.184] (-1384.060) * [-1384.850] (-1385.891) (-1386.560) (-1389.058) -- 0:02:51
145000 -- [-1387.256] (-1389.536) (-1395.396) (-1386.353) * (-1388.996) (-1388.538) [-1383.984] (-1385.850) -- 0:02:51
Average standard deviation of split frequencies: 0.004843
145500 -- [-1382.084] (-1384.982) (-1402.263) (-1386.505) * [-1382.456] (-1385.793) (-1387.127) (-1385.911) -- 0:02:50
146000 -- (-1381.284) [-1381.399] (-1389.868) (-1383.258) * (-1385.299) [-1380.573] (-1384.494) (-1387.946) -- 0:02:49
146500 -- [-1387.587] (-1386.075) (-1395.244) (-1385.206) * (-1388.580) [-1383.601] (-1393.223) (-1386.149) -- 0:02:48
147000 -- (-1386.250) [-1384.228] (-1388.938) (-1390.470) * (-1385.612) (-1384.281) (-1392.637) [-1381.686] -- 0:02:48
147500 -- (-1383.894) [-1390.837] (-1392.191) (-1389.190) * (-1388.433) (-1386.633) (-1387.520) [-1388.114] -- 0:02:47
148000 -- [-1389.508] (-1384.227) (-1392.076) (-1383.978) * (-1392.869) [-1383.905] (-1387.913) (-1394.594) -- 0:02:46
148500 -- (-1390.692) (-1383.439) [-1391.809] (-1386.111) * (-1384.637) [-1380.785] (-1387.009) (-1383.609) -- 0:02:46
149000 -- (-1386.080) (-1384.303) [-1385.447] (-1389.361) * (-1388.307) (-1394.693) (-1385.785) [-1385.800] -- 0:02:45
149500 -- [-1389.494] (-1389.251) (-1387.801) (-1391.863) * [-1383.001] (-1386.804) (-1384.451) (-1385.643) -- 0:02:50
150000 -- [-1387.229] (-1394.265) (-1386.427) (-1389.253) * [-1390.267] (-1392.852) (-1383.464) (-1385.293) -- 0:02:50
Average standard deviation of split frequencies: 0.000000
150500 -- [-1385.853] (-1392.441) (-1393.662) (-1389.260) * (-1387.756) [-1389.309] (-1389.908) (-1391.855) -- 0:02:49
151000 -- (-1385.661) (-1392.368) (-1395.863) [-1391.542] * [-1391.282] (-1384.130) (-1393.770) (-1389.687) -- 0:02:48
151500 -- [-1382.661] (-1386.556) (-1388.903) (-1393.430) * (-1385.553) (-1390.367) (-1391.662) [-1383.980] -- 0:02:48
152000 -- (-1382.741) (-1385.534) [-1389.027] (-1387.462) * (-1389.128) (-1386.708) (-1389.084) [-1386.664] -- 0:02:47
152500 -- [-1385.917] (-1386.363) (-1384.429) (-1387.747) * (-1383.100) [-1385.163] (-1389.520) (-1386.625) -- 0:02:46
153000 -- (-1388.242) (-1383.917) [-1390.673] (-1383.659) * (-1391.612) [-1382.436] (-1387.077) (-1387.434) -- 0:02:46
153500 -- [-1383.444] (-1386.274) (-1387.560) (-1390.711) * (-1389.168) (-1390.412) (-1387.479) [-1393.483] -- 0:02:45
154000 -- [-1383.457] (-1384.239) (-1383.456) (-1385.871) * (-1389.028) [-1389.653] (-1387.255) (-1392.417) -- 0:02:44
154500 -- (-1393.166) (-1385.873) (-1386.513) [-1381.595] * (-1397.160) (-1392.004) [-1387.129] (-1387.622) -- 0:02:49
155000 -- [-1387.025] (-1383.337) (-1382.946) (-1385.223) * (-1384.337) (-1386.435) (-1388.339) [-1389.404] -- 0:02:49
Average standard deviation of split frequencies: 0.001511
155500 -- [-1386.537] (-1383.455) (-1391.584) (-1384.398) * [-1383.289] (-1382.475) (-1381.745) (-1388.946) -- 0:02:48
156000 -- [-1383.962] (-1390.396) (-1385.549) (-1385.246) * (-1387.539) (-1393.058) (-1384.056) [-1381.391] -- 0:02:47
156500 -- (-1384.888) [-1388.640] (-1383.620) (-1397.876) * (-1387.796) (-1386.950) [-1381.995] (-1388.727) -- 0:02:47
157000 -- [-1384.169] (-1390.008) (-1386.337) (-1391.295) * (-1389.637) [-1383.576] (-1384.940) (-1382.739) -- 0:02:46
157500 -- (-1385.702) (-1384.615) [-1383.548] (-1394.869) * (-1394.709) (-1386.366) (-1384.290) [-1386.992] -- 0:02:45
158000 -- [-1388.033] (-1385.063) (-1380.490) (-1395.515) * [-1387.078] (-1386.458) (-1392.095) (-1388.647) -- 0:02:45
158500 -- (-1386.907) (-1383.172) (-1387.229) [-1389.717] * (-1386.663) (-1385.250) [-1384.068] (-1383.675) -- 0:02:44
159000 -- [-1384.618] (-1383.707) (-1386.654) (-1388.812) * (-1384.879) (-1386.344) [-1389.994] (-1397.343) -- 0:02:43
159500 -- (-1383.978) (-1383.477) (-1387.257) [-1385.519] * (-1380.504) (-1386.307) [-1388.066] (-1387.686) -- 0:02:43
160000 -- (-1389.064) (-1386.216) (-1385.853) [-1386.651] * [-1385.400] (-1383.902) (-1388.565) (-1393.833) -- 0:02:48
Average standard deviation of split frequencies: 0.000000
160500 -- [-1381.024] (-1391.445) (-1384.218) (-1380.209) * (-1389.926) [-1384.443] (-1387.500) (-1391.460) -- 0:02:47
161000 -- (-1383.452) [-1383.244] (-1384.996) (-1382.239) * (-1388.733) [-1385.877] (-1386.849) (-1391.621) -- 0:02:46
161500 -- (-1387.832) (-1386.981) (-1392.723) [-1385.061] * (-1389.211) (-1389.027) (-1385.265) [-1388.594] -- 0:02:46
162000 -- (-1387.171) (-1392.003) (-1391.019) [-1381.737] * (-1398.648) (-1393.905) [-1385.012] (-1393.722) -- 0:02:45
162500 -- (-1387.161) (-1391.791) [-1385.754] (-1382.999) * (-1388.197) (-1383.299) [-1384.914] (-1393.048) -- 0:02:44
163000 -- [-1387.714] (-1387.397) (-1392.067) (-1394.278) * (-1389.223) (-1385.743) [-1385.437] (-1390.808) -- 0:02:44
163500 -- (-1387.570) (-1390.254) [-1387.004] (-1385.052) * (-1390.724) [-1386.232] (-1385.985) (-1388.637) -- 0:02:43
164000 -- (-1390.076) (-1385.452) (-1387.630) [-1385.467] * (-1385.911) (-1383.245) (-1386.593) [-1386.195] -- 0:02:43
164500 -- (-1386.365) (-1386.432) (-1387.434) [-1383.055] * (-1387.515) [-1384.747] (-1391.503) (-1391.090) -- 0:02:42
165000 -- (-1386.643) (-1388.134) [-1389.308] (-1392.674) * [-1388.634] (-1386.192) (-1385.991) (-1383.251) -- 0:02:47
Average standard deviation of split frequencies: 0.001420
165500 -- [-1386.844] (-1383.908) (-1384.479) (-1386.838) * (-1388.602) [-1383.013] (-1386.603) (-1393.189) -- 0:02:46
166000 -- (-1383.181) [-1382.606] (-1391.675) (-1393.278) * (-1390.949) [-1383.239] (-1390.402) (-1388.801) -- 0:02:45
166500 -- (-1389.172) (-1382.326) (-1392.275) [-1382.274] * [-1389.339] (-1382.342) (-1386.054) (-1385.645) -- 0:02:45
167000 -- (-1395.777) (-1381.681) [-1382.463] (-1381.566) * (-1389.019) (-1382.508) [-1385.888] (-1390.783) -- 0:02:44
167500 -- (-1387.770) (-1386.618) [-1382.102] (-1390.364) * [-1386.286] (-1383.936) (-1385.908) (-1383.181) -- 0:02:44
168000 -- (-1389.981) (-1383.430) [-1385.792] (-1388.700) * (-1385.727) [-1382.068] (-1385.251) (-1388.093) -- 0:02:43
168500 -- (-1393.111) (-1383.722) [-1385.625] (-1385.618) * (-1381.894) [-1391.138] (-1384.121) (-1391.339) -- 0:02:42
169000 -- (-1389.494) (-1393.686) [-1387.829] (-1393.507) * [-1384.685] (-1396.755) (-1388.130) (-1382.300) -- 0:02:42
169500 -- (-1389.454) [-1387.302] (-1393.198) (-1391.825) * (-1393.023) (-1385.816) [-1388.266] (-1384.016) -- 0:02:41
170000 -- (-1389.406) (-1388.481) [-1384.272] (-1386.383) * [-1388.687] (-1385.969) (-1393.537) (-1383.775) -- 0:02:46
Average standard deviation of split frequencies: 0.000000
170500 -- (-1385.402) [-1386.365] (-1384.202) (-1386.841) * (-1389.163) (-1382.948) (-1391.154) [-1389.326] -- 0:02:45
171000 -- (-1386.853) (-1385.442) [-1385.339] (-1386.428) * (-1390.912) (-1386.599) (-1383.115) [-1386.952] -- 0:02:44
171500 -- (-1382.888) (-1384.001) (-1388.837) [-1386.441] * [-1385.486] (-1389.956) (-1383.263) (-1382.030) -- 0:02:44
172000 -- (-1384.410) (-1382.006) [-1386.165] (-1387.352) * (-1383.676) [-1383.376] (-1389.716) (-1389.321) -- 0:02:43
172500 -- [-1384.565] (-1392.088) (-1386.505) (-1387.125) * (-1391.767) (-1383.858) [-1384.015] (-1396.459) -- 0:02:43
173000 -- (-1384.980) (-1387.370) (-1390.527) [-1384.083] * (-1390.895) (-1389.535) [-1387.091] (-1392.799) -- 0:02:42
173500 -- [-1381.819] (-1389.681) (-1387.335) (-1381.189) * (-1389.002) (-1383.097) [-1381.392] (-1391.056) -- 0:02:41
174000 -- (-1384.092) (-1383.164) [-1384.635] (-1387.615) * (-1383.219) [-1381.032] (-1386.810) (-1387.261) -- 0:02:41
174500 -- (-1387.080) [-1385.332] (-1385.901) (-1384.636) * (-1390.207) (-1387.364) [-1384.009] (-1397.805) -- 0:02:40
175000 -- (-1386.678) (-1387.752) [-1387.922] (-1395.365) * [-1381.765] (-1386.398) (-1386.935) (-1393.903) -- 0:02:45
Average standard deviation of split frequencies: 0.001339
175500 -- (-1390.482) (-1387.548) (-1389.263) [-1387.625] * (-1395.121) [-1383.130] (-1384.772) (-1391.591) -- 0:02:44
176000 -- (-1383.572) (-1387.927) (-1386.831) [-1384.004] * [-1385.336] (-1389.726) (-1383.169) (-1384.167) -- 0:02:43
176500 -- (-1392.143) (-1390.403) [-1387.508] (-1385.423) * (-1385.178) (-1390.426) [-1383.060] (-1382.250) -- 0:02:43
177000 -- (-1390.581) [-1391.811] (-1386.569) (-1383.399) * [-1385.425] (-1388.348) (-1388.956) (-1383.036) -- 0:02:42
177500 -- [-1384.896] (-1386.062) (-1385.756) (-1385.477) * (-1384.138) (-1388.739) [-1391.648] (-1386.102) -- 0:02:42
178000 -- (-1383.790) (-1385.601) [-1387.360] (-1387.254) * [-1389.825] (-1390.442) (-1388.336) (-1386.615) -- 0:02:41
178500 -- (-1385.450) (-1390.967) (-1381.553) [-1392.170] * [-1388.783] (-1391.887) (-1385.785) (-1385.687) -- 0:02:41
179000 -- (-1385.532) (-1388.035) [-1382.944] (-1392.509) * [-1386.152] (-1388.454) (-1390.053) (-1386.372) -- 0:02:40
179500 -- [-1388.523] (-1389.488) (-1383.610) (-1385.553) * (-1384.818) (-1383.527) (-1388.988) [-1386.813] -- 0:02:39
180000 -- (-1389.924) [-1389.490] (-1388.845) (-1389.930) * (-1385.514) (-1386.132) [-1388.969] (-1382.356) -- 0:02:44
Average standard deviation of split frequencies: 0.001305
180500 -- (-1388.096) [-1386.741] (-1382.231) (-1384.928) * (-1386.963) (-1395.981) [-1386.764] (-1380.386) -- 0:02:43
181000 -- (-1391.925) (-1388.168) (-1385.680) [-1384.166] * (-1385.676) (-1393.237) [-1385.780] (-1382.762) -- 0:02:42
181500 -- [-1387.754] (-1393.413) (-1387.080) (-1384.552) * (-1387.081) (-1383.754) [-1389.393] (-1383.954) -- 0:02:42
182000 -- [-1387.287] (-1386.435) (-1385.106) (-1384.929) * [-1384.582] (-1394.295) (-1383.402) (-1384.026) -- 0:02:41
182500 -- (-1385.082) [-1391.171] (-1388.798) (-1384.793) * [-1387.726] (-1387.123) (-1383.836) (-1386.155) -- 0:02:41
183000 -- (-1383.317) (-1394.289) [-1385.565] (-1384.405) * [-1386.446] (-1384.592) (-1388.269) (-1383.394) -- 0:02:40
183500 -- [-1383.025] (-1396.946) (-1388.210) (-1388.014) * (-1387.691) [-1383.294] (-1387.326) (-1386.548) -- 0:02:40
184000 -- [-1385.798] (-1397.405) (-1388.487) (-1386.797) * (-1383.647) [-1381.493] (-1391.064) (-1384.482) -- 0:02:39
184500 -- [-1384.672] (-1383.261) (-1384.000) (-1394.922) * (-1387.678) (-1382.905) (-1387.387) [-1388.316] -- 0:02:39
185000 -- (-1386.205) [-1388.363] (-1389.813) (-1385.678) * (-1387.231) [-1385.390] (-1390.921) (-1385.712) -- 0:02:43
Average standard deviation of split frequencies: 0.003802
185500 -- (-1387.747) (-1388.885) [-1383.224] (-1385.041) * [-1387.263] (-1387.896) (-1388.062) (-1387.513) -- 0:02:42
186000 -- (-1395.581) (-1384.037) (-1387.418) [-1381.492] * (-1382.831) (-1391.581) (-1392.538) [-1382.490] -- 0:02:41
186500 -- (-1389.848) (-1386.482) (-1386.153) [-1389.886] * [-1387.033] (-1388.934) (-1389.664) (-1383.771) -- 0:02:41
187000 -- [-1390.746] (-1390.843) (-1389.323) (-1387.306) * (-1389.902) (-1397.360) [-1391.775] (-1384.495) -- 0:02:40
187500 -- (-1384.511) (-1391.553) [-1386.576] (-1382.956) * [-1389.353] (-1389.127) (-1398.346) (-1389.266) -- 0:02:40
188000 -- (-1381.483) (-1393.590) [-1390.231] (-1388.068) * [-1387.424] (-1384.655) (-1385.319) (-1385.052) -- 0:02:39
188500 -- [-1382.936] (-1384.900) (-1382.090) (-1389.140) * (-1388.547) [-1382.876] (-1388.916) (-1387.888) -- 0:02:39
189000 -- [-1389.384] (-1382.861) (-1387.792) (-1395.316) * (-1387.316) (-1389.078) [-1384.631] (-1384.078) -- 0:02:38
189500 -- (-1389.561) (-1387.675) [-1384.271] (-1388.225) * (-1381.710) [-1385.340] (-1392.423) (-1392.514) -- 0:02:38
190000 -- (-1388.010) (-1388.845) (-1386.860) [-1382.118] * (-1385.048) [-1382.796] (-1384.577) (-1388.914) -- 0:02:42
Average standard deviation of split frequencies: 0.008653
190500 -- (-1385.812) (-1391.716) [-1384.634] (-1383.228) * [-1380.622] (-1388.440) (-1388.769) (-1386.528) -- 0:02:41
191000 -- (-1386.235) [-1387.285] (-1384.636) (-1395.166) * (-1383.674) (-1390.473) (-1381.643) [-1391.990] -- 0:02:40
191500 -- (-1384.693) (-1394.482) [-1384.389] (-1385.957) * (-1385.772) (-1390.353) [-1385.019] (-1389.040) -- 0:02:40
192000 -- [-1391.603] (-1381.763) (-1394.705) (-1390.246) * (-1388.203) (-1385.620) [-1382.597] (-1388.364) -- 0:02:39
192500 -- (-1388.758) (-1385.187) (-1388.406) [-1388.114] * (-1392.956) (-1389.414) (-1384.134) [-1392.820] -- 0:02:39
193000 -- (-1381.658) (-1385.582) (-1389.576) [-1387.997] * (-1397.028) (-1388.935) [-1382.503] (-1386.867) -- 0:02:38
193500 -- [-1383.349] (-1379.969) (-1393.845) (-1390.947) * [-1386.105] (-1392.970) (-1384.265) (-1382.260) -- 0:02:38
194000 -- [-1382.243] (-1390.827) (-1389.891) (-1392.111) * (-1389.464) [-1389.199] (-1384.384) (-1389.816) -- 0:02:37
194500 -- [-1383.854] (-1398.591) (-1381.435) (-1384.115) * (-1382.998) (-1386.974) (-1382.778) [-1386.897] -- 0:02:37
195000 -- [-1384.246] (-1390.231) (-1384.714) (-1390.450) * (-1388.674) [-1384.724] (-1394.844) (-1380.391) -- 0:02:36
Average standard deviation of split frequencies: 0.009621
195500 -- [-1383.643] (-1393.593) (-1382.318) (-1390.008) * (-1386.768) (-1386.076) (-1383.488) [-1386.287] -- 0:02:40
196000 -- (-1382.242) [-1386.514] (-1385.739) (-1388.982) * (-1387.158) (-1388.198) (-1384.777) [-1380.222] -- 0:02:39
196500 -- [-1384.230] (-1392.298) (-1384.954) (-1384.982) * (-1393.057) (-1381.122) (-1385.506) [-1382.754] -- 0:02:39
197000 -- [-1384.761] (-1384.720) (-1387.363) (-1384.911) * (-1390.273) [-1390.637] (-1390.598) (-1393.834) -- 0:02:38
197500 -- [-1387.260] (-1387.296) (-1393.056) (-1385.744) * (-1386.827) [-1386.425] (-1386.876) (-1394.096) -- 0:02:38
198000 -- (-1402.543) (-1390.318) (-1388.555) [-1394.372] * [-1384.826] (-1387.505) (-1384.946) (-1393.019) -- 0:02:37
198500 -- [-1384.396] (-1385.497) (-1393.821) (-1394.042) * (-1380.636) (-1387.604) (-1381.825) [-1387.846] -- 0:02:37
199000 -- (-1395.442) (-1392.287) [-1383.355] (-1392.894) * [-1384.602] (-1385.801) (-1389.900) (-1385.251) -- 0:02:36
199500 -- (-1390.907) [-1384.410] (-1385.512) (-1391.849) * (-1381.975) (-1389.237) (-1383.377) [-1387.097] -- 0:02:36
200000 -- (-1392.953) (-1383.775) (-1390.033) [-1386.203] * (-1386.189) [-1388.693] (-1386.630) (-1382.949) -- 0:02:36
Average standard deviation of split frequencies: 0.010571
200500 -- (-1384.879) (-1388.524) [-1382.297] (-1388.711) * (-1384.821) (-1385.756) [-1384.922] (-1387.956) -- 0:02:39
201000 -- (-1381.907) (-1395.748) [-1384.656] (-1388.034) * [-1384.911] (-1390.236) (-1386.254) (-1391.208) -- 0:02:39
201500 -- (-1393.450) [-1385.724] (-1386.140) (-1384.551) * (-1386.338) (-1389.143) (-1382.828) [-1390.345] -- 0:02:38
202000 -- (-1385.908) (-1393.595) (-1390.286) [-1383.389] * [-1383.129] (-1387.192) (-1386.160) (-1388.883) -- 0:02:38
202500 -- (-1392.770) (-1390.896) [-1387.393] (-1383.197) * (-1387.578) (-1388.725) [-1383.763] (-1387.243) -- 0:02:37
203000 -- (-1389.126) (-1390.765) (-1383.475) [-1387.801] * (-1384.119) (-1387.421) (-1386.428) [-1389.229] -- 0:02:37
203500 -- (-1391.442) (-1386.834) [-1386.722] (-1386.414) * (-1384.497) (-1385.291) (-1388.899) [-1385.947] -- 0:02:36
204000 -- (-1387.322) [-1384.376] (-1389.874) (-1386.371) * [-1385.654] (-1386.105) (-1385.008) (-1389.806) -- 0:02:36
204500 -- (-1391.028) (-1387.128) [-1386.449] (-1386.934) * (-1388.253) (-1401.797) (-1391.047) [-1386.090] -- 0:02:35
205000 -- (-1385.662) [-1388.548] (-1388.775) (-1385.902) * [-1385.510] (-1394.860) (-1384.471) (-1385.624) -- 0:02:35
Average standard deviation of split frequencies: 0.010298
205500 -- (-1391.082) (-1389.107) [-1388.398] (-1384.029) * (-1386.134) [-1386.726] (-1382.238) (-1394.771) -- 0:02:38
206000 -- [-1390.002] (-1383.667) (-1387.471) (-1385.111) * (-1388.735) (-1392.415) (-1381.142) [-1385.894] -- 0:02:38
206500 -- (-1390.730) (-1386.245) (-1387.180) [-1387.210] * (-1402.193) (-1401.506) [-1383.406] (-1390.488) -- 0:02:37
207000 -- [-1388.760] (-1384.726) (-1382.061) (-1388.216) * (-1396.450) (-1393.661) [-1383.603] (-1386.756) -- 0:02:37
207500 -- (-1390.303) (-1388.938) [-1385.422] (-1387.481) * (-1392.559) (-1391.652) (-1388.327) [-1386.771] -- 0:02:36
208000 -- [-1384.783] (-1389.228) (-1386.094) (-1386.737) * (-1389.905) [-1389.129] (-1393.270) (-1382.972) -- 0:02:36
208500 -- (-1390.478) (-1388.618) (-1383.539) [-1386.558] * (-1396.006) (-1392.338) (-1384.380) [-1383.149] -- 0:02:35
209000 -- (-1391.368) (-1389.416) [-1383.844] (-1387.081) * (-1386.522) (-1389.402) [-1384.469] (-1383.739) -- 0:02:35
209500 -- (-1392.687) (-1382.950) [-1386.177] (-1386.801) * (-1389.460) [-1383.750] (-1382.026) (-1385.353) -- 0:02:34
210000 -- (-1387.609) [-1383.674] (-1384.541) (-1388.665) * (-1386.345) [-1381.436] (-1393.517) (-1383.491) -- 0:02:38
Average standard deviation of split frequencies: 0.011188
210500 -- (-1385.599) [-1384.623] (-1382.888) (-1389.367) * (-1384.057) (-1382.784) (-1387.282) [-1385.323] -- 0:02:37
211000 -- [-1387.566] (-1383.126) (-1387.276) (-1387.894) * (-1383.241) (-1386.276) [-1384.126] (-1384.784) -- 0:02:37
211500 -- (-1384.100) (-1391.337) [-1384.150] (-1395.767) * (-1387.991) (-1389.376) (-1388.020) [-1385.074] -- 0:02:36
212000 -- (-1380.110) (-1388.730) (-1390.239) [-1386.154] * (-1384.918) [-1394.393] (-1392.127) (-1390.811) -- 0:02:36
212500 -- [-1387.922] (-1386.594) (-1388.482) (-1388.908) * [-1389.205] (-1390.945) (-1390.972) (-1385.102) -- 0:02:35
213000 -- (-1384.703) (-1385.058) (-1386.572) [-1383.983] * [-1381.742] (-1383.884) (-1387.257) (-1382.970) -- 0:02:35
213500 -- (-1383.952) [-1383.002] (-1385.246) (-1389.886) * (-1389.343) [-1386.130] (-1394.358) (-1383.672) -- 0:02:34
214000 -- (-1387.737) (-1391.164) (-1388.011) [-1384.735] * (-1392.608) [-1384.729] (-1397.364) (-1383.971) -- 0:02:34
214500 -- (-1387.810) (-1386.932) [-1390.400] (-1382.636) * (-1387.430) [-1388.262] (-1391.634) (-1389.629) -- 0:02:37
215000 -- (-1390.765) [-1382.162] (-1384.588) (-1392.735) * (-1390.378) [-1386.688] (-1393.842) (-1392.866) -- 0:02:37
Average standard deviation of split frequencies: 0.010912
215500 -- [-1386.156] (-1386.428) (-1382.089) (-1389.606) * (-1384.157) (-1383.907) [-1383.836] (-1389.713) -- 0:02:36
216000 -- [-1386.623] (-1384.921) (-1386.090) (-1386.535) * (-1389.336) (-1392.638) (-1392.496) [-1392.813] -- 0:02:36
216500 -- (-1384.952) [-1386.707] (-1385.516) (-1386.702) * (-1391.908) (-1387.825) [-1387.208] (-1384.151) -- 0:02:35
217000 -- (-1389.263) [-1383.090] (-1386.050) (-1383.490) * (-1389.101) (-1384.892) (-1385.225) [-1383.103] -- 0:02:35
217500 -- (-1396.532) (-1387.811) (-1386.153) [-1385.865] * [-1390.444] (-1386.060) (-1389.517) (-1388.640) -- 0:02:34
218000 -- (-1389.555) [-1385.978] (-1387.016) (-1385.981) * [-1390.487] (-1384.630) (-1384.657) (-1380.785) -- 0:02:34
218500 -- [-1383.335] (-1391.168) (-1386.287) (-1388.941) * (-1392.494) [-1387.719] (-1396.714) (-1383.577) -- 0:02:33
219000 -- (-1386.921) (-1387.354) [-1382.438] (-1389.173) * (-1392.699) [-1384.653] (-1390.779) (-1391.206) -- 0:02:33
219500 -- (-1386.762) (-1391.483) [-1385.744] (-1390.551) * (-1388.607) (-1386.809) (-1388.772) [-1382.281] -- 0:02:36
220000 -- (-1391.181) (-1388.534) [-1393.094] (-1382.527) * (-1396.447) [-1385.136] (-1384.121) (-1381.329) -- 0:02:36
Average standard deviation of split frequencies: 0.008545
220500 -- (-1389.431) [-1384.433] (-1387.348) (-1383.140) * (-1387.758) (-1386.026) (-1385.895) [-1383.743] -- 0:02:35
221000 -- (-1393.170) (-1386.224) [-1389.655] (-1392.420) * (-1388.208) [-1385.389] (-1383.298) (-1385.838) -- 0:02:35
221500 -- (-1387.448) [-1386.875] (-1390.022) (-1390.656) * (-1385.239) [-1382.009] (-1385.858) (-1390.491) -- 0:02:34
222000 -- [-1390.329] (-1386.083) (-1386.940) (-1394.558) * (-1385.785) (-1385.625) (-1384.542) [-1385.950] -- 0:02:34
222500 -- (-1396.010) [-1388.128] (-1382.971) (-1385.241) * [-1387.140] (-1389.203) (-1387.306) (-1381.464) -- 0:02:33
223000 -- (-1385.647) (-1387.045) (-1391.265) [-1390.120] * [-1384.407] (-1385.243) (-1389.313) (-1388.426) -- 0:02:33
223500 -- [-1383.437] (-1390.329) (-1380.332) (-1382.837) * [-1382.951] (-1384.750) (-1385.957) (-1388.607) -- 0:02:32
224000 -- (-1389.516) (-1385.280) (-1387.474) [-1384.637] * (-1383.256) (-1383.870) [-1385.216] (-1389.891) -- 0:02:32
224500 -- (-1386.631) (-1390.875) (-1390.437) [-1383.367] * (-1385.330) [-1387.048] (-1383.714) (-1384.923) -- 0:02:35
225000 -- [-1387.103] (-1385.015) (-1390.542) (-1388.169) * (-1387.982) [-1384.581] (-1389.033) (-1386.754) -- 0:02:35
Average standard deviation of split frequencies: 0.009386
225500 -- (-1382.894) (-1386.160) (-1392.512) [-1384.858] * [-1380.814] (-1384.193) (-1381.736) (-1383.870) -- 0:02:34
226000 -- (-1387.356) (-1388.488) [-1384.490] (-1394.620) * (-1386.927) (-1384.999) (-1385.688) [-1384.313] -- 0:02:34
226500 -- (-1389.594) (-1385.143) (-1390.021) [-1386.578] * (-1383.785) [-1384.300] (-1387.130) (-1392.958) -- 0:02:33
227000 -- (-1391.071) [-1382.064] (-1387.307) (-1385.805) * (-1381.800) (-1389.572) [-1385.912] (-1386.583) -- 0:02:33
227500 -- (-1384.955) [-1386.106] (-1393.027) (-1388.517) * (-1378.858) (-1389.241) [-1392.470] (-1398.679) -- 0:02:32
228000 -- (-1394.045) (-1389.672) [-1387.925] (-1392.242) * (-1385.873) (-1385.030) [-1383.299] (-1386.371) -- 0:02:32
228500 -- (-1384.635) (-1389.747) (-1382.581) [-1385.868] * (-1383.868) (-1382.920) (-1386.986) [-1385.466] -- 0:02:31
229000 -- (-1382.335) [-1395.286] (-1386.119) (-1384.679) * [-1387.409] (-1379.011) (-1387.928) (-1388.503) -- 0:02:31
229500 -- (-1385.900) [-1385.558] (-1386.503) (-1382.044) * (-1382.328) [-1383.900] (-1386.060) (-1385.927) -- 0:02:34
230000 -- [-1382.467] (-1386.880) (-1388.046) (-1391.309) * [-1386.989] (-1388.425) (-1386.938) (-1391.472) -- 0:02:34
Average standard deviation of split frequencies: 0.010218
230500 -- (-1382.754) [-1385.537] (-1391.775) (-1384.740) * (-1386.761) (-1392.445) (-1389.393) [-1386.635] -- 0:02:33
231000 -- [-1381.782] (-1385.130) (-1390.840) (-1385.523) * (-1388.918) (-1390.777) [-1383.701] (-1396.283) -- 0:02:33
231500 -- (-1384.887) [-1387.767] (-1390.760) (-1392.856) * (-1390.223) (-1390.787) [-1383.177] (-1384.711) -- 0:02:32
232000 -- [-1382.929] (-1385.953) (-1386.709) (-1389.855) * (-1387.692) (-1389.418) [-1383.823] (-1387.627) -- 0:02:32
232500 -- (-1382.570) (-1383.640) [-1386.175] (-1388.044) * [-1389.861] (-1393.464) (-1394.592) (-1385.741) -- 0:02:31
233000 -- (-1388.426) (-1392.368) (-1386.385) [-1384.458] * [-1384.768] (-1390.915) (-1387.373) (-1389.681) -- 0:02:31
233500 -- (-1396.356) (-1383.842) [-1386.140] (-1385.375) * (-1384.015) (-1394.177) [-1382.881] (-1387.295) -- 0:02:31
234000 -- (-1386.946) (-1392.405) (-1386.345) [-1383.804] * (-1393.894) (-1389.735) (-1387.157) [-1389.232] -- 0:02:33
234500 -- (-1384.961) (-1389.782) (-1388.716) [-1385.771] * (-1393.342) (-1385.229) (-1388.543) [-1387.313] -- 0:02:33
235000 -- (-1383.637) [-1388.496] (-1383.108) (-1388.471) * (-1394.472) [-1385.461] (-1394.512) (-1385.035) -- 0:02:33
Average standard deviation of split frequencies: 0.008989
235500 -- (-1388.073) [-1385.899] (-1386.975) (-1383.838) * (-1393.913) [-1384.404] (-1391.780) (-1386.550) -- 0:02:32
236000 -- (-1390.308) (-1387.352) [-1385.147] (-1388.203) * (-1383.095) [-1385.259] (-1396.124) (-1383.901) -- 0:02:32
236500 -- (-1386.311) [-1388.888] (-1390.031) (-1394.656) * (-1388.027) (-1392.550) [-1386.012] (-1387.539) -- 0:02:31
237000 -- [-1385.496] (-1390.593) (-1386.654) (-1398.385) * (-1387.662) (-1389.057) [-1385.746] (-1382.264) -- 0:02:31
237500 -- (-1387.332) [-1386.279] (-1391.143) (-1391.161) * (-1386.241) [-1389.592] (-1388.144) (-1387.247) -- 0:02:30
238000 -- (-1385.425) (-1390.797) [-1380.569] (-1388.685) * [-1384.817] (-1389.956) (-1390.840) (-1389.247) -- 0:02:30
238500 -- [-1382.951] (-1392.136) (-1387.012) (-1381.105) * [-1383.737] (-1388.603) (-1387.432) (-1388.915) -- 0:02:30
239000 -- [-1383.666] (-1387.410) (-1392.430) (-1384.003) * (-1386.797) [-1388.841] (-1384.936) (-1388.807) -- 0:02:29
239500 -- [-1385.580] (-1391.268) (-1386.071) (-1391.093) * (-1387.312) [-1396.325] (-1388.399) (-1387.981) -- 0:02:32
240000 -- (-1387.378) (-1385.628) [-1386.190] (-1390.458) * (-1386.425) [-1386.954] (-1385.285) (-1385.121) -- 0:02:32
Average standard deviation of split frequencies: 0.008814
240500 -- (-1382.580) [-1389.142] (-1388.257) (-1391.488) * (-1386.014) (-1384.687) [-1387.286] (-1384.537) -- 0:02:31
241000 -- [-1386.492] (-1388.033) (-1385.131) (-1384.154) * (-1390.201) (-1390.855) (-1383.212) [-1381.545] -- 0:02:31
241500 -- (-1392.580) [-1389.117] (-1391.666) (-1383.962) * (-1390.432) (-1391.325) [-1383.683] (-1385.165) -- 0:02:30
242000 -- (-1383.785) [-1385.833] (-1388.134) (-1385.768) * (-1386.401) (-1389.432) [-1383.537] (-1389.700) -- 0:02:30
242500 -- [-1384.971] (-1393.695) (-1389.531) (-1386.923) * (-1391.994) [-1390.880] (-1387.738) (-1396.200) -- 0:02:29
243000 -- (-1390.091) [-1390.861] (-1383.277) (-1391.073) * [-1387.857] (-1393.632) (-1384.892) (-1386.215) -- 0:02:29
243500 -- [-1386.622] (-1384.686) (-1385.649) (-1395.175) * (-1392.582) (-1392.741) (-1393.385) [-1381.967] -- 0:02:29
244000 -- (-1381.833) [-1383.838] (-1381.904) (-1386.006) * (-1387.468) (-1392.178) (-1395.384) [-1383.473] -- 0:02:28
244500 -- (-1382.871) [-1383.558] (-1389.410) (-1385.457) * [-1382.624] (-1391.116) (-1397.427) (-1381.709) -- 0:02:31
245000 -- [-1390.763] (-1387.742) (-1392.452) (-1384.832) * (-1384.122) (-1388.924) [-1388.802] (-1382.021) -- 0:02:31
Average standard deviation of split frequencies: 0.008623
245500 -- [-1384.570] (-1390.778) (-1387.804) (-1387.998) * (-1383.530) [-1393.077] (-1383.782) (-1385.788) -- 0:02:30
246000 -- (-1388.002) (-1387.014) (-1384.850) [-1389.039] * (-1384.022) (-1389.171) [-1388.120] (-1387.633) -- 0:02:30
246500 -- (-1388.373) (-1388.164) [-1387.835] (-1384.699) * (-1387.465) (-1393.949) (-1392.735) [-1384.777] -- 0:02:29
247000 -- (-1388.087) (-1387.418) [-1386.780] (-1392.959) * (-1386.100) [-1385.466] (-1384.477) (-1383.864) -- 0:02:29
247500 -- (-1384.779) (-1384.828) [-1387.132] (-1387.260) * [-1380.746] (-1387.590) (-1391.857) (-1389.051) -- 0:02:28
248000 -- [-1384.344] (-1390.140) (-1387.943) (-1385.099) * (-1382.334) (-1390.824) [-1382.963] (-1383.499) -- 0:02:28
248500 -- (-1388.417) [-1384.254] (-1386.560) (-1390.038) * [-1388.886] (-1385.778) (-1384.867) (-1384.542) -- 0:02:28
249000 -- (-1387.575) (-1387.611) [-1382.451] (-1387.508) * (-1381.364) (-1390.633) (-1384.462) [-1391.602] -- 0:02:27
249500 -- (-1387.871) (-1389.382) [-1392.132] (-1384.392) * (-1387.264) [-1389.778] (-1388.807) (-1386.077) -- 0:02:30
250000 -- (-1388.183) [-1385.923] (-1390.719) (-1387.712) * (-1389.526) [-1391.143] (-1389.211) (-1386.495) -- 0:02:30
Average standard deviation of split frequencies: 0.006582
250500 -- (-1391.360) (-1389.422) (-1385.987) [-1387.785] * [-1384.461] (-1386.725) (-1387.369) (-1397.209) -- 0:02:29
251000 -- [-1388.091] (-1388.774) (-1391.929) (-1394.148) * [-1382.448] (-1385.346) (-1394.370) (-1393.053) -- 0:02:29
251500 -- (-1387.912) (-1397.369) [-1397.310] (-1392.976) * (-1383.746) (-1384.287) (-1386.713) [-1391.920] -- 0:02:28
252000 -- [-1389.202] (-1392.116) (-1389.022) (-1395.166) * (-1387.762) (-1383.624) [-1386.125] (-1394.109) -- 0:02:28
252500 -- [-1384.921] (-1383.322) (-1383.069) (-1391.251) * [-1384.050] (-1390.868) (-1389.987) (-1391.347) -- 0:02:28
253000 -- (-1387.757) [-1386.862] (-1393.833) (-1384.198) * (-1393.688) [-1387.179] (-1391.959) (-1391.831) -- 0:02:27
253500 -- (-1390.324) (-1383.443) [-1386.932] (-1387.402) * [-1387.000] (-1384.767) (-1388.082) (-1383.046) -- 0:02:27
254000 -- (-1382.214) (-1390.542) [-1384.771] (-1387.933) * (-1385.375) [-1382.256] (-1390.038) (-1385.507) -- 0:02:26
254500 -- (-1384.818) (-1382.040) [-1382.050] (-1389.564) * (-1387.252) [-1387.410] (-1382.590) (-1391.298) -- 0:02:29
255000 -- (-1385.237) [-1380.709] (-1384.231) (-1385.295) * (-1388.550) (-1388.277) [-1388.490] (-1386.254) -- 0:02:29
Average standard deviation of split frequencies: 0.007366
255500 -- [-1385.053] (-1386.894) (-1393.484) (-1384.548) * (-1387.790) (-1391.647) [-1392.458] (-1387.317) -- 0:02:28
256000 -- (-1391.720) (-1386.455) [-1384.973] (-1384.518) * (-1385.705) (-1387.625) [-1381.679] (-1392.380) -- 0:02:28
256500 -- (-1382.778) (-1391.989) (-1386.059) [-1380.801] * [-1383.981] (-1387.514) (-1391.676) (-1382.648) -- 0:02:27
257000 -- (-1381.186) [-1380.775] (-1386.466) (-1388.475) * [-1387.987] (-1388.850) (-1388.952) (-1382.326) -- 0:02:27
257500 -- (-1389.288) (-1385.669) [-1385.370] (-1384.218) * (-1385.655) (-1388.703) [-1386.428] (-1385.364) -- 0:02:27
258000 -- [-1386.504] (-1392.122) (-1389.940) (-1383.653) * (-1391.549) [-1380.947] (-1382.689) (-1389.057) -- 0:02:26
258500 -- [-1388.405] (-1384.829) (-1391.300) (-1381.239) * (-1390.979) (-1384.726) [-1388.451] (-1385.106) -- 0:02:26
259000 -- (-1387.013) (-1386.160) (-1386.621) [-1384.282] * (-1391.911) (-1380.782) (-1389.971) [-1387.372] -- 0:02:25
259500 -- (-1384.408) [-1389.464] (-1388.091) (-1384.572) * [-1387.871] (-1388.875) (-1384.569) (-1388.502) -- 0:02:28
260000 -- [-1385.773] (-1387.901) (-1383.329) (-1388.072) * (-1386.058) [-1384.383] (-1388.411) (-1385.322) -- 0:02:28
Average standard deviation of split frequencies: 0.007234
260500 -- (-1383.167) (-1391.742) [-1384.694] (-1389.746) * (-1383.827) (-1388.969) (-1386.988) [-1382.725] -- 0:02:27
261000 -- (-1382.584) (-1391.873) [-1385.661] (-1391.611) * [-1381.466] (-1386.566) (-1387.258) (-1383.565) -- 0:02:27
261500 -- [-1386.279] (-1390.587) (-1385.439) (-1386.507) * (-1388.601) (-1386.509) (-1386.794) [-1388.812] -- 0:02:26
262000 -- (-1385.070) (-1385.941) [-1384.771] (-1384.790) * [-1386.241] (-1386.870) (-1387.726) (-1385.856) -- 0:02:26
262500 -- [-1383.993] (-1388.254) (-1387.131) (-1386.696) * (-1389.013) [-1387.019] (-1382.875) (-1385.481) -- 0:02:26
263000 -- (-1388.617) (-1393.029) (-1387.460) [-1384.551] * (-1385.098) (-1383.323) (-1386.758) [-1383.893] -- 0:02:25
263500 -- (-1384.544) (-1388.067) (-1385.885) [-1381.045] * (-1385.950) (-1387.140) (-1391.809) [-1387.899] -- 0:02:25
264000 -- (-1386.879) [-1388.423] (-1391.020) (-1384.991) * [-1384.670] (-1384.257) (-1396.805) (-1389.895) -- 0:02:24
264500 -- (-1384.818) (-1382.655) [-1395.841] (-1385.077) * [-1385.398] (-1384.377) (-1394.778) (-1385.422) -- 0:02:24
265000 -- (-1387.077) (-1386.149) [-1396.646] (-1390.234) * (-1391.972) [-1386.920] (-1387.211) (-1386.603) -- 0:02:27
Average standard deviation of split frequencies: 0.005317
265500 -- (-1385.531) (-1384.989) [-1389.789] (-1387.610) * (-1396.873) [-1384.543] (-1385.511) (-1387.537) -- 0:02:26
266000 -- (-1383.599) (-1385.770) (-1395.236) [-1380.371] * (-1396.169) [-1390.783] (-1383.044) (-1389.751) -- 0:02:26
266500 -- (-1382.252) [-1386.409] (-1389.170) (-1388.250) * (-1389.212) (-1384.927) (-1387.563) [-1390.567] -- 0:02:25
267000 -- [-1385.348] (-1386.114) (-1388.173) (-1392.833) * (-1389.223) (-1393.986) [-1385.025] (-1386.866) -- 0:02:25
267500 -- [-1382.749] (-1388.544) (-1387.791) (-1385.033) * (-1387.199) (-1390.503) [-1392.721] (-1387.788) -- 0:02:25
268000 -- (-1391.149) (-1386.237) [-1386.444] (-1395.606) * [-1386.545] (-1395.668) (-1388.453) (-1384.232) -- 0:02:24
268500 -- (-1383.928) (-1396.413) (-1383.362) [-1389.754] * (-1392.835) (-1391.260) (-1390.053) [-1386.205] -- 0:02:24
269000 -- (-1386.196) (-1389.670) (-1387.221) [-1384.392] * (-1389.835) (-1387.263) (-1392.520) [-1384.391] -- 0:02:24
269500 -- (-1383.024) (-1386.105) (-1387.664) [-1385.979] * (-1390.388) [-1388.544] (-1388.934) (-1384.206) -- 0:02:23
270000 -- (-1381.286) (-1392.105) [-1382.704] (-1389.133) * (-1391.753) (-1384.458) (-1397.341) [-1384.881] -- 0:02:26
Average standard deviation of split frequencies: 0.006096
270500 -- [-1382.905] (-1386.795) (-1385.349) (-1389.293) * [-1381.144] (-1391.317) (-1393.796) (-1385.814) -- 0:02:25
271000 -- (-1381.914) [-1389.284] (-1385.331) (-1385.143) * (-1386.052) (-1386.006) [-1384.204] (-1382.968) -- 0:02:25
271500 -- [-1386.949] (-1392.735) (-1389.037) (-1386.597) * (-1384.903) (-1389.411) [-1383.650] (-1392.953) -- 0:02:24
272000 -- (-1384.381) (-1385.201) [-1381.173] (-1389.772) * (-1383.079) (-1385.776) [-1381.705] (-1388.586) -- 0:02:24
272500 -- [-1388.726] (-1381.226) (-1392.313) (-1388.292) * (-1385.103) (-1386.853) [-1386.597] (-1388.847) -- 0:02:24
273000 -- [-1380.687] (-1392.911) (-1381.955) (-1398.432) * [-1389.410] (-1391.561) (-1391.564) (-1386.243) -- 0:02:23
273500 -- [-1382.925] (-1383.310) (-1387.425) (-1390.682) * [-1390.504] (-1390.909) (-1387.604) (-1391.301) -- 0:02:23
274000 -- (-1388.757) [-1384.000] (-1386.641) (-1392.099) * [-1385.734] (-1388.821) (-1387.342) (-1402.382) -- 0:02:23
274500 -- [-1392.611] (-1384.763) (-1392.492) (-1388.123) * [-1387.544] (-1388.226) (-1385.349) (-1391.380) -- 0:02:22
275000 -- (-1398.654) [-1384.486] (-1389.550) (-1392.436) * (-1385.643) (-1386.238) (-1381.741) [-1388.870] -- 0:02:25
Average standard deviation of split frequencies: 0.005978
275500 -- (-1382.402) [-1384.490] (-1383.804) (-1388.922) * [-1386.081] (-1386.919) (-1387.466) (-1384.897) -- 0:02:24
276000 -- [-1389.573] (-1387.874) (-1384.082) (-1388.640) * (-1390.721) [-1380.708] (-1388.591) (-1392.211) -- 0:02:24
276500 -- (-1395.290) (-1386.234) (-1383.756) [-1386.935] * [-1390.385] (-1386.439) (-1385.849) (-1384.221) -- 0:02:23
277000 -- (-1392.327) (-1392.655) (-1388.795) [-1389.019] * (-1384.835) (-1386.494) (-1385.767) [-1385.273] -- 0:02:23
277500 -- (-1387.128) (-1382.189) [-1386.335] (-1398.629) * (-1385.560) (-1394.588) (-1388.046) [-1382.411] -- 0:02:23
278000 -- [-1383.633] (-1388.159) (-1385.983) (-1391.640) * (-1396.799) (-1389.923) (-1389.789) [-1383.073] -- 0:02:22
278500 -- (-1382.372) (-1388.678) (-1383.772) [-1387.127] * (-1389.643) (-1397.063) (-1393.519) [-1386.431] -- 0:02:22
279000 -- [-1381.485] (-1392.289) (-1385.736) (-1390.066) * (-1397.677) [-1383.521] (-1386.362) (-1391.020) -- 0:02:22
279500 -- (-1387.745) (-1388.160) [-1387.379] (-1390.786) * [-1388.669] (-1387.317) (-1391.187) (-1391.110) -- 0:02:21
280000 -- (-1382.908) (-1384.790) (-1390.379) [-1385.240] * (-1385.168) (-1381.044) [-1388.504] (-1396.728) -- 0:02:24
Average standard deviation of split frequencies: 0.005879
280500 -- [-1383.849] (-1394.438) (-1383.712) (-1385.046) * (-1383.360) (-1382.464) (-1388.455) [-1382.364] -- 0:02:23
281000 -- (-1386.178) (-1390.320) [-1385.102] (-1388.609) * (-1388.122) (-1387.565) [-1387.383] (-1385.200) -- 0:02:23
281500 -- (-1386.641) (-1387.253) (-1390.680) [-1393.148] * [-1387.026] (-1391.478) (-1383.578) (-1384.340) -- 0:02:22
282000 -- (-1389.162) [-1384.608] (-1385.454) (-1381.337) * (-1390.556) (-1382.265) [-1385.549] (-1395.510) -- 0:02:22
282500 -- (-1388.447) (-1385.250) (-1387.070) [-1381.967] * (-1388.670) (-1388.042) [-1384.143] (-1384.695) -- 0:02:22
283000 -- (-1390.923) [-1387.149] (-1389.216) (-1385.715) * [-1387.149] (-1388.482) (-1395.174) (-1390.225) -- 0:02:21
283500 -- (-1387.165) (-1387.571) (-1388.599) [-1383.672] * [-1386.478] (-1385.934) (-1393.126) (-1387.949) -- 0:02:21
284000 -- (-1385.987) (-1387.950) [-1391.544] (-1387.226) * (-1386.265) (-1382.794) [-1388.525] (-1390.596) -- 0:02:21
284500 -- (-1391.321) [-1384.826] (-1390.708) (-1382.557) * [-1386.326] (-1381.870) (-1388.688) (-1387.675) -- 0:02:20
285000 -- (-1388.732) (-1389.291) (-1382.768) [-1384.118] * (-1379.640) [-1382.507] (-1388.339) (-1383.846) -- 0:02:23
Average standard deviation of split frequencies: 0.006593
285500 -- (-1393.558) (-1387.332) [-1385.164] (-1387.203) * (-1384.158) (-1387.423) (-1384.970) [-1383.237] -- 0:02:22
286000 -- (-1389.323) (-1392.738) [-1385.052] (-1386.071) * [-1380.663] (-1389.324) (-1383.629) (-1384.141) -- 0:02:22
286500 -- (-1385.404) [-1392.431] (-1385.276) (-1387.000) * (-1384.520) (-1386.991) [-1390.216] (-1386.785) -- 0:02:21
287000 -- [-1386.096] (-1398.871) (-1387.665) (-1398.004) * (-1391.519) [-1381.834] (-1383.832) (-1381.659) -- 0:02:21
287500 -- [-1383.335] (-1394.562) (-1388.650) (-1387.088) * (-1383.779) [-1383.801] (-1387.268) (-1381.744) -- 0:02:21
288000 -- [-1385.343] (-1392.640) (-1399.170) (-1383.260) * [-1383.861] (-1384.359) (-1385.275) (-1384.313) -- 0:02:20
288500 -- [-1384.702] (-1393.950) (-1391.327) (-1382.598) * [-1385.193] (-1385.269) (-1383.980) (-1387.569) -- 0:02:20
289000 -- (-1387.033) (-1387.520) (-1381.770) [-1381.251] * [-1393.001] (-1395.719) (-1384.798) (-1384.115) -- 0:02:20
289500 -- (-1385.360) (-1386.096) [-1385.132] (-1385.329) * (-1390.682) (-1388.357) [-1385.290] (-1386.475) -- 0:02:19
290000 -- [-1385.834] (-1393.185) (-1388.544) (-1383.038) * [-1384.257] (-1386.915) (-1382.164) (-1383.475) -- 0:02:22
Average standard deviation of split frequencies: 0.006487
290500 -- (-1387.833) [-1384.015] (-1391.639) (-1386.669) * (-1393.054) (-1392.631) (-1389.375) [-1383.887] -- 0:02:21
291000 -- (-1396.306) (-1384.617) (-1383.586) [-1386.387] * (-1386.150) (-1388.136) [-1388.494] (-1385.378) -- 0:02:21
291500 -- (-1388.949) (-1385.482) [-1382.248] (-1388.295) * (-1382.316) (-1389.822) (-1393.246) [-1383.528] -- 0:02:20
292000 -- (-1390.413) [-1397.221] (-1390.142) (-1389.163) * (-1386.273) [-1386.660] (-1388.254) (-1392.636) -- 0:02:20
292500 -- (-1395.744) [-1387.061] (-1382.709) (-1389.099) * (-1384.350) [-1383.398] (-1394.609) (-1394.890) -- 0:02:20
293000 -- (-1390.649) (-1385.992) [-1388.655] (-1391.451) * (-1387.475) (-1381.602) (-1398.483) [-1383.927] -- 0:02:19
293500 -- [-1389.858] (-1392.616) (-1384.608) (-1388.859) * (-1386.263) [-1385.075] (-1394.183) (-1384.527) -- 0:02:19
294000 -- (-1390.023) (-1384.864) [-1387.869] (-1384.131) * [-1386.043] (-1384.705) (-1392.471) (-1385.523) -- 0:02:19
294500 -- [-1391.453] (-1394.510) (-1387.737) (-1385.698) * (-1386.685) (-1391.919) (-1388.684) [-1388.387] -- 0:02:18
295000 -- (-1381.440) (-1384.143) (-1390.810) [-1385.869] * (-1383.595) [-1388.342] (-1385.082) (-1382.181) -- 0:02:18
Average standard deviation of split frequencies: 0.008759
295500 -- (-1386.804) (-1383.565) (-1395.099) [-1382.861] * [-1386.897] (-1391.871) (-1384.666) (-1385.188) -- 0:02:20
296000 -- (-1389.112) (-1383.101) (-1386.604) [-1386.584] * [-1388.167] (-1388.531) (-1390.842) (-1386.623) -- 0:02:20
296500 -- (-1389.819) [-1384.333] (-1393.975) (-1385.493) * (-1385.854) (-1384.949) (-1388.221) [-1383.103] -- 0:02:19
297000 -- (-1384.284) (-1383.430) [-1388.084] (-1385.620) * (-1386.788) (-1383.534) (-1388.300) [-1383.544] -- 0:02:19
297500 -- (-1386.248) [-1385.503] (-1384.364) (-1384.868) * (-1386.106) [-1381.774] (-1386.882) (-1389.519) -- 0:02:19
298000 -- [-1390.469] (-1383.693) (-1397.779) (-1392.173) * [-1383.972] (-1383.916) (-1384.970) (-1383.505) -- 0:02:18
298500 -- (-1386.339) (-1388.353) [-1383.782] (-1384.093) * (-1389.940) (-1385.155) [-1382.971] (-1389.916) -- 0:02:18
299000 -- (-1385.453) (-1386.793) [-1381.729] (-1386.010) * (-1391.060) (-1388.089) (-1384.657) [-1385.416] -- 0:02:18
299500 -- [-1386.583] (-1388.657) (-1384.246) (-1386.598) * (-1394.017) (-1389.469) (-1390.590) [-1387.114] -- 0:02:17
300000 -- (-1394.272) (-1393.243) [-1386.156] (-1391.555) * (-1388.511) (-1386.338) (-1384.705) [-1382.081] -- 0:02:17
Average standard deviation of split frequencies: 0.008623
300500 -- (-1391.599) [-1390.268] (-1388.578) (-1391.130) * (-1394.348) (-1395.034) (-1387.458) [-1383.329] -- 0:02:19
301000 -- (-1388.466) (-1399.317) [-1383.080] (-1390.758) * (-1390.466) (-1387.229) (-1385.512) [-1385.392] -- 0:02:19
301500 -- (-1386.539) [-1386.845] (-1384.695) (-1390.087) * (-1388.137) [-1385.975] (-1387.521) (-1383.553) -- 0:02:19
302000 -- (-1385.184) [-1389.529] (-1386.799) (-1390.243) * (-1391.877) (-1388.403) (-1382.334) [-1382.959] -- 0:02:18
302500 -- [-1384.039] (-1387.707) (-1383.230) (-1388.017) * (-1387.870) (-1386.173) (-1383.431) [-1382.707] -- 0:02:18
303000 -- (-1382.421) (-1383.573) (-1386.282) [-1381.747] * (-1394.050) (-1382.982) (-1386.376) [-1389.767] -- 0:02:18
303500 -- (-1386.590) [-1388.411] (-1383.622) (-1382.838) * (-1386.256) [-1387.091] (-1389.782) (-1386.391) -- 0:02:17
304000 -- (-1382.785) (-1385.387) [-1380.806] (-1387.364) * [-1382.768] (-1384.251) (-1386.572) (-1380.212) -- 0:02:17
304500 -- [-1384.929] (-1392.521) (-1387.788) (-1393.692) * (-1383.976) [-1383.242] (-1386.481) (-1394.082) -- 0:02:17
305000 -- (-1384.757) (-1385.098) (-1387.346) [-1388.438] * [-1387.317] (-1388.893) (-1383.661) (-1386.148) -- 0:02:16
Average standard deviation of split frequencies: 0.006932
305500 -- [-1384.881] (-1387.037) (-1388.913) (-1382.538) * (-1389.268) (-1390.888) [-1384.012] (-1385.404) -- 0:02:18
306000 -- (-1386.045) (-1386.228) [-1384.219] (-1392.976) * (-1385.994) (-1384.705) [-1384.434] (-1391.246) -- 0:02:18
306500 -- (-1382.189) [-1380.893] (-1386.621) (-1389.621) * (-1384.718) [-1386.750] (-1386.335) (-1383.364) -- 0:02:18
307000 -- (-1380.658) (-1381.608) (-1383.583) [-1387.587] * (-1389.116) [-1383.799] (-1395.121) (-1389.080) -- 0:02:17
307500 -- (-1382.114) [-1384.663] (-1386.666) (-1392.018) * (-1384.197) (-1385.091) (-1388.751) [-1387.799] -- 0:02:17
308000 -- (-1387.560) (-1384.566) [-1382.408] (-1385.903) * (-1385.915) [-1385.542] (-1388.479) (-1383.099) -- 0:02:17
308500 -- (-1384.680) (-1390.344) [-1385.865] (-1385.969) * (-1388.779) (-1385.429) [-1385.421] (-1394.221) -- 0:02:16
309000 -- [-1383.859] (-1384.810) (-1382.527) (-1382.145) * (-1388.877) (-1384.666) [-1383.828] (-1385.561) -- 0:02:16
309500 -- (-1382.816) (-1386.757) (-1385.044) [-1391.791] * (-1387.678) [-1382.513] (-1389.608) (-1386.936) -- 0:02:16
310000 -- [-1384.085] (-1383.237) (-1389.675) (-1383.311) * [-1388.197] (-1383.102) (-1387.694) (-1384.958) -- 0:02:15
Average standard deviation of split frequencies: 0.006828
310500 -- (-1387.838) (-1385.003) (-1388.933) [-1383.355] * (-1384.288) (-1381.509) [-1385.353] (-1383.566) -- 0:02:17
311000 -- (-1384.249) (-1391.648) (-1381.672) [-1384.522] * (-1387.516) [-1384.639] (-1386.896) (-1387.652) -- 0:02:17
311500 -- (-1387.237) (-1384.762) [-1385.494] (-1389.479) * (-1389.756) (-1382.326) [-1381.631] (-1387.182) -- 0:02:17
312000 -- (-1388.045) [-1384.671] (-1386.829) (-1384.469) * (-1385.614) (-1383.616) (-1383.191) [-1387.156] -- 0:02:16
312500 -- (-1394.849) [-1388.085] (-1391.676) (-1389.783) * [-1390.119] (-1392.381) (-1390.421) (-1387.268) -- 0:02:16
313000 -- [-1387.519] (-1391.297) (-1388.663) (-1387.619) * (-1395.596) (-1390.399) [-1382.629] (-1392.786) -- 0:02:16
313500 -- (-1386.958) (-1384.940) [-1386.101] (-1385.587) * (-1387.273) [-1382.393] (-1392.864) (-1385.565) -- 0:02:15
314000 -- (-1388.808) [-1390.266] (-1385.783) (-1388.497) * (-1394.393) [-1390.322] (-1392.548) (-1386.325) -- 0:02:15
314500 -- (-1389.935) (-1387.508) (-1387.814) [-1383.496] * [-1383.135] (-1387.766) (-1389.593) (-1392.129) -- 0:02:15
315000 -- [-1383.099] (-1390.191) (-1387.661) (-1382.349) * (-1384.445) [-1388.578] (-1386.775) (-1388.073) -- 0:02:14
Average standard deviation of split frequencies: 0.005967
315500 -- [-1384.727] (-1387.456) (-1391.530) (-1387.365) * (-1387.244) (-1388.489) (-1383.084) [-1384.389] -- 0:02:14
316000 -- (-1388.562) (-1386.599) [-1388.122] (-1384.021) * [-1381.178] (-1387.084) (-1395.407) (-1383.965) -- 0:02:16
316500 -- (-1386.036) [-1390.491] (-1384.043) (-1384.452) * (-1391.748) (-1389.760) [-1386.727] (-1391.974) -- 0:02:16
317000 -- (-1384.762) (-1386.833) (-1381.710) [-1384.972] * (-1390.567) (-1387.215) (-1389.837) [-1386.244] -- 0:02:15
317500 -- (-1387.069) [-1391.514] (-1386.118) (-1382.841) * (-1387.330) (-1381.218) (-1387.972) [-1383.817] -- 0:02:15
318000 -- [-1385.011] (-1388.666) (-1387.287) (-1388.777) * (-1384.741) [-1382.726] (-1393.420) (-1388.656) -- 0:02:15
318500 -- (-1387.428) (-1386.053) (-1387.936) [-1384.080] * (-1384.976) (-1385.174) (-1389.085) [-1380.068] -- 0:02:14
319000 -- (-1386.425) (-1384.906) (-1384.217) [-1382.541] * (-1387.982) (-1387.363) (-1382.206) [-1382.982] -- 0:02:14
319500 -- [-1385.403] (-1385.118) (-1391.913) (-1381.126) * (-1385.523) [-1383.273] (-1384.448) (-1387.496) -- 0:02:14
320000 -- (-1388.963) (-1390.893) (-1386.877) [-1379.551] * (-1386.355) (-1384.357) (-1388.166) [-1385.429] -- 0:02:13
Average standard deviation of split frequencies: 0.004410
320500 -- (-1380.522) [-1387.580] (-1390.789) (-1383.467) * (-1385.332) (-1380.628) (-1385.694) [-1387.312] -- 0:02:13
321000 -- (-1384.421) [-1386.798] (-1386.546) (-1381.624) * (-1384.368) (-1387.763) (-1390.824) [-1385.301] -- 0:02:15
321500 -- (-1383.512) (-1383.879) (-1391.703) [-1381.330] * (-1383.412) [-1384.470] (-1390.360) (-1388.597) -- 0:02:15
322000 -- (-1385.461) [-1383.193] (-1387.448) (-1384.661) * (-1382.156) (-1381.109) [-1385.956] (-1389.862) -- 0:02:14
322500 -- (-1389.876) (-1384.440) (-1385.821) [-1383.228] * (-1385.339) [-1385.825] (-1387.198) (-1391.178) -- 0:02:14
323000 -- (-1387.220) (-1388.883) (-1387.523) [-1385.115] * (-1382.296) (-1384.505) (-1387.878) [-1387.442] -- 0:02:14
323500 -- [-1389.923] (-1390.554) (-1383.801) (-1388.104) * (-1384.797) [-1380.055] (-1397.423) (-1390.437) -- 0:02:13
324000 -- (-1393.135) (-1394.699) (-1388.469) [-1394.378] * (-1388.020) (-1389.351) [-1386.871] (-1383.312) -- 0:02:13
324500 -- (-1392.831) (-1389.479) [-1384.780] (-1387.098) * (-1388.971) (-1388.014) (-1388.035) [-1389.075] -- 0:02:13
325000 -- (-1405.122) (-1389.524) [-1385.531] (-1390.582) * [-1385.218] (-1391.469) (-1387.330) (-1385.248) -- 0:02:12
Average standard deviation of split frequencies: 0.004338
325500 -- [-1385.200] (-1387.045) (-1387.647) (-1392.561) * [-1384.532] (-1382.207) (-1393.826) (-1387.085) -- 0:02:12
326000 -- (-1383.591) (-1387.237) (-1388.899) [-1391.879] * [-1389.729] (-1385.542) (-1394.270) (-1388.104) -- 0:02:14
326500 -- [-1389.407] (-1386.396) (-1392.545) (-1387.069) * (-1393.009) (-1391.556) [-1383.510] (-1391.327) -- 0:02:14
327000 -- [-1385.192] (-1386.042) (-1385.394) (-1388.640) * (-1387.086) (-1387.811) (-1383.050) [-1387.544] -- 0:02:13
327500 -- (-1390.016) [-1390.524] (-1386.495) (-1392.795) * [-1382.726] (-1390.707) (-1386.386) (-1387.962) -- 0:02:13
328000 -- (-1389.146) (-1382.740) (-1392.381) [-1392.291] * (-1383.788) (-1390.639) [-1387.161] (-1385.598) -- 0:02:13
328500 -- [-1389.465] (-1384.237) (-1384.996) (-1392.806) * (-1384.665) (-1391.834) (-1383.399) [-1380.348] -- 0:02:12
329000 -- (-1384.794) (-1383.892) [-1382.606] (-1395.013) * (-1391.849) (-1390.412) [-1387.011] (-1385.590) -- 0:02:12
329500 -- (-1390.497) (-1389.929) [-1382.896] (-1395.184) * (-1388.878) [-1386.631] (-1390.479) (-1387.563) -- 0:02:12
330000 -- (-1387.897) (-1387.198) [-1381.613] (-1400.981) * (-1386.701) [-1389.175] (-1390.928) (-1388.366) -- 0:02:11
Average standard deviation of split frequencies: 0.005702
330500 -- (-1387.171) (-1387.762) [-1381.850] (-1396.408) * (-1386.035) [-1387.811] (-1382.554) (-1385.058) -- 0:02:11
331000 -- (-1393.529) (-1386.836) [-1384.331] (-1385.200) * [-1384.571] (-1393.709) (-1383.348) (-1385.213) -- 0:02:13
331500 -- (-1392.123) [-1389.822] (-1388.474) (-1389.845) * (-1380.415) (-1400.407) (-1388.223) [-1387.030] -- 0:02:13
332000 -- (-1396.255) (-1389.047) [-1391.933] (-1384.071) * (-1385.357) [-1390.771] (-1386.989) (-1387.767) -- 0:02:12
332500 -- (-1387.539) (-1390.456) [-1389.435] (-1386.921) * [-1383.966] (-1395.840) (-1386.374) (-1390.462) -- 0:02:12
333000 -- (-1389.207) (-1392.988) [-1386.723] (-1388.504) * (-1383.912) (-1384.366) (-1381.316) [-1386.722] -- 0:02:12
333500 -- (-1393.581) (-1384.616) [-1386.773] (-1393.355) * (-1388.385) [-1388.364] (-1381.978) (-1393.347) -- 0:02:11
334000 -- [-1383.685] (-1390.839) (-1383.981) (-1381.790) * [-1392.819] (-1392.015) (-1386.000) (-1383.095) -- 0:02:11
334500 -- (-1385.776) (-1388.176) (-1388.892) [-1380.795] * [-1389.960] (-1386.120) (-1388.738) (-1392.558) -- 0:02:11
335000 -- (-1391.055) (-1386.393) (-1384.259) [-1383.606] * (-1391.511) (-1390.477) [-1391.404] (-1385.186) -- 0:02:11
Average standard deviation of split frequencies: 0.004910
335500 -- (-1384.196) (-1386.553) (-1391.057) [-1385.264] * (-1388.220) [-1382.960] (-1385.952) (-1384.467) -- 0:02:10
336000 -- [-1380.118] (-1387.192) (-1386.257) (-1381.320) * [-1383.150] (-1382.862) (-1386.717) (-1387.394) -- 0:02:12
336500 -- (-1390.845) (-1388.783) [-1387.351] (-1388.478) * (-1391.614) [-1384.723] (-1390.771) (-1383.629) -- 0:02:12
337000 -- (-1385.932) [-1390.855] (-1386.765) (-1390.304) * [-1385.893] (-1385.469) (-1384.777) (-1383.116) -- 0:02:11
337500 -- (-1382.731) (-1387.644) [-1385.580] (-1386.657) * (-1382.948) [-1383.844] (-1384.013) (-1385.308) -- 0:02:11
338000 -- [-1382.423] (-1384.458) (-1391.322) (-1384.986) * (-1390.668) (-1396.020) (-1388.745) [-1388.133] -- 0:02:11
338500 -- (-1384.972) (-1386.096) [-1386.843] (-1384.565) * (-1393.670) (-1383.926) [-1387.103] (-1388.497) -- 0:02:10
339000 -- (-1385.934) (-1385.233) [-1383.374] (-1384.757) * (-1385.180) [-1382.250] (-1386.243) (-1384.360) -- 0:02:10
339500 -- (-1388.691) (-1386.980) [-1387.368] (-1388.741) * (-1388.939) (-1383.820) [-1380.571] (-1383.186) -- 0:02:10
340000 -- [-1386.567] (-1387.490) (-1385.862) (-1383.371) * (-1384.164) (-1385.672) (-1383.945) [-1385.296] -- 0:02:10
Average standard deviation of split frequencies: 0.004843
340500 -- (-1384.306) [-1385.006] (-1393.252) (-1382.307) * (-1384.657) (-1384.152) (-1383.248) [-1384.693] -- 0:02:09
341000 -- (-1384.416) (-1386.865) [-1387.130] (-1386.920) * (-1384.746) [-1387.204] (-1389.144) (-1389.651) -- 0:02:11
341500 -- (-1383.544) [-1388.762] (-1387.207) (-1386.395) * [-1381.093] (-1391.925) (-1390.565) (-1382.419) -- 0:02:11
342000 -- (-1388.163) [-1390.102] (-1390.256) (-1383.519) * (-1390.188) (-1389.920) (-1384.726) [-1385.682] -- 0:02:10
342500 -- (-1387.060) (-1388.468) (-1386.430) [-1388.549] * (-1388.686) [-1385.169] (-1384.977) (-1385.925) -- 0:02:10
343000 -- (-1386.691) (-1398.060) [-1384.788] (-1384.460) * (-1385.175) (-1385.130) (-1386.457) [-1389.164] -- 0:02:10
343500 -- (-1388.222) (-1392.300) [-1386.610] (-1388.153) * (-1383.161) (-1389.785) (-1390.010) [-1389.297] -- 0:02:09
344000 -- (-1387.095) (-1396.270) (-1386.070) [-1384.448] * (-1382.692) (-1383.861) (-1383.741) [-1381.982] -- 0:02:09
344500 -- (-1390.745) (-1387.730) [-1387.120] (-1391.031) * (-1394.389) (-1385.150) [-1387.598] (-1387.057) -- 0:02:09
345000 -- [-1385.354] (-1394.620) (-1385.597) (-1382.374) * (-1388.391) (-1393.673) (-1387.375) [-1383.675] -- 0:02:09
Average standard deviation of split frequencies: 0.003406
345500 -- [-1382.377] (-1387.909) (-1384.754) (-1388.604) * (-1390.321) (-1394.715) [-1390.522] (-1384.096) -- 0:02:08
346000 -- (-1392.576) (-1388.966) (-1383.915) [-1387.449] * [-1387.541] (-1383.985) (-1388.641) (-1382.596) -- 0:02:10
346500 -- (-1382.075) (-1383.841) [-1383.672] (-1384.588) * (-1381.824) [-1383.035] (-1382.670) (-1383.272) -- 0:02:10
347000 -- (-1382.993) (-1393.196) [-1383.483] (-1393.187) * (-1384.526) (-1392.427) (-1388.124) [-1382.856] -- 0:02:09
347500 -- (-1386.462) (-1385.083) (-1386.250) [-1386.374] * (-1385.894) (-1384.547) [-1390.311] (-1383.102) -- 0:02:09
348000 -- (-1388.169) [-1382.813] (-1382.801) (-1385.790) * [-1384.436] (-1389.782) (-1388.717) (-1387.777) -- 0:02:09
348500 -- (-1388.891) (-1384.960) (-1385.366) [-1382.791] * (-1385.320) [-1380.556] (-1385.162) (-1384.504) -- 0:02:08
349000 -- (-1385.931) (-1386.873) [-1393.835] (-1388.643) * (-1387.492) [-1390.297] (-1381.460) (-1383.221) -- 0:02:08
349500 -- [-1382.025] (-1384.659) (-1388.422) (-1382.646) * (-1384.903) [-1384.638] (-1384.705) (-1383.667) -- 0:02:08
350000 -- (-1383.441) (-1386.038) (-1388.605) [-1383.308] * (-1389.680) (-1387.269) (-1385.867) [-1381.114] -- 0:02:08
Average standard deviation of split frequencies: 0.003361
350500 -- [-1384.995] (-1385.986) (-1387.150) (-1385.955) * (-1386.222) (-1391.243) [-1390.195] (-1385.307) -- 0:02:07
351000 -- (-1383.684) [-1383.121] (-1389.069) (-1387.364) * (-1386.705) [-1383.335] (-1395.161) (-1387.233) -- 0:02:09
351500 -- (-1387.556) [-1386.916] (-1388.353) (-1385.142) * (-1390.879) (-1384.792) (-1399.098) [-1383.760] -- 0:02:09
352000 -- (-1385.277) (-1385.527) (-1388.964) [-1385.442] * (-1387.448) (-1388.331) (-1394.539) [-1381.496] -- 0:02:08
352500 -- (-1389.178) (-1381.267) [-1384.862] (-1384.316) * (-1385.211) (-1381.066) (-1385.245) [-1383.375] -- 0:02:08
353000 -- (-1384.241) [-1382.642] (-1385.241) (-1384.592) * (-1394.435) [-1382.009] (-1382.810) (-1384.621) -- 0:02:08
353500 -- (-1390.244) (-1385.812) [-1386.640] (-1389.627) * (-1385.057) (-1393.620) [-1384.773] (-1386.476) -- 0:02:08
354000 -- (-1391.283) (-1379.127) [-1387.235] (-1391.281) * (-1389.291) (-1385.377) [-1385.698] (-1384.773) -- 0:02:07
354500 -- (-1389.130) (-1383.298) (-1384.684) [-1383.403] * (-1390.532) (-1386.187) [-1386.551] (-1389.376) -- 0:02:07
355000 -- (-1383.344) [-1385.128] (-1385.613) (-1387.847) * (-1385.146) (-1391.356) (-1391.587) [-1382.957] -- 0:02:07
Average standard deviation of split frequencies: 0.003310
355500 -- (-1394.220) (-1382.050) [-1385.521] (-1383.557) * (-1391.539) (-1391.598) (-1384.592) [-1382.240] -- 0:02:06
356000 -- (-1385.302) (-1380.420) (-1384.230) [-1382.592] * (-1387.866) (-1386.428) (-1384.463) [-1384.336] -- 0:02:06
356500 -- (-1390.266) [-1383.596] (-1385.762) (-1390.196) * (-1384.434) (-1385.476) [-1391.745] (-1384.001) -- 0:02:08
357000 -- (-1383.870) (-1385.220) [-1386.212] (-1384.972) * (-1404.986) [-1388.358] (-1386.360) (-1381.416) -- 0:02:07
357500 -- (-1385.050) (-1384.343) (-1387.818) [-1384.346] * (-1399.982) [-1385.957] (-1383.305) (-1386.289) -- 0:02:07
358000 -- (-1393.223) (-1382.603) (-1389.140) [-1392.094] * (-1388.410) (-1386.198) (-1386.903) [-1386.632] -- 0:02:07
358500 -- (-1394.496) (-1390.944) [-1383.163] (-1385.855) * (-1383.730) (-1384.632) (-1395.308) [-1382.059] -- 0:02:07
359000 -- (-1381.371) (-1388.389) [-1383.693] (-1383.174) * (-1390.934) (-1386.038) (-1394.183) [-1380.598] -- 0:02:06
359500 -- [-1385.856] (-1383.801) (-1382.184) (-1382.460) * (-1385.724) (-1387.495) (-1387.835) [-1383.516] -- 0:02:06
360000 -- [-1386.161] (-1388.460) (-1382.695) (-1385.981) * (-1386.826) (-1386.986) (-1394.467) [-1385.768] -- 0:02:06
Average standard deviation of split frequencies: 0.003268
360500 -- [-1386.289] (-1389.177) (-1390.481) (-1389.470) * (-1392.688) (-1390.233) (-1390.951) [-1389.345] -- 0:02:05
361000 -- (-1393.802) (-1393.889) [-1383.730] (-1390.563) * (-1385.471) (-1385.343) [-1385.353] (-1389.423) -- 0:02:05
361500 -- (-1389.588) (-1396.562) [-1393.001] (-1385.611) * (-1387.025) [-1382.929] (-1383.142) (-1381.663) -- 0:02:07
362000 -- (-1393.610) (-1396.132) (-1386.778) [-1389.427] * (-1390.531) (-1382.538) (-1383.587) [-1383.484] -- 0:02:06
362500 -- [-1388.233] (-1390.361) (-1388.526) (-1392.239) * (-1392.340) (-1391.167) [-1383.701] (-1387.981) -- 0:02:06
363000 -- [-1385.604] (-1390.947) (-1385.907) (-1386.693) * (-1389.985) [-1385.108] (-1385.420) (-1385.036) -- 0:02:06
363500 -- (-1387.487) (-1381.658) (-1381.921) [-1389.570] * (-1395.750) [-1381.322] (-1390.832) (-1396.841) -- 0:02:06
364000 -- (-1381.906) (-1389.809) [-1387.155] (-1389.190) * (-1401.376) [-1385.970] (-1387.693) (-1390.062) -- 0:02:05
364500 -- (-1385.101) [-1383.376] (-1382.072) (-1387.078) * [-1387.909] (-1381.679) (-1388.956) (-1382.391) -- 0:02:05
365000 -- (-1392.855) (-1380.728) (-1386.676) [-1386.368] * (-1393.185) (-1385.187) (-1384.936) [-1385.263] -- 0:02:05
Average standard deviation of split frequencies: 0.005152
365500 -- (-1395.183) [-1385.483] (-1386.170) (-1384.225) * [-1393.389] (-1385.355) (-1385.506) (-1384.268) -- 0:02:04
366000 -- (-1391.097) (-1395.184) (-1390.892) [-1383.459] * (-1392.400) [-1386.899] (-1391.788) (-1387.718) -- 0:02:04
366500 -- (-1398.745) (-1384.657) [-1386.242] (-1382.576) * (-1388.230) [-1384.738] (-1386.650) (-1384.838) -- 0:02:06
367000 -- (-1393.634) (-1384.711) (-1388.229) [-1386.282] * (-1394.163) (-1389.848) (-1388.264) [-1389.109] -- 0:02:05
367500 -- (-1400.612) [-1384.959] (-1390.127) (-1389.699) * (-1385.980) (-1385.866) (-1394.144) [-1382.024] -- 0:02:05
368000 -- (-1386.613) (-1388.086) (-1390.773) [-1381.701] * (-1390.193) [-1384.715] (-1387.296) (-1387.498) -- 0:02:05
368500 -- [-1384.476] (-1395.629) (-1393.945) (-1382.864) * (-1392.221) (-1391.072) (-1385.571) [-1383.421] -- 0:02:05
369000 -- (-1390.178) (-1389.382) (-1388.339) [-1383.013] * [-1391.479] (-1386.127) (-1388.820) (-1388.302) -- 0:02:04
369500 -- (-1392.696) (-1394.040) (-1383.058) [-1390.462] * [-1385.209] (-1389.431) (-1389.620) (-1385.623) -- 0:02:04
370000 -- (-1384.518) (-1398.760) [-1383.789] (-1386.945) * (-1389.202) [-1391.124] (-1382.676) (-1380.738) -- 0:02:04
Average standard deviation of split frequencies: 0.005723
370500 -- [-1386.269] (-1393.435) (-1385.040) (-1387.413) * (-1381.559) (-1393.199) (-1382.315) [-1385.757] -- 0:02:04
371000 -- [-1384.637] (-1390.627) (-1387.106) (-1386.127) * (-1384.116) [-1389.556] (-1380.741) (-1383.880) -- 0:02:03
371500 -- (-1382.682) [-1384.567] (-1390.207) (-1394.194) * [-1386.177] (-1397.938) (-1384.632) (-1390.194) -- 0:02:05
372000 -- (-1384.256) [-1383.786] (-1390.591) (-1392.126) * [-1387.050] (-1384.564) (-1387.027) (-1387.110) -- 0:02:04
372500 -- (-1387.695) [-1388.952] (-1390.687) (-1386.105) * (-1383.150) (-1380.640) (-1388.748) [-1381.399] -- 0:02:04
373000 -- [-1385.986] (-1388.434) (-1392.912) (-1383.493) * [-1383.496] (-1384.154) (-1390.775) (-1392.005) -- 0:02:04
373500 -- (-1383.847) (-1389.433) [-1388.567] (-1385.082) * [-1385.995] (-1394.096) (-1385.739) (-1388.437) -- 0:02:04
374000 -- [-1388.332] (-1391.249) (-1388.075) (-1385.375) * (-1386.949) (-1392.522) [-1381.432] (-1382.191) -- 0:02:03
374500 -- (-1387.337) (-1385.458) (-1395.233) [-1383.521] * (-1390.108) (-1391.839) (-1386.375) [-1383.926] -- 0:02:03
375000 -- (-1384.231) (-1382.740) (-1390.433) [-1387.142] * (-1384.842) (-1384.180) [-1387.712] (-1381.434) -- 0:02:03
Average standard deviation of split frequencies: 0.006896
375500 -- [-1389.317] (-1387.837) (-1395.489) (-1393.265) * (-1388.681) (-1384.349) [-1383.469] (-1384.379) -- 0:02:03
376000 -- (-1384.899) (-1386.445) (-1394.330) [-1387.420] * (-1389.675) (-1395.745) (-1381.537) [-1385.040] -- 0:02:02
376500 -- [-1383.809] (-1391.393) (-1383.252) (-1388.089) * [-1384.627] (-1390.456) (-1385.757) (-1389.449) -- 0:02:04
377000 -- (-1383.035) [-1388.926] (-1388.069) (-1395.466) * (-1387.671) [-1387.177] (-1386.432) (-1387.907) -- 0:02:03
377500 -- [-1380.877] (-1391.771) (-1388.575) (-1384.755) * [-1387.477] (-1386.578) (-1389.003) (-1382.374) -- 0:02:03
378000 -- (-1385.677) (-1386.736) (-1388.953) [-1384.198] * (-1384.757) (-1389.419) [-1384.591] (-1385.238) -- 0:02:03
378500 -- (-1390.395) (-1389.745) [-1388.821] (-1382.871) * (-1386.213) (-1384.018) (-1383.847) [-1385.583] -- 0:02:03
379000 -- (-1381.860) (-1395.194) (-1404.213) [-1383.438] * [-1384.655] (-1388.857) (-1392.418) (-1384.472) -- 0:02:02
379500 -- (-1383.985) (-1396.981) (-1382.644) [-1384.191] * (-1386.195) [-1389.496] (-1388.553) (-1389.626) -- 0:02:02
380000 -- (-1383.531) [-1389.741] (-1382.317) (-1384.325) * (-1384.644) [-1385.775] (-1384.753) (-1384.002) -- 0:02:02
Average standard deviation of split frequencies: 0.008049
380500 -- (-1384.645) (-1393.340) [-1383.253] (-1385.092) * [-1387.956] (-1388.524) (-1386.182) (-1384.088) -- 0:02:02
381000 -- [-1384.023] (-1395.795) (-1388.966) (-1387.900) * (-1388.438) (-1388.523) [-1385.738] (-1387.670) -- 0:02:01
381500 -- (-1386.083) (-1391.595) (-1383.863) [-1389.737] * (-1385.637) [-1381.015] (-1383.269) (-1391.649) -- 0:02:03
382000 -- (-1383.057) (-1384.861) [-1386.745] (-1389.553) * (-1389.165) [-1384.778] (-1382.714) (-1392.629) -- 0:02:02
382500 -- (-1389.433) [-1390.409] (-1393.627) (-1386.752) * (-1388.309) (-1387.028) (-1394.143) [-1389.714] -- 0:02:02
383000 -- (-1385.341) (-1390.230) (-1388.686) [-1386.385] * (-1384.390) (-1387.634) (-1382.635) [-1390.658] -- 0:02:02
383500 -- (-1387.655) (-1389.936) (-1386.997) [-1388.580] * [-1390.112] (-1386.600) (-1389.839) (-1388.476) -- 0:02:02
384000 -- (-1386.430) [-1390.646] (-1388.363) (-1383.210) * (-1386.749) (-1395.602) (-1389.514) [-1389.846] -- 0:02:01
384500 -- (-1388.141) (-1389.791) [-1380.857] (-1387.553) * (-1388.964) (-1389.261) (-1384.495) [-1387.136] -- 0:02:01
385000 -- (-1389.242) (-1381.404) [-1381.155] (-1386.060) * [-1382.344] (-1386.686) (-1384.212) (-1390.955) -- 0:02:01
Average standard deviation of split frequencies: 0.007938
385500 -- [-1382.542] (-1387.150) (-1389.358) (-1391.991) * (-1386.699) (-1383.956) [-1382.236] (-1387.440) -- 0:02:01
386000 -- (-1383.386) [-1387.243] (-1388.619) (-1389.718) * (-1385.120) [-1385.302] (-1388.459) (-1387.469) -- 0:02:00
386500 -- (-1392.598) (-1393.479) [-1387.658] (-1390.315) * (-1395.595) (-1382.736) [-1386.313] (-1383.495) -- 0:02:02
387000 -- [-1386.494] (-1391.182) (-1382.968) (-1392.652) * (-1390.613) (-1390.009) (-1384.814) [-1382.252] -- 0:02:01
387500 -- (-1387.328) [-1385.111] (-1387.951) (-1387.337) * [-1387.700] (-1390.820) (-1385.697) (-1383.602) -- 0:02:01
388000 -- (-1384.000) (-1388.784) (-1392.055) [-1383.056] * (-1387.578) (-1387.759) [-1383.879] (-1391.484) -- 0:02:01
388500 -- (-1391.078) (-1386.256) (-1385.616) [-1384.689] * (-1386.878) (-1391.437) [-1383.413] (-1385.535) -- 0:02:01
389000 -- (-1388.838) (-1386.215) (-1386.448) [-1382.435] * [-1381.850] (-1391.028) (-1386.055) (-1392.252) -- 0:02:00
389500 -- (-1387.897) (-1390.829) [-1388.606] (-1389.113) * [-1383.017] (-1382.465) (-1387.174) (-1380.450) -- 0:02:00
390000 -- [-1386.372] (-1390.089) (-1390.762) (-1389.648) * (-1386.096) [-1386.892] (-1384.693) (-1390.158) -- 0:02:00
Average standard deviation of split frequencies: 0.007843
390500 -- (-1394.344) (-1387.244) [-1385.829] (-1387.848) * (-1384.798) (-1391.962) [-1386.119] (-1393.280) -- 0:02:00
391000 -- (-1384.279) (-1390.149) (-1388.206) [-1389.228] * (-1393.100) (-1389.851) [-1389.572] (-1400.223) -- 0:01:59
391500 -- (-1388.054) [-1388.614] (-1387.665) (-1389.180) * [-1381.905] (-1386.107) (-1394.606) (-1394.477) -- 0:02:01
392000 -- (-1387.833) (-1389.915) (-1385.624) [-1391.568] * [-1391.808] (-1389.790) (-1388.716) (-1389.831) -- 0:02:00
392500 -- [-1386.395] (-1386.905) (-1391.455) (-1391.450) * (-1387.168) [-1393.936] (-1387.038) (-1392.722) -- 0:02:00
393000 -- (-1388.952) (-1387.126) [-1391.103] (-1390.581) * (-1385.753) (-1389.989) (-1386.313) [-1390.027] -- 0:02:00
393500 -- [-1382.881] (-1384.058) (-1385.866) (-1388.803) * (-1384.821) (-1392.978) (-1388.599) [-1385.023] -- 0:02:00
394000 -- (-1388.282) [-1386.353] (-1388.230) (-1389.749) * (-1383.301) (-1382.900) [-1392.680] (-1389.358) -- 0:01:59
394500 -- (-1389.317) (-1388.414) (-1386.526) [-1387.015] * (-1381.889) (-1389.150) [-1386.215] (-1394.159) -- 0:01:59
395000 -- (-1388.461) (-1385.893) (-1383.981) [-1386.912] * (-1387.919) [-1383.705] (-1391.459) (-1389.104) -- 0:01:59
Average standard deviation of split frequencies: 0.008333
395500 -- [-1386.450] (-1388.521) (-1387.723) (-1385.778) * (-1386.420) (-1384.184) [-1388.746] (-1387.455) -- 0:01:59
396000 -- [-1384.006] (-1385.876) (-1379.880) (-1389.399) * (-1391.271) [-1383.672] (-1389.082) (-1389.703) -- 0:01:58
396500 -- (-1386.862) (-1387.895) (-1388.557) [-1385.360] * [-1391.657] (-1383.476) (-1388.506) (-1394.243) -- 0:02:00
397000 -- [-1382.862] (-1385.917) (-1386.137) (-1382.333) * (-1397.183) [-1383.837] (-1392.239) (-1391.591) -- 0:01:59
397500 -- (-1386.610) [-1384.888] (-1389.535) (-1384.200) * (-1385.455) (-1387.402) [-1387.875] (-1386.917) -- 0:01:59
398000 -- (-1387.602) (-1395.526) (-1389.207) [-1387.341] * (-1398.428) (-1392.386) (-1385.454) [-1387.782] -- 0:01:59
398500 -- (-1393.009) (-1386.683) (-1393.937) [-1386.534] * (-1397.930) [-1387.383] (-1395.453) (-1382.123) -- 0:01:59
399000 -- [-1385.847] (-1384.778) (-1389.574) (-1389.902) * [-1392.091] (-1392.543) (-1385.439) (-1390.929) -- 0:01:58
399500 -- (-1385.099) (-1385.569) (-1385.976) [-1383.423] * (-1387.746) (-1386.571) (-1381.352) [-1384.070] -- 0:01:58
400000 -- [-1385.413] (-1386.925) (-1388.318) (-1392.322) * (-1386.499) (-1385.529) (-1383.592) [-1386.817] -- 0:01:58
Average standard deviation of split frequencies: 0.008236
400500 -- [-1386.480] (-1385.390) (-1388.375) (-1383.698) * [-1382.735] (-1385.805) (-1381.123) (-1387.793) -- 0:01:58
401000 -- [-1387.773] (-1384.158) (-1384.628) (-1390.689) * [-1383.091] (-1382.374) (-1388.395) (-1390.455) -- 0:01:58
401500 -- [-1388.326] (-1378.973) (-1392.724) (-1383.695) * (-1391.413) (-1382.445) [-1381.520] (-1387.427) -- 0:01:59
402000 -- (-1385.494) (-1380.349) [-1385.221] (-1392.180) * (-1391.443) (-1386.512) (-1383.483) [-1387.051] -- 0:01:59
402500 -- (-1387.687) (-1386.732) (-1387.853) [-1389.045] * (-1385.504) [-1387.474] (-1383.811) (-1388.106) -- 0:01:58
403000 -- [-1387.228] (-1393.542) (-1379.773) (-1392.018) * [-1390.459] (-1391.552) (-1391.357) (-1382.848) -- 0:01:58
403500 -- [-1387.051] (-1388.335) (-1384.714) (-1388.864) * (-1388.159) (-1399.795) [-1385.959] (-1385.234) -- 0:01:58
404000 -- (-1388.803) (-1386.264) (-1388.694) [-1386.838] * (-1386.948) (-1391.500) [-1382.788] (-1390.113) -- 0:01:58
404500 -- (-1385.529) (-1394.471) (-1392.541) [-1388.802] * [-1383.307] (-1390.774) (-1383.653) (-1383.903) -- 0:01:57
405000 -- (-1389.004) [-1383.671] (-1386.899) (-1389.996) * (-1382.373) (-1392.952) [-1387.949] (-1393.143) -- 0:01:57
Average standard deviation of split frequencies: 0.008128
405500 -- [-1382.048] (-1386.274) (-1397.945) (-1388.300) * (-1385.118) (-1388.728) (-1385.716) [-1388.936] -- 0:01:57
406000 -- (-1385.166) [-1382.329] (-1394.346) (-1383.416) * (-1389.088) (-1397.811) [-1382.148] (-1385.778) -- 0:01:57
406500 -- (-1381.959) (-1384.936) (-1394.831) [-1386.044] * [-1388.077] (-1394.639) (-1395.008) (-1388.312) -- 0:01:58
407000 -- (-1388.207) [-1383.741] (-1388.472) (-1389.822) * (-1389.045) (-1387.628) (-1386.675) [-1388.768] -- 0:01:58
407500 -- (-1384.239) [-1381.197] (-1393.152) (-1396.046) * (-1384.025) (-1390.086) (-1387.728) [-1388.539] -- 0:01:57
408000 -- [-1384.100] (-1388.079) (-1392.655) (-1390.389) * [-1382.583] (-1381.929) (-1385.496) (-1393.795) -- 0:01:57
408500 -- (-1386.268) [-1386.806] (-1389.421) (-1391.144) * (-1383.627) [-1387.990] (-1383.952) (-1393.783) -- 0:01:57
409000 -- [-1384.954] (-1381.578) (-1389.708) (-1384.797) * [-1385.652] (-1393.842) (-1384.782) (-1388.793) -- 0:01:57
409500 -- (-1386.603) (-1391.864) [-1386.244] (-1387.630) * [-1382.644] (-1394.788) (-1388.391) (-1390.905) -- 0:01:56
410000 -- (-1392.951) (-1396.567) [-1382.767] (-1383.359) * [-1381.746] (-1385.766) (-1388.970) (-1386.135) -- 0:01:56
Average standard deviation of split frequencies: 0.007461
410500 -- (-1384.080) (-1395.092) [-1381.838] (-1385.877) * (-1386.252) [-1391.821] (-1388.602) (-1386.983) -- 0:01:56
411000 -- (-1385.409) (-1390.674) (-1382.431) [-1383.321] * (-1392.839) (-1387.794) [-1382.252] (-1394.845) -- 0:01:56
411500 -- [-1388.282] (-1395.619) (-1383.033) (-1385.359) * [-1382.877] (-1393.698) (-1383.793) (-1385.137) -- 0:01:57
412000 -- (-1383.725) [-1389.655] (-1384.859) (-1396.648) * (-1382.307) (-1387.739) [-1384.099] (-1386.184) -- 0:01:57
412500 -- (-1383.064) (-1387.321) [-1387.440] (-1389.823) * (-1381.641) [-1384.386] (-1386.904) (-1386.891) -- 0:01:56
413000 -- (-1390.228) (-1389.186) (-1385.958) [-1380.907] * [-1382.820] (-1383.708) (-1384.616) (-1384.812) -- 0:01:56
413500 -- (-1391.320) (-1387.930) (-1388.707) [-1387.191] * (-1391.015) [-1383.033] (-1385.596) (-1385.957) -- 0:01:56
414000 -- [-1384.432] (-1388.928) (-1387.183) (-1393.008) * (-1387.565) [-1386.990] (-1385.447) (-1394.871) -- 0:01:56
414500 -- (-1390.967) (-1382.128) [-1392.284] (-1386.969) * (-1385.531) (-1393.515) (-1382.710) [-1382.535] -- 0:01:55
415000 -- (-1386.920) [-1378.777] (-1385.324) (-1388.073) * [-1388.904] (-1388.533) (-1380.670) (-1386.312) -- 0:01:55
Average standard deviation of split frequencies: 0.007932
415500 -- [-1386.565] (-1383.773) (-1393.392) (-1393.159) * (-1382.932) (-1393.149) (-1381.016) [-1386.769] -- 0:01:55
416000 -- (-1383.492) (-1381.806) (-1383.554) [-1383.260] * [-1385.427] (-1386.279) (-1388.685) (-1382.894) -- 0:01:55
416500 -- (-1385.446) [-1386.576] (-1391.193) (-1391.663) * [-1390.314] (-1389.678) (-1386.159) (-1385.409) -- 0:01:56
417000 -- [-1382.441] (-1384.961) (-1384.880) (-1394.063) * (-1389.897) (-1391.164) (-1385.579) [-1382.584] -- 0:01:56
417500 -- (-1386.303) [-1385.447] (-1390.915) (-1387.446) * [-1386.924] (-1386.066) (-1387.898) (-1385.712) -- 0:01:55
418000 -- (-1384.271) (-1384.931) (-1388.475) [-1386.078] * [-1386.942] (-1382.512) (-1386.320) (-1385.320) -- 0:01:55
418500 -- [-1383.904] (-1389.716) (-1382.854) (-1388.668) * [-1381.630] (-1381.818) (-1386.508) (-1387.211) -- 0:01:55
419000 -- (-1384.654) (-1389.364) [-1385.848] (-1393.581) * (-1382.413) (-1389.896) (-1386.356) [-1383.669] -- 0:01:55
419500 -- (-1392.765) [-1387.073] (-1385.926) (-1389.848) * (-1383.536) [-1391.841] (-1383.846) (-1386.710) -- 0:01:54
420000 -- [-1391.757] (-1394.215) (-1390.335) (-1383.922) * [-1385.894] (-1390.474) (-1390.204) (-1382.282) -- 0:01:54
Average standard deviation of split frequencies: 0.007844
420500 -- (-1389.445) (-1388.451) [-1383.329] (-1389.456) * (-1387.517) (-1386.607) [-1387.789] (-1384.881) -- 0:01:54
421000 -- (-1388.278) (-1390.197) [-1385.947] (-1385.768) * [-1384.811] (-1388.666) (-1386.975) (-1385.569) -- 0:01:54
421500 -- [-1388.032] (-1389.538) (-1390.524) (-1384.930) * (-1391.471) (-1384.368) [-1383.700] (-1384.139) -- 0:01:55
422000 -- [-1390.506] (-1392.248) (-1392.982) (-1394.432) * (-1392.112) (-1386.994) (-1387.328) [-1387.126] -- 0:01:55
422500 -- (-1386.313) (-1393.280) [-1384.928] (-1388.980) * (-1389.332) (-1392.573) (-1386.139) [-1386.470] -- 0:01:54
423000 -- (-1386.947) (-1388.804) [-1387.539] (-1388.250) * [-1385.171] (-1386.559) (-1385.654) (-1390.407) -- 0:01:54
423500 -- [-1384.024] (-1397.342) (-1384.224) (-1387.906) * (-1385.680) (-1381.436) (-1392.188) [-1385.949] -- 0:01:54
424000 -- (-1386.018) (-1386.570) (-1385.998) [-1387.688] * (-1384.390) (-1391.878) (-1387.814) [-1385.099] -- 0:01:54
424500 -- (-1386.844) [-1383.161] (-1389.558) (-1390.994) * [-1382.489] (-1389.019) (-1386.734) (-1382.232) -- 0:01:53
425000 -- (-1390.701) [-1383.500] (-1385.110) (-1388.524) * (-1383.664) (-1385.232) [-1386.310] (-1383.406) -- 0:01:53
Average standard deviation of split frequencies: 0.007746
425500 -- (-1393.997) (-1384.172) (-1389.516) [-1384.408] * (-1390.294) [-1384.164] (-1383.728) (-1389.202) -- 0:01:53
426000 -- [-1387.664] (-1385.010) (-1392.302) (-1388.582) * [-1383.255] (-1390.144) (-1386.723) (-1387.382) -- 0:01:53
426500 -- (-1386.154) [-1387.605] (-1385.041) (-1388.989) * (-1385.171) (-1386.914) (-1389.722) [-1382.779] -- 0:01:54
427000 -- (-1386.045) [-1380.021] (-1387.604) (-1389.011) * [-1385.516] (-1384.988) (-1393.532) (-1383.621) -- 0:01:54
427500 -- [-1382.224] (-1388.474) (-1385.907) (-1396.223) * (-1384.546) [-1381.213] (-1394.661) (-1389.378) -- 0:01:53
428000 -- (-1388.203) (-1385.023) [-1388.389] (-1394.348) * [-1380.905] (-1384.187) (-1388.774) (-1381.592) -- 0:01:53
428500 -- (-1391.509) (-1386.500) [-1390.105] (-1384.584) * (-1387.319) [-1383.582] (-1391.460) (-1384.475) -- 0:01:53
429000 -- (-1394.472) (-1387.372) [-1384.615] (-1382.559) * (-1385.484) (-1382.340) (-1387.539) [-1382.246] -- 0:01:53
429500 -- (-1389.585) [-1385.136] (-1384.143) (-1389.912) * [-1381.035] (-1382.375) (-1389.305) (-1386.328) -- 0:01:52
430000 -- (-1388.785) (-1382.809) (-1385.423) [-1388.842] * (-1382.451) [-1383.020] (-1388.370) (-1385.420) -- 0:01:52
Average standard deviation of split frequencies: 0.006568
430500 -- [-1386.666] (-1386.954) (-1392.355) (-1388.956) * (-1395.591) [-1383.540] (-1384.842) (-1385.274) -- 0:01:52
431000 -- (-1390.879) (-1382.876) (-1388.262) [-1386.489] * (-1387.280) (-1387.619) [-1390.466] (-1387.821) -- 0:01:52
431500 -- (-1387.794) (-1383.621) [-1388.216] (-1385.828) * (-1388.952) [-1387.569] (-1391.918) (-1385.479) -- 0:01:53
432000 -- (-1388.525) [-1387.666] (-1382.837) (-1384.365) * (-1384.562) (-1387.806) (-1382.730) [-1384.521] -- 0:01:53
432500 -- (-1388.946) [-1383.953] (-1385.828) (-1385.455) * (-1380.658) [-1385.675] (-1381.451) (-1392.921) -- 0:01:52
433000 -- (-1383.326) (-1387.948) [-1391.150] (-1386.059) * (-1383.643) (-1383.186) (-1391.260) [-1384.683] -- 0:01:52
433500 -- (-1386.509) [-1385.611] (-1389.990) (-1391.443) * (-1383.481) (-1395.584) (-1384.661) [-1380.486] -- 0:01:52
434000 -- (-1384.180) (-1387.540) (-1390.738) [-1382.355] * (-1388.260) (-1390.348) (-1387.413) [-1381.302] -- 0:01:52
434500 -- [-1387.128] (-1387.741) (-1393.762) (-1384.098) * (-1383.772) (-1386.930) (-1387.216) [-1388.532] -- 0:01:51
435000 -- (-1385.169) (-1391.662) (-1396.295) [-1383.593] * (-1385.780) (-1386.975) (-1386.265) [-1384.547] -- 0:01:51
Average standard deviation of split frequencies: 0.005947
435500 -- (-1389.208) [-1389.243] (-1392.298) (-1379.852) * [-1385.761] (-1387.469) (-1390.233) (-1387.481) -- 0:01:51
436000 -- [-1391.234] (-1384.435) (-1384.457) (-1388.500) * (-1385.588) [-1384.627] (-1383.552) (-1391.640) -- 0:01:51
436500 -- (-1389.017) (-1391.406) (-1391.311) [-1391.487] * (-1385.531) [-1386.669] (-1385.412) (-1388.136) -- 0:01:52
437000 -- (-1387.322) (-1385.814) [-1389.699] (-1389.486) * (-1384.663) [-1388.541] (-1393.692) (-1389.826) -- 0:01:52
437500 -- (-1384.574) (-1394.474) (-1385.475) [-1384.354] * (-1391.019) [-1384.534] (-1388.118) (-1386.829) -- 0:01:51
438000 -- (-1389.274) (-1387.395) [-1386.996] (-1390.461) * (-1389.943) (-1387.404) (-1388.337) [-1391.040] -- 0:01:51
438500 -- (-1388.370) [-1385.229] (-1387.970) (-1389.641) * [-1393.809] (-1388.412) (-1388.368) (-1387.911) -- 0:01:51
439000 -- (-1387.209) [-1383.845] (-1385.338) (-1391.022) * (-1392.881) [-1390.239] (-1385.127) (-1385.808) -- 0:01:51
439500 -- [-1383.391] (-1385.179) (-1392.532) (-1382.464) * [-1387.259] (-1395.658) (-1387.386) (-1387.346) -- 0:01:50
440000 -- (-1387.882) (-1385.735) (-1382.568) [-1383.077] * (-1389.510) (-1391.630) [-1388.999] (-1385.394) -- 0:01:50
Average standard deviation of split frequencies: 0.004814
440500 -- (-1384.067) [-1381.648] (-1390.558) (-1387.816) * [-1387.596] (-1391.218) (-1387.025) (-1386.911) -- 0:01:50
441000 -- [-1381.915] (-1383.446) (-1388.500) (-1382.739) * (-1389.428) (-1388.875) (-1387.320) [-1390.798] -- 0:01:50
441500 -- (-1387.349) (-1393.106) [-1388.859] (-1381.131) * [-1389.427] (-1391.109) (-1388.603) (-1384.236) -- 0:01:51
442000 -- (-1388.081) [-1383.081] (-1390.466) (-1389.210) * (-1394.834) (-1386.340) [-1382.679] (-1384.839) -- 0:01:51
442500 -- (-1384.103) [-1384.347] (-1384.630) (-1388.901) * (-1387.329) (-1386.580) [-1385.163] (-1384.652) -- 0:01:50
443000 -- (-1394.356) (-1384.477) [-1387.030] (-1387.268) * (-1386.481) (-1391.500) (-1386.409) [-1384.911] -- 0:01:50
443500 -- (-1382.156) (-1389.838) [-1389.298] (-1386.994) * (-1393.558) (-1388.956) [-1388.567] (-1391.960) -- 0:01:50
444000 -- (-1387.123) [-1384.494] (-1386.233) (-1384.584) * (-1389.428) (-1388.668) [-1383.919] (-1385.009) -- 0:01:50
444500 -- [-1384.898] (-1385.466) (-1385.441) (-1387.023) * (-1385.386) [-1388.782] (-1392.381) (-1383.094) -- 0:01:49
445000 -- (-1386.117) (-1386.528) [-1386.959] (-1385.540) * [-1383.380] (-1383.451) (-1389.450) (-1385.733) -- 0:01:49
Average standard deviation of split frequencies: 0.003699
445500 -- [-1381.982] (-1384.230) (-1396.285) (-1392.635) * (-1384.511) (-1384.355) [-1381.176] (-1383.964) -- 0:01:49
446000 -- (-1390.834) [-1384.092] (-1387.909) (-1395.321) * (-1386.804) [-1383.676] (-1395.694) (-1385.775) -- 0:01:49
446500 -- (-1383.595) (-1391.738) [-1386.174] (-1394.748) * (-1386.000) [-1390.820] (-1383.737) (-1391.161) -- 0:01:50
447000 -- (-1382.854) (-1387.564) [-1382.369] (-1392.396) * (-1383.665) (-1381.909) (-1385.939) [-1386.027] -- 0:01:50
447500 -- (-1385.439) [-1384.398] (-1382.090) (-1392.555) * (-1391.932) (-1383.849) [-1385.176] (-1381.915) -- 0:01:49
448000 -- (-1385.943) (-1398.641) (-1382.966) [-1382.819] * [-1386.471] (-1386.421) (-1385.343) (-1389.428) -- 0:01:49
448500 -- (-1389.265) (-1390.090) (-1381.922) [-1393.177] * [-1384.059] (-1384.972) (-1380.878) (-1391.302) -- 0:01:49
449000 -- (-1392.773) [-1387.566] (-1383.245) (-1387.360) * (-1383.323) (-1384.689) [-1385.815] (-1392.217) -- 0:01:49
449500 -- (-1381.207) [-1386.347] (-1386.045) (-1391.031) * (-1385.845) [-1387.101] (-1386.797) (-1389.907) -- 0:01:48
450000 -- (-1390.279) (-1384.176) [-1382.029] (-1386.216) * (-1393.704) (-1390.994) [-1380.746] (-1388.484) -- 0:01:48
Average standard deviation of split frequencies: 0.002615
450500 -- (-1386.023) (-1388.603) [-1386.877] (-1383.355) * (-1384.703) [-1389.677] (-1385.540) (-1385.131) -- 0:01:48
451000 -- (-1387.905) (-1386.138) (-1387.401) [-1386.613] * (-1386.586) (-1389.240) (-1391.036) [-1387.184] -- 0:01:48
451500 -- (-1388.116) (-1389.006) (-1385.593) [-1386.124] * (-1386.239) (-1390.169) (-1391.026) [-1386.809] -- 0:01:49
452000 -- (-1382.381) (-1393.903) (-1389.411) [-1384.226] * (-1391.988) (-1396.428) [-1385.903] (-1389.695) -- 0:01:49
452500 -- (-1386.824) (-1399.428) [-1385.546] (-1390.552) * (-1389.938) [-1387.741] (-1388.541) (-1388.780) -- 0:01:48
453000 -- (-1385.927) (-1390.289) [-1387.506] (-1386.872) * (-1386.568) [-1387.086] (-1382.718) (-1388.094) -- 0:01:48
453500 -- [-1386.532] (-1385.777) (-1388.617) (-1387.639) * (-1388.163) (-1384.313) (-1389.587) [-1393.272] -- 0:01:48
454000 -- (-1383.528) (-1386.606) (-1392.269) [-1387.869] * (-1385.039) (-1394.008) (-1387.757) [-1388.525] -- 0:01:48
454500 -- (-1381.954) (-1388.275) (-1383.240) [-1385.240] * (-1393.230) (-1387.383) (-1390.814) [-1385.947] -- 0:01:48
455000 -- (-1387.283) [-1381.984] (-1387.518) (-1387.262) * [-1385.468] (-1383.147) (-1384.480) (-1384.044) -- 0:01:47
Average standard deviation of split frequencies: 0.001551
455500 -- (-1382.939) (-1387.277) (-1383.684) [-1387.003] * (-1385.341) (-1386.072) (-1385.684) [-1380.005] -- 0:01:47
456000 -- [-1381.144] (-1399.530) (-1386.729) (-1381.391) * [-1381.270] (-1385.970) (-1387.720) (-1383.969) -- 0:01:47
456500 -- [-1385.004] (-1384.838) (-1390.713) (-1388.422) * [-1386.363] (-1383.128) (-1382.678) (-1389.101) -- 0:01:48
457000 -- (-1381.369) (-1388.153) [-1390.289] (-1385.848) * (-1392.726) [-1384.160] (-1388.541) (-1389.870) -- 0:01:48
457500 -- (-1383.202) (-1386.164) (-1388.710) [-1387.732] * (-1388.243) (-1383.340) [-1384.774] (-1384.611) -- 0:01:47
458000 -- (-1390.781) (-1388.517) [-1383.265] (-1389.620) * (-1384.483) [-1382.107] (-1389.510) (-1388.502) -- 0:01:47
458500 -- (-1384.247) [-1382.683] (-1386.599) (-1386.365) * (-1388.007) [-1384.150] (-1387.105) (-1388.320) -- 0:01:47
459000 -- [-1388.060] (-1391.613) (-1385.752) (-1388.066) * [-1385.851] (-1393.339) (-1389.619) (-1386.067) -- 0:01:47
459500 -- (-1384.857) [-1385.079] (-1385.502) (-1384.367) * (-1390.725) (-1386.489) [-1397.468] (-1385.071) -- 0:01:47
460000 -- (-1385.513) (-1385.700) [-1385.829] (-1381.869) * [-1387.157] (-1392.644) (-1392.073) (-1382.946) -- 0:01:46
Average standard deviation of split frequencies: 0.002558
460500 -- (-1388.101) (-1393.926) [-1393.994] (-1384.340) * [-1392.832] (-1396.988) (-1386.986) (-1384.693) -- 0:01:46
461000 -- [-1382.843] (-1391.171) (-1398.525) (-1385.219) * (-1384.655) (-1388.048) (-1389.786) [-1384.789] -- 0:01:46
461500 -- [-1383.346] (-1385.634) (-1393.970) (-1388.711) * (-1387.303) [-1388.852] (-1388.924) (-1383.415) -- 0:01:47
462000 -- (-1387.520) [-1395.221] (-1391.133) (-1387.442) * (-1387.511) [-1383.217] (-1386.134) (-1385.875) -- 0:01:47
462500 -- [-1389.591] (-1388.923) (-1395.832) (-1391.218) * (-1384.942) (-1389.499) [-1384.484] (-1385.521) -- 0:01:46
463000 -- (-1385.529) [-1388.558] (-1389.650) (-1392.955) * (-1393.382) (-1382.240) [-1390.076] (-1378.797) -- 0:01:46
463500 -- [-1391.818] (-1387.506) (-1384.386) (-1390.734) * (-1383.606) (-1394.688) [-1383.417] (-1384.148) -- 0:01:46
464000 -- (-1383.951) (-1384.731) [-1381.978] (-1385.145) * (-1384.660) [-1388.211] (-1385.916) (-1392.279) -- 0:01:46
464500 -- [-1385.938] (-1390.604) (-1389.287) (-1390.003) * (-1380.901) (-1393.406) [-1386.375] (-1390.584) -- 0:01:46
465000 -- (-1384.307) [-1388.529] (-1386.874) (-1386.424) * (-1385.671) [-1388.870] (-1387.189) (-1393.282) -- 0:01:45
Average standard deviation of split frequencies: 0.003035
465500 -- (-1386.650) (-1392.339) [-1390.256] (-1386.942) * (-1388.012) (-1389.412) [-1383.921] (-1395.494) -- 0:01:45
466000 -- (-1390.096) (-1387.592) [-1387.812] (-1384.630) * [-1382.405] (-1389.136) (-1384.454) (-1393.544) -- 0:01:45
466500 -- (-1386.229) (-1385.420) (-1388.657) [-1383.147] * (-1384.175) (-1385.465) [-1385.212] (-1385.913) -- 0:01:46
467000 -- (-1384.512) (-1391.465) [-1390.512] (-1384.985) * (-1383.946) [-1381.630] (-1385.773) (-1384.257) -- 0:01:46
467500 -- (-1386.035) [-1385.573] (-1388.239) (-1386.498) * (-1391.851) (-1395.439) (-1383.328) [-1385.956] -- 0:01:45
468000 -- [-1387.379] (-1384.755) (-1394.462) (-1386.276) * (-1394.369) (-1393.663) (-1386.465) [-1387.750] -- 0:01:45
468500 -- (-1385.776) [-1388.616] (-1382.596) (-1383.087) * (-1385.659) (-1387.162) [-1383.162] (-1384.200) -- 0:01:45
469000 -- (-1388.366) (-1386.516) (-1385.076) [-1383.709] * (-1385.182) (-1380.942) (-1387.284) [-1389.962] -- 0:01:45
469500 -- (-1384.973) (-1391.418) [-1383.977] (-1385.536) * (-1389.210) (-1382.551) (-1383.046) [-1385.954] -- 0:01:45
470000 -- (-1395.117) [-1386.036] (-1385.909) (-1382.916) * (-1384.533) (-1394.615) (-1389.184) [-1389.641] -- 0:01:44
Average standard deviation of split frequencies: 0.004006
470500 -- (-1389.946) (-1384.683) [-1391.897] (-1386.040) * (-1382.943) [-1387.318] (-1394.000) (-1386.618) -- 0:01:44
471000 -- (-1388.426) (-1384.152) (-1387.645) [-1385.541] * (-1386.788) [-1382.786] (-1389.506) (-1382.442) -- 0:01:44
471500 -- (-1387.546) (-1386.340) [-1387.373] (-1386.239) * (-1386.178) (-1387.188) [-1382.829] (-1387.773) -- 0:01:44
472000 -- (-1394.419) [-1385.489] (-1390.469) (-1395.187) * [-1382.519] (-1388.052) (-1384.156) (-1397.133) -- 0:01:45
472500 -- (-1385.271) [-1384.822] (-1387.804) (-1384.494) * (-1386.993) (-1386.247) (-1389.094) [-1387.838] -- 0:01:44
473000 -- [-1380.691] (-1390.719) (-1389.892) (-1391.302) * [-1384.203] (-1385.851) (-1387.082) (-1382.770) -- 0:01:44
473500 -- [-1389.127] (-1405.068) (-1385.941) (-1387.281) * (-1387.522) (-1387.799) (-1386.775) [-1385.418] -- 0:01:44
474000 -- (-1380.522) (-1389.834) [-1384.665] (-1384.472) * (-1386.757) (-1385.281) (-1381.909) [-1388.172] -- 0:01:44
474500 -- [-1383.512] (-1386.460) (-1394.130) (-1384.864) * (-1385.254) (-1380.570) [-1382.644] (-1390.612) -- 0:01:44
475000 -- (-1381.304) [-1385.295] (-1387.010) (-1388.966) * [-1388.416] (-1388.916) (-1384.166) (-1393.847) -- 0:01:43
Average standard deviation of split frequencies: 0.003466
475500 -- [-1389.442] (-1387.165) (-1395.404) (-1389.583) * [-1384.438] (-1385.074) (-1393.899) (-1392.189) -- 0:01:43
476000 -- (-1383.632) [-1386.024] (-1382.591) (-1393.614) * (-1389.379) (-1383.467) (-1391.672) [-1385.273] -- 0:01:43
476500 -- (-1385.409) [-1384.727] (-1384.522) (-1389.360) * (-1382.261) (-1387.655) (-1391.911) [-1386.755] -- 0:01:43
477000 -- (-1381.481) (-1387.976) (-1389.991) [-1385.214] * [-1386.683] (-1388.615) (-1387.391) (-1386.501) -- 0:01:44
477500 -- [-1384.732] (-1380.843) (-1386.693) (-1384.923) * (-1385.055) [-1388.337] (-1383.558) (-1387.822) -- 0:01:43
478000 -- (-1389.336) [-1382.274] (-1393.119) (-1397.994) * (-1384.521) (-1393.339) [-1386.784] (-1386.473) -- 0:01:43
478500 -- (-1383.281) (-1385.815) [-1385.160] (-1392.287) * [-1385.096] (-1398.314) (-1386.017) (-1386.621) -- 0:01:43
479000 -- [-1387.291] (-1390.030) (-1389.560) (-1389.932) * [-1380.745] (-1395.140) (-1382.537) (-1385.521) -- 0:01:43
479500 -- (-1385.858) [-1388.553] (-1383.403) (-1392.352) * (-1391.135) (-1397.670) [-1385.995] (-1389.679) -- 0:01:43
480000 -- (-1385.769) [-1388.082] (-1385.357) (-1391.027) * [-1384.645] (-1388.895) (-1381.444) (-1385.221) -- 0:01:42
Average standard deviation of split frequencies: 0.002942
480500 -- (-1384.586) [-1387.771] (-1386.245) (-1385.531) * (-1385.883) [-1388.930] (-1391.241) (-1385.365) -- 0:01:42
481000 -- (-1388.028) (-1385.840) (-1386.945) [-1391.712] * (-1384.296) (-1385.555) [-1383.788] (-1384.330) -- 0:01:42
481500 -- (-1383.779) (-1381.698) (-1383.905) [-1389.119] * (-1390.190) (-1386.754) (-1384.316) [-1382.769] -- 0:01:42
482000 -- (-1385.817) (-1386.893) (-1389.051) [-1385.645] * (-1386.763) [-1388.764] (-1385.813) (-1384.806) -- 0:01:43
482500 -- [-1386.800] (-1390.819) (-1387.017) (-1384.381) * (-1391.879) (-1385.235) [-1382.184] (-1387.087) -- 0:01:42
483000 -- [-1387.051] (-1393.552) (-1392.715) (-1389.837) * (-1393.453) (-1387.220) (-1385.987) [-1388.454] -- 0:01:42
483500 -- [-1384.852] (-1387.779) (-1396.072) (-1386.013) * (-1386.826) [-1381.633] (-1387.905) (-1389.519) -- 0:01:42
484000 -- (-1386.719) (-1387.311) (-1385.558) [-1392.665] * (-1384.996) [-1383.489] (-1387.029) (-1388.552) -- 0:01:42
484500 -- [-1390.363] (-1383.975) (-1398.513) (-1395.986) * (-1387.450) (-1386.294) (-1390.122) [-1386.060] -- 0:01:42
485000 -- [-1389.051] (-1383.847) (-1385.186) (-1388.016) * [-1384.280] (-1389.249) (-1387.724) (-1383.364) -- 0:01:41
Average standard deviation of split frequencies: 0.003880
485500 -- [-1388.968] (-1387.131) (-1392.505) (-1393.754) * (-1393.756) (-1392.054) (-1390.443) [-1387.285] -- 0:01:41
486000 -- (-1384.111) [-1387.294] (-1384.742) (-1395.450) * [-1386.430] (-1387.516) (-1389.223) (-1391.326) -- 0:01:41
486500 -- (-1388.372) [-1384.391] (-1393.994) (-1385.004) * [-1381.133] (-1385.211) (-1391.496) (-1395.239) -- 0:01:42
487000 -- [-1387.864] (-1390.045) (-1389.913) (-1387.524) * [-1382.077] (-1386.829) (-1386.293) (-1391.663) -- 0:01:42
487500 -- (-1392.753) [-1388.710] (-1386.780) (-1387.653) * (-1391.614) (-1384.795) (-1387.475) [-1391.427] -- 0:01:41
488000 -- (-1390.715) [-1386.931] (-1388.238) (-1388.399) * (-1389.043) (-1385.953) [-1382.232] (-1380.880) -- 0:01:41
488500 -- (-1387.431) [-1389.432] (-1387.903) (-1397.024) * (-1388.254) (-1387.867) (-1388.129) [-1382.708] -- 0:01:41
489000 -- (-1389.411) (-1386.140) (-1383.242) [-1382.536] * (-1388.158) (-1387.148) (-1394.409) [-1387.192] -- 0:01:41
489500 -- (-1384.859) (-1390.409) [-1382.310] (-1386.528) * (-1386.492) (-1389.700) (-1382.526) [-1385.473] -- 0:01:41
490000 -- (-1389.304) [-1384.715] (-1393.661) (-1388.360) * [-1386.218] (-1387.705) (-1386.454) (-1389.799) -- 0:01:40
Average standard deviation of split frequencies: 0.003843
490500 -- (-1396.340) [-1383.279] (-1387.937) (-1385.612) * (-1386.036) [-1380.345] (-1382.722) (-1388.479) -- 0:01:40
491000 -- (-1383.836) [-1383.265] (-1394.334) (-1384.013) * (-1385.134) (-1387.038) [-1392.047] (-1389.875) -- 0:01:40
491500 -- (-1387.232) [-1381.775] (-1387.698) (-1385.766) * (-1383.684) (-1383.289) (-1386.432) [-1388.252] -- 0:01:41
492000 -- (-1385.916) (-1385.746) (-1384.651) [-1388.340] * (-1388.933) [-1385.401] (-1381.830) (-1383.319) -- 0:01:41
492500 -- (-1387.775) [-1383.799] (-1388.658) (-1390.450) * (-1384.962) (-1385.863) (-1384.277) [-1385.618] -- 0:01:40
493000 -- [-1389.241] (-1385.664) (-1385.320) (-1384.305) * (-1389.008) (-1388.285) (-1389.312) [-1384.196] -- 0:01:40
493500 -- (-1387.153) (-1383.733) (-1386.185) [-1382.362] * (-1384.782) (-1384.075) [-1387.916] (-1392.344) -- 0:01:40
494000 -- [-1382.218] (-1389.409) (-1389.231) (-1391.924) * (-1387.755) [-1384.483] (-1388.352) (-1399.803) -- 0:01:40
494500 -- [-1386.339] (-1388.561) (-1384.228) (-1397.215) * (-1387.181) (-1388.830) [-1384.912] (-1397.380) -- 0:01:40
495000 -- (-1395.191) [-1386.627] (-1384.406) (-1395.575) * (-1383.518) [-1387.841] (-1386.871) (-1401.081) -- 0:01:39
Average standard deviation of split frequencies: 0.003802
495500 -- [-1383.414] (-1389.251) (-1385.028) (-1389.071) * (-1387.308) [-1383.387] (-1390.614) (-1386.098) -- 0:01:39
496000 -- (-1387.385) (-1385.084) (-1387.559) [-1386.735] * (-1389.230) (-1389.355) (-1386.326) [-1384.206] -- 0:01:39
496500 -- (-1390.190) (-1385.019) [-1388.539] (-1385.212) * [-1388.567] (-1388.037) (-1386.975) (-1388.397) -- 0:01:40
497000 -- (-1385.681) [-1382.389] (-1389.806) (-1383.773) * (-1385.340) [-1386.755] (-1386.733) (-1390.208) -- 0:01:40
497500 -- [-1386.653] (-1388.920) (-1390.462) (-1383.448) * (-1388.014) [-1382.127] (-1384.267) (-1388.480) -- 0:01:39
498000 -- (-1386.714) [-1382.571] (-1393.510) (-1383.316) * [-1385.878] (-1400.780) (-1393.295) (-1404.404) -- 0:01:39
498500 -- (-1389.403) (-1385.773) (-1384.054) [-1386.992] * (-1385.239) (-1390.935) [-1384.684] (-1386.227) -- 0:01:39
499000 -- [-1385.055] (-1386.442) (-1390.454) (-1385.669) * [-1393.336] (-1387.708) (-1389.689) (-1390.721) -- 0:01:39
499500 -- [-1384.047] (-1386.526) (-1393.990) (-1382.509) * (-1386.060) (-1390.511) [-1386.176] (-1385.686) -- 0:01:39
500000 -- [-1383.600] (-1386.677) (-1389.747) (-1389.877) * (-1389.672) [-1386.218] (-1381.751) (-1389.518) -- 0:01:39
Average standard deviation of split frequencies: 0.003766
500500 -- (-1389.595) (-1386.095) (-1387.513) [-1393.147] * (-1389.564) (-1390.258) [-1385.099] (-1381.666) -- 0:01:38
501000 -- [-1384.597] (-1385.994) (-1388.074) (-1390.697) * [-1385.832] (-1384.518) (-1383.108) (-1381.671) -- 0:01:38
501500 -- [-1385.967] (-1385.549) (-1388.431) (-1383.617) * [-1381.680] (-1388.288) (-1390.753) (-1384.651) -- 0:01:38
502000 -- (-1389.238) (-1382.219) (-1396.251) [-1389.469] * (-1383.678) (-1385.527) [-1382.452] (-1385.601) -- 0:01:39
502500 -- (-1383.734) [-1391.369] (-1391.881) (-1386.659) * (-1386.578) [-1387.732] (-1385.195) (-1393.646) -- 0:01:39
503000 -- (-1383.113) (-1383.336) (-1387.321) [-1384.474] * [-1388.317] (-1386.200) (-1383.891) (-1386.975) -- 0:01:38
503500 -- (-1392.810) (-1387.424) [-1389.965] (-1386.525) * (-1387.518) (-1388.146) [-1386.701] (-1395.750) -- 0:01:38
504000 -- [-1384.773] (-1397.777) (-1388.581) (-1390.203) * (-1387.432) (-1385.168) (-1386.468) [-1386.131] -- 0:01:38
504500 -- (-1384.635) (-1400.488) (-1393.818) [-1384.118] * [-1389.553] (-1389.921) (-1396.811) (-1389.533) -- 0:01:38
505000 -- (-1384.173) (-1395.855) [-1386.352] (-1386.124) * (-1393.424) (-1384.032) [-1388.646] (-1389.840) -- 0:01:38
Average standard deviation of split frequencies: 0.003727
505500 -- [-1381.925] (-1394.300) (-1383.954) (-1388.525) * [-1381.927] (-1384.565) (-1386.814) (-1393.358) -- 0:01:37
506000 -- (-1387.582) [-1387.092] (-1389.398) (-1387.736) * [-1386.793] (-1387.226) (-1388.931) (-1391.152) -- 0:01:37
506500 -- [-1389.022] (-1390.640) (-1387.128) (-1381.778) * (-1392.623) (-1388.141) (-1388.354) [-1393.134] -- 0:01:37
507000 -- (-1387.570) (-1387.297) (-1388.057) [-1384.580] * (-1396.099) (-1390.745) (-1391.461) [-1387.001] -- 0:01:38
507500 -- (-1385.115) (-1389.215) (-1393.588) [-1387.658] * [-1382.591] (-1388.208) (-1386.080) (-1400.523) -- 0:01:38
508000 -- (-1390.115) [-1382.227] (-1392.905) (-1385.963) * (-1389.647) [-1386.326] (-1389.328) (-1387.966) -- 0:01:37
508500 -- (-1384.450) [-1386.985] (-1385.980) (-1382.258) * (-1380.244) (-1388.737) (-1391.095) [-1383.335] -- 0:01:37
509000 -- [-1386.370] (-1389.418) (-1392.398) (-1382.957) * [-1381.931] (-1382.500) (-1389.224) (-1387.942) -- 0:01:37
509500 -- (-1383.415) (-1387.332) (-1383.741) [-1382.658] * (-1383.764) (-1383.316) (-1385.451) [-1388.641] -- 0:01:37
510000 -- (-1390.950) (-1387.820) (-1392.210) [-1387.374] * (-1386.368) (-1387.493) (-1387.211) [-1383.162] -- 0:01:37
Average standard deviation of split frequencies: 0.003231
510500 -- [-1387.227] (-1384.783) (-1382.695) (-1382.228) * (-1384.840) (-1379.812) [-1388.066] (-1385.958) -- 0:01:36
511000 -- (-1387.585) [-1383.742] (-1388.021) (-1385.596) * (-1383.972) [-1384.096] (-1386.819) (-1392.946) -- 0:01:36
511500 -- [-1393.283] (-1385.026) (-1386.888) (-1385.929) * (-1393.251) [-1388.635] (-1387.063) (-1393.649) -- 0:01:36
512000 -- (-1384.891) (-1382.337) [-1383.237] (-1394.451) * (-1384.984) (-1393.287) [-1380.284] (-1386.573) -- 0:01:37
512500 -- [-1384.709] (-1391.943) (-1386.977) (-1384.592) * (-1388.293) (-1394.907) [-1385.903] (-1386.690) -- 0:01:37
513000 -- (-1382.200) (-1385.172) (-1387.387) [-1386.296] * (-1384.899) (-1402.388) [-1384.472] (-1387.023) -- 0:01:36
513500 -- (-1387.573) (-1388.070) (-1384.520) [-1383.454] * [-1383.244] (-1388.193) (-1391.372) (-1388.029) -- 0:01:36
514000 -- (-1384.492) [-1385.910] (-1381.167) (-1385.427) * [-1382.578] (-1385.640) (-1391.192) (-1390.794) -- 0:01:36
514500 -- (-1388.711) (-1389.015) [-1385.260] (-1384.200) * (-1385.271) (-1386.332) [-1402.809] (-1389.440) -- 0:01:36
515000 -- (-1389.421) (-1387.985) (-1394.474) [-1388.041] * (-1382.239) [-1387.268] (-1395.960) (-1386.691) -- 0:01:36
Average standard deviation of split frequencies: 0.003198
515500 -- (-1385.851) (-1391.951) (-1384.642) [-1386.627] * (-1388.394) [-1382.735] (-1394.869) (-1385.126) -- 0:01:35
516000 -- (-1389.002) (-1389.148) [-1385.639] (-1389.891) * [-1385.874] (-1386.317) (-1388.289) (-1396.863) -- 0:01:35
516500 -- (-1384.870) (-1381.857) (-1386.921) [-1383.461] * (-1389.880) [-1382.151] (-1392.387) (-1385.132) -- 0:01:35
517000 -- (-1386.711) [-1387.451] (-1385.131) (-1389.828) * [-1381.528] (-1385.145) (-1388.155) (-1386.815) -- 0:01:36
517500 -- (-1389.026) [-1380.789] (-1384.433) (-1381.493) * (-1392.595) (-1384.188) [-1384.841] (-1386.669) -- 0:01:36
518000 -- (-1391.514) (-1389.242) (-1391.865) [-1389.674] * (-1386.657) [-1396.724] (-1382.625) (-1386.843) -- 0:01:35
518500 -- (-1389.044) (-1395.947) (-1385.084) [-1389.022] * (-1390.149) (-1386.740) (-1387.310) [-1386.466] -- 0:01:35
519000 -- [-1392.890] (-1391.999) (-1386.012) (-1385.977) * (-1392.051) (-1385.393) [-1387.431] (-1385.374) -- 0:01:35
519500 -- (-1389.567) (-1383.402) (-1396.476) [-1383.741] * (-1383.703) (-1395.943) [-1387.044] (-1389.306) -- 0:01:35
520000 -- (-1387.121) (-1386.625) (-1386.042) [-1385.061] * [-1385.523] (-1391.651) (-1387.863) (-1397.533) -- 0:01:35
Average standard deviation of split frequencies: 0.003169
520500 -- (-1383.877) (-1391.629) (-1389.376) [-1385.555] * (-1381.833) [-1390.758] (-1388.046) (-1387.795) -- 0:01:34
521000 -- (-1385.282) (-1393.401) (-1384.839) [-1383.132] * (-1382.141) (-1400.066) [-1383.921] (-1391.734) -- 0:01:34
521500 -- (-1386.165) (-1390.549) (-1389.729) [-1383.000] * [-1388.970] (-1401.842) (-1383.352) (-1379.946) -- 0:01:34
522000 -- (-1385.055) [-1389.009] (-1391.186) (-1383.140) * (-1386.156) (-1399.397) (-1386.853) [-1384.172] -- 0:01:35
522500 -- [-1385.274] (-1383.427) (-1395.370) (-1383.615) * (-1391.959) (-1400.955) [-1384.525] (-1384.587) -- 0:01:35
523000 -- [-1383.686] (-1382.613) (-1393.093) (-1386.517) * [-1387.737] (-1400.849) (-1391.133) (-1382.242) -- 0:01:34
523500 -- (-1381.118) (-1388.277) (-1391.913) [-1386.927] * [-1383.172] (-1395.444) (-1387.237) (-1392.817) -- 0:01:34
524000 -- (-1385.756) [-1385.938] (-1387.894) (-1384.043) * [-1392.868] (-1391.815) (-1386.685) (-1387.056) -- 0:01:34
524500 -- [-1390.451] (-1394.061) (-1386.742) (-1384.069) * (-1383.395) [-1391.504] (-1387.106) (-1391.524) -- 0:01:34
525000 -- [-1387.351] (-1390.168) (-1384.470) (-1391.731) * (-1388.049) (-1390.743) [-1385.347] (-1401.180) -- 0:01:34
Average standard deviation of split frequencies: 0.002241
525500 -- [-1389.670] (-1388.698) (-1385.113) (-1397.743) * (-1399.365) (-1387.590) [-1387.764] (-1396.496) -- 0:01:33
526000 -- (-1390.363) (-1390.072) [-1383.055] (-1382.576) * (-1395.283) (-1380.884) [-1390.480] (-1389.160) -- 0:01:33
526500 -- [-1389.226] (-1392.895) (-1387.399) (-1383.610) * (-1389.301) (-1395.163) (-1384.591) [-1384.010] -- 0:01:33
527000 -- (-1388.177) (-1387.388) (-1381.801) [-1388.795] * (-1401.249) (-1384.759) (-1385.428) [-1387.904] -- 0:01:34
527500 -- [-1389.863] (-1393.049) (-1383.129) (-1388.112) * (-1394.804) (-1390.771) (-1387.530) [-1382.555] -- 0:01:34
528000 -- (-1384.605) (-1391.276) (-1390.444) [-1387.666] * (-1390.634) (-1388.005) [-1388.744] (-1382.331) -- 0:01:33
528500 -- (-1389.134) [-1384.301] (-1388.415) (-1389.966) * [-1391.070] (-1390.156) (-1389.008) (-1385.049) -- 0:01:33
529000 -- (-1393.284) (-1386.714) [-1379.540] (-1393.501) * (-1391.967) (-1383.435) (-1389.483) [-1385.255] -- 0:01:33
529500 -- (-1395.915) [-1386.936] (-1383.848) (-1388.998) * (-1383.560) (-1387.345) [-1383.701] (-1384.978) -- 0:01:33
530000 -- [-1382.733] (-1386.858) (-1389.093) (-1387.848) * (-1381.923) (-1388.072) (-1384.457) [-1386.381] -- 0:01:33
Average standard deviation of split frequencies: 0.001332
530500 -- (-1386.672) [-1387.288] (-1394.881) (-1391.815) * [-1384.681] (-1384.546) (-1384.030) (-1382.302) -- 0:01:32
531000 -- [-1386.537] (-1385.612) (-1394.771) (-1387.680) * (-1385.200) (-1385.360) [-1383.832] (-1387.127) -- 0:01:32
531500 -- (-1381.805) [-1385.597] (-1382.623) (-1393.178) * (-1392.154) [-1380.146] (-1383.794) (-1393.128) -- 0:01:32
532000 -- (-1386.482) [-1385.829] (-1389.703) (-1394.481) * (-1390.315) [-1385.795] (-1385.632) (-1391.357) -- 0:01:33
532500 -- (-1389.246) (-1394.066) (-1385.612) [-1388.607] * (-1395.515) (-1382.632) [-1388.952] (-1381.362) -- 0:01:33
533000 -- [-1383.663] (-1391.135) (-1389.412) (-1384.809) * (-1381.984) [-1389.330] (-1386.101) (-1384.950) -- 0:01:32
533500 -- (-1384.747) (-1406.304) [-1385.696] (-1387.475) * (-1388.409) (-1387.210) [-1390.161] (-1396.379) -- 0:01:32
534000 -- (-1389.797) (-1394.542) [-1385.003] (-1388.987) * [-1382.592] (-1384.064) (-1383.744) (-1396.462) -- 0:01:32
534500 -- (-1389.069) [-1390.294] (-1381.124) (-1384.331) * (-1386.444) (-1382.127) (-1383.142) [-1387.194] -- 0:01:32
535000 -- [-1388.365] (-1390.441) (-1384.915) (-1390.675) * (-1383.939) [-1385.349] (-1386.565) (-1393.552) -- 0:01:32
Average standard deviation of split frequencies: 0.001319
535500 -- (-1385.738) (-1392.734) (-1388.871) [-1389.171] * (-1394.636) (-1387.460) [-1385.022] (-1393.739) -- 0:01:31
536000 -- (-1390.818) [-1381.534] (-1384.918) (-1383.598) * (-1382.620) (-1389.002) [-1383.998] (-1398.082) -- 0:01:31
536500 -- (-1388.552) (-1385.862) (-1382.171) [-1386.298] * (-1388.598) (-1386.764) [-1383.763] (-1401.104) -- 0:01:31
537000 -- (-1394.820) [-1385.190] (-1385.707) (-1393.482) * [-1383.983] (-1383.780) (-1381.668) (-1395.448) -- 0:01:32
537500 -- [-1388.013] (-1395.235) (-1391.292) (-1392.288) * (-1388.606) (-1382.826) [-1386.402] (-1389.463) -- 0:01:32
538000 -- [-1390.440] (-1384.230) (-1384.596) (-1383.631) * (-1388.544) (-1390.537) (-1386.425) [-1382.439] -- 0:01:31
538500 -- (-1387.716) (-1385.083) [-1385.036] (-1392.153) * (-1383.834) (-1388.891) [-1382.573] (-1384.104) -- 0:01:31
539000 -- (-1386.373) (-1387.944) [-1384.379] (-1386.590) * (-1386.193) [-1387.050] (-1388.982) (-1390.149) -- 0:01:31
539500 -- (-1383.394) [-1384.587] (-1382.836) (-1388.794) * (-1388.369) (-1385.558) (-1395.153) [-1390.968] -- 0:01:31
540000 -- (-1381.487) (-1385.467) [-1384.470] (-1383.186) * (-1386.312) (-1388.154) [-1385.394] (-1388.220) -- 0:01:31
Average standard deviation of split frequencies: 0.001308
540500 -- (-1388.094) (-1388.167) (-1385.825) [-1391.253] * [-1386.306] (-1387.744) (-1386.141) (-1382.228) -- 0:01:30
541000 -- [-1384.551] (-1391.247) (-1386.869) (-1394.047) * (-1399.268) (-1385.629) [-1384.295] (-1388.233) -- 0:01:30
541500 -- (-1383.474) [-1391.116] (-1387.158) (-1391.139) * (-1387.110) (-1396.216) [-1387.748] (-1390.821) -- 0:01:30
542000 -- (-1387.464) (-1392.620) [-1384.564] (-1385.075) * (-1390.787) [-1383.669] (-1380.972) (-1385.477) -- 0:01:31
542500 -- (-1387.499) [-1383.822] (-1379.965) (-1390.868) * (-1386.610) (-1387.841) [-1383.614] (-1385.166) -- 0:01:31
543000 -- (-1386.500) [-1383.256] (-1384.667) (-1389.198) * [-1382.448] (-1387.706) (-1381.900) (-1382.753) -- 0:01:30
543500 -- (-1390.779) (-1381.801) [-1386.158] (-1384.856) * (-1381.794) [-1393.575] (-1382.723) (-1386.982) -- 0:01:30
544000 -- [-1384.307] (-1384.174) (-1391.695) (-1388.127) * (-1386.260) (-1386.579) (-1383.271) [-1386.962] -- 0:01:30
544500 -- (-1387.867) (-1382.771) (-1389.972) [-1387.526] * [-1384.394] (-1393.812) (-1385.019) (-1391.533) -- 0:01:30
545000 -- [-1398.434] (-1388.437) (-1388.392) (-1386.721) * (-1387.289) [-1386.844] (-1398.270) (-1394.955) -- 0:01:30
Average standard deviation of split frequencies: 0.001295
545500 -- (-1392.920) (-1386.800) [-1385.228] (-1390.313) * (-1386.814) [-1388.427] (-1385.544) (-1391.668) -- 0:01:29
546000 -- (-1388.648) (-1386.619) (-1385.179) [-1392.079] * (-1391.694) [-1386.310] (-1383.583) (-1388.351) -- 0:01:29
546500 -- (-1388.854) [-1384.326] (-1386.620) (-1385.078) * [-1387.447] (-1386.109) (-1386.904) (-1387.818) -- 0:01:29
547000 -- (-1387.610) [-1383.771] (-1391.902) (-1387.032) * [-1385.406] (-1389.754) (-1389.479) (-1385.735) -- 0:01:30
547500 -- (-1391.980) (-1386.669) [-1394.107] (-1393.521) * (-1391.229) (-1388.019) [-1391.688] (-1388.564) -- 0:01:30
548000 -- (-1383.489) (-1389.644) (-1393.138) [-1387.906] * [-1390.278] (-1384.075) (-1385.008) (-1388.242) -- 0:01:29
548500 -- (-1387.977) [-1387.397] (-1386.156) (-1386.533) * [-1386.849] (-1392.625) (-1389.356) (-1392.375) -- 0:01:29
549000 -- [-1389.643] (-1387.848) (-1385.703) (-1381.845) * (-1386.599) (-1383.361) [-1384.736] (-1397.619) -- 0:01:29
549500 -- (-1389.528) (-1394.048) (-1389.653) [-1386.618] * (-1384.963) [-1384.475] (-1390.774) (-1389.808) -- 0:01:29
550000 -- (-1393.704) (-1389.684) [-1385.175] (-1385.393) * (-1380.372) [-1382.145] (-1385.526) (-1398.941) -- 0:01:29
Average standard deviation of split frequencies: 0.001712
550500 -- (-1387.705) (-1385.304) (-1383.158) [-1386.207] * (-1385.069) (-1382.715) (-1385.468) [-1389.776] -- 0:01:29
551000 -- (-1381.419) [-1383.334] (-1383.605) (-1383.700) * [-1382.947] (-1381.937) (-1391.179) (-1383.650) -- 0:01:28
551500 -- (-1385.060) (-1384.941) (-1383.344) [-1381.689] * (-1386.010) (-1383.179) [-1382.627] (-1391.489) -- 0:01:28
552000 -- [-1383.575] (-1382.674) (-1383.672) (-1390.126) * [-1390.407] (-1391.890) (-1393.977) (-1394.410) -- 0:01:29
552500 -- (-1388.607) (-1387.490) [-1388.761] (-1382.720) * (-1387.822) [-1390.303] (-1388.799) (-1393.764) -- 0:01:29
553000 -- (-1387.660) (-1386.050) (-1385.165) [-1382.593] * (-1384.174) [-1386.519] (-1382.693) (-1391.048) -- 0:01:28
553500 -- (-1392.616) (-1384.292) [-1379.855] (-1383.033) * (-1387.473) [-1384.762] (-1383.517) (-1390.378) -- 0:01:28
554000 -- (-1389.476) (-1384.781) [-1383.889] (-1389.435) * (-1385.485) (-1380.439) [-1383.414] (-1383.689) -- 0:01:28
554500 -- [-1384.383] (-1388.016) (-1392.261) (-1384.290) * (-1386.386) [-1384.622] (-1386.833) (-1387.632) -- 0:01:28
555000 -- [-1381.177] (-1387.840) (-1384.078) (-1388.083) * [-1385.381] (-1386.586) (-1388.632) (-1384.358) -- 0:01:28
Average standard deviation of split frequencies: 0.001272
555500 -- (-1382.496) (-1385.662) [-1383.190] (-1387.923) * [-1383.269] (-1388.486) (-1388.642) (-1392.372) -- 0:01:28
556000 -- (-1392.953) [-1385.949] (-1392.165) (-1394.725) * (-1383.316) [-1383.958] (-1394.205) (-1396.769) -- 0:01:27
556500 -- [-1386.389] (-1385.342) (-1392.968) (-1386.219) * (-1385.863) (-1387.553) (-1386.066) [-1393.800] -- 0:01:27
557000 -- [-1391.260] (-1391.748) (-1388.934) (-1392.231) * [-1389.644] (-1384.159) (-1388.668) (-1383.650) -- 0:01:28
557500 -- (-1387.349) (-1388.134) (-1390.384) [-1387.942] * (-1383.555) [-1388.621] (-1393.956) (-1385.826) -- 0:01:28
558000 -- (-1385.157) [-1385.165] (-1392.434) (-1393.246) * (-1387.114) (-1380.123) (-1392.483) [-1383.361] -- 0:01:27
558500 -- [-1389.721] (-1392.425) (-1391.225) (-1392.007) * (-1382.513) (-1385.682) (-1390.749) [-1390.076] -- 0:01:27
559000 -- [-1395.890] (-1385.525) (-1388.706) (-1388.443) * [-1386.215] (-1390.330) (-1390.162) (-1393.984) -- 0:01:27
559500 -- (-1390.382) (-1389.055) (-1390.917) [-1381.800] * (-1392.242) [-1389.894] (-1387.544) (-1388.660) -- 0:01:27
560000 -- [-1385.237] (-1383.953) (-1389.437) (-1388.938) * (-1395.823) [-1384.152] (-1393.090) (-1386.902) -- 0:01:27
Average standard deviation of split frequencies: 0.001261
560500 -- [-1386.620] (-1385.160) (-1388.712) (-1384.982) * (-1391.626) (-1385.812) [-1388.121] (-1382.772) -- 0:01:27
561000 -- (-1391.776) [-1382.646] (-1392.014) (-1388.812) * (-1383.097) (-1387.549) (-1384.000) [-1384.869] -- 0:01:26
561500 -- (-1390.451) [-1387.670] (-1384.088) (-1387.025) * (-1389.581) (-1382.822) [-1384.702] (-1387.746) -- 0:01:26
562000 -- (-1389.701) [-1384.017] (-1382.060) (-1388.503) * (-1392.530) (-1383.455) [-1382.584] (-1388.331) -- 0:01:27
562500 -- (-1388.822) [-1390.111] (-1394.896) (-1393.409) * (-1383.697) [-1385.162] (-1384.121) (-1391.036) -- 0:01:27
563000 -- (-1386.816) [-1382.009] (-1384.195) (-1388.275) * (-1386.119) (-1391.807) (-1387.897) [-1384.035] -- 0:01:26
563500 -- (-1389.475) (-1383.505) [-1385.185] (-1386.306) * [-1389.356] (-1391.544) (-1385.148) (-1382.208) -- 0:01:26
564000 -- (-1388.611) [-1384.176] (-1387.703) (-1388.422) * (-1389.374) (-1394.811) [-1382.628] (-1385.569) -- 0:01:26
564500 -- (-1389.601) [-1381.218] (-1382.498) (-1392.046) * (-1388.736) (-1386.974) (-1391.541) [-1390.992] -- 0:01:26
565000 -- (-1389.036) [-1383.332] (-1382.465) (-1391.999) * (-1387.702) (-1392.174) (-1382.446) [-1380.848] -- 0:01:26
Average standard deviation of split frequencies: 0.001666
565500 -- (-1395.524) (-1383.127) [-1384.518] (-1398.033) * (-1393.575) [-1383.679] (-1391.417) (-1382.073) -- 0:01:26
566000 -- (-1383.658) (-1386.014) [-1382.694] (-1390.813) * (-1387.137) [-1382.864] (-1384.169) (-1393.211) -- 0:01:25
566500 -- (-1385.681) [-1382.450] (-1388.637) (-1395.518) * (-1391.664) (-1388.251) [-1389.493] (-1386.406) -- 0:01:25
567000 -- [-1382.043] (-1380.341) (-1389.010) (-1390.544) * (-1387.826) (-1387.318) (-1388.508) [-1382.700] -- 0:01:26
567500 -- [-1383.602] (-1386.794) (-1388.053) (-1385.185) * (-1386.028) [-1397.363] (-1388.519) (-1387.860) -- 0:01:26
568000 -- (-1387.711) (-1387.309) (-1384.536) [-1385.387] * (-1381.092) (-1389.656) (-1388.955) [-1384.333] -- 0:01:25
568500 -- (-1384.854) (-1389.710) [-1386.981] (-1387.492) * (-1388.537) [-1388.249] (-1387.281) (-1389.380) -- 0:01:25
569000 -- (-1391.535) (-1395.362) [-1386.444] (-1395.407) * [-1385.914] (-1388.308) (-1385.641) (-1390.898) -- 0:01:25
569500 -- [-1382.696] (-1387.048) (-1385.455) (-1387.881) * [-1385.876] (-1392.081) (-1385.966) (-1395.162) -- 0:01:25
570000 -- (-1389.436) (-1385.450) (-1387.200) [-1386.988] * (-1387.654) (-1385.117) [-1384.814] (-1390.098) -- 0:01:25
Average standard deviation of split frequencies: 0.002478
570500 -- (-1384.878) (-1385.177) [-1387.157] (-1379.860) * (-1387.401) (-1393.719) [-1387.308] (-1382.935) -- 0:01:25
571000 -- (-1386.385) (-1391.912) [-1392.129] (-1384.869) * (-1382.141) (-1381.893) [-1393.836] (-1384.353) -- 0:01:24
571500 -- [-1385.373] (-1391.089) (-1388.545) (-1389.720) * (-1384.703) (-1386.704) [-1389.430] (-1386.685) -- 0:01:24
572000 -- (-1386.447) (-1382.245) (-1388.962) [-1387.356] * (-1387.149) [-1383.742] (-1387.516) (-1381.785) -- 0:01:25
572500 -- [-1382.598] (-1395.290) (-1396.345) (-1390.556) * (-1387.942) (-1387.024) (-1385.573) [-1387.077] -- 0:01:25
573000 -- (-1383.108) (-1384.871) (-1393.583) [-1388.020] * [-1385.894] (-1389.769) (-1386.029) (-1385.694) -- 0:01:24
573500 -- (-1385.590) (-1387.341) (-1387.194) [-1385.144] * [-1387.623] (-1386.476) (-1395.576) (-1390.544) -- 0:01:24
574000 -- [-1384.669] (-1395.671) (-1392.807) (-1385.675) * (-1382.666) (-1389.085) [-1389.378] (-1385.140) -- 0:01:24
574500 -- [-1382.556] (-1394.256) (-1386.633) (-1383.961) * (-1385.141) [-1385.379] (-1386.513) (-1392.436) -- 0:01:24
575000 -- (-1387.333) (-1388.474) (-1385.749) [-1387.216] * [-1389.946] (-1384.647) (-1388.864) (-1388.804) -- 0:01:24
Average standard deviation of split frequencies: 0.002455
575500 -- (-1388.963) (-1383.803) (-1390.572) [-1386.160] * [-1393.516] (-1383.167) (-1384.346) (-1390.074) -- 0:01:24
576000 -- (-1383.986) (-1387.914) (-1384.652) [-1384.874] * (-1388.811) [-1384.800] (-1391.084) (-1387.271) -- 0:01:23
576500 -- (-1391.773) (-1382.311) (-1389.793) [-1388.216] * (-1388.163) (-1385.474) [-1388.849] (-1383.121) -- 0:01:23
577000 -- (-1385.265) [-1382.397] (-1382.601) (-1390.044) * (-1393.132) (-1384.461) [-1386.506] (-1388.872) -- 0:01:24
577500 -- [-1384.302] (-1384.782) (-1385.629) (-1393.666) * (-1383.736) (-1384.500) [-1383.570] (-1389.219) -- 0:01:24
578000 -- [-1382.976] (-1387.080) (-1383.425) (-1386.934) * (-1383.515) [-1386.271] (-1388.707) (-1383.028) -- 0:01:23
578500 -- (-1387.266) [-1385.237] (-1383.658) (-1392.671) * (-1397.497) (-1383.044) (-1390.468) [-1382.520] -- 0:01:23
579000 -- (-1385.964) (-1382.625) (-1384.538) [-1380.945] * (-1393.249) [-1386.794] (-1383.309) (-1386.733) -- 0:01:23
579500 -- (-1388.443) [-1383.057] (-1387.336) (-1388.815) * (-1389.922) [-1382.964] (-1386.230) (-1389.831) -- 0:01:23
580000 -- [-1385.855] (-1386.259) (-1388.010) (-1389.709) * [-1391.579] (-1381.945) (-1388.783) (-1384.542) -- 0:01:23
Average standard deviation of split frequencies: 0.002435
580500 -- [-1386.969] (-1380.504) (-1387.015) (-1386.492) * [-1390.347] (-1387.844) (-1381.833) (-1387.597) -- 0:01:23
581000 -- (-1391.229) [-1381.059] (-1394.087) (-1388.069) * (-1396.056) (-1385.892) (-1391.882) [-1388.563] -- 0:01:22
581500 -- (-1392.603) [-1382.830] (-1388.982) (-1394.867) * (-1390.855) (-1385.927) [-1386.314] (-1387.375) -- 0:01:22
582000 -- [-1389.173] (-1385.327) (-1388.334) (-1396.252) * [-1383.065] (-1387.630) (-1391.630) (-1391.623) -- 0:01:23
582500 -- (-1392.640) [-1385.013] (-1390.146) (-1392.286) * [-1388.117] (-1384.750) (-1390.083) (-1389.497) -- 0:01:23
583000 -- [-1384.645] (-1388.184) (-1388.388) (-1396.925) * (-1384.048) [-1388.585] (-1391.121) (-1397.853) -- 0:01:22
583500 -- (-1384.026) (-1386.502) (-1389.284) [-1382.666] * [-1385.652] (-1383.646) (-1392.739) (-1390.500) -- 0:01:22
584000 -- [-1384.751] (-1389.393) (-1388.070) (-1383.753) * (-1382.413) (-1384.191) [-1384.804] (-1388.648) -- 0:01:22
584500 -- (-1386.400) (-1388.958) (-1394.096) [-1385.652] * (-1385.727) (-1386.223) [-1385.561] (-1396.408) -- 0:01:22
585000 -- [-1391.730] (-1392.198) (-1386.743) (-1387.058) * (-1386.294) (-1383.268) [-1393.008] (-1388.117) -- 0:01:22
Average standard deviation of split frequencies: 0.002011
585500 -- (-1387.115) (-1391.236) [-1385.926] (-1389.058) * (-1388.070) (-1385.888) [-1388.757] (-1393.685) -- 0:01:22
586000 -- (-1388.668) (-1389.449) (-1383.796) [-1390.085] * (-1385.537) [-1383.477] (-1388.284) (-1392.922) -- 0:01:21
586500 -- (-1389.792) [-1393.803] (-1382.061) (-1392.976) * [-1385.531] (-1384.484) (-1402.391) (-1394.142) -- 0:01:21
587000 -- (-1383.345) (-1386.807) [-1386.220] (-1388.677) * (-1389.498) [-1383.900] (-1394.267) (-1386.817) -- 0:01:22
587500 -- [-1383.229] (-1389.468) (-1390.111) (-1392.638) * [-1384.213] (-1382.421) (-1402.112) (-1392.884) -- 0:01:22
588000 -- (-1391.732) (-1392.603) (-1387.546) [-1386.943] * (-1385.756) (-1386.356) [-1389.765] (-1387.831) -- 0:01:21
588500 -- [-1392.568] (-1399.918) (-1384.856) (-1384.774) * (-1386.350) [-1383.706] (-1389.421) (-1390.907) -- 0:01:21
589000 -- [-1387.837] (-1385.048) (-1385.196) (-1389.736) * (-1387.871) (-1383.346) [-1384.305] (-1387.554) -- 0:01:21
589500 -- (-1393.470) (-1385.440) [-1382.236] (-1388.090) * (-1388.499) [-1382.369] (-1381.793) (-1392.769) -- 0:01:21
590000 -- (-1385.072) [-1383.997] (-1385.817) (-1384.711) * (-1387.153) (-1385.570) (-1394.455) [-1383.978] -- 0:01:21
Average standard deviation of split frequencies: 0.001995
590500 -- (-1387.234) (-1383.931) [-1383.273] (-1386.127) * (-1385.971) (-1387.295) (-1386.709) [-1388.518] -- 0:01:21
591000 -- (-1390.165) (-1388.967) [-1391.465] (-1386.665) * (-1390.876) [-1387.692] (-1388.521) (-1386.047) -- 0:01:20
591500 -- (-1389.140) (-1390.498) (-1390.862) [-1383.613] * (-1391.737) [-1384.603] (-1385.912) (-1388.380) -- 0:01:20
592000 -- (-1382.548) (-1384.568) (-1383.792) [-1388.575] * (-1387.306) (-1387.851) (-1385.398) [-1388.953] -- 0:01:21
592500 -- [-1383.290] (-1391.059) (-1388.046) (-1386.382) * (-1381.200) (-1394.890) (-1386.610) [-1388.629] -- 0:01:21
593000 -- (-1390.249) [-1383.008] (-1384.115) (-1380.773) * [-1389.035] (-1387.803) (-1395.604) (-1385.740) -- 0:01:20
593500 -- (-1394.585) (-1384.520) (-1382.353) [-1385.592] * (-1383.596) [-1389.866] (-1387.856) (-1385.331) -- 0:01:20
594000 -- (-1385.923) (-1386.829) (-1385.027) [-1381.134] * (-1385.188) (-1389.580) [-1383.714] (-1387.893) -- 0:01:20
594500 -- [-1383.268] (-1389.542) (-1385.421) (-1389.777) * [-1384.548] (-1390.723) (-1386.612) (-1382.732) -- 0:01:20
595000 -- (-1393.067) [-1390.270] (-1384.217) (-1391.726) * (-1385.024) (-1387.548) [-1383.569] (-1386.338) -- 0:01:20
Average standard deviation of split frequencies: 0.001977
595500 -- [-1388.177] (-1387.077) (-1386.675) (-1385.067) * [-1383.839] (-1386.119) (-1382.284) (-1385.985) -- 0:01:20
596000 -- (-1386.106) (-1384.290) [-1383.113] (-1386.812) * [-1383.717] (-1389.232) (-1389.503) (-1387.066) -- 0:01:19
596500 -- [-1384.148] (-1390.984) (-1385.549) (-1385.164) * [-1384.383] (-1392.577) (-1390.015) (-1385.031) -- 0:01:19
597000 -- (-1391.648) (-1386.198) [-1388.699] (-1388.691) * (-1383.881) [-1381.177] (-1391.905) (-1386.742) -- 0:01:20
597500 -- (-1385.283) [-1387.411] (-1390.505) (-1388.715) * (-1386.382) (-1386.488) (-1388.157) [-1386.482] -- 0:01:20
598000 -- (-1389.429) [-1389.089] (-1392.167) (-1385.795) * (-1385.822) (-1392.102) [-1384.337] (-1389.133) -- 0:01:19
598500 -- (-1387.659) (-1384.906) (-1384.926) [-1385.087] * (-1384.225) [-1383.007] (-1389.289) (-1394.783) -- 0:01:19
599000 -- (-1385.931) (-1389.111) (-1385.851) [-1385.446] * [-1382.038] (-1393.106) (-1382.170) (-1385.558) -- 0:01:19
599500 -- (-1393.051) [-1383.817] (-1395.266) (-1391.929) * (-1383.037) (-1392.494) [-1394.047] (-1384.376) -- 0:01:19
600000 -- (-1387.270) [-1381.659] (-1394.156) (-1383.306) * (-1388.438) (-1389.146) [-1383.404] (-1392.068) -- 0:01:19
Average standard deviation of split frequencies: 0.001177
600500 -- (-1383.508) (-1390.299) [-1387.763] (-1392.072) * (-1392.390) [-1385.449] (-1383.400) (-1390.258) -- 0:01:19
601000 -- (-1386.270) (-1385.539) [-1385.479] (-1388.819) * (-1381.142) [-1385.177] (-1390.179) (-1391.903) -- 0:01:19
601500 -- (-1384.455) (-1384.798) (-1385.682) [-1386.999] * (-1389.043) (-1384.453) [-1397.771] (-1385.811) -- 0:01:18
602000 -- (-1387.457) (-1383.961) (-1389.244) [-1390.673] * (-1394.896) (-1388.659) (-1388.242) [-1385.154] -- 0:01:19
602500 -- [-1387.649] (-1382.110) (-1384.677) (-1385.703) * [-1388.170] (-1383.487) (-1389.303) (-1381.603) -- 0:01:19
603000 -- (-1384.049) (-1388.269) [-1382.298] (-1386.561) * (-1387.387) (-1386.159) (-1386.989) [-1382.546] -- 0:01:19
603500 -- (-1389.129) (-1384.161) (-1386.119) [-1387.139] * (-1394.280) [-1387.218] (-1391.175) (-1385.966) -- 0:01:18
604000 -- (-1383.486) (-1396.471) [-1387.272] (-1392.022) * [-1386.488] (-1382.713) (-1395.669) (-1387.475) -- 0:01:18
604500 -- (-1396.450) (-1383.654) (-1385.243) [-1388.985] * (-1382.849) (-1386.741) (-1395.287) [-1388.317] -- 0:01:18
605000 -- (-1395.102) (-1386.245) [-1384.575] (-1384.904) * (-1386.467) [-1388.904] (-1399.340) (-1389.179) -- 0:01:18
Average standard deviation of split frequencies: 0.000778
605500 -- (-1391.156) (-1388.539) [-1389.646] (-1391.409) * (-1387.251) [-1391.050] (-1394.009) (-1385.438) -- 0:01:18
606000 -- (-1386.703) (-1381.306) (-1387.351) [-1385.815] * [-1382.624] (-1383.895) (-1391.726) (-1387.917) -- 0:01:18
606500 -- (-1381.272) [-1384.914] (-1394.359) (-1386.583) * (-1391.985) [-1383.860] (-1389.915) (-1382.480) -- 0:01:17
607000 -- [-1382.203] (-1384.167) (-1395.388) (-1391.345) * [-1388.207] (-1387.811) (-1393.195) (-1384.840) -- 0:01:18
607500 -- (-1386.218) [-1385.431] (-1390.957) (-1382.435) * (-1383.367) (-1394.391) (-1384.818) [-1386.130] -- 0:01:18
608000 -- (-1385.856) (-1386.970) (-1391.775) [-1387.257] * [-1385.582] (-1384.469) (-1386.109) (-1384.049) -- 0:01:18
608500 -- (-1394.629) [-1383.887] (-1392.039) (-1392.046) * (-1384.919) [-1387.738] (-1383.152) (-1385.704) -- 0:01:17
609000 -- (-1388.502) (-1390.740) [-1387.570] (-1390.024) * (-1385.706) (-1386.399) (-1390.318) [-1382.725] -- 0:01:17
609500 -- [-1395.282] (-1384.555) (-1385.691) (-1389.203) * (-1385.014) (-1386.839) (-1383.439) [-1382.864] -- 0:01:17
610000 -- (-1390.967) [-1387.814] (-1392.493) (-1386.588) * (-1390.999) [-1386.019] (-1381.642) (-1382.862) -- 0:01:17
Average standard deviation of split frequencies: 0.000772
610500 -- (-1387.448) [-1390.822] (-1388.216) (-1385.408) * (-1386.728) (-1389.990) (-1381.338) [-1384.902] -- 0:01:17
611000 -- (-1385.176) (-1381.690) [-1384.255] (-1387.051) * (-1389.376) (-1390.036) (-1388.500) [-1387.415] -- 0:01:17
611500 -- (-1389.555) (-1386.205) [-1388.500] (-1384.146) * (-1389.745) (-1392.943) [-1386.465] (-1384.867) -- 0:01:16
612000 -- (-1393.147) [-1385.520] (-1388.592) (-1386.785) * (-1387.360) (-1385.341) [-1383.090] (-1392.786) -- 0:01:17
612500 -- [-1387.999] (-1391.704) (-1389.664) (-1384.586) * (-1389.007) [-1386.232] (-1388.336) (-1391.418) -- 0:01:17
613000 -- (-1386.325) (-1391.902) (-1386.386) [-1384.163] * (-1382.751) [-1384.601] (-1394.202) (-1394.532) -- 0:01:17
613500 -- (-1383.649) (-1387.640) (-1382.244) [-1385.104] * (-1383.367) (-1388.367) [-1384.821] (-1385.637) -- 0:01:16
614000 -- (-1383.383) (-1386.899) [-1385.194] (-1388.816) * (-1391.940) (-1395.387) [-1385.251] (-1388.838) -- 0:01:16
614500 -- (-1389.522) (-1386.564) (-1386.021) [-1382.319] * (-1391.514) (-1381.108) [-1378.944] (-1386.857) -- 0:01:16
615000 -- [-1391.225] (-1380.526) (-1391.746) (-1382.233) * (-1385.876) [-1381.956] (-1382.243) (-1383.788) -- 0:01:16
Average standard deviation of split frequencies: 0.000383
615500 -- [-1386.759] (-1391.412) (-1390.961) (-1389.723) * (-1392.404) (-1388.602) [-1387.647] (-1388.733) -- 0:01:16
616000 -- [-1388.338] (-1389.584) (-1393.957) (-1389.063) * (-1391.539) (-1387.883) (-1383.335) [-1384.740] -- 0:01:16
616500 -- [-1390.355] (-1390.133) (-1392.225) (-1384.057) * (-1383.147) (-1386.478) [-1392.604] (-1385.984) -- 0:01:15
617000 -- (-1390.963) [-1383.752] (-1391.238) (-1385.225) * (-1390.688) (-1390.675) (-1388.889) [-1380.507] -- 0:01:16
617500 -- (-1387.848) [-1390.856] (-1395.902) (-1385.868) * (-1386.578) (-1392.355) [-1389.499] (-1381.289) -- 0:01:16
618000 -- (-1395.385) [-1385.243] (-1391.784) (-1384.804) * (-1385.875) (-1392.682) (-1384.317) [-1381.539] -- 0:01:16
618500 -- (-1382.779) (-1385.798) (-1394.784) [-1388.997] * (-1384.408) [-1391.422] (-1387.103) (-1384.255) -- 0:01:15
619000 -- (-1386.356) (-1387.197) (-1384.545) [-1385.827] * (-1383.664) (-1384.315) (-1388.591) [-1379.589] -- 0:01:15
619500 -- [-1387.052] (-1386.592) (-1387.810) (-1385.812) * (-1383.511) (-1384.901) (-1381.049) [-1386.187] -- 0:01:15
620000 -- [-1390.014] (-1392.576) (-1392.819) (-1386.864) * (-1386.720) (-1384.034) [-1384.217] (-1388.706) -- 0:01:15
Average standard deviation of split frequencies: 0.000380
620500 -- (-1385.655) (-1390.840) (-1385.859) [-1383.210] * [-1381.736] (-1383.590) (-1392.127) (-1393.392) -- 0:01:15
621000 -- (-1383.811) (-1387.677) (-1387.560) [-1383.180] * (-1390.285) [-1383.882] (-1386.934) (-1391.194) -- 0:01:15
621500 -- (-1386.984) (-1390.393) [-1381.031] (-1388.537) * (-1388.272) [-1384.237] (-1384.859) (-1387.466) -- 0:01:14
622000 -- [-1383.254] (-1385.982) (-1385.520) (-1381.036) * (-1388.484) (-1383.488) [-1385.268] (-1383.662) -- 0:01:15
622500 -- (-1385.066) [-1385.319] (-1384.526) (-1385.304) * [-1383.900] (-1394.631) (-1380.680) (-1388.083) -- 0:01:15
623000 -- [-1386.078] (-1391.899) (-1380.558) (-1391.154) * [-1385.458] (-1391.613) (-1388.318) (-1387.935) -- 0:01:15
623500 -- (-1382.586) [-1393.204] (-1387.399) (-1386.087) * (-1390.240) (-1393.216) (-1384.760) [-1386.613] -- 0:01:14
624000 -- (-1392.994) (-1387.570) [-1386.318] (-1386.010) * (-1394.246) (-1394.078) [-1383.700] (-1389.654) -- 0:01:14
624500 -- (-1388.642) (-1385.877) [-1385.424] (-1389.616) * [-1387.277] (-1384.144) (-1389.829) (-1392.257) -- 0:01:14
625000 -- (-1386.890) [-1394.660] (-1388.707) (-1387.839) * (-1384.663) (-1388.244) [-1386.866] (-1390.726) -- 0:01:14
Average standard deviation of split frequencies: 0.000377
625500 -- [-1391.857] (-1393.021) (-1396.648) (-1387.448) * (-1385.106) [-1389.348] (-1389.945) (-1385.988) -- 0:01:14
626000 -- (-1387.261) (-1392.684) [-1387.606] (-1387.356) * (-1391.981) [-1384.919] (-1388.014) (-1383.629) -- 0:01:14
626500 -- (-1388.187) (-1393.287) [-1387.469] (-1384.852) * (-1387.211) [-1382.502] (-1389.594) (-1384.434) -- 0:01:13
627000 -- (-1386.405) [-1390.081] (-1385.450) (-1385.645) * (-1389.867) [-1384.458] (-1388.264) (-1388.460) -- 0:01:14
627500 -- [-1385.261] (-1384.920) (-1390.706) (-1388.360) * [-1381.720] (-1387.976) (-1385.384) (-1383.985) -- 0:01:14
628000 -- (-1389.164) (-1392.366) [-1383.594] (-1386.169) * (-1387.049) (-1384.484) [-1383.437] (-1386.378) -- 0:01:14
628500 -- (-1386.757) (-1385.940) (-1391.978) [-1385.985] * (-1393.423) [-1386.255] (-1388.499) (-1387.244) -- 0:01:13
629000 -- (-1392.338) (-1387.208) (-1387.188) [-1392.532] * (-1391.002) (-1384.424) [-1382.719] (-1385.860) -- 0:01:13
629500 -- (-1385.659) (-1390.914) [-1388.630] (-1385.452) * (-1389.623) [-1385.595] (-1384.097) (-1391.996) -- 0:01:13
630000 -- [-1385.525] (-1381.028) (-1385.761) (-1387.356) * (-1387.951) (-1386.076) [-1385.987] (-1388.709) -- 0:01:13
Average standard deviation of split frequencies: 0.001121
630500 -- (-1390.805) (-1387.888) (-1389.261) [-1386.555] * (-1384.662) (-1391.724) (-1386.206) [-1391.090] -- 0:01:13
631000 -- (-1383.557) [-1384.971] (-1388.881) (-1388.505) * (-1388.921) (-1392.908) [-1387.404] (-1392.792) -- 0:01:13
631500 -- (-1384.942) (-1384.280) (-1386.926) [-1384.975] * (-1384.983) [-1382.855] (-1386.564) (-1385.123) -- 0:01:12
632000 -- (-1395.146) [-1381.546] (-1392.773) (-1388.365) * (-1382.947) (-1388.406) [-1381.125] (-1390.710) -- 0:01:13
632500 -- (-1390.826) (-1381.637) [-1383.655] (-1384.137) * [-1387.042] (-1382.681) (-1389.163) (-1387.698) -- 0:01:13
633000 -- (-1387.948) [-1380.512] (-1383.647) (-1386.122) * (-1394.086) [-1381.906] (-1390.056) (-1387.848) -- 0:01:13
633500 -- (-1387.714) (-1386.051) [-1390.550] (-1385.225) * [-1384.476] (-1388.244) (-1389.832) (-1384.887) -- 0:01:12
634000 -- (-1395.752) (-1386.889) [-1380.873] (-1382.256) * (-1388.054) (-1382.917) (-1381.774) [-1385.283] -- 0:01:12
634500 -- [-1393.045] (-1386.055) (-1386.788) (-1384.362) * (-1389.353) (-1385.861) (-1387.773) [-1389.687] -- 0:01:12
635000 -- [-1385.301] (-1389.143) (-1384.936) (-1391.859) * [-1391.699] (-1380.791) (-1388.479) (-1390.670) -- 0:01:12
Average standard deviation of split frequencies: 0.000741
635500 -- (-1386.120) (-1398.332) (-1388.775) [-1387.295] * [-1386.567] (-1390.407) (-1394.430) (-1389.582) -- 0:01:12
636000 -- [-1382.034] (-1388.534) (-1390.252) (-1388.623) * (-1389.595) (-1383.064) (-1387.512) [-1391.269] -- 0:01:12
636500 -- [-1382.725] (-1391.534) (-1385.477) (-1389.772) * (-1387.458) [-1386.818] (-1391.016) (-1385.415) -- 0:01:11
637000 -- (-1390.778) [-1388.867] (-1384.654) (-1385.599) * (-1385.067) [-1387.142] (-1394.330) (-1388.514) -- 0:01:12
637500 -- (-1388.268) (-1386.724) (-1385.829) [-1383.264] * (-1391.230) [-1389.648] (-1391.189) (-1385.229) -- 0:01:12
638000 -- [-1383.915] (-1385.754) (-1396.945) (-1382.871) * (-1391.573) (-1389.737) [-1384.481] (-1387.489) -- 0:01:12
638500 -- (-1387.109) [-1385.825] (-1388.078) (-1388.118) * (-1394.989) (-1390.711) [-1389.933] (-1383.588) -- 0:01:11
639000 -- (-1392.634) (-1389.945) [-1381.923] (-1386.703) * (-1387.971) (-1388.690) [-1385.826] (-1385.670) -- 0:01:11
639500 -- (-1391.388) (-1396.976) [-1384.868] (-1386.707) * (-1382.946) (-1385.451) [-1387.099] (-1384.643) -- 0:01:11
640000 -- [-1387.831] (-1389.391) (-1392.726) (-1386.766) * (-1385.606) (-1382.499) (-1385.827) [-1385.437] -- 0:01:11
Average standard deviation of split frequencies: 0.000368
640500 -- (-1393.353) [-1383.507] (-1384.391) (-1385.586) * [-1381.954] (-1389.035) (-1381.979) (-1382.982) -- 0:01:11
641000 -- (-1389.547) [-1380.041] (-1390.487) (-1390.171) * [-1387.914] (-1384.908) (-1390.908) (-1386.477) -- 0:01:11
641500 -- (-1387.929) (-1387.981) (-1388.157) [-1387.509] * (-1387.642) [-1385.039] (-1387.354) (-1389.148) -- 0:01:10
642000 -- (-1389.887) (-1381.721) (-1389.652) [-1385.894] * [-1391.430] (-1394.240) (-1383.773) (-1399.059) -- 0:01:11
642500 -- (-1383.381) (-1390.023) [-1386.790] (-1391.838) * (-1395.202) [-1387.319] (-1383.461) (-1395.497) -- 0:01:11
643000 -- (-1389.365) (-1382.935) (-1384.189) [-1386.155] * (-1394.041) (-1384.642) [-1387.401] (-1397.880) -- 0:01:11
643500 -- (-1389.470) [-1385.200] (-1386.020) (-1391.568) * (-1382.727) (-1382.939) [-1383.638] (-1387.037) -- 0:01:10
644000 -- [-1386.039] (-1385.047) (-1390.170) (-1395.137) * (-1386.363) (-1383.021) (-1389.687) [-1387.852] -- 0:01:10
644500 -- (-1386.844) [-1384.961] (-1391.659) (-1394.633) * (-1386.734) (-1393.318) [-1386.180] (-1391.457) -- 0:01:10
645000 -- (-1387.383) [-1384.393] (-1399.103) (-1393.991) * (-1386.735) (-1384.792) [-1383.217] (-1386.294) -- 0:01:10
Average standard deviation of split frequencies: 0.000730
645500 -- (-1382.003) (-1384.634) [-1387.295] (-1398.470) * (-1390.207) (-1385.988) [-1384.749] (-1382.514) -- 0:01:10
646000 -- [-1384.460] (-1385.841) (-1398.867) (-1387.789) * [-1382.118] (-1386.077) (-1389.186) (-1385.677) -- 0:01:10
646500 -- (-1388.859) (-1384.217) (-1390.119) [-1384.177] * [-1392.249] (-1387.805) (-1387.610) (-1387.441) -- 0:01:09
647000 -- (-1385.054) [-1381.318] (-1385.631) (-1384.602) * (-1391.089) [-1389.191] (-1387.679) (-1393.491) -- 0:01:10
647500 -- (-1385.453) [-1382.342] (-1382.546) (-1391.576) * [-1392.259] (-1387.237) (-1388.801) (-1389.082) -- 0:01:10
648000 -- (-1390.594) [-1383.206] (-1387.808) (-1388.705) * (-1393.254) (-1388.760) (-1382.953) [-1388.406] -- 0:01:10
648500 -- [-1393.526] (-1382.213) (-1388.839) (-1390.434) * (-1383.347) (-1388.587) (-1382.738) [-1384.422] -- 0:01:09
649000 -- [-1389.261] (-1385.789) (-1382.881) (-1388.255) * (-1389.029) (-1384.485) [-1387.132] (-1383.448) -- 0:01:09
649500 -- (-1386.359) [-1388.732] (-1393.064) (-1386.187) * (-1383.332) (-1391.160) [-1387.656] (-1386.116) -- 0:01:09
650000 -- [-1386.486] (-1389.389) (-1387.920) (-1381.839) * (-1384.876) (-1385.152) (-1388.567) [-1384.312] -- 0:01:09
Average standard deviation of split frequencies: 0.001087
650500 -- (-1391.627) [-1390.726] (-1384.139) (-1389.689) * (-1383.029) (-1384.119) (-1395.753) [-1385.371] -- 0:01:09
651000 -- (-1392.415) [-1384.197] (-1396.125) (-1385.989) * (-1387.826) (-1383.711) (-1385.661) [-1386.628] -- 0:01:09
651500 -- (-1392.102) [-1385.794] (-1387.752) (-1385.658) * (-1383.084) [-1387.359] (-1385.137) (-1390.479) -- 0:01:09
652000 -- [-1389.196] (-1390.045) (-1385.408) (-1391.048) * (-1382.163) (-1382.416) [-1389.883] (-1382.196) -- 0:01:09
652500 -- (-1389.370) (-1385.267) [-1382.653] (-1382.902) * (-1384.524) (-1386.071) (-1385.413) [-1389.262] -- 0:01:09
653000 -- (-1386.921) (-1386.792) [-1381.248] (-1384.195) * [-1384.472] (-1391.859) (-1389.947) (-1390.055) -- 0:01:09
653500 -- [-1393.175] (-1386.705) (-1386.105) (-1383.370) * (-1383.808) (-1384.538) [-1388.644] (-1388.582) -- 0:01:08
654000 -- [-1385.329] (-1390.303) (-1384.529) (-1389.405) * (-1387.217) [-1386.427] (-1382.259) (-1390.728) -- 0:01:08
654500 -- [-1391.436] (-1386.727) (-1391.928) (-1397.605) * (-1389.135) (-1389.697) [-1386.838] (-1384.277) -- 0:01:08
655000 -- (-1388.738) (-1389.470) (-1384.582) [-1388.279] * [-1384.039] (-1384.876) (-1385.075) (-1387.128) -- 0:01:08
Average standard deviation of split frequencies: 0.001078
655500 -- [-1386.282] (-1386.544) (-1394.187) (-1385.475) * (-1392.178) [-1384.563] (-1386.727) (-1386.204) -- 0:01:08
656000 -- (-1385.472) [-1382.883] (-1388.068) (-1393.427) * (-1388.819) (-1382.428) [-1387.378] (-1387.166) -- 0:01:08
656500 -- (-1385.297) [-1384.970] (-1391.038) (-1390.044) * (-1392.806) [-1384.787] (-1385.694) (-1388.256) -- 0:01:08
657000 -- (-1385.278) (-1383.455) (-1398.659) [-1389.282] * (-1387.336) (-1384.228) [-1388.587] (-1385.925) -- 0:01:08
657500 -- [-1386.249] (-1383.218) (-1396.916) (-1392.895) * (-1390.329) (-1389.298) (-1388.602) [-1382.931] -- 0:01:08
658000 -- [-1384.581] (-1383.940) (-1394.445) (-1390.487) * (-1395.046) [-1384.556] (-1384.015) (-1384.077) -- 0:01:08
658500 -- (-1385.962) (-1388.750) [-1385.457] (-1380.936) * (-1390.484) [-1385.709] (-1389.312) (-1389.137) -- 0:01:07
659000 -- (-1385.265) [-1385.851] (-1383.628) (-1387.352) * (-1384.950) (-1384.102) [-1383.237] (-1387.844) -- 0:01:07
659500 -- (-1386.249) (-1385.626) (-1382.319) [-1382.161] * (-1383.055) (-1385.214) [-1387.913] (-1387.260) -- 0:01:07
660000 -- (-1383.724) [-1385.471] (-1388.604) (-1387.142) * (-1383.681) (-1384.073) [-1383.384] (-1387.766) -- 0:01:07
Average standard deviation of split frequencies: 0.001427
660500 -- (-1385.903) (-1384.336) (-1383.506) [-1386.288] * (-1387.992) [-1386.793] (-1380.556) (-1389.095) -- 0:01:07
661000 -- (-1387.562) [-1387.092] (-1393.604) (-1388.493) * [-1380.394] (-1381.823) (-1383.781) (-1389.120) -- 0:01:07
661500 -- (-1386.664) [-1384.972] (-1389.321) (-1388.444) * (-1388.548) [-1382.615] (-1380.201) (-1391.821) -- 0:01:07
662000 -- (-1386.107) [-1386.118] (-1383.432) (-1385.992) * (-1387.962) (-1387.038) [-1383.417] (-1387.226) -- 0:01:07
662500 -- (-1385.988) [-1383.636] (-1382.549) (-1384.909) * (-1380.915) (-1387.421) (-1388.224) [-1388.798] -- 0:01:07
663000 -- (-1386.312) (-1383.188) [-1387.185] (-1395.418) * [-1392.269] (-1388.772) (-1387.808) (-1385.425) -- 0:01:07
663500 -- (-1381.037) (-1381.608) [-1390.398] (-1388.094) * [-1388.888] (-1393.793) (-1390.719) (-1386.763) -- 0:01:06
664000 -- (-1385.231) (-1389.202) (-1390.306) [-1389.061] * (-1381.733) (-1390.124) (-1387.645) [-1384.151] -- 0:01:06
664500 -- [-1387.941] (-1382.536) (-1387.215) (-1385.441) * (-1386.366) [-1381.372] (-1385.584) (-1381.066) -- 0:01:06
665000 -- (-1387.864) (-1385.690) [-1388.462] (-1384.492) * (-1388.536) (-1384.238) (-1395.357) [-1391.263] -- 0:01:06
Average standard deviation of split frequencies: 0.001416
665500 -- (-1389.272) (-1379.560) (-1386.332) [-1391.758] * (-1393.448) [-1386.409] (-1384.172) (-1385.387) -- 0:01:06
666000 -- [-1382.756] (-1389.730) (-1389.175) (-1386.449) * [-1388.568] (-1396.192) (-1383.931) (-1394.196) -- 0:01:06
666500 -- (-1389.551) (-1387.833) (-1384.961) [-1386.455] * (-1386.099) [-1389.574] (-1383.683) (-1387.300) -- 0:01:06
667000 -- [-1383.262] (-1393.242) (-1382.459) (-1388.667) * [-1382.671] (-1383.566) (-1385.053) (-1382.611) -- 0:01:06
667500 -- (-1384.612) (-1384.164) [-1385.592] (-1391.900) * (-1385.685) (-1385.260) (-1392.705) [-1385.709] -- 0:01:06
668000 -- (-1389.995) (-1390.283) (-1392.643) [-1387.889] * [-1388.923] (-1384.670) (-1395.165) (-1391.238) -- 0:01:06
668500 -- [-1387.985] (-1387.778) (-1391.367) (-1382.458) * (-1387.032) (-1383.898) [-1386.169] (-1396.134) -- 0:01:05
669000 -- [-1385.968] (-1389.978) (-1388.867) (-1387.795) * (-1384.555) (-1387.087) [-1384.046] (-1389.184) -- 0:01:05
669500 -- (-1388.051) (-1390.941) (-1388.312) [-1392.549] * [-1382.712] (-1392.150) (-1384.720) (-1387.254) -- 0:01:05
670000 -- (-1388.238) [-1387.374] (-1389.382) (-1389.842) * (-1390.662) [-1383.520] (-1387.578) (-1385.298) -- 0:01:05
Average standard deviation of split frequencies: 0.001054
670500 -- (-1388.682) (-1388.622) (-1388.341) [-1390.745] * (-1390.606) (-1385.205) [-1392.566] (-1387.973) -- 0:01:05
671000 -- (-1393.528) (-1386.840) [-1385.054] (-1393.964) * (-1386.069) [-1388.901] (-1388.208) (-1387.047) -- 0:01:05
671500 -- [-1397.532] (-1382.242) (-1403.493) (-1388.301) * (-1382.318) (-1381.799) [-1382.736] (-1388.061) -- 0:01:05
672000 -- [-1385.167] (-1387.470) (-1382.738) (-1385.397) * [-1387.488] (-1400.226) (-1383.185) (-1393.935) -- 0:01:05
672500 -- (-1383.111) (-1384.136) (-1395.892) [-1382.402] * (-1386.103) (-1387.898) [-1384.683] (-1395.541) -- 0:01:05
673000 -- [-1381.410] (-1384.314) (-1394.126) (-1392.448) * (-1384.059) [-1381.441] (-1386.779) (-1388.236) -- 0:01:05
673500 -- (-1384.811) (-1388.174) (-1382.607) [-1384.748] * (-1385.975) (-1384.085) (-1386.999) [-1383.650] -- 0:01:04
674000 -- (-1394.704) (-1379.790) [-1385.129] (-1389.971) * [-1384.343] (-1386.124) (-1385.795) (-1387.796) -- 0:01:04
674500 -- [-1382.949] (-1385.314) (-1382.128) (-1384.722) * [-1388.852] (-1382.573) (-1383.047) (-1389.601) -- 0:01:04
675000 -- (-1383.970) [-1380.547] (-1390.809) (-1392.195) * (-1384.562) [-1383.910] (-1388.488) (-1386.329) -- 0:01:04
Average standard deviation of split frequencies: 0.001743
675500 -- [-1382.299] (-1383.031) (-1389.170) (-1394.484) * (-1385.299) [-1386.921] (-1387.189) (-1384.890) -- 0:01:04
676000 -- (-1387.977) (-1388.924) [-1385.028] (-1387.696) * [-1389.266] (-1382.411) (-1385.289) (-1387.308) -- 0:01:04
676500 -- (-1387.570) (-1383.716) (-1385.899) [-1392.435] * (-1384.556) (-1390.483) [-1391.209] (-1382.239) -- 0:01:04
677000 -- (-1386.244) (-1387.382) [-1381.617] (-1385.511) * [-1388.799] (-1386.400) (-1394.153) (-1388.148) -- 0:01:04
677500 -- [-1387.884] (-1393.616) (-1385.533) (-1386.137) * (-1389.009) (-1389.496) (-1388.128) [-1384.419] -- 0:01:04
678000 -- [-1383.962] (-1390.981) (-1382.224) (-1384.993) * (-1386.284) [-1385.642] (-1386.685) (-1390.622) -- 0:01:04
678500 -- (-1389.346) (-1389.930) [-1382.132] (-1387.909) * (-1389.406) [-1379.636] (-1384.721) (-1387.780) -- 0:01:03
679000 -- [-1383.850] (-1385.078) (-1386.769) (-1392.759) * (-1385.847) [-1384.607] (-1381.980) (-1388.513) -- 0:01:03
679500 -- (-1391.890) (-1386.291) [-1388.048] (-1393.169) * (-1386.932) (-1389.082) [-1385.639] (-1383.942) -- 0:01:03
680000 -- [-1386.458] (-1387.647) (-1385.245) (-1391.148) * [-1383.513] (-1384.916) (-1385.859) (-1387.880) -- 0:01:03
Average standard deviation of split frequencies: 0.002078
680500 -- [-1381.230] (-1388.158) (-1383.717) (-1387.015) * (-1387.148) (-1389.818) (-1387.742) [-1383.175] -- 0:01:03
681000 -- (-1380.763) [-1383.056] (-1387.650) (-1384.786) * (-1383.960) [-1391.214] (-1389.810) (-1385.720) -- 0:01:03
681500 -- (-1393.785) [-1387.170] (-1387.151) (-1396.953) * (-1380.541) (-1387.014) [-1382.748] (-1387.440) -- 0:01:03
682000 -- (-1388.256) (-1381.626) (-1386.103) [-1388.828] * (-1387.052) [-1384.035] (-1384.704) (-1385.955) -- 0:01:03
682500 -- (-1385.676) (-1384.849) [-1384.964] (-1388.110) * (-1386.611) (-1385.766) (-1387.598) [-1388.170] -- 0:01:03
683000 -- (-1388.657) (-1385.610) (-1383.829) [-1383.721] * [-1387.083] (-1384.899) (-1384.284) (-1390.280) -- 0:01:03
683500 -- (-1385.133) [-1390.966] (-1391.855) (-1390.342) * (-1385.882) [-1387.119] (-1388.566) (-1387.102) -- 0:01:02
684000 -- [-1389.618] (-1384.906) (-1385.323) (-1394.142) * (-1390.694) (-1392.099) [-1382.025] (-1388.349) -- 0:01:02
684500 -- (-1386.501) [-1385.328] (-1387.331) (-1387.362) * [-1383.262] (-1386.316) (-1383.850) (-1385.246) -- 0:01:02
685000 -- (-1384.334) [-1384.808] (-1388.402) (-1387.001) * (-1383.290) (-1392.093) (-1387.063) [-1383.694] -- 0:01:02
Average standard deviation of split frequencies: 0.001374
685500 -- (-1384.587) (-1383.819) (-1388.694) [-1387.208] * (-1385.094) (-1386.596) [-1381.567] (-1388.500) -- 0:01:02
686000 -- [-1388.541] (-1386.399) (-1387.177) (-1385.039) * (-1393.821) (-1393.398) [-1379.956] (-1391.110) -- 0:01:02
686500 -- (-1382.723) (-1380.511) (-1383.341) [-1385.373] * (-1389.607) (-1387.951) [-1381.190] (-1385.830) -- 0:01:02
687000 -- [-1385.177] (-1387.615) (-1390.261) (-1385.523) * (-1387.300) (-1387.764) (-1385.999) [-1385.947] -- 0:01:02
687500 -- [-1388.166] (-1391.602) (-1386.282) (-1394.352) * (-1386.574) (-1388.550) [-1384.883] (-1386.993) -- 0:01:02
688000 -- [-1388.555] (-1396.367) (-1386.379) (-1382.180) * (-1383.309) [-1382.583] (-1388.893) (-1385.400) -- 0:01:02
688500 -- [-1390.278] (-1386.127) (-1386.368) (-1386.440) * (-1395.351) (-1384.177) (-1396.638) [-1388.298] -- 0:01:01
689000 -- [-1383.691] (-1383.842) (-1390.079) (-1381.514) * [-1386.122] (-1384.261) (-1398.319) (-1386.538) -- 0:01:01
689500 -- (-1388.222) (-1382.250) (-1387.603) [-1382.955] * (-1388.433) (-1387.450) (-1387.578) [-1382.129] -- 0:01:01
690000 -- (-1383.511) (-1383.732) [-1384.915] (-1389.174) * (-1389.000) (-1384.323) [-1383.333] (-1388.162) -- 0:01:01
Average standard deviation of split frequencies: 0.001365
690500 -- (-1386.194) (-1381.959) [-1382.480] (-1387.258) * (-1384.407) [-1388.516] (-1391.877) (-1396.538) -- 0:01:01
691000 -- [-1388.396] (-1386.347) (-1387.598) (-1385.505) * (-1385.243) (-1393.304) (-1388.563) [-1385.785] -- 0:01:01
691500 -- (-1388.946) (-1388.154) (-1382.185) [-1385.647] * (-1389.393) (-1389.263) [-1384.507] (-1386.624) -- 0:01:01
692000 -- [-1385.669] (-1398.820) (-1384.698) (-1388.990) * (-1384.864) (-1389.541) (-1385.698) [-1385.941] -- 0:01:01
692500 -- (-1382.605) (-1394.441) [-1384.175] (-1387.540) * (-1387.149) (-1384.696) (-1391.264) [-1384.579] -- 0:01:01
693000 -- [-1382.665] (-1390.217) (-1386.566) (-1383.057) * (-1384.115) (-1393.687) (-1389.077) [-1387.766] -- 0:01:01
693500 -- (-1388.823) [-1382.559] (-1388.635) (-1381.941) * (-1387.996) (-1386.615) (-1387.644) [-1389.086] -- 0:01:00
694000 -- (-1384.155) (-1389.202) (-1386.953) [-1389.858] * (-1389.616) [-1387.372] (-1386.556) (-1384.404) -- 0:01:00
694500 -- [-1382.583] (-1385.336) (-1387.538) (-1388.508) * (-1386.333) (-1388.387) (-1384.846) [-1384.022] -- 0:01:00
695000 -- (-1388.247) [-1387.709] (-1385.698) (-1394.041) * (-1393.126) (-1388.247) (-1387.595) [-1382.716] -- 0:01:00
Average standard deviation of split frequencies: 0.000677
695500 -- (-1385.490) [-1384.159] (-1387.095) (-1390.321) * [-1388.904] (-1392.527) (-1383.442) (-1386.220) -- 0:01:00
696000 -- (-1391.403) [-1382.021] (-1382.586) (-1392.834) * (-1385.425) (-1385.954) [-1381.130] (-1387.904) -- 0:01:00
696500 -- [-1391.571] (-1384.246) (-1384.243) (-1386.670) * (-1383.634) (-1385.341) [-1384.470] (-1385.216) -- 0:01:00
697000 -- [-1389.492] (-1387.895) (-1392.180) (-1383.627) * (-1393.347) (-1384.319) [-1389.131] (-1385.253) -- 0:01:00
697500 -- (-1382.061) [-1384.784] (-1386.184) (-1388.771) * [-1387.724] (-1389.071) (-1387.649) (-1382.093) -- 0:01:00
698000 -- [-1386.188] (-1383.537) (-1387.447) (-1387.242) * (-1393.842) [-1386.659] (-1383.675) (-1385.414) -- 0:01:00
698500 -- (-1383.653) [-1379.779] (-1396.883) (-1396.561) * (-1389.367) (-1387.166) (-1385.506) [-1386.233] -- 0:00:59
699000 -- (-1385.871) (-1389.244) [-1390.455] (-1388.092) * [-1386.489] (-1383.244) (-1388.896) (-1387.219) -- 0:00:59
699500 -- (-1394.360) (-1386.098) [-1386.929] (-1389.267) * (-1390.916) [-1388.293] (-1390.372) (-1391.392) -- 0:00:59
700000 -- (-1384.448) [-1387.439] (-1386.359) (-1384.547) * (-1389.477) (-1383.071) (-1387.922) [-1382.467] -- 0:00:59
Average standard deviation of split frequencies: 0.001009
700500 -- (-1385.440) (-1385.896) (-1391.226) [-1385.031] * (-1387.919) [-1387.102] (-1394.036) (-1384.364) -- 0:00:59
701000 -- (-1393.228) [-1387.917] (-1388.515) (-1382.950) * (-1387.822) (-1383.981) [-1389.458] (-1388.548) -- 0:00:59
701500 -- (-1383.733) (-1385.742) (-1386.092) [-1382.643] * [-1382.863] (-1386.039) (-1393.013) (-1386.974) -- 0:00:59
702000 -- (-1386.343) (-1383.386) (-1383.114) [-1383.024] * (-1386.943) (-1385.028) (-1386.163) [-1384.149] -- 0:00:59
702500 -- (-1390.635) (-1393.217) [-1384.183] (-1384.409) * [-1385.063] (-1390.929) (-1386.142) (-1388.127) -- 0:00:59
703000 -- (-1394.896) (-1391.210) [-1386.880] (-1388.203) * [-1383.815] (-1385.029) (-1386.367) (-1380.486) -- 0:00:59
703500 -- (-1384.697) (-1392.456) [-1386.370] (-1391.614) * (-1388.494) [-1381.287] (-1388.562) (-1386.293) -- 0:00:59
704000 -- (-1383.318) (-1387.148) [-1388.319] (-1381.916) * [-1383.194] (-1381.490) (-1389.133) (-1383.059) -- 0:00:58
704500 -- (-1391.859) [-1386.620] (-1389.142) (-1385.773) * (-1386.296) [-1384.971] (-1396.244) (-1385.089) -- 0:00:58
705000 -- (-1388.572) (-1385.520) (-1394.523) [-1384.243] * (-1387.336) (-1384.078) [-1389.255] (-1395.102) -- 0:00:58
Average standard deviation of split frequencies: 0.001669
705500 -- [-1383.411] (-1387.672) (-1388.596) (-1393.439) * (-1392.946) (-1384.977) [-1388.202] (-1386.123) -- 0:00:58
706000 -- (-1386.509) [-1389.531] (-1388.363) (-1389.798) * [-1391.610] (-1382.587) (-1391.447) (-1385.502) -- 0:00:58
706500 -- (-1383.638) (-1395.146) [-1383.613] (-1396.659) * (-1390.395) (-1382.394) (-1390.654) [-1382.775] -- 0:00:58
707000 -- [-1381.890] (-1384.309) (-1384.749) (-1394.708) * (-1385.308) [-1379.689] (-1386.987) (-1394.362) -- 0:00:58
707500 -- [-1384.906] (-1387.340) (-1384.328) (-1392.016) * [-1386.907] (-1385.239) (-1385.917) (-1387.431) -- 0:00:58
708000 -- (-1385.447) (-1387.020) [-1380.093] (-1391.067) * [-1391.961] (-1386.038) (-1388.375) (-1387.770) -- 0:00:58
708500 -- (-1388.958) (-1384.592) [-1383.688] (-1391.448) * (-1393.872) [-1387.292] (-1388.099) (-1383.990) -- 0:00:58
709000 -- (-1386.704) [-1386.780] (-1388.746) (-1391.507) * (-1392.262) (-1385.857) (-1389.072) [-1388.420] -- 0:00:57
709500 -- (-1385.545) [-1388.221] (-1386.367) (-1394.161) * (-1398.618) [-1383.100] (-1390.360) (-1388.781) -- 0:00:57
710000 -- (-1393.500) (-1387.946) (-1385.681) [-1390.502] * [-1383.220] (-1386.367) (-1386.842) (-1393.652) -- 0:00:57
Average standard deviation of split frequencies: 0.001327
710500 -- [-1385.848] (-1388.114) (-1390.122) (-1388.877) * [-1385.512] (-1383.871) (-1387.183) (-1384.515) -- 0:00:57
711000 -- (-1391.914) [-1385.716] (-1390.021) (-1386.818) * [-1384.833] (-1387.469) (-1389.230) (-1382.832) -- 0:00:57
711500 -- (-1389.455) (-1387.586) (-1384.731) [-1381.566] * (-1385.306) [-1384.574] (-1384.742) (-1385.966) -- 0:00:57
712000 -- (-1392.738) [-1382.655] (-1391.954) (-1383.094) * (-1389.407) [-1385.057] (-1385.440) (-1387.043) -- 0:00:57
712500 -- (-1387.683) (-1392.349) (-1383.657) [-1383.040] * (-1386.038) (-1392.427) [-1385.519] (-1391.647) -- 0:00:57
713000 -- (-1384.943) (-1384.905) [-1389.042] (-1386.009) * [-1386.278] (-1387.686) (-1384.670) (-1390.202) -- 0:00:57
713500 -- (-1406.503) [-1383.919] (-1390.438) (-1385.232) * [-1387.417] (-1383.685) (-1385.690) (-1391.696) -- 0:00:57
714000 -- (-1385.476) (-1392.151) (-1388.411) [-1388.142] * (-1387.253) (-1389.190) [-1383.266] (-1395.292) -- 0:00:56
714500 -- [-1386.476] (-1386.498) (-1390.818) (-1392.766) * (-1392.832) (-1385.218) [-1383.349] (-1385.172) -- 0:00:56
715000 -- [-1387.406] (-1391.886) (-1390.408) (-1383.851) * (-1382.381) [-1383.985] (-1392.466) (-1389.138) -- 0:00:56
Average standard deviation of split frequencies: 0.002304
715500 -- (-1386.025) (-1386.775) (-1387.818) [-1384.656] * (-1383.645) (-1382.320) (-1389.901) [-1388.552] -- 0:00:56
716000 -- (-1390.313) [-1383.673] (-1386.645) (-1384.402) * (-1386.280) (-1384.392) (-1385.979) [-1383.991] -- 0:00:56
716500 -- (-1390.924) [-1380.461] (-1387.846) (-1384.533) * [-1382.934] (-1387.477) (-1382.197) (-1389.572) -- 0:00:56
717000 -- (-1382.762) [-1382.331] (-1395.071) (-1387.845) * (-1391.443) (-1389.829) [-1388.614] (-1396.369) -- 0:00:56
717500 -- (-1379.695) (-1390.669) [-1385.285] (-1387.863) * (-1398.082) (-1383.227) [-1383.410] (-1390.690) -- 0:00:56
718000 -- (-1389.598) (-1390.349) [-1386.875] (-1390.816) * (-1392.122) [-1385.007] (-1383.653) (-1399.186) -- 0:00:56
718500 -- [-1386.400] (-1386.967) (-1390.639) (-1391.139) * (-1390.404) (-1384.244) [-1383.162] (-1385.927) -- 0:00:56
719000 -- (-1384.735) [-1391.508] (-1387.473) (-1384.482) * (-1383.259) (-1390.544) (-1396.013) [-1383.353] -- 0:00:55
719500 -- (-1387.359) [-1383.272] (-1385.514) (-1383.309) * (-1386.524) [-1388.523] (-1386.568) (-1384.769) -- 0:00:55
720000 -- (-1384.166) (-1392.228) (-1388.806) [-1387.386] * (-1387.017) (-1391.166) (-1387.711) [-1386.199] -- 0:00:55
Average standard deviation of split frequencies: 0.002289
720500 -- [-1389.144] (-1384.014) (-1387.368) (-1394.068) * [-1386.266] (-1394.382) (-1384.255) (-1386.100) -- 0:00:55
721000 -- [-1392.225] (-1386.801) (-1386.966) (-1387.520) * (-1385.912) (-1397.130) [-1383.227] (-1385.586) -- 0:00:55
721500 -- (-1394.322) (-1385.845) (-1387.871) [-1391.009] * (-1385.405) (-1387.339) [-1384.089] (-1383.058) -- 0:00:55
722000 -- (-1391.365) [-1384.349] (-1388.841) (-1388.877) * [-1388.864] (-1386.365) (-1387.102) (-1384.714) -- 0:00:55
722500 -- (-1395.043) (-1388.057) [-1386.581] (-1383.804) * (-1392.474) [-1386.929] (-1389.225) (-1393.267) -- 0:00:55
723000 -- (-1384.121) (-1385.381) [-1386.262] (-1395.907) * [-1383.763] (-1389.502) (-1391.093) (-1387.778) -- 0:00:55
723500 -- (-1384.398) [-1382.436] (-1393.838) (-1388.958) * (-1386.455) [-1382.859] (-1387.690) (-1384.401) -- 0:00:55
724000 -- (-1388.367) (-1386.259) (-1407.669) [-1383.136] * (-1391.541) (-1383.755) (-1383.407) [-1385.793] -- 0:00:54
724500 -- (-1383.626) [-1386.483] (-1390.491) (-1387.998) * (-1391.110) (-1390.464) [-1385.377] (-1382.198) -- 0:00:54
725000 -- (-1388.103) [-1381.076] (-1392.481) (-1389.448) * (-1386.070) [-1383.199] (-1388.281) (-1387.981) -- 0:00:54
Average standard deviation of split frequencies: 0.002597
725500 -- (-1392.237) [-1384.268] (-1390.014) (-1393.133) * (-1386.251) (-1387.745) [-1389.289] (-1388.277) -- 0:00:54
726000 -- [-1385.482] (-1382.651) (-1385.314) (-1384.211) * [-1384.122] (-1383.357) (-1389.451) (-1383.886) -- 0:00:54
726500 -- (-1381.403) (-1388.047) [-1383.625] (-1386.691) * (-1384.231) (-1388.578) (-1385.170) [-1387.883] -- 0:00:54
727000 -- [-1386.636] (-1380.782) (-1389.824) (-1395.656) * (-1379.242) (-1385.116) [-1381.948] (-1387.342) -- 0:00:54
727500 -- (-1390.934) [-1384.935] (-1391.326) (-1386.644) * (-1383.797) (-1386.549) [-1384.328] (-1390.084) -- 0:00:54
728000 -- (-1388.592) (-1388.949) (-1383.305) [-1383.007] * (-1386.355) [-1387.445] (-1393.225) (-1388.616) -- 0:00:54
728500 -- (-1390.349) (-1391.789) [-1384.423] (-1389.108) * (-1387.413) [-1382.783] (-1389.021) (-1390.908) -- 0:00:54
729000 -- [-1388.724] (-1386.717) (-1384.907) (-1393.679) * (-1390.690) [-1381.741] (-1392.208) (-1384.577) -- 0:00:53
729500 -- (-1387.474) (-1387.747) (-1385.606) [-1384.055] * (-1389.410) [-1388.070] (-1392.843) (-1382.062) -- 0:00:53
730000 -- [-1392.138] (-1393.845) (-1386.015) (-1388.096) * (-1386.264) (-1386.120) [-1388.909] (-1388.191) -- 0:00:53
Average standard deviation of split frequencies: 0.002258
730500 -- (-1397.536) (-1394.538) [-1385.383] (-1384.885) * (-1380.823) (-1383.608) (-1392.083) [-1388.925] -- 0:00:53
731000 -- (-1392.971) [-1384.892] (-1384.104) (-1387.455) * (-1384.723) [-1387.288] (-1381.758) (-1392.956) -- 0:00:53
731500 -- (-1398.673) [-1384.719] (-1384.943) (-1393.382) * [-1388.578] (-1383.219) (-1389.320) (-1390.390) -- 0:00:53
732000 -- [-1387.932] (-1384.665) (-1389.897) (-1384.941) * (-1387.765) (-1386.898) [-1386.488] (-1387.197) -- 0:00:53
732500 -- (-1386.780) (-1386.047) [-1394.408] (-1387.725) * [-1383.689] (-1396.141) (-1391.720) (-1388.553) -- 0:00:53
733000 -- (-1384.738) [-1388.894] (-1389.681) (-1388.258) * [-1380.822] (-1391.035) (-1388.311) (-1394.774) -- 0:00:53
733500 -- (-1385.182) (-1386.044) [-1387.078] (-1385.788) * [-1380.423] (-1396.858) (-1388.222) (-1391.074) -- 0:00:53
734000 -- (-1392.141) (-1390.731) [-1389.046] (-1391.042) * [-1380.749] (-1399.095) (-1384.655) (-1385.152) -- 0:00:52
734500 -- (-1392.015) (-1390.001) (-1391.487) [-1391.257] * [-1383.697] (-1395.880) (-1392.010) (-1385.401) -- 0:00:52
735000 -- (-1389.737) (-1394.206) [-1388.687] (-1395.816) * [-1384.477] (-1397.910) (-1383.656) (-1387.022) -- 0:00:52
Average standard deviation of split frequencies: 0.002562
735500 -- (-1388.591) (-1384.629) [-1386.461] (-1393.936) * (-1387.478) (-1387.573) (-1403.516) [-1390.868] -- 0:00:52
736000 -- [-1384.667] (-1386.991) (-1385.885) (-1392.880) * (-1386.866) [-1383.805] (-1391.399) (-1384.376) -- 0:00:52
736500 -- (-1388.578) [-1385.272] (-1385.784) (-1391.239) * [-1383.772] (-1389.501) (-1386.040) (-1385.703) -- 0:00:52
737000 -- (-1394.438) (-1388.333) [-1387.340] (-1387.122) * (-1381.917) (-1390.102) (-1385.482) [-1383.755] -- 0:00:52
737500 -- (-1392.698) [-1386.109] (-1386.866) (-1385.395) * (-1384.272) (-1388.489) (-1383.223) [-1383.938] -- 0:00:52
738000 -- (-1391.072) (-1386.754) (-1383.325) [-1382.694] * (-1391.700) [-1386.577] (-1394.340) (-1385.711) -- 0:00:52
738500 -- [-1385.612] (-1395.710) (-1386.037) (-1388.320) * (-1388.838) [-1385.149] (-1385.048) (-1388.901) -- 0:00:52
739000 -- (-1393.146) (-1389.377) (-1385.829) [-1388.157] * (-1396.378) (-1395.243) (-1388.184) [-1383.228] -- 0:00:51
739500 -- [-1387.083] (-1384.424) (-1384.942) (-1385.461) * (-1382.865) (-1387.844) [-1383.197] (-1384.640) -- 0:00:51
740000 -- (-1389.837) (-1384.630) (-1387.174) [-1383.755] * [-1384.261] (-1388.417) (-1385.253) (-1386.043) -- 0:00:51
Average standard deviation of split frequencies: 0.002228
740500 -- (-1393.414) (-1382.055) (-1388.314) [-1390.454] * (-1384.789) [-1386.160] (-1384.896) (-1384.603) -- 0:00:51
741000 -- (-1388.504) (-1389.143) [-1392.056] (-1390.090) * (-1383.024) (-1386.567) (-1395.697) [-1387.596] -- 0:00:51
741500 -- [-1382.873] (-1388.313) (-1388.620) (-1387.295) * (-1385.438) (-1387.947) [-1384.918] (-1391.651) -- 0:00:51
742000 -- (-1393.619) (-1382.886) [-1381.207] (-1388.325) * (-1389.621) (-1387.107) [-1388.619] (-1386.383) -- 0:00:51
742500 -- (-1393.244) [-1381.430] (-1385.368) (-1386.476) * [-1388.468] (-1386.231) (-1384.314) (-1386.471) -- 0:00:51
743000 -- (-1384.323) [-1390.862] (-1382.476) (-1390.883) * [-1384.791] (-1381.445) (-1386.151) (-1387.688) -- 0:00:51
743500 -- [-1389.885] (-1388.305) (-1394.333) (-1390.864) * (-1386.071) [-1389.050] (-1391.586) (-1383.670) -- 0:00:51
744000 -- (-1387.208) [-1389.886] (-1386.725) (-1391.124) * [-1384.408] (-1382.559) (-1391.791) (-1386.253) -- 0:00:50
744500 -- (-1387.444) (-1391.318) (-1385.466) [-1392.384] * (-1390.889) [-1383.791] (-1392.168) (-1383.781) -- 0:00:50
745000 -- [-1386.621] (-1391.097) (-1383.644) (-1391.910) * (-1384.090) [-1389.850] (-1386.705) (-1389.562) -- 0:00:50
Average standard deviation of split frequencies: 0.002212
745500 -- (-1383.406) (-1383.897) [-1390.272] (-1386.825) * [-1384.747] (-1391.539) (-1384.200) (-1388.007) -- 0:00:50
746000 -- (-1386.195) (-1384.987) (-1385.379) [-1385.602] * (-1390.383) [-1390.372] (-1387.367) (-1393.211) -- 0:00:50
746500 -- [-1384.005] (-1387.352) (-1385.498) (-1384.754) * (-1385.988) (-1391.234) (-1383.851) [-1385.053] -- 0:00:50
747000 -- (-1386.244) (-1388.457) [-1387.247] (-1381.965) * (-1384.229) (-1381.990) (-1386.695) [-1386.585] -- 0:00:50
747500 -- (-1390.230) (-1386.098) (-1393.577) [-1385.060] * (-1392.871) [-1386.764] (-1388.393) (-1384.370) -- 0:00:50
748000 -- [-1389.223] (-1383.662) (-1381.602) (-1384.540) * [-1391.477] (-1392.045) (-1383.261) (-1389.351) -- 0:00:50
748500 -- (-1390.856) (-1390.157) [-1382.871] (-1384.716) * (-1389.340) (-1392.826) [-1389.974] (-1387.556) -- 0:00:50
749000 -- (-1392.149) [-1384.434] (-1394.636) (-1384.127) * (-1384.839) (-1388.711) [-1385.822] (-1385.398) -- 0:00:49
749500 -- (-1387.213) [-1385.576] (-1385.988) (-1384.856) * (-1382.402) (-1390.427) [-1387.489] (-1388.660) -- 0:00:49
750000 -- (-1386.500) [-1388.158] (-1389.035) (-1384.351) * (-1381.575) (-1391.505) [-1387.560] (-1388.383) -- 0:00:49
Average standard deviation of split frequencies: 0.002826
750500 -- (-1386.604) (-1384.480) [-1383.242] (-1383.794) * [-1387.061] (-1391.692) (-1388.069) (-1389.413) -- 0:00:49
751000 -- (-1380.405) (-1390.269) (-1390.228) [-1386.859] * (-1389.276) (-1391.040) (-1394.899) [-1383.397] -- 0:00:49
751500 -- (-1384.109) [-1391.110] (-1389.308) (-1393.151) * (-1386.864) (-1387.471) [-1384.296] (-1390.898) -- 0:00:49
752000 -- (-1384.369) [-1388.142] (-1391.948) (-1386.643) * (-1386.042) [-1384.525] (-1380.277) (-1386.990) -- 0:00:49
752500 -- (-1392.624) [-1387.511] (-1389.362) (-1386.205) * (-1389.312) (-1390.783) [-1384.012] (-1385.008) -- 0:00:49
753000 -- [-1383.618] (-1387.569) (-1388.243) (-1387.313) * (-1386.132) (-1389.572) [-1390.676] (-1385.038) -- 0:00:49
753500 -- (-1394.826) (-1390.501) (-1384.446) [-1388.119] * (-1383.107) (-1389.906) [-1394.731] (-1391.142) -- 0:00:49
754000 -- (-1392.361) (-1393.208) [-1386.282] (-1384.032) * (-1385.556) [-1388.573] (-1391.582) (-1390.361) -- 0:00:48
754500 -- (-1390.463) (-1390.812) (-1393.679) [-1387.428] * (-1394.382) (-1388.337) [-1382.877] (-1385.718) -- 0:00:48
755000 -- (-1391.296) (-1383.788) (-1387.139) [-1386.708] * (-1389.720) (-1383.733) (-1391.258) [-1387.527] -- 0:00:48
Average standard deviation of split frequencies: 0.003118
755500 -- (-1392.646) (-1384.001) (-1388.609) [-1386.516] * [-1385.054] (-1385.907) (-1380.625) (-1387.169) -- 0:00:48
756000 -- [-1390.239] (-1388.744) (-1385.226) (-1384.779) * (-1383.681) (-1390.679) [-1384.798] (-1382.782) -- 0:00:48
756500 -- [-1384.046] (-1382.985) (-1388.450) (-1390.782) * [-1384.843] (-1388.745) (-1385.527) (-1398.912) -- 0:00:48
757000 -- (-1396.371) [-1381.873] (-1383.852) (-1386.101) * (-1381.528) (-1394.187) (-1386.191) [-1390.719] -- 0:00:48
757500 -- (-1387.384) (-1391.698) (-1388.772) [-1387.916] * (-1387.119) (-1390.929) [-1383.061] (-1385.460) -- 0:00:48
758000 -- (-1387.966) [-1391.323] (-1388.131) (-1389.728) * [-1385.183] (-1384.987) (-1380.320) (-1385.891) -- 0:00:48
758500 -- [-1391.290] (-1390.110) (-1392.032) (-1389.410) * (-1386.273) (-1384.998) (-1384.440) [-1383.841] -- 0:00:48
759000 -- [-1390.175] (-1388.520) (-1391.373) (-1394.221) * (-1384.743) (-1385.936) (-1380.721) [-1387.923] -- 0:00:47
759500 -- [-1381.897] (-1381.206) (-1396.075) (-1394.603) * (-1386.100) (-1386.308) (-1386.580) [-1390.802] -- 0:00:47
760000 -- (-1385.474) (-1383.115) [-1387.524] (-1390.248) * (-1388.754) (-1387.762) [-1388.098] (-1391.756) -- 0:00:47
Average standard deviation of split frequencies: 0.003099
760500 -- (-1383.969) (-1387.982) [-1382.977] (-1383.741) * (-1388.565) (-1390.735) (-1386.740) [-1387.172] -- 0:00:47
761000 -- (-1389.331) (-1386.192) [-1387.714] (-1384.983) * (-1380.930) (-1394.451) (-1389.208) [-1385.803] -- 0:00:47
761500 -- (-1393.562) (-1386.802) (-1383.498) [-1382.964] * [-1386.127] (-1389.512) (-1394.788) (-1387.468) -- 0:00:47
762000 -- (-1386.644) (-1385.896) (-1387.755) [-1381.389] * (-1383.771) (-1386.487) (-1395.276) [-1385.123] -- 0:00:47
762500 -- (-1385.252) (-1385.544) (-1387.300) [-1386.609] * (-1382.608) [-1384.758] (-1388.733) (-1397.854) -- 0:00:47
763000 -- (-1394.749) (-1387.288) [-1386.307] (-1384.228) * (-1385.998) [-1385.420] (-1390.398) (-1393.171) -- 0:00:47
763500 -- (-1386.077) (-1381.016) (-1387.971) [-1384.871] * (-1386.341) (-1384.175) (-1384.252) [-1386.457] -- 0:00:47
764000 -- (-1394.518) (-1394.102) [-1382.403] (-1387.838) * (-1383.464) [-1390.268] (-1391.775) (-1389.600) -- 0:00:46
764500 -- (-1383.888) (-1389.979) (-1379.952) [-1385.744] * (-1384.211) [-1385.629] (-1383.877) (-1388.442) -- 0:00:46
765000 -- (-1385.272) (-1382.295) (-1387.024) [-1386.279] * (-1383.650) (-1383.759) (-1387.022) [-1386.649] -- 0:00:46
Average standard deviation of split frequencies: 0.002462
765500 -- [-1387.565] (-1387.876) (-1389.803) (-1385.242) * (-1391.943) [-1380.551] (-1391.381) (-1390.432) -- 0:00:46
766000 -- (-1386.628) [-1382.817] (-1384.187) (-1392.916) * (-1389.010) (-1388.228) (-1387.597) [-1391.269] -- 0:00:46
766500 -- (-1390.338) (-1386.886) (-1382.602) [-1380.853] * (-1386.962) (-1386.997) (-1385.020) [-1383.436] -- 0:00:46
767000 -- (-1381.555) [-1380.675] (-1381.259) (-1386.233) * (-1384.811) (-1392.028) (-1389.396) [-1385.370] -- 0:00:46
767500 -- (-1388.770) (-1390.543) [-1386.893] (-1387.903) * (-1386.052) (-1384.020) [-1386.493] (-1385.369) -- 0:00:46
768000 -- (-1382.913) (-1385.352) [-1385.314] (-1387.062) * (-1387.639) [-1385.043] (-1384.034) (-1384.964) -- 0:00:46
768500 -- (-1380.889) (-1388.673) (-1387.744) [-1386.219] * (-1390.249) (-1391.456) [-1383.216] (-1390.061) -- 0:00:46
769000 -- (-1382.403) (-1393.580) [-1384.093] (-1386.344) * [-1384.879] (-1389.369) (-1380.750) (-1385.098) -- 0:00:45
769500 -- (-1386.989) (-1384.299) (-1390.337) [-1387.145] * [-1387.920] (-1387.092) (-1386.492) (-1382.116) -- 0:00:45
770000 -- (-1380.446) [-1386.486] (-1386.221) (-1396.009) * (-1386.198) [-1392.988] (-1387.622) (-1384.431) -- 0:00:45
Average standard deviation of split frequencies: 0.003058
770500 -- (-1389.538) [-1385.723] (-1384.739) (-1389.385) * [-1389.676] (-1389.125) (-1387.905) (-1385.052) -- 0:00:45
771000 -- (-1386.018) (-1386.220) [-1382.805] (-1388.068) * (-1388.804) (-1393.364) [-1383.735] (-1390.280) -- 0:00:45
771500 -- (-1382.401) (-1389.199) [-1383.688] (-1387.533) * (-1385.382) (-1389.585) [-1388.879] (-1385.700) -- 0:00:45
772000 -- (-1389.412) (-1382.773) (-1392.252) [-1387.782] * (-1394.563) (-1381.500) [-1382.592] (-1382.743) -- 0:00:45
772500 -- (-1388.069) [-1386.247] (-1384.263) (-1384.890) * (-1393.694) [-1384.009] (-1389.257) (-1386.355) -- 0:00:45
773000 -- [-1383.714] (-1391.161) (-1397.496) (-1390.566) * [-1385.152] (-1383.229) (-1384.762) (-1391.183) -- 0:00:45
773500 -- (-1383.788) (-1385.443) [-1386.730] (-1387.633) * (-1385.378) [-1381.990] (-1392.203) (-1390.894) -- 0:00:45
774000 -- (-1388.945) (-1384.597) (-1387.184) [-1389.632] * (-1394.290) (-1386.760) (-1387.453) [-1381.984] -- 0:00:44
774500 -- (-1393.896) (-1382.234) (-1384.143) [-1383.262] * (-1384.131) [-1383.740] (-1383.736) (-1386.170) -- 0:00:44
775000 -- [-1385.238] (-1392.350) (-1387.799) (-1391.918) * [-1385.569] (-1395.026) (-1393.049) (-1387.839) -- 0:00:44
Average standard deviation of split frequencies: 0.003037
775500 -- (-1388.963) (-1388.631) (-1388.416) [-1382.683] * [-1386.432] (-1395.425) (-1385.202) (-1381.879) -- 0:00:44
776000 -- (-1396.900) (-1388.019) [-1386.866] (-1384.646) * [-1384.291] (-1392.109) (-1384.972) (-1387.426) -- 0:00:44
776500 -- (-1385.420) (-1394.424) [-1383.952] (-1385.271) * (-1389.191) (-1384.467) (-1385.611) [-1389.854] -- 0:00:44
777000 -- (-1388.269) [-1384.398] (-1386.099) (-1383.120) * (-1385.704) (-1385.195) [-1381.688] (-1385.538) -- 0:00:44
777500 -- (-1384.026) (-1389.562) [-1382.695] (-1384.510) * [-1387.090] (-1383.628) (-1384.751) (-1386.320) -- 0:00:44
778000 -- (-1390.509) (-1387.975) [-1391.180] (-1386.679) * (-1385.569) [-1385.798] (-1383.684) (-1388.263) -- 0:00:44
778500 -- (-1395.705) (-1385.481) [-1384.074] (-1383.780) * (-1386.287) [-1383.498] (-1391.152) (-1389.031) -- 0:00:44
779000 -- (-1388.979) (-1386.672) [-1388.330] (-1385.118) * (-1387.847) (-1387.551) (-1387.684) [-1384.904] -- 0:00:43
779500 -- (-1387.353) (-1391.485) (-1382.719) [-1387.799] * (-1389.895) (-1389.340) (-1384.677) [-1383.993] -- 0:00:43
780000 -- (-1385.055) (-1397.062) (-1384.128) [-1389.692] * (-1391.738) (-1395.220) [-1382.231] (-1386.756) -- 0:00:43
Average standard deviation of split frequencies: 0.002113
780500 -- (-1390.882) (-1384.860) [-1381.395] (-1389.182) * (-1386.523) (-1383.834) (-1381.353) [-1382.040] -- 0:00:43
781000 -- (-1387.566) (-1389.112) (-1384.809) [-1384.618] * (-1392.141) (-1385.621) [-1382.005] (-1390.891) -- 0:00:43
781500 -- (-1388.143) (-1390.608) [-1389.676] (-1386.469) * (-1388.205) [-1391.074] (-1387.751) (-1388.403) -- 0:00:43
782000 -- (-1387.362) [-1391.731] (-1383.399) (-1388.911) * (-1391.520) (-1387.452) (-1384.476) [-1395.712] -- 0:00:43
782500 -- [-1388.957] (-1392.200) (-1389.554) (-1384.878) * (-1389.239) [-1383.247] (-1383.541) (-1393.220) -- 0:00:43
783000 -- (-1394.138) (-1388.269) [-1383.170] (-1384.268) * [-1392.931] (-1379.985) (-1386.682) (-1391.331) -- 0:00:43
783500 -- (-1389.293) (-1389.338) [-1382.717] (-1386.364) * (-1384.692) (-1385.545) (-1387.212) [-1386.580] -- 0:00:43
784000 -- (-1386.590) [-1384.748] (-1383.411) (-1386.808) * [-1383.574] (-1386.719) (-1383.411) (-1387.401) -- 0:00:42
784500 -- [-1384.978] (-1387.667) (-1391.299) (-1383.659) * [-1389.938] (-1384.997) (-1380.122) (-1387.020) -- 0:00:42
785000 -- [-1385.036] (-1382.293) (-1393.816) (-1382.498) * (-1381.968) [-1381.713] (-1387.039) (-1388.152) -- 0:00:42
Average standard deviation of split frequencies: 0.002399
785500 -- (-1386.066) [-1390.245] (-1386.190) (-1381.863) * (-1383.236) [-1396.081] (-1382.076) (-1387.939) -- 0:00:42
786000 -- (-1388.944) [-1385.338] (-1384.684) (-1384.366) * (-1386.291) (-1389.238) [-1382.380] (-1387.760) -- 0:00:42
786500 -- (-1388.174) (-1386.799) (-1387.061) [-1385.991] * (-1389.113) (-1396.267) [-1383.602] (-1389.201) -- 0:00:42
787000 -- (-1384.909) (-1386.360) (-1383.431) [-1381.182] * (-1385.800) (-1394.084) [-1385.918] (-1392.709) -- 0:00:42
787500 -- (-1385.007) [-1388.090] (-1391.101) (-1383.240) * (-1386.522) (-1390.575) [-1384.903] (-1398.154) -- 0:00:42
788000 -- (-1389.588) [-1386.318] (-1389.675) (-1388.705) * (-1386.989) (-1389.269) [-1383.688] (-1389.189) -- 0:00:42
788500 -- (-1391.366) [-1390.641] (-1383.508) (-1386.237) * (-1398.369) (-1385.898) (-1389.584) [-1386.332] -- 0:00:42
789000 -- (-1387.087) (-1391.513) [-1383.978] (-1384.853) * (-1387.386) (-1385.161) (-1387.489) [-1390.399] -- 0:00:41
789500 -- (-1390.578) (-1382.934) (-1382.432) [-1382.493] * (-1396.506) (-1390.120) [-1388.432] (-1384.242) -- 0:00:41
790000 -- (-1385.872) (-1386.498) (-1383.488) [-1387.743] * [-1385.938] (-1384.346) (-1386.856) (-1381.445) -- 0:00:41
Average standard deviation of split frequencies: 0.002385
790500 -- (-1385.401) (-1387.916) (-1383.105) [-1384.124] * (-1388.278) (-1383.407) [-1385.898] (-1383.076) -- 0:00:41
791000 -- (-1388.475) (-1385.562) (-1387.046) [-1389.384] * (-1387.025) (-1388.542) [-1386.010] (-1388.508) -- 0:00:41
791500 -- [-1383.622] (-1384.772) (-1389.641) (-1383.059) * (-1391.325) (-1383.171) (-1385.189) [-1385.592] -- 0:00:41
792000 -- (-1385.703) (-1390.459) [-1384.169] (-1386.291) * (-1391.787) [-1384.925] (-1381.183) (-1386.438) -- 0:00:41
792500 -- (-1391.679) (-1387.210) (-1381.008) [-1389.287] * (-1386.854) [-1381.318] (-1387.544) (-1388.053) -- 0:00:41
793000 -- (-1387.492) (-1385.743) [-1385.348] (-1388.331) * (-1388.687) (-1389.390) (-1388.169) [-1384.475] -- 0:00:41
793500 -- (-1385.933) (-1392.688) (-1385.241) [-1387.140] * (-1383.347) (-1389.405) (-1390.260) [-1388.549] -- 0:00:41
794000 -- [-1385.030] (-1385.543) (-1388.798) (-1386.101) * (-1383.609) [-1381.792] (-1388.885) (-1380.517) -- 0:00:40
794500 -- (-1391.399) [-1384.623] (-1383.294) (-1387.168) * (-1390.354) [-1385.594] (-1384.151) (-1389.612) -- 0:00:40
795000 -- (-1383.023) (-1387.820) [-1387.749] (-1384.501) * [-1382.382] (-1388.009) (-1384.561) (-1394.809) -- 0:00:40
Average standard deviation of split frequencies: 0.002369
795500 -- (-1384.338) (-1391.626) [-1390.121] (-1386.327) * [-1385.215] (-1388.749) (-1383.320) (-1394.376) -- 0:00:40
796000 -- (-1384.259) [-1381.891] (-1383.506) (-1393.790) * (-1386.337) (-1391.458) [-1383.467] (-1385.312) -- 0:00:40
796500 -- (-1384.088) (-1384.932) (-1399.059) [-1383.393] * [-1387.520] (-1389.781) (-1383.464) (-1385.434) -- 0:00:40
797000 -- [-1391.728] (-1386.770) (-1387.707) (-1384.104) * (-1384.841) [-1396.947] (-1389.999) (-1386.213) -- 0:00:40
797500 -- (-1387.315) (-1390.693) [-1385.551] (-1385.594) * (-1381.544) [-1390.207] (-1386.539) (-1386.550) -- 0:00:40
798000 -- [-1386.555] (-1387.519) (-1382.351) (-1391.875) * (-1388.218) (-1383.183) (-1387.252) [-1390.705] -- 0:00:40
798500 -- (-1384.904) (-1385.284) (-1386.986) [-1384.972] * (-1389.035) (-1389.837) [-1382.011] (-1385.975) -- 0:00:40
799000 -- (-1390.548) [-1385.765] (-1390.073) (-1382.479) * (-1386.164) [-1382.381] (-1385.512) (-1388.890) -- 0:00:39
799500 -- (-1389.978) [-1383.089] (-1384.872) (-1386.796) * (-1382.683) (-1391.454) (-1389.406) [-1385.308] -- 0:00:39
800000 -- [-1388.126] (-1384.986) (-1385.860) (-1387.051) * (-1383.480) (-1390.541) (-1388.572) [-1382.657] -- 0:00:39
Average standard deviation of split frequencies: 0.002944
800500 -- (-1391.682) (-1388.002) (-1383.674) [-1385.581] * (-1392.182) [-1386.419] (-1388.322) (-1382.968) -- 0:00:39
801000 -- (-1394.058) [-1384.117] (-1389.851) (-1388.523) * [-1387.223] (-1387.419) (-1388.194) (-1386.915) -- 0:00:39
801500 -- (-1384.821) (-1386.397) [-1385.922] (-1394.929) * (-1384.601) (-1387.917) (-1388.620) [-1386.534] -- 0:00:39
802000 -- (-1397.380) (-1389.820) (-1382.774) [-1386.251] * (-1385.999) [-1389.547] (-1390.485) (-1392.047) -- 0:00:39
802500 -- (-1386.632) (-1389.931) (-1389.248) [-1382.597] * (-1386.407) [-1391.413] (-1387.956) (-1384.524) -- 0:00:39
803000 -- (-1390.941) [-1389.028] (-1384.786) (-1385.818) * (-1385.214) [-1384.804] (-1387.885) (-1386.889) -- 0:00:39
803500 -- [-1381.146] (-1386.761) (-1389.737) (-1389.302) * (-1384.489) (-1385.293) [-1385.974] (-1384.695) -- 0:00:39
804000 -- [-1385.788] (-1384.096) (-1385.247) (-1389.246) * (-1384.959) (-1385.895) (-1389.640) [-1386.660] -- 0:00:39
804500 -- (-1391.827) (-1386.822) [-1381.157] (-1392.595) * [-1382.165] (-1381.295) (-1392.732) (-1385.702) -- 0:00:38
805000 -- (-1388.852) (-1385.012) [-1380.412] (-1386.409) * [-1385.670] (-1387.741) (-1388.264) (-1389.272) -- 0:00:38
Average standard deviation of split frequencies: 0.002632
805500 -- (-1388.193) (-1390.895) [-1385.648] (-1390.304) * (-1382.669) (-1385.352) (-1390.454) [-1384.450] -- 0:00:38
806000 -- (-1399.856) [-1389.420] (-1387.390) (-1391.270) * (-1381.471) (-1386.736) (-1389.721) [-1383.452] -- 0:00:38
806500 -- (-1392.805) [-1382.294] (-1390.067) (-1387.447) * (-1388.890) (-1390.427) (-1388.558) [-1384.011] -- 0:00:38
807000 -- (-1389.866) (-1384.364) (-1384.260) [-1385.577] * (-1390.321) [-1387.436] (-1386.425) (-1385.872) -- 0:00:38
807500 -- (-1389.589) [-1381.807] (-1380.922) (-1391.638) * (-1385.607) (-1389.614) (-1381.901) [-1388.914] -- 0:00:38
808000 -- (-1394.668) (-1388.697) (-1384.802) [-1382.748] * (-1396.152) (-1391.114) [-1385.544] (-1382.629) -- 0:00:38
808500 -- (-1385.207) (-1383.377) (-1390.748) [-1388.653] * (-1387.693) (-1382.691) [-1384.212] (-1387.398) -- 0:00:38
809000 -- (-1382.250) (-1385.910) [-1386.412] (-1379.216) * (-1395.453) [-1390.870] (-1386.258) (-1390.243) -- 0:00:38
809500 -- (-1388.443) (-1386.790) [-1383.395] (-1390.890) * [-1386.661] (-1387.719) (-1386.177) (-1388.545) -- 0:00:37
810000 -- (-1387.282) (-1387.788) [-1390.290] (-1386.384) * (-1388.447) [-1387.710] (-1390.423) (-1383.938) -- 0:00:37
Average standard deviation of split frequencies: 0.002035
810500 -- [-1380.114] (-1386.502) (-1388.852) (-1390.176) * (-1386.392) (-1384.024) [-1389.002] (-1387.525) -- 0:00:37
811000 -- (-1391.344) (-1387.708) (-1389.612) [-1385.398] * (-1387.750) [-1384.151] (-1385.479) (-1389.265) -- 0:00:37
811500 -- (-1386.375) [-1385.082] (-1386.823) (-1383.326) * [-1385.200] (-1388.162) (-1386.320) (-1384.486) -- 0:00:37
812000 -- (-1386.275) [-1385.823] (-1395.455) (-1386.559) * (-1388.632) (-1382.513) [-1393.430] (-1389.851) -- 0:00:37
812500 -- (-1387.778) (-1386.027) (-1385.351) [-1380.443] * (-1390.051) (-1385.620) [-1391.867] (-1391.924) -- 0:00:37
813000 -- (-1390.859) [-1386.995] (-1385.972) (-1392.474) * (-1383.672) [-1384.301] (-1394.267) (-1381.336) -- 0:00:37
813500 -- (-1387.734) (-1387.961) (-1386.225) [-1386.670] * [-1386.085] (-1385.078) (-1390.282) (-1380.628) -- 0:00:37
814000 -- (-1387.047) (-1388.275) [-1386.994] (-1387.336) * (-1381.525) (-1384.773) [-1383.581] (-1389.468) -- 0:00:37
814500 -- (-1388.067) [-1383.507] (-1386.459) (-1389.006) * [-1389.454] (-1384.851) (-1385.907) (-1386.439) -- 0:00:36
815000 -- [-1388.381] (-1387.090) (-1392.811) (-1381.404) * (-1383.291) (-1391.774) (-1390.103) [-1384.230] -- 0:00:36
Average standard deviation of split frequencies: 0.002600
815500 -- (-1393.419) [-1382.233] (-1390.258) (-1390.771) * (-1382.744) [-1388.412] (-1392.900) (-1381.931) -- 0:00:36
816000 -- (-1398.567) (-1386.647) (-1386.887) [-1382.436] * [-1384.027] (-1390.387) (-1386.033) (-1387.078) -- 0:00:36
816500 -- (-1386.158) [-1385.309] (-1387.322) (-1385.402) * (-1388.030) (-1383.936) [-1383.675] (-1392.909) -- 0:00:36
817000 -- (-1388.329) (-1386.335) (-1387.253) [-1382.886] * (-1390.381) (-1389.542) (-1383.024) [-1385.343] -- 0:00:36
817500 -- [-1386.409] (-1381.412) (-1385.841) (-1386.974) * (-1386.234) [-1386.579] (-1387.122) (-1387.929) -- 0:00:36
818000 -- (-1388.466) (-1389.339) (-1396.160) [-1384.201] * (-1392.611) [-1385.852] (-1384.884) (-1402.285) -- 0:00:36
818500 -- (-1385.041) (-1388.671) [-1384.559] (-1389.255) * (-1388.429) (-1390.967) (-1386.184) [-1390.334] -- 0:00:36
819000 -- (-1382.649) [-1386.594] (-1390.220) (-1387.455) * [-1383.697] (-1392.389) (-1382.969) (-1389.891) -- 0:00:36
819500 -- (-1386.768) (-1391.456) [-1384.616] (-1388.048) * (-1387.269) [-1387.255] (-1388.368) (-1391.851) -- 0:00:35
820000 -- (-1394.999) (-1383.129) [-1382.512] (-1385.567) * (-1386.218) (-1380.518) [-1382.749] (-1386.245) -- 0:00:35
Average standard deviation of split frequencies: 0.002585
820500 -- (-1394.281) (-1391.587) (-1389.194) [-1387.237] * (-1390.596) (-1386.132) (-1387.094) [-1389.092] -- 0:00:35
821000 -- (-1389.511) (-1387.305) [-1385.441] (-1387.480) * (-1392.544) (-1383.584) [-1386.439] (-1384.073) -- 0:00:35
821500 -- (-1387.693) (-1396.151) (-1384.168) [-1387.091] * (-1387.668) (-1389.197) (-1389.933) [-1388.326] -- 0:00:35
822000 -- [-1381.126] (-1385.792) (-1386.515) (-1389.764) * (-1386.316) [-1382.825] (-1389.198) (-1398.177) -- 0:00:35
822500 -- (-1385.625) (-1387.455) (-1388.067) [-1380.782] * (-1383.761) (-1391.171) (-1392.573) [-1385.853] -- 0:00:35
823000 -- (-1382.253) (-1385.617) [-1385.513] (-1385.787) * (-1390.489) [-1389.084] (-1390.456) (-1386.775) -- 0:00:35
823500 -- [-1386.890] (-1385.673) (-1385.467) (-1387.704) * (-1392.041) (-1385.257) [-1384.077] (-1395.785) -- 0:00:35
824000 -- (-1389.958) (-1386.229) [-1386.392] (-1390.299) * (-1387.560) (-1387.816) [-1386.574] (-1384.097) -- 0:00:35
824500 -- [-1381.960] (-1382.512) (-1395.321) (-1385.957) * [-1388.863] (-1383.664) (-1390.960) (-1387.799) -- 0:00:34
825000 -- (-1386.956) [-1383.103] (-1386.280) (-1387.242) * [-1388.230] (-1387.183) (-1390.128) (-1381.700) -- 0:00:34
Average standard deviation of split frequencies: 0.003424
825500 -- (-1392.972) [-1383.493] (-1388.356) (-1385.635) * (-1399.539) (-1387.789) [-1380.826] (-1387.146) -- 0:00:34
826000 -- [-1397.737] (-1390.840) (-1380.587) (-1384.812) * (-1391.221) (-1389.328) [-1381.406] (-1389.211) -- 0:00:34
826500 -- (-1391.344) (-1395.631) [-1386.541] (-1383.040) * [-1384.273] (-1392.383) (-1391.732) (-1384.352) -- 0:00:34
827000 -- (-1386.689) [-1386.181] (-1388.446) (-1386.902) * [-1384.165] (-1388.236) (-1386.640) (-1387.113) -- 0:00:34
827500 -- (-1389.172) (-1388.570) [-1386.719] (-1387.128) * (-1385.524) [-1382.628] (-1387.220) (-1388.570) -- 0:00:34
828000 -- (-1382.145) (-1386.968) [-1388.684] (-1383.603) * (-1384.703) (-1388.774) [-1386.478] (-1386.935) -- 0:00:34
828500 -- (-1387.002) (-1387.650) [-1385.045] (-1387.567) * [-1384.283] (-1387.582) (-1386.886) (-1382.357) -- 0:00:34
829000 -- (-1383.061) (-1387.274) (-1384.050) [-1384.615] * [-1382.665] (-1390.670) (-1389.393) (-1382.116) -- 0:00:34
829500 -- [-1380.060] (-1386.451) (-1385.082) (-1384.191) * (-1385.131) (-1392.171) (-1387.194) [-1385.282] -- 0:00:33
830000 -- (-1389.757) (-1387.413) [-1386.289] (-1387.242) * [-1382.895] (-1388.372) (-1390.818) (-1385.391) -- 0:00:33
Average standard deviation of split frequencies: 0.003121
830500 -- [-1383.426] (-1388.010) (-1381.524) (-1394.759) * (-1383.245) [-1384.597] (-1380.538) (-1390.469) -- 0:00:33
831000 -- [-1382.688] (-1387.771) (-1388.282) (-1392.956) * (-1381.810) (-1389.524) [-1389.303] (-1383.235) -- 0:00:33
831500 -- [-1382.603] (-1383.401) (-1389.765) (-1390.922) * (-1382.366) (-1391.183) (-1385.314) [-1391.587] -- 0:00:33
832000 -- [-1396.854] (-1394.876) (-1384.487) (-1390.846) * (-1383.223) (-1381.158) [-1387.875] (-1390.839) -- 0:00:33
832500 -- (-1390.328) (-1395.518) [-1385.170] (-1387.475) * (-1380.791) [-1384.826] (-1383.592) (-1384.086) -- 0:00:33
833000 -- (-1392.727) (-1388.154) [-1385.708] (-1394.744) * (-1388.133) [-1384.265] (-1381.748) (-1386.890) -- 0:00:33
833500 -- (-1390.556) (-1387.603) (-1385.544) [-1390.502] * [-1383.784] (-1386.094) (-1385.650) (-1381.039) -- 0:00:33
834000 -- (-1395.376) (-1386.045) [-1386.245] (-1391.109) * (-1383.942) (-1382.885) [-1388.522] (-1382.519) -- 0:00:33
834500 -- (-1389.017) (-1385.083) (-1382.920) [-1385.881] * [-1381.639] (-1389.947) (-1384.715) (-1380.794) -- 0:00:32
835000 -- (-1388.134) (-1387.359) [-1383.701] (-1385.334) * (-1382.578) (-1384.170) (-1383.647) [-1385.901] -- 0:00:32
Average standard deviation of split frequencies: 0.003101
835500 -- (-1391.271) [-1387.053] (-1388.561) (-1388.753) * (-1382.537) (-1380.376) (-1385.536) [-1383.844] -- 0:00:32
836000 -- (-1383.317) [-1384.793] (-1390.811) (-1384.565) * (-1391.830) [-1379.581] (-1383.677) (-1385.074) -- 0:00:32
836500 -- [-1383.961] (-1387.767) (-1383.853) (-1385.170) * (-1382.818) [-1388.841] (-1384.408) (-1393.596) -- 0:00:32
837000 -- (-1387.973) (-1393.423) (-1388.440) [-1389.304] * (-1383.442) [-1385.416] (-1389.536) (-1386.284) -- 0:00:32
837500 -- [-1384.935] (-1384.282) (-1388.494) (-1388.636) * (-1384.844) [-1387.297] (-1395.048) (-1389.100) -- 0:00:32
838000 -- (-1387.552) [-1386.832] (-1387.230) (-1391.398) * (-1383.931) [-1383.237] (-1388.144) (-1383.295) -- 0:00:32
838500 -- (-1382.468) (-1392.522) [-1382.624] (-1388.990) * (-1387.007) (-1387.547) (-1388.980) [-1388.625] -- 0:00:32
839000 -- (-1386.773) (-1384.752) [-1381.368] (-1384.767) * (-1384.610) (-1386.686) (-1385.118) [-1384.018] -- 0:00:32
839500 -- (-1387.808) [-1395.494] (-1383.089) (-1389.088) * (-1382.274) [-1388.068] (-1388.759) (-1389.605) -- 0:00:31
840000 -- (-1387.922) [-1383.096] (-1384.222) (-1389.531) * (-1389.524) (-1390.199) (-1387.014) [-1386.188] -- 0:00:31
Average standard deviation of split frequencies: 0.003365
840500 -- (-1387.984) [-1381.968] (-1386.165) (-1393.890) * (-1387.950) (-1386.271) (-1386.136) [-1385.497] -- 0:00:31
841000 -- (-1386.535) (-1390.327) (-1384.839) [-1387.908] * (-1385.368) (-1387.475) (-1388.484) [-1385.756] -- 0:00:31
841500 -- (-1384.045) (-1382.635) [-1387.225] (-1393.178) * (-1391.313) (-1383.029) (-1391.291) [-1384.155] -- 0:00:31
842000 -- [-1383.413] (-1389.480) (-1386.680) (-1386.348) * (-1386.315) [-1383.121] (-1390.039) (-1388.753) -- 0:00:31
842500 -- (-1387.197) (-1386.761) [-1383.858] (-1387.869) * (-1381.085) [-1387.109] (-1394.096) (-1387.146) -- 0:00:31
843000 -- (-1389.109) [-1388.255] (-1386.212) (-1382.736) * (-1383.386) (-1389.006) (-1388.314) [-1385.860] -- 0:00:31
843500 -- (-1400.795) [-1386.622] (-1385.832) (-1385.350) * (-1385.262) [-1389.588] (-1390.007) (-1385.154) -- 0:00:31
844000 -- (-1398.909) [-1385.061] (-1384.147) (-1380.494) * (-1388.657) [-1389.330] (-1387.404) (-1386.222) -- 0:00:31
844500 -- (-1386.187) (-1385.419) (-1389.420) [-1386.283] * (-1386.073) (-1384.204) [-1393.545] (-1384.780) -- 0:00:30
845000 -- (-1387.892) (-1394.580) [-1388.554] (-1393.192) * (-1385.869) (-1384.453) (-1389.772) [-1385.019] -- 0:00:30
Average standard deviation of split frequencies: 0.003343
845500 -- (-1385.599) (-1384.451) [-1382.587] (-1394.646) * (-1389.933) [-1386.867] (-1394.059) (-1388.004) -- 0:00:30
846000 -- (-1381.078) (-1388.263) (-1385.226) [-1389.345] * (-1391.279) (-1382.574) [-1392.443] (-1386.347) -- 0:00:30
846500 -- (-1381.817) (-1389.874) (-1388.118) [-1385.512] * (-1385.808) [-1382.314] (-1389.716) (-1389.677) -- 0:00:30
847000 -- [-1382.673] (-1392.621) (-1389.815) (-1386.900) * (-1387.848) (-1386.150) [-1383.978] (-1389.164) -- 0:00:30
847500 -- (-1387.461) (-1392.753) (-1387.241) [-1386.909] * (-1384.621) (-1388.938) [-1385.278] (-1390.687) -- 0:00:30
848000 -- (-1382.655) (-1386.610) (-1389.238) [-1385.771] * (-1384.245) [-1385.331] (-1393.055) (-1382.874) -- 0:00:30
848500 -- (-1387.822) (-1387.980) [-1383.797] (-1381.222) * [-1385.961] (-1386.357) (-1395.684) (-1390.564) -- 0:00:30
849000 -- [-1385.509] (-1384.323) (-1391.059) (-1384.822) * [-1385.785] (-1389.280) (-1385.234) (-1391.081) -- 0:00:30
849500 -- (-1391.248) (-1389.095) (-1386.833) [-1382.262] * (-1383.869) (-1383.434) [-1387.382] (-1389.071) -- 0:00:29
850000 -- (-1391.436) (-1387.073) (-1394.989) [-1388.236] * [-1382.326] (-1382.407) (-1394.864) (-1391.498) -- 0:00:29
Average standard deviation of split frequencies: 0.003325
850500 -- [-1387.142] (-1391.983) (-1385.829) (-1396.721) * (-1387.351) [-1385.045] (-1385.177) (-1397.162) -- 0:00:29
851000 -- (-1385.155) (-1385.806) [-1385.385] (-1385.885) * (-1385.536) (-1386.023) [-1388.489] (-1393.599) -- 0:00:29
851500 -- (-1384.978) (-1389.598) [-1380.271] (-1387.000) * [-1391.915] (-1381.511) (-1385.458) (-1389.112) -- 0:00:29
852000 -- (-1392.955) [-1386.813] (-1384.248) (-1388.516) * [-1388.510] (-1385.304) (-1388.677) (-1386.210) -- 0:00:29
852500 -- (-1384.961) (-1392.174) (-1382.561) [-1385.593] * (-1385.908) [-1380.416] (-1389.903) (-1387.462) -- 0:00:29
853000 -- (-1392.658) (-1398.306) [-1384.737] (-1387.374) * (-1386.421) (-1384.302) (-1390.368) [-1385.003] -- 0:00:29
853500 -- (-1392.703) [-1392.457] (-1387.295) (-1387.417) * (-1386.920) [-1392.110] (-1390.951) (-1386.244) -- 0:00:29
854000 -- (-1389.484) [-1386.779] (-1389.262) (-1384.418) * (-1391.787) (-1387.248) [-1386.849] (-1383.307) -- 0:00:29
854500 -- (-1382.978) (-1388.107) [-1391.104] (-1390.908) * [-1385.762] (-1383.248) (-1387.950) (-1386.634) -- 0:00:28
855000 -- [-1385.573] (-1385.155) (-1389.924) (-1389.516) * [-1382.253] (-1391.687) (-1384.614) (-1393.956) -- 0:00:28
Average standard deviation of split frequencies: 0.003304
855500 -- [-1385.662] (-1390.309) (-1394.833) (-1385.742) * (-1391.945) (-1386.304) (-1382.406) [-1386.102] -- 0:00:28
856000 -- (-1384.912) (-1386.065) (-1400.613) [-1382.722] * (-1390.347) [-1382.003] (-1382.705) (-1388.650) -- 0:00:28
856500 -- [-1389.835] (-1393.929) (-1397.481) (-1385.824) * (-1386.476) (-1390.744) (-1386.513) [-1385.669] -- 0:00:28
857000 -- [-1381.258] (-1383.335) (-1392.978) (-1385.347) * (-1391.516) (-1386.256) [-1385.458] (-1388.573) -- 0:00:28
857500 -- (-1385.824) (-1384.717) [-1386.533] (-1385.961) * (-1384.407) [-1382.611] (-1387.124) (-1392.720) -- 0:00:28
858000 -- (-1385.135) (-1385.880) (-1382.983) [-1384.702] * (-1391.653) [-1384.642] (-1393.512) (-1391.862) -- 0:00:28
858500 -- (-1387.913) [-1390.101] (-1384.481) (-1386.040) * (-1386.987) (-1384.553) [-1385.605] (-1392.386) -- 0:00:28
859000 -- (-1389.626) (-1384.612) (-1397.446) [-1389.453] * (-1387.369) (-1385.541) [-1384.979] (-1388.424) -- 0:00:28
859500 -- (-1388.991) (-1391.222) (-1387.453) [-1382.303] * (-1389.241) (-1386.139) [-1384.075] (-1388.549) -- 0:00:27
860000 -- (-1384.020) [-1383.093] (-1390.823) (-1387.939) * (-1389.144) (-1382.896) [-1386.213] (-1388.142) -- 0:00:27
Average standard deviation of split frequencies: 0.003286
860500 -- (-1386.098) [-1387.908] (-1386.030) (-1383.788) * (-1386.197) (-1383.767) [-1388.708] (-1389.412) -- 0:00:27
861000 -- (-1380.577) (-1386.961) [-1386.406] (-1391.807) * (-1381.212) (-1388.428) [-1394.864] (-1388.128) -- 0:00:27
861500 -- [-1383.740] (-1389.275) (-1393.783) (-1390.293) * (-1384.006) [-1388.467] (-1388.644) (-1387.801) -- 0:00:27
862000 -- [-1389.098] (-1381.832) (-1390.735) (-1384.279) * (-1386.186) [-1384.386] (-1386.925) (-1391.647) -- 0:00:27
862500 -- (-1385.778) [-1382.802] (-1385.915) (-1391.514) * (-1387.138) (-1384.933) [-1385.172] (-1393.917) -- 0:00:27
863000 -- [-1382.511] (-1384.555) (-1383.661) (-1385.656) * [-1388.292] (-1395.774) (-1386.081) (-1394.039) -- 0:00:27
863500 -- (-1382.362) [-1385.309] (-1393.462) (-1383.050) * (-1382.650) (-1390.402) (-1386.698) [-1394.695] -- 0:00:27
864000 -- [-1382.922] (-1387.600) (-1392.042) (-1384.535) * [-1385.485] (-1387.612) (-1385.022) (-1386.777) -- 0:00:27
864500 -- (-1380.893) (-1387.260) [-1386.066] (-1387.992) * (-1382.396) [-1384.239] (-1386.014) (-1389.093) -- 0:00:26
865000 -- (-1385.343) [-1388.756] (-1390.215) (-1391.462) * (-1384.112) (-1386.763) (-1389.359) [-1382.583] -- 0:00:26
Average standard deviation of split frequencies: 0.003810
865500 -- (-1385.934) (-1389.759) (-1389.299) [-1389.440] * [-1388.315] (-1396.415) (-1385.871) (-1388.811) -- 0:00:26
866000 -- (-1385.374) (-1384.257) [-1389.504] (-1390.032) * (-1386.117) (-1386.446) (-1390.047) [-1391.084] -- 0:00:26
866500 -- [-1382.639] (-1384.067) (-1386.435) (-1381.175) * (-1386.848) (-1395.114) [-1385.026] (-1390.730) -- 0:00:26
867000 -- (-1392.520) (-1395.908) (-1386.422) [-1384.087] * (-1386.074) [-1389.661] (-1385.879) (-1386.449) -- 0:00:26
867500 -- (-1388.884) (-1386.748) [-1386.094] (-1385.606) * [-1384.462] (-1383.432) (-1387.066) (-1388.534) -- 0:00:26
868000 -- (-1390.259) [-1382.658] (-1387.772) (-1387.866) * (-1383.722) (-1386.039) [-1386.232] (-1386.408) -- 0:00:26
868500 -- (-1388.140) (-1383.214) [-1383.194] (-1387.798) * (-1387.241) (-1385.366) [-1386.401] (-1382.583) -- 0:00:26
869000 -- (-1386.575) [-1383.391] (-1383.402) (-1386.858) * (-1389.943) [-1382.792] (-1383.569) (-1385.632) -- 0:00:26
869500 -- (-1392.023) [-1385.014] (-1383.486) (-1386.619) * (-1388.505) (-1389.656) (-1393.439) [-1387.528] -- 0:00:25
870000 -- (-1388.981) [-1384.540] (-1384.233) (-1384.169) * [-1388.977] (-1387.588) (-1384.434) (-1384.753) -- 0:00:25
Average standard deviation of split frequencies: 0.004061
870500 -- (-1384.606) (-1397.780) (-1389.102) [-1396.716] * (-1387.245) (-1383.207) [-1385.986] (-1389.716) -- 0:00:25
871000 -- (-1381.961) (-1393.291) (-1386.263) [-1386.882] * (-1387.078) [-1383.727] (-1383.850) (-1394.473) -- 0:00:25
871500 -- (-1388.413) (-1386.400) [-1388.242] (-1382.178) * [-1382.533] (-1385.440) (-1385.807) (-1390.743) -- 0:00:25
872000 -- (-1385.424) [-1385.998] (-1380.749) (-1386.610) * (-1387.097) (-1392.401) [-1384.709] (-1381.921) -- 0:00:25
872500 -- (-1386.118) (-1388.724) (-1391.484) [-1384.106] * (-1390.638) (-1390.435) (-1393.126) [-1388.535] -- 0:00:25
873000 -- (-1389.320) [-1387.672] (-1385.682) (-1384.831) * [-1391.372] (-1382.164) (-1385.943) (-1387.731) -- 0:00:25
873500 -- [-1387.819] (-1389.847) (-1390.769) (-1384.659) * [-1386.142] (-1386.705) (-1389.162) (-1385.835) -- 0:00:25
874000 -- (-1388.936) [-1383.452] (-1387.384) (-1385.656) * (-1387.419) [-1384.267] (-1390.983) (-1392.215) -- 0:00:25
874500 -- (-1384.202) [-1388.920] (-1386.727) (-1388.418) * (-1394.405) (-1388.245) (-1388.544) [-1383.387] -- 0:00:24
875000 -- (-1390.547) (-1386.057) (-1387.486) [-1382.836] * [-1384.093] (-1384.098) (-1390.395) (-1383.121) -- 0:00:24
Average standard deviation of split frequencies: 0.003767
875500 -- (-1387.870) (-1385.691) (-1385.827) [-1384.568] * [-1392.339] (-1392.301) (-1385.949) (-1385.357) -- 0:00:24
876000 -- (-1386.991) [-1384.241] (-1386.116) (-1385.191) * (-1384.535) (-1381.028) [-1384.516] (-1382.843) -- 0:00:24
876500 -- [-1385.556] (-1381.088) (-1385.512) (-1385.675) * (-1385.621) [-1384.949] (-1383.857) (-1387.793) -- 0:00:24
877000 -- [-1385.230] (-1392.163) (-1388.503) (-1386.074) * (-1388.914) (-1386.753) [-1386.436] (-1384.654) -- 0:00:24
877500 -- (-1384.696) (-1386.305) (-1382.647) [-1383.546] * [-1388.229] (-1385.679) (-1385.392) (-1396.668) -- 0:00:24
878000 -- (-1386.663) (-1388.237) (-1381.731) [-1380.941] * (-1393.705) (-1388.789) (-1386.089) [-1384.555] -- 0:00:24
878500 -- (-1385.664) (-1385.053) [-1382.035] (-1385.680) * [-1386.150] (-1387.459) (-1386.105) (-1388.460) -- 0:00:24
879000 -- (-1386.307) [-1385.506] (-1390.232) (-1398.181) * [-1388.957] (-1381.931) (-1388.129) (-1389.860) -- 0:00:24
879500 -- [-1384.054] (-1384.164) (-1387.662) (-1388.399) * (-1387.452) [-1387.381] (-1392.414) (-1386.237) -- 0:00:23
880000 -- (-1385.517) [-1382.585] (-1390.456) (-1388.140) * (-1386.698) [-1387.388] (-1391.144) (-1392.008) -- 0:00:23
Average standard deviation of split frequencies: 0.004282
880500 -- [-1383.268] (-1383.541) (-1389.405) (-1383.725) * [-1380.584] (-1387.827) (-1386.582) (-1389.319) -- 0:00:23
881000 -- (-1382.726) [-1384.039] (-1386.728) (-1391.854) * [-1385.942] (-1388.956) (-1389.188) (-1386.144) -- 0:00:23
881500 -- (-1382.860) (-1385.625) [-1387.137] (-1387.418) * (-1386.597) [-1384.062] (-1389.923) (-1393.030) -- 0:00:23
882000 -- [-1382.281] (-1387.279) (-1386.209) (-1385.194) * (-1395.898) [-1386.696] (-1382.243) (-1387.100) -- 0:00:23
882500 -- (-1385.225) [-1386.430] (-1384.091) (-1388.315) * [-1394.574] (-1387.167) (-1386.284) (-1387.020) -- 0:00:23
883000 -- [-1382.860] (-1392.384) (-1386.865) (-1395.171) * (-1396.616) [-1387.492] (-1388.800) (-1389.537) -- 0:00:23
883500 -- (-1381.728) [-1383.376] (-1387.180) (-1398.447) * (-1386.352) [-1384.046] (-1389.235) (-1383.523) -- 0:00:23
884000 -- (-1381.661) (-1385.893) [-1388.176] (-1383.916) * (-1391.182) (-1385.530) (-1384.096) [-1387.760] -- 0:00:23
884500 -- [-1386.120] (-1385.930) (-1384.740) (-1390.049) * (-1389.115) [-1387.962] (-1383.684) (-1384.602) -- 0:00:22
885000 -- [-1384.486] (-1390.611) (-1384.360) (-1385.724) * (-1382.304) (-1389.837) (-1387.734) [-1385.996] -- 0:00:22
Average standard deviation of split frequencies: 0.004256
885500 -- (-1391.501) (-1382.930) (-1387.642) [-1388.025] * (-1386.322) (-1387.516) (-1388.133) [-1390.709] -- 0:00:22
886000 -- (-1387.915) (-1381.876) [-1384.250] (-1387.626) * (-1393.758) (-1383.267) (-1389.020) [-1385.922] -- 0:00:22
886500 -- (-1399.147) [-1387.725] (-1386.739) (-1388.209) * (-1393.880) [-1387.015] (-1391.302) (-1390.076) -- 0:00:22
887000 -- [-1389.775] (-1387.549) (-1385.833) (-1385.403) * (-1384.696) (-1384.285) (-1388.511) [-1384.566] -- 0:00:22
887500 -- [-1386.069] (-1393.750) (-1386.127) (-1386.513) * [-1383.653] (-1385.121) (-1385.378) (-1383.716) -- 0:00:22
888000 -- (-1388.539) [-1383.821] (-1383.687) (-1385.995) * (-1387.217) (-1385.649) [-1383.220] (-1383.362) -- 0:00:22
888500 -- (-1384.916) [-1382.719] (-1382.610) (-1393.271) * (-1387.562) (-1387.664) [-1382.046] (-1388.616) -- 0:00:22
889000 -- (-1390.991) [-1383.461] (-1389.601) (-1385.126) * (-1386.817) (-1384.005) (-1385.145) [-1383.565] -- 0:00:22
889500 -- [-1388.253] (-1389.311) (-1393.711) (-1384.041) * (-1389.141) (-1391.588) [-1382.389] (-1387.251) -- 0:00:21
890000 -- (-1385.905) (-1386.710) (-1384.353) [-1383.951] * (-1387.948) (-1386.723) [-1386.311] (-1384.484) -- 0:00:21
Average standard deviation of split frequencies: 0.004234
890500 -- [-1385.636] (-1386.641) (-1386.244) (-1387.713) * (-1383.763) (-1385.935) (-1385.621) [-1389.128] -- 0:00:21
891000 -- (-1390.666) (-1385.102) (-1389.364) [-1392.310] * [-1387.810] (-1385.293) (-1381.802) (-1386.478) -- 0:00:21
891500 -- (-1386.788) (-1384.400) [-1385.628] (-1383.677) * (-1393.177) (-1390.557) [-1386.029] (-1388.175) -- 0:00:21
892000 -- (-1391.222) [-1385.688] (-1385.527) (-1386.854) * (-1386.059) [-1395.426] (-1383.645) (-1396.096) -- 0:00:21
892500 -- (-1387.053) (-1387.544) (-1387.914) [-1391.072] * (-1390.652) (-1392.933) [-1385.380] (-1388.908) -- 0:00:21
893000 -- (-1390.682) (-1391.389) (-1383.609) [-1385.539] * (-1386.040) (-1395.920) [-1392.659] (-1387.261) -- 0:00:21
893500 -- (-1388.180) [-1386.694] (-1380.657) (-1386.076) * (-1391.457) (-1392.651) [-1389.460] (-1380.385) -- 0:00:21
894000 -- [-1383.560] (-1385.126) (-1384.561) (-1386.362) * (-1389.223) [-1392.566] (-1383.395) (-1381.699) -- 0:00:21
894500 -- (-1385.422) (-1383.856) [-1385.510] (-1391.360) * (-1388.110) [-1384.622] (-1387.205) (-1387.486) -- 0:00:20
895000 -- [-1381.436] (-1381.602) (-1389.087) (-1387.997) * (-1389.841) (-1384.041) (-1383.387) [-1382.147] -- 0:00:20
Average standard deviation of split frequencies: 0.004998
895500 -- (-1390.574) [-1381.567] (-1387.462) (-1392.677) * (-1384.376) (-1386.490) (-1392.292) [-1387.150] -- 0:00:20
896000 -- (-1385.998) (-1383.220) [-1380.910] (-1391.457) * (-1384.669) [-1383.709] (-1388.428) (-1386.574) -- 0:00:20
896500 -- [-1386.422] (-1385.953) (-1386.413) (-1388.733) * (-1387.867) [-1386.067] (-1386.681) (-1385.773) -- 0:00:20
897000 -- (-1384.475) (-1385.544) (-1384.512) [-1387.610] * (-1387.067) (-1388.399) (-1385.435) [-1385.149] -- 0:00:20
897500 -- (-1389.539) (-1383.696) [-1387.958] (-1384.132) * (-1387.138) (-1389.552) [-1391.734] (-1390.833) -- 0:00:20
898000 -- [-1392.072] (-1393.017) (-1386.459) (-1388.058) * (-1387.207) [-1386.531] (-1385.777) (-1385.027) -- 0:00:20
898500 -- [-1386.517] (-1386.427) (-1381.366) (-1389.733) * [-1387.704] (-1384.822) (-1387.660) (-1389.633) -- 0:00:20
899000 -- (-1386.216) (-1388.750) (-1387.544) [-1391.712] * (-1386.629) (-1384.972) [-1387.883] (-1390.224) -- 0:00:20
899500 -- (-1385.139) (-1385.007) (-1386.814) [-1386.416] * [-1389.426] (-1388.780) (-1395.940) (-1392.378) -- 0:00:19
900000 -- [-1385.859] (-1390.042) (-1385.658) (-1385.241) * (-1383.589) (-1393.516) [-1385.861] (-1391.681) -- 0:00:19
Average standard deviation of split frequencies: 0.004187
900500 -- (-1393.408) (-1398.144) (-1385.719) [-1387.053] * [-1393.014] (-1382.521) (-1383.696) (-1393.632) -- 0:00:19
901000 -- (-1386.330) [-1394.494] (-1382.653) (-1391.378) * (-1385.776) (-1389.340) [-1391.464] (-1393.963) -- 0:00:19
901500 -- [-1385.431] (-1391.234) (-1392.346) (-1392.771) * [-1388.700] (-1388.056) (-1383.798) (-1389.955) -- 0:00:19
902000 -- (-1383.687) (-1385.108) [-1386.530] (-1397.090) * (-1393.747) (-1383.859) [-1385.732] (-1392.653) -- 0:00:19
902500 -- [-1382.948] (-1384.789) (-1387.137) (-1386.546) * [-1387.551] (-1389.354) (-1391.348) (-1384.861) -- 0:00:19
903000 -- (-1386.382) (-1385.061) [-1385.420] (-1381.301) * (-1387.880) [-1387.730] (-1386.790) (-1387.584) -- 0:00:19
903500 -- [-1385.355] (-1383.874) (-1393.570) (-1386.301) * [-1384.766] (-1381.214) (-1391.243) (-1386.180) -- 0:00:19
904000 -- [-1388.158] (-1393.964) (-1386.362) (-1396.235) * (-1387.354) [-1387.345] (-1383.428) (-1387.040) -- 0:00:19
904500 -- [-1383.198] (-1389.115) (-1392.640) (-1391.731) * (-1394.938) (-1385.858) (-1391.142) [-1385.709] -- 0:00:19
905000 -- (-1386.154) (-1387.215) [-1384.580] (-1388.801) * (-1390.346) (-1395.404) (-1383.464) [-1386.251] -- 0:00:18
Average standard deviation of split frequencies: 0.004423
905500 -- (-1393.040) (-1386.725) [-1387.341] (-1390.607) * (-1392.310) (-1384.995) [-1388.778] (-1385.259) -- 0:00:18
906000 -- (-1392.377) [-1387.471] (-1390.653) (-1385.125) * (-1386.284) [-1384.528] (-1381.675) (-1389.699) -- 0:00:18
906500 -- [-1386.618] (-1384.817) (-1388.367) (-1387.938) * (-1390.842) [-1381.135] (-1385.429) (-1389.495) -- 0:00:18
907000 -- [-1387.975] (-1385.437) (-1383.458) (-1384.356) * (-1388.111) (-1384.312) [-1384.597] (-1387.332) -- 0:00:18
907500 -- (-1388.296) [-1387.600] (-1386.489) (-1387.477) * [-1386.996] (-1393.770) (-1384.897) (-1386.876) -- 0:00:18
908000 -- [-1386.125] (-1384.105) (-1391.627) (-1387.744) * (-1387.548) (-1398.455) (-1386.607) [-1385.993] -- 0:00:18
908500 -- [-1386.533] (-1385.759) (-1386.809) (-1383.040) * (-1393.718) (-1387.759) (-1387.425) [-1391.704] -- 0:00:18
909000 -- [-1387.085] (-1385.139) (-1384.726) (-1382.856) * (-1390.834) [-1388.311] (-1383.106) (-1383.953) -- 0:00:18
909500 -- (-1387.747) (-1390.030) [-1386.566] (-1386.758) * (-1390.679) (-1387.478) [-1383.925] (-1387.221) -- 0:00:18
910000 -- (-1388.660) [-1387.896] (-1390.319) (-1389.843) * (-1385.533) [-1387.649] (-1383.376) (-1393.722) -- 0:00:17
Average standard deviation of split frequencies: 0.004400
910500 -- (-1388.020) (-1390.615) [-1386.117] (-1383.412) * (-1388.045) (-1385.244) (-1385.403) [-1384.980] -- 0:00:17
911000 -- (-1385.994) (-1387.634) (-1386.730) [-1386.088] * [-1389.271] (-1385.563) (-1384.853) (-1384.707) -- 0:00:17
911500 -- [-1386.292] (-1390.949) (-1393.638) (-1393.426) * (-1386.336) [-1384.863] (-1384.651) (-1386.331) -- 0:00:17
912000 -- (-1383.725) (-1392.482) (-1387.345) [-1387.586] * (-1388.769) [-1385.314] (-1382.552) (-1382.136) -- 0:00:17
912500 -- (-1388.512) [-1395.360] (-1383.850) (-1392.687) * (-1385.112) (-1386.630) [-1386.057] (-1388.046) -- 0:00:17
913000 -- [-1390.396] (-1391.517) (-1385.681) (-1386.601) * (-1390.019) (-1386.373) [-1386.642] (-1383.215) -- 0:00:17
913500 -- [-1382.881] (-1388.915) (-1380.939) (-1389.540) * (-1389.972) (-1385.288) (-1390.444) [-1389.068] -- 0:00:17
914000 -- (-1388.359) (-1391.501) (-1388.810) [-1384.810] * (-1384.795) (-1385.906) (-1384.721) [-1385.611] -- 0:00:17
914500 -- [-1387.443] (-1385.185) (-1387.689) (-1385.410) * (-1393.708) [-1384.382] (-1385.342) (-1382.637) -- 0:00:17
915000 -- (-1382.289) (-1391.725) (-1389.709) [-1382.523] * (-1389.289) (-1386.841) [-1387.257] (-1382.289) -- 0:00:16
Average standard deviation of split frequencies: 0.003345
915500 -- (-1383.717) (-1384.742) [-1388.064] (-1387.938) * (-1385.435) (-1390.286) (-1387.629) [-1390.775] -- 0:00:16
916000 -- (-1387.810) [-1385.665] (-1389.407) (-1389.558) * (-1392.010) [-1387.448] (-1383.960) (-1382.581) -- 0:00:16
916500 -- (-1386.561) (-1395.221) [-1382.613] (-1384.176) * (-1390.208) [-1382.844] (-1383.040) (-1388.172) -- 0:00:16
917000 -- (-1385.363) (-1388.848) (-1383.576) [-1384.554] * (-1391.226) [-1384.930] (-1392.099) (-1387.838) -- 0:00:16
917500 -- (-1389.356) (-1389.255) [-1386.812] (-1383.543) * (-1382.709) (-1391.581) [-1388.339] (-1385.825) -- 0:00:16
918000 -- [-1389.576] (-1398.430) (-1387.185) (-1386.567) * (-1390.462) (-1393.279) (-1382.994) [-1382.681] -- 0:00:16
918500 -- (-1384.630) (-1386.660) (-1389.553) [-1384.778] * (-1385.084) (-1391.161) [-1380.488] (-1385.531) -- 0:00:16
919000 -- (-1391.955) [-1385.996] (-1386.087) (-1390.643) * (-1383.544) (-1389.924) (-1381.542) [-1382.057] -- 0:00:16
919500 -- (-1386.264) (-1388.822) (-1386.490) [-1395.423] * (-1388.321) (-1393.495) [-1383.077] (-1382.523) -- 0:00:16
920000 -- (-1388.624) (-1388.749) (-1386.346) [-1388.446] * (-1386.202) [-1387.878] (-1387.536) (-1387.648) -- 0:00:15
Average standard deviation of split frequencies: 0.003328
920500 -- (-1384.942) (-1390.296) (-1391.055) [-1389.665] * [-1386.645] (-1381.711) (-1388.955) (-1381.187) -- 0:00:15
921000 -- (-1385.718) (-1386.344) [-1387.587] (-1386.423) * (-1382.250) [-1385.961] (-1383.835) (-1387.704) -- 0:00:15
921500 -- (-1390.964) (-1385.403) (-1393.068) [-1390.479] * (-1385.098) (-1383.369) [-1389.308] (-1391.132) -- 0:00:15
922000 -- (-1385.271) [-1389.182] (-1393.576) (-1392.110) * (-1382.426) (-1385.225) [-1389.316] (-1383.724) -- 0:00:15
922500 -- [-1381.271] (-1385.426) (-1385.463) (-1386.840) * (-1383.850) [-1391.302] (-1393.612) (-1388.388) -- 0:00:15
923000 -- (-1385.191) (-1389.219) (-1389.095) [-1386.032] * [-1389.989] (-1390.459) (-1393.023) (-1385.201) -- 0:00:15
923500 -- [-1385.718] (-1386.188) (-1387.588) (-1389.225) * (-1387.372) (-1391.686) (-1392.255) [-1387.950] -- 0:00:15
924000 -- (-1389.110) (-1383.681) (-1387.564) [-1385.391] * (-1389.297) [-1383.647] (-1387.172) (-1389.901) -- 0:00:15
924500 -- [-1385.276] (-1385.643) (-1388.440) (-1385.696) * (-1400.489) (-1383.764) (-1393.717) [-1388.559] -- 0:00:15
925000 -- [-1382.760] (-1388.981) (-1387.811) (-1388.318) * (-1383.150) (-1392.061) (-1388.168) [-1397.673] -- 0:00:14
Average standard deviation of split frequencies: 0.003054
925500 -- [-1381.270] (-1392.716) (-1381.923) (-1384.690) * [-1386.311] (-1386.349) (-1382.821) (-1393.127) -- 0:00:14
926000 -- (-1384.504) (-1385.736) (-1386.606) [-1388.191] * (-1384.397) (-1384.949) [-1388.215] (-1390.189) -- 0:00:14
926500 -- [-1388.915] (-1386.253) (-1390.512) (-1384.197) * [-1385.071] (-1389.736) (-1391.312) (-1385.396) -- 0:00:14
927000 -- [-1388.977] (-1383.579) (-1384.489) (-1384.240) * [-1387.991] (-1389.930) (-1387.717) (-1381.992) -- 0:00:14
927500 -- (-1387.063) (-1387.061) (-1392.638) [-1386.942] * (-1395.098) (-1394.459) [-1387.500] (-1387.433) -- 0:00:14
928000 -- (-1382.124) (-1384.045) [-1389.453] (-1385.751) * (-1390.851) (-1389.672) (-1387.472) [-1383.738] -- 0:00:14
928500 -- [-1388.737] (-1384.158) (-1393.779) (-1383.245) * (-1384.692) (-1385.310) (-1389.676) [-1383.067] -- 0:00:14
929000 -- (-1391.830) (-1385.372) (-1389.510) [-1381.989] * (-1387.841) (-1383.795) [-1383.433] (-1392.794) -- 0:00:14
929500 -- (-1389.651) (-1386.723) (-1388.170) [-1384.134] * [-1383.700] (-1388.084) (-1386.032) (-1382.915) -- 0:00:14
930000 -- (-1391.361) [-1390.180] (-1388.074) (-1384.949) * (-1387.578) (-1390.370) (-1390.374) [-1383.628] -- 0:00:13
Average standard deviation of split frequencies: 0.003546
930500 -- (-1390.320) [-1385.025] (-1384.773) (-1385.552) * (-1383.883) (-1393.930) (-1388.180) [-1382.379] -- 0:00:13
931000 -- [-1385.337] (-1384.541) (-1384.435) (-1384.317) * (-1390.591) (-1392.699) [-1383.695] (-1386.396) -- 0:00:13
931500 -- (-1399.148) (-1381.925) (-1389.801) [-1384.202] * (-1386.140) [-1382.302] (-1381.940) (-1390.083) -- 0:00:13
932000 -- (-1392.240) (-1385.126) (-1395.066) [-1383.352] * (-1386.086) (-1387.823) [-1384.480] (-1387.690) -- 0:00:13
932500 -- (-1395.163) (-1391.943) [-1385.190] (-1388.428) * (-1387.859) (-1387.573) [-1382.086] (-1389.351) -- 0:00:13
933000 -- [-1393.144] (-1386.459) (-1387.370) (-1388.447) * (-1385.294) [-1384.443] (-1384.607) (-1391.081) -- 0:00:13
933500 -- (-1391.175) [-1383.959] (-1390.202) (-1387.698) * (-1394.425) (-1399.224) [-1383.680] (-1391.164) -- 0:00:13
934000 -- (-1383.958) (-1381.097) [-1395.399] (-1388.438) * [-1381.944] (-1384.179) (-1385.307) (-1388.877) -- 0:00:13
934500 -- (-1385.148) [-1384.171] (-1389.897) (-1390.697) * (-1387.639) [-1384.934] (-1390.522) (-1391.046) -- 0:00:13
935000 -- (-1386.884) [-1387.805] (-1388.445) (-1386.740) * [-1389.205] (-1389.801) (-1381.123) (-1388.077) -- 0:00:12
Average standard deviation of split frequencies: 0.003525
935500 -- [-1385.654] (-1384.905) (-1389.862) (-1384.084) * (-1383.375) (-1390.585) [-1384.139] (-1392.552) -- 0:00:12
936000 -- (-1387.556) (-1385.628) (-1389.670) [-1384.990] * (-1384.464) (-1393.025) (-1387.880) [-1383.642] -- 0:00:12
936500 -- (-1388.633) [-1391.854] (-1384.776) (-1391.072) * (-1384.890) (-1394.766) (-1388.569) [-1386.608] -- 0:00:12
937000 -- (-1388.619) (-1383.694) [-1388.797] (-1386.318) * (-1386.138) [-1388.559] (-1382.398) (-1387.419) -- 0:00:12
937500 -- (-1381.912) (-1387.188) (-1387.532) [-1388.509] * (-1387.394) (-1386.585) [-1381.566] (-1385.678) -- 0:00:12
938000 -- (-1394.649) (-1385.833) [-1389.384] (-1387.948) * (-1387.823) [-1389.589] (-1380.780) (-1382.997) -- 0:00:12
938500 -- (-1387.021) [-1381.841] (-1393.602) (-1390.522) * (-1390.338) (-1385.637) [-1380.993] (-1387.563) -- 0:00:12
939000 -- (-1381.422) (-1384.430) [-1383.719] (-1389.369) * (-1392.811) [-1384.736] (-1381.589) (-1387.787) -- 0:00:12
939500 -- (-1395.146) (-1387.579) [-1382.951] (-1388.392) * (-1382.440) [-1385.114] (-1383.535) (-1391.467) -- 0:00:12
940000 -- (-1384.149) [-1383.680] (-1385.040) (-1395.203) * [-1387.162] (-1386.358) (-1388.461) (-1387.776) -- 0:00:11
Average standard deviation of split frequencies: 0.003007
940500 -- (-1386.079) (-1388.668) (-1390.374) [-1388.424] * [-1385.298] (-1387.804) (-1387.310) (-1388.041) -- 0:00:11
941000 -- (-1390.213) (-1387.366) (-1387.822) [-1387.950] * (-1386.245) [-1385.468] (-1387.550) (-1385.013) -- 0:00:11
941500 -- (-1388.333) (-1388.916) [-1388.462] (-1392.602) * (-1384.195) (-1386.779) (-1383.202) [-1387.180] -- 0:00:11
942000 -- [-1384.386] (-1385.106) (-1390.048) (-1386.219) * [-1385.547] (-1385.503) (-1386.121) (-1390.862) -- 0:00:11
942500 -- (-1382.399) [-1386.476] (-1384.044) (-1390.205) * (-1384.313) (-1390.298) (-1387.751) [-1388.972] -- 0:00:11
943000 -- (-1391.699) [-1383.616] (-1387.148) (-1381.563) * (-1387.981) (-1390.160) (-1386.705) [-1392.297] -- 0:00:11
943500 -- (-1387.420) [-1383.654] (-1383.921) (-1386.045) * (-1387.296) (-1384.676) (-1382.652) [-1384.052] -- 0:00:11
944000 -- (-1391.579) (-1387.470) [-1386.248] (-1382.417) * (-1400.666) (-1385.912) [-1394.139] (-1388.142) -- 0:00:11
944500 -- (-1388.198) (-1387.918) (-1384.382) [-1386.120] * (-1393.597) (-1382.544) [-1383.746] (-1393.476) -- 0:00:11
945000 -- (-1381.804) (-1382.190) [-1388.553] (-1391.708) * (-1382.869) [-1384.580] (-1388.325) (-1384.055) -- 0:00:10
Average standard deviation of split frequencies: 0.003239
945500 -- (-1391.423) [-1385.561] (-1389.418) (-1391.822) * (-1388.212) [-1396.025] (-1385.605) (-1385.881) -- 0:00:10
946000 -- (-1388.365) (-1383.466) [-1384.248] (-1388.255) * (-1391.657) [-1391.177] (-1388.240) (-1384.003) -- 0:00:10
946500 -- (-1386.404) (-1386.102) [-1389.836] (-1384.068) * (-1388.321) (-1392.565) (-1387.685) [-1386.572] -- 0:00:10
947000 -- [-1382.559] (-1392.342) (-1385.909) (-1387.540) * (-1389.854) (-1386.671) [-1391.305] (-1381.393) -- 0:00:10
947500 -- (-1389.212) [-1384.333] (-1389.403) (-1382.485) * (-1386.560) (-1386.856) (-1384.416) [-1381.884] -- 0:00:10
948000 -- (-1383.766) [-1383.691] (-1394.933) (-1384.642) * [-1385.610] (-1396.817) (-1389.896) (-1382.930) -- 0:00:10
948500 -- [-1386.682] (-1387.421) (-1389.234) (-1383.947) * (-1390.220) (-1389.691) (-1383.055) [-1384.820] -- 0:00:10
949000 -- [-1388.713] (-1385.794) (-1392.306) (-1388.180) * (-1385.813) (-1383.749) (-1386.020) [-1390.741] -- 0:00:10
949500 -- (-1386.349) (-1382.013) (-1383.302) [-1386.282] * (-1389.554) (-1381.553) [-1387.701] (-1387.611) -- 0:00:10
950000 -- (-1386.081) (-1385.001) [-1388.109] (-1386.232) * [-1387.529] (-1382.995) (-1387.089) (-1386.879) -- 0:00:09
Average standard deviation of split frequencies: 0.002975
950500 -- [-1384.440] (-1382.460) (-1386.015) (-1382.484) * (-1383.815) [-1386.717] (-1390.184) (-1385.609) -- 0:00:09
951000 -- (-1387.999) [-1385.710] (-1388.069) (-1391.849) * [-1385.859] (-1387.461) (-1386.634) (-1385.734) -- 0:00:09
951500 -- (-1385.252) [-1382.835] (-1393.603) (-1388.736) * [-1380.373] (-1388.264) (-1384.346) (-1382.221) -- 0:00:09
952000 -- [-1383.612] (-1387.930) (-1390.140) (-1391.882) * [-1383.036] (-1384.190) (-1385.013) (-1384.548) -- 0:00:09
952500 -- [-1385.577] (-1387.203) (-1388.362) (-1393.440) * (-1384.572) [-1390.768] (-1383.166) (-1387.247) -- 0:00:09
953000 -- (-1386.846) (-1386.367) (-1391.061) [-1386.131] * [-1384.458] (-1387.511) (-1390.867) (-1390.150) -- 0:00:09
953500 -- (-1379.460) (-1387.208) [-1384.253] (-1388.316) * (-1386.364) (-1384.690) [-1383.102] (-1388.473) -- 0:00:09
954000 -- (-1388.010) (-1389.296) [-1384.417] (-1387.295) * (-1383.288) (-1401.212) [-1382.173] (-1383.542) -- 0:00:09
954500 -- (-1381.791) (-1385.340) (-1390.768) [-1384.308] * (-1383.092) (-1388.479) [-1385.254] (-1386.230) -- 0:00:09
955000 -- (-1381.824) (-1385.963) (-1384.643) [-1382.396] * (-1384.179) (-1387.888) (-1387.440) [-1383.316] -- 0:00:08
Average standard deviation of split frequencies: 0.002959
955500 -- (-1387.475) [-1384.519] (-1392.538) (-1383.179) * (-1385.562) [-1391.435] (-1393.377) (-1387.454) -- 0:00:08
956000 -- (-1385.484) (-1388.728) [-1382.983] (-1385.897) * (-1388.980) [-1386.258] (-1390.877) (-1387.175) -- 0:00:08
956500 -- (-1386.477) (-1389.452) [-1385.450] (-1386.540) * (-1388.352) [-1385.445] (-1387.985) (-1381.853) -- 0:00:08
957000 -- (-1384.497) (-1393.255) [-1382.920] (-1386.548) * (-1396.653) (-1381.191) (-1387.989) [-1388.480] -- 0:00:08
957500 -- (-1388.221) (-1384.881) [-1394.067] (-1386.459) * (-1385.557) (-1386.954) (-1385.006) [-1391.292] -- 0:00:08
958000 -- [-1388.548] (-1384.502) (-1386.293) (-1385.865) * (-1387.738) [-1391.488] (-1385.853) (-1386.900) -- 0:00:08
958500 -- (-1389.156) (-1384.820) [-1386.241] (-1388.798) * (-1382.122) [-1383.925] (-1384.792) (-1385.494) -- 0:00:08
959000 -- (-1386.536) (-1392.224) [-1389.901] (-1392.466) * (-1386.937) [-1386.650] (-1384.065) (-1387.179) -- 0:00:08
959500 -- (-1385.916) (-1387.931) [-1390.863] (-1385.704) * (-1387.414) (-1395.526) [-1383.303] (-1390.983) -- 0:00:08
960000 -- [-1387.855] (-1382.908) (-1385.731) (-1383.917) * (-1389.988) [-1396.022] (-1393.251) (-1389.321) -- 0:00:07
Average standard deviation of split frequencies: 0.003190
960500 -- (-1385.881) (-1384.238) (-1388.509) [-1383.445] * (-1385.285) (-1385.644) [-1383.552] (-1384.677) -- 0:00:07
961000 -- (-1387.703) (-1384.679) (-1384.902) [-1388.647] * (-1384.833) (-1392.558) [-1382.263] (-1386.466) -- 0:00:07
961500 -- (-1384.816) (-1386.060) [-1388.115] (-1386.473) * (-1384.250) (-1385.871) (-1387.699) [-1385.939] -- 0:00:07
962000 -- (-1383.770) (-1385.210) (-1385.087) [-1382.640] * (-1384.239) (-1383.334) [-1385.645] (-1387.962) -- 0:00:07
962500 -- (-1383.509) (-1385.583) [-1384.345] (-1385.523) * (-1388.162) [-1383.147] (-1390.050) (-1391.415) -- 0:00:07
963000 -- (-1383.715) (-1387.718) (-1386.023) [-1382.645] * (-1383.275) (-1385.605) [-1383.691] (-1383.787) -- 0:00:07
963500 -- (-1385.536) (-1389.782) (-1388.254) [-1387.225] * (-1386.576) (-1390.457) [-1390.730] (-1389.670) -- 0:00:07
964000 -- (-1382.492) [-1383.953] (-1383.430) (-1391.423) * [-1391.811] (-1396.648) (-1383.697) (-1387.560) -- 0:00:07
964500 -- (-1382.305) [-1382.611] (-1394.092) (-1382.328) * [-1385.488] (-1385.004) (-1384.944) (-1391.036) -- 0:00:07
965000 -- (-1391.213) (-1385.966) [-1382.711] (-1385.422) * (-1383.011) [-1388.083] (-1389.704) (-1386.040) -- 0:00:06
Average standard deviation of split frequencies: 0.003172
965500 -- (-1390.035) (-1383.554) [-1382.684] (-1395.471) * [-1391.596] (-1399.986) (-1387.959) (-1387.865) -- 0:00:06
966000 -- (-1385.224) (-1394.082) (-1391.340) [-1391.776] * (-1387.307) (-1384.208) [-1389.079] (-1388.047) -- 0:00:06
966500 -- (-1388.882) (-1388.511) [-1384.118] (-1393.580) * (-1386.591) [-1391.232] (-1387.288) (-1386.023) -- 0:00:06
967000 -- (-1389.787) [-1381.543] (-1387.737) (-1387.365) * [-1386.379] (-1385.824) (-1393.029) (-1390.952) -- 0:00:06
967500 -- (-1395.942) (-1385.793) [-1391.104] (-1390.573) * (-1386.924) (-1386.463) [-1384.391] (-1383.685) -- 0:00:06
968000 -- [-1386.118] (-1388.922) (-1407.477) (-1386.162) * (-1386.110) (-1385.577) (-1389.368) [-1382.858] -- 0:00:06
968500 -- (-1383.304) (-1390.607) [-1386.504] (-1392.107) * (-1382.956) (-1386.126) (-1382.264) [-1383.882] -- 0:00:06
969000 -- (-1384.495) (-1389.099) [-1390.762] (-1390.037) * [-1381.000] (-1383.942) (-1383.769) (-1386.703) -- 0:00:06
969500 -- (-1383.707) (-1388.761) [-1389.445] (-1389.260) * [-1384.683] (-1390.808) (-1386.386) (-1384.681) -- 0:00:06
970000 -- [-1383.501] (-1392.638) (-1392.682) (-1384.251) * (-1382.776) [-1387.570] (-1382.691) (-1385.093) -- 0:00:05
Average standard deviation of split frequencies: 0.003642
970500 -- (-1385.928) [-1386.601] (-1390.620) (-1384.277) * (-1383.934) [-1391.314] (-1385.781) (-1382.067) -- 0:00:05
971000 -- [-1381.641] (-1388.028) (-1389.343) (-1385.088) * (-1387.207) (-1391.217) (-1382.726) [-1381.450] -- 0:00:05
971500 -- [-1384.921] (-1389.882) (-1383.693) (-1384.045) * [-1389.364] (-1387.665) (-1394.827) (-1383.959) -- 0:00:05
972000 -- [-1380.644] (-1393.392) (-1389.678) (-1391.549) * (-1381.593) [-1388.877] (-1381.604) (-1384.284) -- 0:00:05
972500 -- (-1385.052) (-1384.356) [-1386.624] (-1390.946) * [-1387.314] (-1393.012) (-1387.240) (-1386.989) -- 0:00:05
973000 -- (-1384.684) (-1385.328) [-1383.908] (-1382.882) * (-1394.308) (-1387.535) [-1389.513] (-1386.779) -- 0:00:05
973500 -- (-1385.080) (-1390.278) [-1385.697] (-1395.277) * (-1391.802) [-1386.073] (-1387.113) (-1388.556) -- 0:00:05
974000 -- (-1386.655) [-1387.385] (-1382.303) (-1394.054) * (-1393.260) (-1390.845) [-1386.281] (-1382.991) -- 0:00:05
974500 -- (-1387.936) (-1387.261) [-1391.750] (-1388.006) * (-1385.181) (-1385.263) (-1383.313) [-1385.243] -- 0:00:05
975000 -- (-1390.923) (-1389.038) (-1391.879) [-1388.724] * (-1384.963) (-1386.626) (-1384.820) [-1387.465] -- 0:00:04
Average standard deviation of split frequencies: 0.003864
975500 -- (-1384.970) (-1388.620) (-1391.991) [-1390.668] * (-1387.155) [-1388.733] (-1388.654) (-1383.518) -- 0:00:04
976000 -- [-1387.892] (-1389.301) (-1385.818) (-1385.408) * (-1383.640) (-1387.452) (-1385.134) [-1385.546] -- 0:00:04
976500 -- (-1390.163) [-1385.092] (-1388.770) (-1388.780) * [-1383.450] (-1382.938) (-1393.722) (-1387.789) -- 0:00:04
977000 -- [-1382.463] (-1383.742) (-1387.449) (-1381.221) * (-1385.863) (-1384.103) (-1383.664) [-1386.909] -- 0:00:04
977500 -- [-1385.712] (-1390.776) (-1386.603) (-1381.443) * [-1383.940] (-1384.296) (-1386.156) (-1385.913) -- 0:00:04
978000 -- (-1388.090) (-1387.355) [-1388.962] (-1388.045) * (-1384.349) (-1382.731) (-1384.973) [-1388.822] -- 0:00:04
978500 -- (-1386.456) (-1394.004) [-1387.387] (-1394.748) * [-1385.667] (-1397.044) (-1383.100) (-1386.357) -- 0:00:04
979000 -- (-1384.490) (-1405.196) [-1382.375] (-1389.367) * (-1392.169) [-1385.710] (-1382.350) (-1385.097) -- 0:00:04
979500 -- (-1389.028) [-1387.436] (-1388.146) (-1383.422) * [-1386.584] (-1391.800) (-1387.195) (-1386.330) -- 0:00:04
980000 -- (-1389.614) (-1388.474) [-1390.079] (-1384.565) * (-1381.949) [-1382.812] (-1394.921) (-1390.130) -- 0:00:03
Average standard deviation of split frequencies: 0.003846
980500 -- (-1389.700) (-1385.970) (-1385.962) [-1390.832] * (-1383.162) [-1383.186] (-1387.222) (-1394.430) -- 0:00:03
981000 -- (-1391.005) (-1394.316) [-1381.024] (-1391.041) * (-1390.112) [-1384.913] (-1390.670) (-1385.210) -- 0:00:03
981500 -- (-1384.687) [-1385.418] (-1389.713) (-1385.306) * (-1386.048) (-1383.460) (-1384.855) [-1387.066] -- 0:00:03
982000 -- (-1388.048) (-1386.539) (-1387.826) [-1382.295] * (-1390.187) (-1389.165) [-1385.231] (-1382.173) -- 0:00:03
982500 -- (-1389.869) (-1383.914) (-1386.419) [-1386.448] * (-1390.680) (-1387.281) [-1384.158] (-1387.389) -- 0:00:03
983000 -- (-1397.864) (-1387.510) [-1387.831] (-1386.005) * (-1384.642) (-1383.599) [-1381.988] (-1387.003) -- 0:00:03
983500 -- (-1391.229) (-1386.909) (-1384.692) [-1387.329] * (-1386.516) (-1384.374) [-1387.204] (-1386.130) -- 0:00:03
984000 -- (-1392.173) (-1388.426) [-1385.707] (-1383.913) * (-1384.219) (-1383.992) [-1386.407] (-1393.749) -- 0:00:03
984500 -- (-1390.723) (-1389.587) [-1385.916] (-1382.981) * (-1384.264) (-1389.051) [-1388.780] (-1395.217) -- 0:00:03
985000 -- (-1387.520) [-1386.375] (-1383.284) (-1396.333) * (-1391.394) [-1383.204] (-1386.010) (-1394.705) -- 0:00:02
Average standard deviation of split frequencies: 0.004064
985500 -- (-1385.722) (-1384.755) [-1384.437] (-1384.525) * (-1389.285) (-1387.572) [-1384.126] (-1400.142) -- 0:00:02
986000 -- (-1388.042) (-1388.932) [-1385.630] (-1385.546) * (-1390.163) [-1380.546] (-1385.925) (-1399.101) -- 0:00:02
986500 -- (-1384.583) [-1388.785] (-1385.762) (-1387.265) * [-1384.639] (-1391.797) (-1391.738) (-1404.460) -- 0:00:02
987000 -- (-1381.336) (-1389.347) (-1386.381) [-1388.283] * (-1386.833) [-1389.963] (-1387.089) (-1394.874) -- 0:00:02
987500 -- (-1387.283) (-1385.316) [-1384.710] (-1385.493) * (-1388.327) [-1385.781] (-1386.345) (-1387.121) -- 0:00:02
988000 -- (-1387.760) (-1387.708) (-1393.541) [-1393.160] * (-1395.878) (-1385.494) (-1394.689) [-1386.834] -- 0:00:02
988500 -- [-1386.018] (-1395.993) (-1385.059) (-1390.141) * (-1392.281) [-1391.315] (-1387.023) (-1386.221) -- 0:00:02
989000 -- [-1384.642] (-1388.878) (-1394.537) (-1384.807) * (-1391.815) (-1391.748) [-1390.794] (-1383.013) -- 0:00:02
989500 -- (-1383.134) [-1383.084] (-1381.976) (-1388.275) * (-1397.051) (-1390.523) (-1391.172) [-1382.683] -- 0:00:02
990000 -- (-1391.952) (-1382.048) [-1385.872] (-1382.952) * [-1386.972] (-1389.233) (-1381.377) (-1388.638) -- 0:00:01
Average standard deviation of split frequencies: 0.004283
990500 -- [-1384.917] (-1383.448) (-1388.813) (-1386.910) * (-1388.335) [-1387.569] (-1384.220) (-1389.917) -- 0:00:01
991000 -- (-1383.843) (-1387.435) (-1389.703) [-1383.625] * [-1387.468] (-1387.236) (-1388.149) (-1387.512) -- 0:00:01
991500 -- (-1390.822) (-1389.926) [-1382.995] (-1384.316) * (-1383.739) (-1388.401) [-1383.521] (-1389.158) -- 0:00:01
992000 -- (-1400.551) (-1384.164) [-1380.811] (-1392.219) * (-1387.920) [-1382.907] (-1385.293) (-1393.433) -- 0:00:01
992500 -- (-1390.820) (-1389.024) [-1381.807] (-1386.018) * [-1389.921] (-1385.226) (-1387.747) (-1388.896) -- 0:00:01
993000 -- (-1392.449) (-1389.335) [-1388.374] (-1387.186) * (-1386.701) (-1388.104) [-1387.007] (-1388.345) -- 0:00:01
993500 -- (-1392.342) (-1390.467) [-1387.517] (-1386.981) * (-1388.069) (-1385.507) [-1386.368] (-1384.999) -- 0:00:01
994000 -- [-1388.112] (-1388.393) (-1386.349) (-1390.043) * (-1389.274) (-1384.010) (-1384.915) [-1382.625] -- 0:00:01
994500 -- (-1383.304) [-1387.741] (-1383.038) (-1381.659) * (-1383.662) (-1389.676) [-1386.442] (-1384.500) -- 0:00:01
995000 -- (-1392.362) (-1389.436) (-1387.212) [-1383.612] * (-1385.833) (-1386.507) (-1387.063) [-1385.616] -- 0:00:00
Average standard deviation of split frequencies: 0.004496
995500 -- [-1386.661] (-1399.421) (-1390.621) (-1387.666) * (-1395.448) (-1389.624) (-1390.637) [-1384.143] -- 0:00:00
996000 -- [-1383.081] (-1391.639) (-1395.586) (-1389.026) * (-1387.230) [-1385.005] (-1385.548) (-1385.387) -- 0:00:00
996500 -- (-1382.736) (-1383.679) (-1388.981) [-1383.337] * [-1387.697] (-1384.627) (-1383.212) (-1384.531) -- 0:00:00
997000 -- (-1385.926) (-1386.456) (-1390.539) [-1385.345] * (-1388.606) (-1390.093) [-1385.187] (-1387.919) -- 0:00:00
997500 -- (-1390.555) [-1385.739] (-1385.456) (-1387.249) * (-1393.889) (-1387.118) (-1384.315) [-1385.027] -- 0:00:00
998000 -- (-1394.983) [-1386.983] (-1384.292) (-1388.801) * (-1387.851) [-1386.915] (-1384.618) (-1391.294) -- 0:00:00
998500 -- (-1388.631) (-1386.215) (-1391.470) [-1386.706] * [-1381.893] (-1387.378) (-1387.293) (-1386.237) -- 0:00:00
999000 -- [-1387.190] (-1392.175) (-1394.011) (-1385.175) * (-1387.297) (-1389.422) (-1387.771) [-1393.248] -- 0:00:00
999500 -- (-1383.953) (-1387.005) [-1387.563] (-1388.229) * (-1385.802) (-1385.274) (-1390.524) [-1388.153] -- 0:00:00
1000000 -- (-1385.570) [-1390.626] (-1388.023) (-1386.270) * (-1388.786) (-1389.245) [-1387.484] (-1391.814) -- 0:00:00
Average standard deviation of split frequencies: 0.004004
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1385.570373 -- 15.360779
Chain 1 -- -1385.570373 -- 15.360779
Chain 2 -- -1390.626379 -- 15.582046
Chain 2 -- -1390.626379 -- 15.582046
Chain 3 -- -1388.022721 -- 16.854116
Chain 3 -- -1388.022721 -- 16.854116
Chain 4 -- -1386.270318 -- 18.536465
Chain 4 -- -1386.270318 -- 18.536465
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1388.785809 -- 16.751879
Chain 1 -- -1388.785809 -- 16.751879
Chain 2 -- -1389.244806 -- 17.706938
Chain 2 -- -1389.244805 -- 17.706938
Chain 3 -- -1387.483810 -- 14.144647
Chain 3 -- -1387.483810 -- 14.144647
Chain 4 -- -1391.813909 -- 16.555755
Chain 4 -- -1391.813905 -- 16.555755
Analysis completed in 3 mins 19 seconds
Analysis used 199.48 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1377.85
Likelihood of best state for "cold" chain of run 2 was -1377.85
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
59.9 % ( 52 %) Dirichlet(Revmat{all})
73.8 % ( 63 %) Slider(Revmat{all})
27.6 % ( 25 %) Dirichlet(Pi{all})
29.9 % ( 28 %) Slider(Pi{all})
66.6 % ( 36 %) Multiplier(Alpha{1,2})
55.2 % ( 25 %) Multiplier(Alpha{3})
78.0 % ( 45 %) Slider(Pinvar{all})
4.5 % ( 10 %) ExtSPR(Tau{all},V{all})
4.4 % ( 7 %) ExtTBR(Tau{all},V{all})
4.4 % ( 6 %) NNI(Tau{all},V{all})
5.3 % ( 6 %) ParsSPR(Tau{all},V{all})
26.2 % ( 30 %) Multiplier(V{all})
35.1 % ( 39 %) Nodeslider(V{all})
25.8 % ( 21 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
60.0 % ( 44 %) Dirichlet(Revmat{all})
73.7 % ( 65 %) Slider(Revmat{all})
28.0 % ( 29 %) Dirichlet(Pi{all})
29.2 % ( 24 %) Slider(Pi{all})
66.8 % ( 40 %) Multiplier(Alpha{1,2})
54.7 % ( 23 %) Multiplier(Alpha{3})
78.1 % ( 57 %) Slider(Pinvar{all})
4.3 % ( 9 %) ExtSPR(Tau{all},V{all})
4.2 % ( 3 %) ExtTBR(Tau{all},V{all})
4.4 % ( 4 %) NNI(Tau{all},V{all})
5.1 % ( 5 %) ParsSPR(Tau{all},V{all})
26.1 % ( 25 %) Multiplier(V{all})
35.3 % ( 33 %) Nodeslider(V{all})
25.6 % ( 29 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.83 0.68 0.55
2 | 166837 0.84 0.70
3 | 166777 166279 0.85
4 | 166647 166936 166524
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.83 0.68 0.55
2 | 166466 0.84 0.70
3 | 167173 166326 0.85
4 | 166870 166592 166573
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/59/CG13022-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/59/CG13022-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/59/CG13022-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1384.44
| 2 |
| 2 1 1 |
| 2 1 2 2 1 2 |
| 2 1 1 2 1 |
| 1 2 1 1 12 2 |
| 22 21 *2 2 2 1 2 |
| 2 2 12 1 2 1 1|
|1 1 * 1 2 1 2 * 1 1 11 |
|21 1 *1 1 2 1 1 2* 2 1 |
| 11 1 2 2 1 21 1 2 |
| 2 * 2 1 2 1 2 2 2 2 2 12|
| 1 1 2 1 11* 2 2 1 |
| 2 2 1 2 22 1 2 |
| 2 2 1 1 2 |
| 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1387.32
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/59/CG13022-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/59/CG13022-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/59/CG13022-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1383.16 -1392.46
2 -1383.16 -1395.53
--------------------------------------
TOTAL -1383.16 -1394.88
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/59/CG13022-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/59/CG13022-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/59/CG13022-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.243180 0.001154 0.182205 0.312728 0.240276 1453.05 1477.02 1.000
r(A<->C){all} 0.107085 0.001244 0.042878 0.174052 0.104374 839.81 855.15 1.001
r(A<->G){all} 0.264706 0.002911 0.164727 0.369796 0.260424 549.52 791.40 1.000
r(A<->T){all} 0.116909 0.001412 0.048832 0.190788 0.113173 824.24 891.24 1.000
r(C<->G){all} 0.093312 0.001074 0.029985 0.152797 0.090665 994.19 997.83 1.000
r(C<->T){all} 0.266609 0.003103 0.155766 0.371185 0.262406 826.46 886.53 1.000
r(G<->T){all} 0.151379 0.001758 0.072492 0.232150 0.147984 955.15 1025.42 1.001
pi(A){all} 0.253749 0.000271 0.223848 0.286440 0.253493 1313.62 1333.47 1.000
pi(C){all} 0.263861 0.000280 0.230819 0.296913 0.263651 1352.26 1369.02 1.000
pi(G){all} 0.262425 0.000280 0.228771 0.294624 0.262249 1178.46 1296.39 1.000
pi(T){all} 0.219964 0.000261 0.189470 0.252169 0.219840 1196.86 1204.01 1.000
alpha{1,2} 0.127184 0.013124 0.000102 0.336323 0.101083 890.39 1073.06 1.000
alpha{3} 1.310203 0.445173 0.302480 2.582717 1.178156 1501.00 1501.00 1.000
pinvar{all} 0.254025 0.018564 0.001211 0.487918 0.249926 1061.47 1104.20 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/59/CG13022-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/59/CG13022-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/59/CG13022-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/59/CG13022-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
Key to taxon bipartitions (saved to file "/opt/ADOPS/59/CG13022-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------
1 -- .****
2 -- .*...
3 -- ..*..
4 -- ...*.
5 -- ....*
6 -- ...**
7 -- .**..
-----------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/59/CG13022-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
6 3002 1.000000 0.000000 1.000000 1.000000 2
7 2801 0.933045 0.008009 0.927382 0.938708 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/59/CG13022-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.040731 0.000142 0.019178 0.063979 0.039228 1.000 2
length{all}[2] 0.020565 0.000055 0.006835 0.035010 0.019679 1.000 2
length{all}[3] 0.014393 0.000040 0.003465 0.026472 0.013468 1.000 2
length{all}[4] 0.044375 0.000162 0.020988 0.069045 0.042862 1.000 2
length{all}[5] 0.054445 0.000198 0.030557 0.084230 0.052993 1.000 2
length{all}[6] 0.055923 0.000255 0.026897 0.087046 0.053808 1.000 2
length{all}[7] 0.013298 0.000051 0.000396 0.026544 0.012301 1.000 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.004004
Maximum standard deviation of split frequencies = 0.008009
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.000
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------------------------ C4 (4)
|----------------100----------------+
+ \------------------------------------ C5 (5)
|
| /------------------------------------ C2 (2)
\-----------------93----------------+
\------------------------------------ C3 (3)
Phylogram (based on average branch lengths):
/-------------------------- C1 (1)
|
| /----------------------------- C4 (4)
|-----------------------------------+
+ \------------------------------------ C5 (5)
|
| /-------------- C2 (2)
\-------+
\--------- C3 (3)
|------------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3 trees sampled):
95 % credible set contains 2 trees
99 % credible set contains 3 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 5 ls = 609
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Sites with gaps or missing data are removed.
15 ambiguity characters in seq. 1
18 ambiguity characters in seq. 2
18 ambiguity characters in seq. 3
15 ambiguity characters in seq. 4
12 ambiguity characters in seq. 5
6 sites are removed. 78 167 179 180 202 203
Sequences read..
Counting site patterns.. 0:00
111 patterns at 197 / 197 sites (100.0%), 0:00
Counting codons..
80 bytes for distance
108336 bytes for conP
15096 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, (4, 5), (2, 3)); MP score: 95
162504 bytes for conP, adjusted
0.084683 0.110604 0.104923 0.113196 0.025263 0.045816 0.031771 0.300000 1.300000
ntime & nrate & np: 7 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 9
lnL0 = -1409.568006
Iterating by ming2
Initial: fx= 1409.568006
x= 0.08468 0.11060 0.10492 0.11320 0.02526 0.04582 0.03177 0.30000 1.30000
1 h-m-p 0.0000 0.0159 133.7538 +++YCYCCC 1400.524922 5 0.0014 25 | 0/9
2 h-m-p 0.0005 0.0023 210.5206 +YYYYYC 1378.907248 5 0.0018 43 | 0/9
3 h-m-p 0.0001 0.0003 255.9361 CCCC 1377.833523 3 0.0001 61 | 0/9
4 h-m-p 0.0006 0.0054 44.3182 CCC 1377.266903 2 0.0007 77 | 0/9
5 h-m-p 0.0005 0.0084 58.9071 +YYC 1375.817304 2 0.0019 92 | 0/9
6 h-m-p 0.0004 0.0040 260.4518 +YYYCYYYCCC 1362.461125 9 0.0027 118 | 0/9
7 h-m-p 0.0001 0.0005 676.1499 YCCCCC 1361.272979 5 0.0001 139 | 0/9
8 h-m-p 0.0241 0.1207 1.4231 YCCC 1361.111642 3 0.0110 156 | 0/9
9 h-m-p 0.0036 0.0435 4.3628 +YYYYCC 1358.072181 5 0.0140 175 | 0/9
10 h-m-p 0.0003 0.0017 65.9435 +YCYCCC 1353.546244 5 0.0010 196 | 0/9
11 h-m-p 0.5434 3.5672 0.1212 CYCC 1351.958555 3 0.6539 213 | 0/9
12 h-m-p 0.5888 5.5650 0.1346 YCCC 1350.216019 3 1.4663 239 | 0/9
13 h-m-p 1.6000 8.0000 0.1178 YCCC 1349.684467 3 0.7218 265 | 0/9
14 h-m-p 0.8399 8.0000 0.1012 YCCC 1349.029387 3 1.8244 291 | 0/9
15 h-m-p 1.6000 8.0000 0.0802 CYC 1348.732450 2 1.7163 315 | 0/9
16 h-m-p 1.6000 8.0000 0.0281 CC 1348.685582 1 1.9613 338 | 0/9
17 h-m-p 1.6000 8.0000 0.0009 YC 1348.683975 1 1.2639 360 | 0/9
18 h-m-p 1.6000 8.0000 0.0005 C 1348.683785 0 1.9735 381 | 0/9
19 h-m-p 1.6000 8.0000 0.0003 C 1348.683769 0 1.4836 402 | 0/9
20 h-m-p 1.6000 8.0000 0.0001 C 1348.683768 0 1.5964 423 | 0/9
21 h-m-p 1.6000 8.0000 0.0000 C 1348.683768 0 1.3399 444 | 0/9
22 h-m-p 1.6000 8.0000 0.0000 C 1348.683768 0 1.6000 465 | 0/9
23 h-m-p 1.6000 8.0000 0.0000 -Y 1348.683768 0 0.1000 487
Out..
lnL = -1348.683768
488 lfun, 488 eigenQcodon, 3416 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, (4, 5), (2, 3)); MP score: 95
0.084683 0.110604 0.104923 0.113196 0.025263 0.045816 0.031771 1.641314 0.573207 0.492243
ntime & nrate & np: 7 2 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 6.872937
np = 10
lnL0 = -1352.996214
Iterating by ming2
Initial: fx= 1352.996214
x= 0.08468 0.11060 0.10492 0.11320 0.02526 0.04582 0.03177 1.64131 0.57321 0.49224
1 h-m-p 0.0000 0.0177 54.1273 +++YCCC 1352.439686 3 0.0004 23 | 0/10
2 h-m-p 0.0004 0.0058 61.2622 ++ 1349.876329 m 0.0058 36 | 0/10
3 h-m-p -0.0000 -0.0000 545.1785
h-m-p: -2.47254080e-20 -1.23627040e-19 5.45178460e+02 1349.876329
.. | 0/10
4 h-m-p 0.0000 0.0036 500.6347 +YCYCCC 1344.870162 5 0.0001 68 | 0/10
5 h-m-p 0.0003 0.0025 124.4675 +YYCCC 1337.623808 4 0.0010 88 | 0/10
6 h-m-p 0.0003 0.0013 120.3357 YCCCCC 1335.019204 5 0.0005 110 | 0/10
7 h-m-p 0.0004 0.0018 61.6761 YCCCC 1333.893024 4 0.0008 130 | 0/10
8 h-m-p 0.0004 0.0018 37.7598 CCCC 1333.683823 3 0.0004 149 | 0/10
9 h-m-p 0.0018 0.0091 8.7066 YCCC 1333.546160 3 0.0041 167 | 0/10
10 h-m-p 0.0004 0.0020 26.6317 +C 1333.402122 0 0.0016 181 | 0/10
11 h-m-p 0.0031 0.0155 2.8615 CC 1333.398693 1 0.0008 196 | 0/10
12 h-m-p 0.0045 0.7470 0.5376 +CC 1333.383320 1 0.0213 212 | 0/10
13 h-m-p 0.0008 0.1173 14.1494 ++CCCC 1333.107820 3 0.0131 243 | 0/10
14 h-m-p 0.3053 2.6945 0.6067 YCC 1332.976953 2 0.1820 259 | 0/10
15 h-m-p 1.6000 8.0000 0.0051 CCC 1332.948634 2 1.7790 286 | 0/10
16 h-m-p 1.6000 8.0000 0.0031 C 1332.933609 0 1.6000 309 | 0/10
17 h-m-p 1.2924 8.0000 0.0038 CC 1332.932356 1 1.0599 334 | 0/10
18 h-m-p 1.6000 8.0000 0.0004 Y 1332.932332 0 0.7926 357 | 0/10
19 h-m-p 1.6000 8.0000 0.0000 Y 1332.932331 0 0.8889 380 | 0/10
20 h-m-p 1.6000 8.0000 0.0000 Y 1332.932331 0 0.9865 403 | 0/10
21 h-m-p 1.6000 8.0000 0.0000 Y 1332.932331 0 1.0140 426 | 0/10
22 h-m-p 1.6000 8.0000 0.0000 C 1332.932331 0 1.6000 449 | 0/10
23 h-m-p 1.6000 8.0000 0.0000 --Y 1332.932331 0 0.0250 474
Out..
lnL = -1332.932331
475 lfun, 1425 eigenQcodon, 6650 P(t)
Time used: 0:03
Model 2: PositiveSelection
TREE # 1
(1, (4, 5), (2, 3)); MP score: 95
initial w for M2:NSpselection reset.
0.084683 0.110604 0.104923 0.113196 0.025263 0.045816 0.031771 1.567019 0.986220 0.117156 0.463564 2.408838
ntime & nrate & np: 7 3 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 5.497485
np = 12
lnL0 = -1352.511542
Iterating by ming2
Initial: fx= 1352.511542
x= 0.08468 0.11060 0.10492 0.11320 0.02526 0.04582 0.03177 1.56702 0.98622 0.11716 0.46356 2.40884
1 h-m-p 0.0000 0.0170 74.8855 ++YCCC 1351.642551 3 0.0004 24 | 0/12
2 h-m-p 0.0005 0.0054 51.6762 +CCC 1349.967864 2 0.0018 44 | 0/12
3 h-m-p 0.0006 0.0031 115.6806 +CCCC 1344.339093 3 0.0025 66 | 0/12
4 h-m-p 0.0000 0.0001 1612.4685 ++ 1341.039713 m 0.0001 81 | 1/12
5 h-m-p 0.0004 0.0020 83.2648 CCCC 1340.673070 3 0.0004 102 | 1/12
6 h-m-p 0.0028 0.0173 12.6390 YCCCC 1338.931922 4 0.0054 124 | 1/12
7 h-m-p 0.0011 0.0118 59.9676 +YYYCC 1334.017603 4 0.0041 145 | 1/12
8 h-m-p 0.0043 0.0216 9.6266 CC 1333.971966 1 0.0010 162 | 1/12
9 h-m-p 0.0023 0.4935 4.2737 +++CYC 1332.345882 2 0.1587 183 | 1/12
10 h-m-p 0.0013 0.0067 98.7859 YYCC 1332.108514 3 0.0010 202 | 1/12
11 h-m-p 0.0865 2.1697 1.0896 +CCCCC 1331.431171 4 0.3819 226 | 0/12
12 h-m-p 0.0046 0.0231 87.4144 CYC 1331.242829 2 0.0013 244 | 0/12
13 h-m-p 0.0617 0.9685 1.8159 +CYCCC 1330.250553 4 0.3316 267 | 0/12
14 h-m-p 0.6047 8.0000 0.9958 CCCC 1329.202718 3 0.8948 288 | 0/12
15 h-m-p 1.1752 8.0000 0.7582 CCC 1327.396371 2 1.8828 319 | 0/12
16 h-m-p 1.4922 7.4609 0.1717 YYC 1327.055885 2 1.2407 348 | 0/12
17 h-m-p 0.4081 8.0000 0.5219 +YCC 1326.860902 2 1.2561 379 | 0/12
18 h-m-p 1.6000 8.0000 0.3415 +CCC 1326.343080 2 6.3348 411 | 0/12
19 h-m-p 1.6000 8.0000 0.7839 CCCC 1326.006366 3 1.9714 444 | 0/12
20 h-m-p 1.6000 8.0000 0.3377 YCC 1325.937919 2 0.7423 474 | 0/12
21 h-m-p 0.3912 8.0000 0.6408 +CC 1325.884905 1 1.9488 504 | 0/12
22 h-m-p 1.6000 8.0000 0.0338 CC 1325.879337 1 1.2901 533 | 0/12
23 h-m-p 1.6000 8.0000 0.0169 +CC 1325.871623 1 5.7925 563 | 0/12
24 h-m-p 0.4534 8.0000 0.2156 +CCC 1325.865594 2 2.4300 595 | 0/12
25 h-m-p 1.6000 8.0000 0.0349 YC 1325.865226 1 1.2334 623 | 0/12
26 h-m-p 1.6000 8.0000 0.0055 C 1325.865212 0 1.4579 650 | 0/12
27 h-m-p 1.6000 8.0000 0.0007 C 1325.865209 0 2.0660 677 | 0/12
28 h-m-p 0.8862 8.0000 0.0016 C 1325.865209 0 1.2436 704 | 0/12
29 h-m-p 1.6000 8.0000 0.0002 Y 1325.865209 0 1.2503 731 | 0/12
30 h-m-p 1.6000 8.0000 0.0000 Y 1325.865209 0 1.1201 758 | 0/12
31 h-m-p 1.6000 8.0000 0.0000 ---------------Y 1325.865209 0 0.0000 800
Out..
lnL = -1325.865209
801 lfun, 3204 eigenQcodon, 16821 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1332.470492 S = -1241.933737 -84.317637
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 111 patterns 0:09
did 20 / 111 patterns 0:09
did 30 / 111 patterns 0:10
did 40 / 111 patterns 0:10
did 50 / 111 patterns 0:10
did 60 / 111 patterns 0:10
did 70 / 111 patterns 0:10
did 80 / 111 patterns 0:10
did 90 / 111 patterns 0:10
did 100 / 111 patterns 0:10
did 110 / 111 patterns 0:10
did 111 / 111 patterns 0:10
Time used: 0:10
Model 3: discrete
TREE # 1
(1, (4, 5), (2, 3)); MP score: 95
0.084683 0.110604 0.104923 0.113196 0.025263 0.045816 0.031771 1.718334 0.331355 0.382499 0.162602 0.405923 0.679672
ntime & nrate & np: 7 4 13
Bounds (np=13):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 9.737499
np = 13
lnL0 = -1344.403797
Iterating by ming2
Initial: fx= 1344.403797
x= 0.08468 0.11060 0.10492 0.11320 0.02526 0.04582 0.03177 1.71833 0.33136 0.38250 0.16260 0.40592 0.67967
1 h-m-p 0.0000 0.0071 49.2776 +++YCCC 1343.908975 3 0.0004 26 | 0/13
2 h-m-p 0.0004 0.0038 54.0479 +CCCC 1342.420710 3 0.0017 49 | 0/13
3 h-m-p 0.0001 0.0006 160.3741 ++ 1339.891840 m 0.0006 65 | 1/13
4 h-m-p 0.0003 0.0019 212.9748 +CYCCC 1337.648114 4 0.0013 89 | 1/13
5 h-m-p 0.0001 0.0004 346.9496 YCCC 1337.266488 3 0.0002 110 | 1/13
6 h-m-p 0.0009 0.0045 27.3351 CCC 1337.106504 2 0.0011 130 | 1/13
7 h-m-p 0.0022 0.0256 13.6761 YCCC 1336.863558 3 0.0039 151 | 1/13
8 h-m-p 0.0013 0.0916 41.9088 +YCCC 1335.305722 3 0.0091 173 | 1/13
9 h-m-p 0.0072 0.0359 8.1645 YCCC 1335.169753 3 0.0034 194 | 1/13
10 h-m-p 0.0078 0.1850 3.5062 +YCCCC 1332.753497 4 0.0640 218 | 0/13
11 h-m-p 0.0388 0.2816 5.7794 YCCC 1332.660565 3 0.0065 239 | 0/13
12 h-m-p 0.0086 0.0719 4.3337 ++ 1331.872982 m 0.0719 255 | 0/13
13 h-m-p 0.1649 2.4205 1.8902 +YCCC 1330.668639 3 0.4675 277 | 0/13
14 h-m-p 0.4278 2.1389 2.0630 YCCC 1330.086533 3 0.2659 298 | 0/13
15 h-m-p 0.3118 1.5590 0.4087 YCCC 1329.035373 3 0.7316 319 | 0/13
16 h-m-p 0.3104 1.5522 0.7502 ++ 1328.171865 m 1.5522 348 | 1/13
17 h-m-p 1.0706 8.0000 1.0873 YCCC 1327.838828 3 0.5439 382 | 1/13
18 h-m-p 1.0061 8.0000 0.5878 CYC 1327.267867 2 1.1772 401 | 1/13
19 h-m-p 1.6000 8.0000 0.3594 CCC 1326.803114 2 2.1195 433 | 1/13
20 h-m-p 1.3571 8.0000 0.5613 CCC 1326.433795 2 1.3817 465 | 1/13
21 h-m-p 1.6000 8.0000 0.4441 CYCC 1326.124449 3 2.2926 498 | 1/13
22 h-m-p 1.6000 8.0000 0.6155 CCC 1325.968808 2 1.5175 530 | 1/13
23 h-m-p 1.6000 8.0000 0.5068 YCCC 1325.855281 3 0.9473 563 | 1/13
24 h-m-p 0.7840 8.0000 0.6123 +CYC 1325.669912 2 2.8530 595 | 1/13
25 h-m-p 1.6000 8.0000 0.2180 CC 1325.628674 1 1.4043 625 | 1/13
26 h-m-p 1.6000 8.0000 0.1595 YCC 1325.619637 2 1.2080 656 | 1/13
27 h-m-p 1.6000 8.0000 0.0687 CC 1325.612180 1 1.9093 686 | 1/13
28 h-m-p 1.0569 8.0000 0.1241 CC 1325.610159 1 1.3183 716 | 1/13
29 h-m-p 1.6000 8.0000 0.0501 YC 1325.609978 1 1.0875 745 | 1/13
30 h-m-p 1.6000 8.0000 0.0051 C 1325.609964 0 1.6139 773 | 1/13
31 h-m-p 1.6000 8.0000 0.0006 C 1325.609963 0 1.5772 801 | 1/13
32 h-m-p 1.6000 8.0000 0.0003 C 1325.609963 0 1.3219 829 | 1/13
33 h-m-p 1.6000 8.0000 0.0000 Y 1325.609963 0 1.2571 857 | 1/13
34 h-m-p 1.6000 8.0000 0.0000 C 1325.609963 0 1.6000 885 | 1/13
35 h-m-p 1.6000 8.0000 0.0000 ----Y 1325.609963 0 0.0016 917
Out..
lnL = -1325.609963
918 lfun, 3672 eigenQcodon, 19278 P(t)
Time used: 0:17
Model 7: beta
TREE # 1
(1, (4, 5), (2, 3)); MP score: 95
0.084683 0.110604 0.104923 0.113196 0.025263 0.045816 0.031771 1.702069 0.665673 1.549129
ntime & nrate & np: 7 1 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 11.202827
np = 10
lnL0 = -1339.722605
Iterating by ming2
Initial: fx= 1339.722605
x= 0.08468 0.11060 0.10492 0.11320 0.02526 0.04582 0.03177 1.70207 0.66567 1.54913
1 h-m-p 0.0000 0.0453 43.6666 ++CYC 1339.440204 2 0.0003 20 | 0/10
2 h-m-p 0.0006 0.0037 23.8526 CYC 1339.315824 2 0.0005 36 | 0/10
3 h-m-p 0.0014 0.0438 9.2103 CCC 1339.276462 2 0.0011 53 | 0/10
4 h-m-p 0.0003 0.0152 32.8753 +CCCC 1339.070107 3 0.0018 73 | 0/10
5 h-m-p 0.0006 0.0057 104.4419 CCCC 1338.787702 3 0.0008 92 | 0/10
6 h-m-p 0.0009 0.0058 90.5242 YCCC 1338.609169 3 0.0006 110 | 0/10
7 h-m-p 0.0144 0.1764 3.7326 CC 1338.580045 1 0.0053 125 | 0/10
8 h-m-p 0.0010 0.0652 20.4089 ++YCYCYCCC 1337.561558 7 0.0275 151 | 0/10
9 h-m-p 0.0526 0.2632 3.5532 YC 1337.532329 1 0.0069 165 | 0/10
10 h-m-p 0.0007 0.0281 32.6489 ++YYYYYC 1336.893639 5 0.0116 185 | 0/10
11 h-m-p 0.0272 0.1358 5.3638 +YYYYCYYCYC 1333.682062 9 0.1277 211 | 0/10
12 h-m-p 0.0085 0.0426 1.1661 YYC 1333.679211 2 0.0016 226 | 0/10
13 h-m-p 0.0135 6.7424 0.7457 ++YCCC 1333.162278 3 0.3654 246 | 0/10
14 h-m-p 0.1207 0.6036 0.1087 +CCCC 1332.983061 3 0.4500 276 | 0/10
15 h-m-p 1.6000 8.0000 0.0099 CC 1332.973695 1 1.3230 301 | 0/10
16 h-m-p 1.6000 8.0000 0.0031 C 1332.973415 0 1.5847 324 | 0/10
17 h-m-p 1.6000 8.0000 0.0008 YC 1332.973319 1 3.4054 348 | 0/10
18 h-m-p 1.6000 8.0000 0.0009 C 1332.973297 0 1.5085 371 | 0/10
19 h-m-p 1.6000 8.0000 0.0005 Y 1332.973297 0 1.1567 394 | 0/10
20 h-m-p 0.9194 8.0000 0.0007 --Y 1332.973297 0 0.0239 419 | 0/10
21 h-m-p 0.0161 7.9981 0.0010 +C 1332.973297 0 0.0871 443 | 0/10
22 h-m-p 0.0750 6.8643 0.0012 C 1332.973297 0 0.0934 466 | 0/10
23 h-m-p 0.0791 5.7744 0.0014 C 1332.973296 0 0.0855 489 | 0/10
24 h-m-p 0.0711 4.7598 0.0017 C 1332.973296 0 0.0711 512 | 0/10
25 h-m-p 0.0578 3.8309 0.0021 C 1332.973296 0 0.0689 535 | 0/10
26 h-m-p 0.0546 2.9936 0.0026 C 1332.973296 0 0.0532 558 | 0/10
27 h-m-p 0.0400 2.2183 0.0035 C 1332.973296 0 0.0397 581 | 0/10
28 h-m-p 0.0281 1.5459 0.0049 C 1332.973296 0 0.0272 604 | 0/10
29 h-m-p 0.0173 0.9707 0.0077 C 1332.973296 0 0.0159 627 | 0/10
30 h-m-p 0.0083 0.4968 0.0148 C 1332.973296 0 0.0070 650 | 0/10
31 h-m-p 0.0018 0.1252 0.0578 Y 1332.973296 0 0.0013 673 | 0/10
32 h-m-p 0.0160 8.0000 0.0511 -------------.. | 0/10
33 h-m-p 0.0004 0.2148 0.1306 Y 1332.973292 0 0.0004 730 | 0/10
34 h-m-p 0.0026 1.0832 0.0212 Y 1332.973292 0 0.0005 753 | 0/10
35 h-m-p 0.0011 0.5472 0.0244 Y 1332.973292 0 0.0005 776 | 0/10
36 h-m-p 0.0006 0.3090 0.0278 C 1332.973292 0 0.0002 799 | 0/10
37 h-m-p 0.0001 0.0487 0.1671 C 1332.973292 0 0.0001 822 | 0/10
38 h-m-p 0.0000 0.0032 2.4758 C 1332.973292 0 0.0000 845 | 0/10
39 h-m-p 0.0193 8.0000 0.0004 -C 1332.973292 0 0.0011 859 | 0/10
40 h-m-p 0.0160 8.0000 0.0019 ---Y 1332.973292 0 0.0000 885 | 0/10
41 h-m-p 0.0160 8.0000 0.0004 C 1332.973292 0 0.0037 908 | 0/10
42 h-m-p 0.0160 8.0000 0.0008 C 1332.973292 0 0.0191 931 | 0/10
43 h-m-p 0.0160 8.0000 0.0108 Y 1332.973292 0 0.0021 954 | 0/10
44 h-m-p 0.1871 8.0000 0.0001 C 1332.973292 0 0.2524 977 | 0/10
45 h-m-p 1.6000 8.0000 0.0000 Y 1332.973292 0 1.0145 1000 | 0/10
46 h-m-p 1.6000 8.0000 0.0000 C 1332.973292 0 2.0764 1023 | 0/10
47 h-m-p 1.6000 8.0000 0.0000 -Y 1332.973292 0 0.1000 1047 | 0/10
48 h-m-p 0.0396 8.0000 0.0000 C 1332.973292 0 0.0396 1070 | 0/10
49 h-m-p 0.0245 8.0000 0.0000 Y 1332.973292 0 0.0245 1093 | 0/10
50 h-m-p 0.0164 8.0000 0.0000 -------C 1332.973292 0 0.0000 1123
Out..
lnL = -1332.973292
1124 lfun, 12364 eigenQcodon, 78680 P(t)
Time used: 0:44
Model 8: beta&w>1
TREE # 1
(1, (4, 5), (2, 3)); MP score: 95
initial w for M8:NSbetaw>1 reset.
0.084683 0.110604 0.104923 0.113196 0.025263 0.045816 0.031771 1.592234 0.900000 0.401601 1.403915 2.022819
ntime & nrate & np: 7 2 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 9.959430
np = 12
lnL0 = -1331.749509
Iterating by ming2
Initial: fx= 1331.749509
x= 0.08468 0.11060 0.10492 0.11320 0.02526 0.04582 0.03177 1.59223 0.90000 0.40160 1.40392 2.02282
1 h-m-p 0.0000 0.0040 66.9336 ++YCCC 1331.000044 3 0.0004 24 | 0/12
2 h-m-p 0.0006 0.0032 40.8367 CCC 1330.568036 2 0.0007 43 | 0/12
3 h-m-p 0.0014 0.0106 18.7435 YCC 1330.435950 2 0.0010 61 | 0/12
4 h-m-p 0.0004 0.0082 49.9111 +YYCC 1330.048713 3 0.0012 81 | 0/12
5 h-m-p 0.0011 0.0068 51.5361 CCY 1329.722667 2 0.0011 100 | 0/12
6 h-m-p 0.0010 0.0049 54.0023 YCC 1329.544281 2 0.0006 118 | 0/12
7 h-m-p 0.0037 0.0326 9.4051 CC 1329.512560 1 0.0011 135 | 0/12
8 h-m-p 0.0033 0.1614 3.1725 YC 1329.482601 1 0.0070 151 | 0/12
9 h-m-p 0.0008 0.1437 27.1953 ++YCCC 1328.772151 3 0.0218 173 | 0/12
10 h-m-p 0.0016 0.0086 380.5280 YCCCC 1327.404923 4 0.0028 195 | 0/12
11 h-m-p 1.0021 5.0104 0.6635 YYCC 1327.108811 3 0.6599 214 | 0/12
12 h-m-p 0.2042 5.0288 2.1444 CCC 1326.689132 2 0.2952 245 | 0/12
13 h-m-p 0.1754 0.8769 2.0329 CCCCC 1326.491244 4 0.2149 268 | 0/12
14 h-m-p 0.7592 8.0000 0.5754 +YCCC 1326.255883 3 2.0070 289 | 0/12
15 h-m-p 1.6000 8.0000 0.3091 YCC 1326.193068 2 0.7164 319 | 0/12
16 h-m-p 0.5312 8.0000 0.4168 +CCCC 1326.111300 3 2.2446 353 | 0/12
17 h-m-p 1.6000 8.0000 0.2335 CCCC 1326.066534 3 2.5199 386 | 0/12
18 h-m-p 1.6000 8.0000 0.1653 +YYC 1325.927920 2 5.8060 416 | 0/12
19 h-m-p 0.2956 1.4781 0.6503 YCYCCC 1325.871741 5 0.4428 451 | 0/12
20 h-m-p 0.2340 1.3614 1.2304 YCCCCC 1325.821860 5 0.3194 487 | 0/12
21 h-m-p 0.2507 2.1555 1.5677 YCC 1325.777770 2 0.1819 505 | 0/12
22 h-m-p 0.8943 8.0000 0.3188 YC 1325.740891 1 1.9133 521 | 0/12
23 h-m-p 1.4726 8.0000 0.4142 CYC 1325.726529 2 1.3766 551 | 0/12
24 h-m-p 1.6000 8.0000 0.1084 YC 1325.723872 1 0.9697 579 | 0/12
25 h-m-p 1.5431 8.0000 0.0681 C 1325.723601 0 1.3087 606 | 0/12
26 h-m-p 1.6000 8.0000 0.0075 Y 1325.723569 0 0.9825 633 | 0/12
27 h-m-p 1.2510 8.0000 0.0059 C 1325.723555 0 1.0597 660 | 0/12
28 h-m-p 1.6000 8.0000 0.0007 Y 1325.723554 0 1.0556 687 | 0/12
29 h-m-p 1.6000 8.0000 0.0001 Y 1325.723554 0 1.1013 714 | 0/12
30 h-m-p 1.6000 8.0000 0.0000 C 1325.723554 0 0.5593 741 | 0/12
31 h-m-p 0.6835 8.0000 0.0000 Y 1325.723554 0 0.3438 768 | 0/12
32 h-m-p 0.4491 8.0000 0.0000 Y 1325.723554 0 0.2104 795 | 0/12
33 h-m-p 0.3758 8.0000 0.0000 -Y 1325.723554 0 0.0235 823
Out..
lnL = -1325.723554
824 lfun, 9888 eigenQcodon, 63448 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1331.792636 S = -1242.029278 -84.585359
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 111 patterns 1:06
did 20 / 111 patterns 1:07
did 30 / 111 patterns 1:07
did 40 / 111 patterns 1:07
did 50 / 111 patterns 1:07
did 60 / 111 patterns 1:07
did 70 / 111 patterns 1:08
did 80 / 111 patterns 1:08
did 90 / 111 patterns 1:08
did 100 / 111 patterns 1:08
did 110 / 111 patterns 1:08
did 111 / 111 patterns 1:08
Time used: 1:08
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=203
D_melanogaster_CG13022-PB MLVLFIASLIVSCAQGAQVYMQFNGQGYSYNTDGDRLDRSVVKPSFGASS
D_sechellia_CG13022-PB MLVLWIASLIVSCAQGAQVYMQFNGQGYSYNTDGDRLDRSVVTPTFGASS
D_simulans_CG13022-PB MLVLLIASLIVSCAHGAQVYMQFNGQGYSYNTDGDRLDRSVVSPRFGASS
D_yakuba_CG13022-PB MLVLGIALLAVSCAQGAQVYMQFNGQGYSYNTDGDRLDRSVVSPSFRASS
D_erecta_CG13022-PB MLLLWMALLTVSCAQGAQVYMQFNGQGYSYNTDGDRLDRSVVAPSFVASS
**:* :* * ****:*************************** * * ***
D_melanogaster_CG13022-PB LDSFGPLNFVHQSLRTRQNPLSRISYN-TQDNLAVATSSLSAGYQLASTN
D_sechellia_CG13022-PB LDSFAPLNFVHQALRTRQNPLARISYN-TQNNLAVATSSLSRGYQIAATN
D_simulans_CG13022-PB LDSFGPLNFVHQALRTRQNPLARISYN-TQDNLAVATSSLSGGYQLAPTN
D_yakuba_CG13022-PB LDSFGPLNFVQQALRTRHSPLPRISYNPAQDNLAEATSLLSRGYQVAPTN
D_erecta_CG13022-PB LDAFGPLNFVQQALRTRHHPLPRISYN-AQDNLAEATSLLSSGYQAAPTN
**:*.*****:*:****: **.***** :*:*** *** ** *** *.**
D_melanogaster_CG13022-PB HLKHRQSQQNFDFSTDQMSHAQHTDEAGNVLGKYSYYDEAGYHELSYKAG
D_sechellia_CG13022-PB HLKPLQSHQNFDFSTDQMSHAQHTDEAGNVLGKYSYYDEAGYHELSYKAG
D_simulans_CG13022-PB HLKPLQSHQNFDFSTDQMSHAQHTDEAGNVLGKYSYYDEAGYHELSYKAG
D_yakuba_CG13022-PB QLKPLQSHRNFDFSTDQMSHAQHTDEAGNVLGKYSYYDEAGYHELSYKAG
D_erecta_CG13022-PB QLKPLQRHQNFDFSTDQMSHAQHTDEAGNVLGKYSYYDEAGYHELSYKAG
:** * ::*****************************************
D_melanogaster_CG13022-PB AGIGFVVMGGNLAKATTAAEPHSEIEIG--NGIQTNALTSLQELHKYRGY
D_sechellia_CG13022-PB AGIGFVVMGGNLAKAT-AAEPHSEIEIG--NGIQTNALTSLQELHKYRGY
D_simulans_CG13022-PB AGIGFVVMGGNLAKAT-AAEPHSEIEIG--NGIQTNALTSLQELHKYRGY
D_yakuba_CG13022-PB AGIGFVVMGGNLAKAT-AAEPHSEIEIG--NGIQTNALTGLQELHKYRGY
D_erecta_CG13022-PB AGIGFVVMGGNLAKAS-AAEPHSEIGIGIGNGIHTNALTSLPELHKYRGY
***************: ******** ** ***:*****.* ********
D_melanogaster_CG13022-PB To-
D_sechellia_CG13022-PB Too
D_simulans_CG13022-PB Too
D_yakuba_CG13022-PB To-
D_erecta_CG13022-PB T--
*
>D_melanogaster_CG13022-PB ATGTTGGTGCTTTTCATTGCTTCGCTGATAGTTTCCTGTGCTCAAGGAGC GCAAGTGTATATGCAGTTCAATGGACAAGGATACTCCTACAACACGGATG GCGATAGATTGGATAGGAGTGTCGTTAAGCCTAGTTTTGGGGCATCTTCT CTGGATTCCTTTGGTCCGCTGAACTTTGTGCATCAATCTCTGAGGACAAG ACAGAATCCACTTTCCCGGATTTCCTACAAT---ACACAGGATAACCTAG CAGTGGCAACATCTTCGCTGAGTGCGGGCTACCAATTAGCATCGACCAAC CACCTGAAGCACCGGCAAAGCCAGCAAAACTTTGATTTCAGCACCGACCA GATGTCGCATGCCCAGCACACCGATGAGGCGGGAAATGTTTTGGGCAAGT ACTCCTACTACGATGAGGCTGGCTACCATGAGCTGAGCTACAAGGCGGGC GCCGGCATCGGATTCGTGGTCATGGGTGGCAATTTGGCCAAGGCCACCAC CGCCGCTGAACCGCACTCGGAAATCGAAATCGGA------AACGGAATCC AAACAAATGCCTTGACTAGCCTGCAAGAGTTGCATAAATATCGTGGCTAC ACG------ >D_sechellia_CG13022-PB ATGTTGGTGCTTTGGATTGCTTCGCTGATAGTTTCCTGTGCTCAAGGAGC GCAAGTGTATATGCAGTTCAATGGACAAGGATACTCCTACAACACGGATG GCGATAGATTGGATAGGAGTGTCGTTACTCCTACTTTTGGGGCATCTTCT CTGGATTCCTTTGCTCCGCTGAACTTTGTGCATCAGGCTCTGAGAACAAG GCAAAATCCGCTTGCCAGAATTTCCTACAAC---ACACAGAATAATCTAG CAGTGGCAACATCCTCGCTAAGTAGGGGCTACCAAATTGCAGCGACCAAC CACCTGAAGCCCCTGCAAAGCCATCAAAACTTTGATTTCAGCACCGACCA GATGTCGCATGCCCAGCACACCGATGAGGCGGGAAATGTTTTGGGCAAGT ACTCCTACTACGATGAGGCTGGCTACCATGAGCTGAGCTACAAGGCGGGC GCCGGCATCGGATTCGTGGTCATGGGTGGCAATTTGGCCAAGGCCACC-- -GCCGCTGAACCGCACTCGGAAATCGAAATCGGA------AACGGAATCC AAACAAATGCCTTGACAAGCCTGCAAGAGTTGCATAAATATCGTGGCTAC ACG------ >D_simulans_CG13022-PB ATGTTGGTGCTTTTGATTGCTTCGCTGATAGTTTCCTGTGCTCATGGAGC GCAAGTGTATATGCAGTTCAATGGACAAGGATACTCCTACAACACGGATG GCGATAGATTGGATAGGAGTGTCGTTTCCCCTAGATTTGGGGCATCTTCT CTGGATTCCTTTGGTCCGCTGAACTTTGTGCATCAGGCTCTGAGAACAAG GCAAAATCCGCTTGCCAGAATTTCCTACAAC---ACACAGGATAATCTAG CAGTGGCAACATCCTCGCTGAGTGGGGGCTACCAACTAGCGCCGACCAAC CACCTGAAGCCCCTGCAAAGCCATCAAAACTTTGATTTCAGCACCGACCA GATGTCGCATGCCCAGCACACCGATGAGGCGGGAAATGTTTTGGGCAAGT ACTCCTACTACGATGAGGCTGGCTACCATGAGCTCAGCTACAAGGCGGGC GCCGGCATCGGATTCGTGGTCATGGGTGGCAATTTGGCCAAGGCCACC-- -GCCGCTGAACCGCACTCGGAAATCGAAATCGGA------AACGGAATCC AAACAAATGCCTTGACAAGCCTGCAAGAGTTGCATAAATATCGTGGCTAC ACG------ >D_yakuba_CG13022-PB ATGCTGGTGCTCGGGATTGCATTGCTGGCAGTTTCCTGTGCTCAAGGAGC GCAAGTGTACATGCAGTTCAATGGACAAGGGTACTCCTACAACACGGATG GCGATAGATTGGACAGGAGTGTCGTTTCCCCCAGCTTTAGGGCATCTTCT CTGGATTCCTTTGGGCCACTAAACTTTGTGCAGCAGGCCTTGAGGACAAG ACACAGTCCACTTCCCAGGATTTCCTACAATCCTGCACAGGATAATCTGG CAGAGGCAACTTCCTTGCTGAGTAGAGGCTACCAAGTAGCACCGACCAAT CAACTGAAGCCGCTGCAAAGCCACCGAAACTTTGATTTCAGCACCGACCA GATGTCGCATGCCCAGCACACCGATGAGGCGGGAAATGTGTTGGGCAAGT ACTCCTACTACGATGAGGCTGGCTACCATGAGCTGAGCTACAAGGCGGGC GCCGGCATCGGATTCGTGGTCATGGGTGGCAATTTGGCCAAGGCCACC-- -GCCGCCGAACCGCACTCGGAAATAGAAATCGGA------AACGGAATCC AAACAAATGCCTTGACAGGCCTGCAAGAGTTGCATAAATATCGTGGCTAC ACG------ >D_erecta_CG13022-PB ATGCTGCTGCTTTGGATGGCATTGCTGACAGTTTCCTGCGCTCAAGGCGC GCAAGTGTATATGCAGTTCAATGGGCAAGGATACTCCTACAACACGGATG GCGATAGATTGGATAGGAGTGTCGTTGCCCCCAGCTTTGTGGCATCTTCT CTGGATGCCTTTGGTCCACTGAACTTTGTGCAGCAGGCCTTGAGGACAAG GCACCATCCACTGCCCAGGATTTCCTACAAT---GCGCAGGATAATCTGG CGGAGGCAACTTCCTTGCTGAGTAGCGGCTACCAAGCAGCACCGACCAAC CAACTGAAGCCCCTGCAAAGACACCAAAACTTTGATTTCAGCACCGACCA GATGTCGCATGCCCAGCACACCGATGAGGCGGGAAATGTTTTGGGCAAGT ACTCCTACTACGATGAGGCTGGCTACCACGAGCTGAGCTACAAGGCGGGC GCCGGCATCGGATTCGTGGTCATGGGTGGCAATTTGGCCAAGGCCTCC-- -GCTGCTGAACCGCACTCGGAAATCGGAATCGGAATCGGAAACGGAATCC ACACAAATGCCTTGACTAGCCTGCCAGAGTTGCATAAATATCGTGGCTAC ACG------
>D_melanogaster_CG13022-PB MLVLFIASLIVSCAQGAQVYMQFNGQGYSYNTDGDRLDRSVVKPSFGASS LDSFGPLNFVHQSLRTRQNPLSRISYN-TQDNLAVATSSLSAGYQLASTN HLKHRQSQQNFDFSTDQMSHAQHTDEAGNVLGKYSYYDEAGYHELSYKAG AGIGFVVMGGNLAKATTAAEPHSEIEIG--NGIQTNALTSLQELHKYRGY T >D_sechellia_CG13022-PB MLVLWIASLIVSCAQGAQVYMQFNGQGYSYNTDGDRLDRSVVTPTFGASS LDSFAPLNFVHQALRTRQNPLARISYN-TQNNLAVATSSLSRGYQIAATN HLKPLQSHQNFDFSTDQMSHAQHTDEAGNVLGKYSYYDEAGYHELSYKAG AGIGFVVMGGNLAKAT-AAEPHSEIEIG--NGIQTNALTSLQELHKYRGY T >D_simulans_CG13022-PB MLVLLIASLIVSCAHGAQVYMQFNGQGYSYNTDGDRLDRSVVSPRFGASS LDSFGPLNFVHQALRTRQNPLARISYN-TQDNLAVATSSLSGGYQLAPTN HLKPLQSHQNFDFSTDQMSHAQHTDEAGNVLGKYSYYDEAGYHELSYKAG AGIGFVVMGGNLAKAT-AAEPHSEIEIG--NGIQTNALTSLQELHKYRGY T >D_yakuba_CG13022-PB MLVLGIALLAVSCAQGAQVYMQFNGQGYSYNTDGDRLDRSVVSPSFRASS LDSFGPLNFVQQALRTRHSPLPRISYNPAQDNLAEATSLLSRGYQVAPTN QLKPLQSHRNFDFSTDQMSHAQHTDEAGNVLGKYSYYDEAGYHELSYKAG AGIGFVVMGGNLAKAT-AAEPHSEIEIG--NGIQTNALTGLQELHKYRGY T >D_erecta_CG13022-PB MLLLWMALLTVSCAQGAQVYMQFNGQGYSYNTDGDRLDRSVVAPSFVASS LDAFGPLNFVQQALRTRHHPLPRISYN-AQDNLAEATSLLSSGYQAAPTN QLKPLQRHQNFDFSTDQMSHAQHTDEAGNVLGKYSYYDEAGYHELSYKAG AGIGFVVMGGNLAKAS-AAEPHSEIGIGIGNGIHTNALTSLPELHKYRGY T
#NEXUS
[ID: 4006675645]
begin taxa;
dimensions ntax=5;
taxlabels
D_melanogaster_CG13022-PB
D_sechellia_CG13022-PB
D_simulans_CG13022-PB
D_yakuba_CG13022-PB
D_erecta_CG13022-PB
;
end;
begin trees;
translate
1 D_melanogaster_CG13022-PB,
2 D_sechellia_CG13022-PB,
3 D_simulans_CG13022-PB,
4 D_yakuba_CG13022-PB,
5 D_erecta_CG13022-PB
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.0392285,(4:0.04286153,5:0.05299345)1.000:0.05380754,(2:0.01967939,3:0.01346758)0.933:0.01230135);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.0392285,(4:0.04286153,5:0.05299345):0.05380754,(2:0.01967939,3:0.01346758):0.01230135);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/59/CG13022-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/59/CG13022-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/59/CG13022-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1383.16 -1392.46
2 -1383.16 -1395.53
--------------------------------------
TOTAL -1383.16 -1394.88
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/59/CG13022-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/59/CG13022-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/59/CG13022-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.243180 0.001154 0.182205 0.312728 0.240276 1453.05 1477.02 1.000
r(A<->C){all} 0.107085 0.001244 0.042878 0.174052 0.104374 839.81 855.15 1.001
r(A<->G){all} 0.264706 0.002911 0.164727 0.369796 0.260424 549.52 791.40 1.000
r(A<->T){all} 0.116909 0.001412 0.048832 0.190788 0.113173 824.24 891.24 1.000
r(C<->G){all} 0.093312 0.001074 0.029985 0.152797 0.090665 994.19 997.83 1.000
r(C<->T){all} 0.266609 0.003103 0.155766 0.371185 0.262406 826.46 886.53 1.000
r(G<->T){all} 0.151379 0.001758 0.072492 0.232150 0.147984 955.15 1025.42 1.001
pi(A){all} 0.253749 0.000271 0.223848 0.286440 0.253493 1313.62 1333.47 1.000
pi(C){all} 0.263861 0.000280 0.230819 0.296913 0.263651 1352.26 1369.02 1.000
pi(G){all} 0.262425 0.000280 0.228771 0.294624 0.262249 1178.46 1296.39 1.000
pi(T){all} 0.219964 0.000261 0.189470 0.252169 0.219840 1196.86 1204.01 1.000
alpha{1,2} 0.127184 0.013124 0.000102 0.336323 0.101083 890.39 1073.06 1.000
alpha{3} 1.310203 0.445173 0.302480 2.582717 1.178156 1501.00 1501.00 1.000
pinvar{all} 0.254025 0.018564 0.001211 0.487918 0.249926 1061.47 1104.20 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/59/CG13022-PB/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 5 ls = 197
Codon usage in sequences
----------------------------------------------------------------------------------------------------------------------
Phe TTT 4 4 4 4 4 | Ser TCT 4 2 2 2 2 | Tyr TAT 2 2 2 1 2 | Cys TGT 1 1 1 1 0
TTC 4 3 3 3 3 | TCC 6 6 7 7 6 | TAC 10 10 10 11 10 | TGC 0 0 0 0 1
Leu TTA 1 0 0 0 0 | TCA 0 0 0 0 0 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 6 6 7 8 8 | TCG 5 4 4 2 2 | TAG 0 0 0 0 0 | Trp TGG 0 1 0 0 1
----------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 1 1 | Pro CCT 1 1 1 0 0 | His CAT 4 5 6 3 3 | Arg CGT 1 1 1 1 1
CTC 0 0 1 1 0 | CCC 0 1 1 2 3 | CAC 4 3 3 4 6 | CGC 0 0 0 0 0
CTA 1 2 2 1 0 | CCA 1 0 0 2 3 | Gln CAA 9 9 8 8 7 | CGA 0 0 0 1 0
CTG 8 8 8 9 12 | CCG 2 3 4 3 2 | CAG 6 5 5 6 6 | CGG 2 0 0 0 0
----------------------------------------------------------------------------------------------------------------------
Ile ATT 2 3 2 2 1 | Thr ACT 1 2 0 1 2 | Asn AAT 6 7 6 7 6 | Ser AGT 3 2 2 3 2
ATC 4 4 4 3 4 | ACC 4 4 4 4 3 | AAC 6 6 6 4 5 | AGC 4 4 4 4 5
ATA 1 1 1 1 0 | ACA 4 5 5 3 3 | Lys AAA 1 1 1 1 1 | Arg AGA 2 3 4 3 2
Met ATG 4 4 4 4 5 | ACG 2 2 2 2 2 | AAG 5 4 4 4 4 | AGG 2 3 2 4 4
----------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 2 3 | Ala GCT 4 6 5 2 4 | Asp GAT 8 7 8 7 8 | Gly GGT 2 1 2 1 2
GTC 2 2 2 2 2 | GCC 6 7 7 8 8 | GAC 1 1 1 2 1 | GGC 8 8 8 9 9
GTA 0 0 0 1 0 | GCA 4 4 3 7 5 | Glu GAA 3 3 3 3 2 | GGA 7 7 7 6 6
GTG 5 5 5 5 4 | GCG 4 4 4 3 5 | GAG 4 4 4 5 5 | GGG 1 1 2 3 1
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_CG13022-PB
position 1: T:0.21827 C:0.20812 A:0.25888 G:0.31472
position 2: T:0.23858 C:0.24365 A:0.35025 G:0.16751
position 3: T:0.24365 C:0.29949 A:0.17259 G:0.28426
Average T:0.23350 C:0.25042 A:0.26058 G:0.25550
#2: D_sechellia_CG13022-PB
position 1: T:0.19797 C:0.20305 A:0.27919 G:0.31980
position 2: T:0.23858 C:0.25888 A:0.34010 G:0.16244
position 3: T:0.24873 C:0.29949 A:0.17766 G:0.27411
Average T:0.22843 C:0.25381 A:0.26565 G:0.25212
#3: D_simulans_CG13022-PB
position 1: T:0.20305 C:0.21320 A:0.25888 G:0.32487
position 2: T:0.24365 C:0.24873 A:0.34010 G:0.16751
position 3: T:0.23858 C:0.30964 A:0.17259 G:0.27919
Average T:0.22843 C:0.25719 A:0.25719 G:0.25719
#4: D_yakuba_CG13022-PB
position 1: T:0.19797 C:0.21320 A:0.25381 G:0.33503
position 2: T:0.23858 C:0.24365 A:0.33503 G:0.18274
position 3: T:0.19289 C:0.32487 A:0.18782 G:0.29442
Average T:0.20981 C:0.26058 A:0.25888 G:0.27073
#5: D_erecta_CG13022-PB
position 1: T:0.19797 C:0.22335 A:0.24873 G:0.32995
position 2: T:0.23858 C:0.25381 A:0.33503 G:0.17259
position 3: T:0.20812 C:0.33503 A:0.14721 G:0.30964
Average T:0.21489 C:0.27073 A:0.24365 G:0.27073
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 20 | Ser S TCT 12 | Tyr Y TAT 9 | Cys C TGT 4
TTC 16 | TCC 32 | TAC 51 | TGC 1
Leu L TTA 1 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 35 | TCG 17 | TAG 0 | Trp W TGG 2
------------------------------------------------------------------------------
Leu L CTT 8 | Pro P CCT 3 | His H CAT 21 | Arg R CGT 5
CTC 2 | CCC 7 | CAC 20 | CGC 0
CTA 6 | CCA 6 | Gln Q CAA 41 | CGA 1
CTG 45 | CCG 14 | CAG 28 | CGG 2
------------------------------------------------------------------------------
Ile I ATT 10 | Thr T ACT 6 | Asn N AAT 32 | Ser S AGT 12
ATC 19 | ACC 19 | AAC 27 | AGC 21
ATA 4 | ACA 20 | Lys K AAA 5 | Arg R AGA 14
Met M ATG 21 | ACG 10 | AAG 21 | AGG 15
------------------------------------------------------------------------------
Val V GTT 14 | Ala A GCT 21 | Asp D GAT 38 | Gly G GGT 8
GTC 10 | GCC 36 | GAC 6 | GGC 42
GTA 1 | GCA 23 | Glu E GAA 14 | GGA 33
GTG 24 | GCG 20 | GAG 22 | GGG 8
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.20305 C:0.21218 A:0.25990 G:0.32487
position 2: T:0.23959 C:0.24975 A:0.34010 G:0.17056
position 3: T:0.22640 C:0.31371 A:0.17157 G:0.28832
Average T:0.22301 C:0.25854 A:0.25719 G:0.26125
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_CG13022-PB
D_sechellia_CG13022-PB 0.3673 (0.0364 0.0990)
D_simulans_CG13022-PB 0.2551 (0.0283 0.1109) 0.5342 (0.0214 0.0401)
D_yakuba_CG13022-PB 0.2936 (0.0637 0.2170) 0.1924 (0.0482 0.2504) 0.1995 (0.0459 0.2299)
D_erecta_CG13022-PB 0.4099 (0.0766 0.1869) 0.2934 (0.0624 0.2128) 0.3096 (0.0613 0.1980) 0.2612 (0.0434 0.1663)
Model 0: one-ratio
TREE # 1: (1, (4, 5), (2, 3)); MP score: 95
lnL(ntime: 7 np: 9): -1348.683768 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.094567 0.120150 0.100300 0.118748 0.028250 0.048045 0.031138 1.641314 0.325204
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.54120
(1: 0.094567, (4: 0.100300, 5: 0.118748): 0.120150, (2: 0.048045, 3: 0.031138): 0.028250);
(D_melanogaster_CG13022-PB: 0.094567, (D_yakuba_CG13022-PB: 0.100300, D_erecta_CG13022-PB: 0.118748): 0.120150, (D_sechellia_CG13022-PB: 0.048045, D_simulans_CG13022-PB: 0.031138): 0.028250);
Detailed output identifying parameters
kappa (ts/tv) = 1.64131
omega (dN/dS) = 0.32520
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.095 447.2 143.8 0.3252 0.0209 0.0644 9.4 9.3
6..7 0.120 447.2 143.8 0.3252 0.0266 0.0818 11.9 11.8
7..4 0.100 447.2 143.8 0.3252 0.0222 0.0683 9.9 9.8
7..5 0.119 447.2 143.8 0.3252 0.0263 0.0809 11.8 11.6
6..8 0.028 447.2 143.8 0.3252 0.0063 0.0192 2.8 2.8
8..2 0.048 447.2 143.8 0.3252 0.0106 0.0327 4.8 4.7
8..3 0.031 447.2 143.8 0.3252 0.0069 0.0212 3.1 3.0
tree length for dN: 0.1199
tree length for dS: 0.3686
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 95
lnL(ntime: 7 np: 10): -1332.932331 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.098473 0.125850 0.105366 0.124669 0.030196 0.048662 0.033390 1.567019 0.729468 0.017217
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.56661
(1: 0.098473, (4: 0.105366, 5: 0.124669): 0.125850, (2: 0.048662, 3: 0.033390): 0.030196);
(D_melanogaster_CG13022-PB: 0.098473, (D_yakuba_CG13022-PB: 0.105366, D_erecta_CG13022-PB: 0.124669): 0.125850, (D_sechellia_CG13022-PB: 0.048662, D_simulans_CG13022-PB: 0.033390): 0.030196);
Detailed output identifying parameters
kappa (ts/tv) = 1.56702
dN/dS (w) for site classes (K=2)
p: 0.72947 0.27053
w: 0.01722 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.098 448.4 142.6 0.2831 0.0204 0.0720 9.1 10.3
6..7 0.126 448.4 142.6 0.2831 0.0260 0.0920 11.7 13.1
7..4 0.105 448.4 142.6 0.2831 0.0218 0.0770 9.8 11.0
7..5 0.125 448.4 142.6 0.2831 0.0258 0.0911 11.6 13.0
6..8 0.030 448.4 142.6 0.2831 0.0062 0.0221 2.8 3.1
8..2 0.049 448.4 142.6 0.2831 0.0101 0.0356 4.5 5.1
8..3 0.033 448.4 142.6 0.2831 0.0069 0.0244 3.1 3.5
Time used: 0:03
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 95
lnL(ntime: 7 np: 12): -1325.865209 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.103874 0.143479 0.118859 0.137731 0.037483 0.053372 0.036237 1.718334 0.781052 0.195875 0.078840 9.901727
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.63103
(1: 0.103874, (4: 0.118859, 5: 0.137731): 0.143479, (2: 0.053372, 3: 0.036237): 0.037483);
(D_melanogaster_CG13022-PB: 0.103874, (D_yakuba_CG13022-PB: 0.118859, D_erecta_CG13022-PB: 0.137731): 0.143479, (D_sechellia_CG13022-PB: 0.053372, D_simulans_CG13022-PB: 0.036237): 0.037483);
Detailed output identifying parameters
kappa (ts/tv) = 1.71833
dN/dS (w) for site classes (K=3)
p: 0.78105 0.19587 0.02307
w: 0.07884 1.00000 9.90173
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.104 446.1 144.9 0.4859 0.0275 0.0566 12.3 8.2
6..7 0.143 446.1 144.9 0.4859 0.0380 0.0782 16.9 11.3
7..4 0.119 446.1 144.9 0.4859 0.0315 0.0647 14.0 9.4
7..5 0.138 446.1 144.9 0.4859 0.0365 0.0750 16.3 10.9
6..8 0.037 446.1 144.9 0.4859 0.0099 0.0204 4.4 3.0
8..2 0.053 446.1 144.9 0.4859 0.0141 0.0291 6.3 4.2
8..3 0.036 446.1 144.9 0.4859 0.0096 0.0197 4.3 2.9
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG13022-PB)
Pr(w>1) post mean +- SE for w
5 F 0.946 9.424
43 K 0.983* 9.752
91 A 0.941 9.374
95 L 0.970* 9.631
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG13022-PB)
Pr(w>1) post mean +- SE for w
5 F 0.966* 7.298 +- 2.324
43 K 0.986* 7.429 +- 2.164
91 A 0.963* 7.276 +- 2.350
95 L 0.973* 7.354 +- 2.271
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.442 0.473 0.084 0.001 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.001 0.010 0.036 0.081 0.123 0.150 0.160 0.158 0.147 0.133
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.036
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.013 0.312
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.055 0.320
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.004 0.078 0.179
sum of density on p0-p1 = 1.000000
Time used: 0:10
Model 3: discrete (3 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 95
lnL(ntime: 7 np: 13): -1325.609963 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.103766 0.142994 0.118655 0.137179 0.037386 0.053228 0.036199 1.702069 0.587774 0.388287 0.000001 0.624204 9.560002
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.62941
(1: 0.103766, (4: 0.118655, 5: 0.137179): 0.142994, (2: 0.053228, 3: 0.036199): 0.037386);
(D_melanogaster_CG13022-PB: 0.103766, (D_yakuba_CG13022-PB: 0.118655, D_erecta_CG13022-PB: 0.137179): 0.142994, (D_sechellia_CG13022-PB: 0.053228, D_simulans_CG13022-PB: 0.036199): 0.037386);
Detailed output identifying parameters
kappa (ts/tv) = 1.70207
dN/dS (w) for site classes (K=3)
p: 0.58777 0.38829 0.02394
w: 0.00000 0.62420 9.56000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.104 446.3 144.7 0.4712 0.0271 0.0576 12.1 8.3
6..7 0.143 446.3 144.7 0.4712 0.0374 0.0794 16.7 11.5
7..4 0.119 446.3 144.7 0.4712 0.0310 0.0658 13.8 9.5
7..5 0.137 446.3 144.7 0.4712 0.0359 0.0761 16.0 11.0
6..8 0.037 446.3 144.7 0.4712 0.0098 0.0207 4.4 3.0
8..2 0.053 446.3 144.7 0.4712 0.0139 0.0295 6.2 4.3
8..3 0.036 446.3 144.7 0.4712 0.0095 0.0201 4.2 2.9
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG13022-PB)
Pr(w>1) post mean +- SE for w
5 F 0.979* 9.374
43 K 0.995** 9.511
91 A 0.977* 9.355
95 L 0.985* 9.430
Time used: 0:17
Model 7: beta (10 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 95
lnL(ntime: 7 np: 10): -1332.973292 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.098895 0.126326 0.106042 0.125292 0.030587 0.048925 0.033589 1.592234 0.007758 0.016583
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.56966
(1: 0.098895, (4: 0.106042, 5: 0.125292): 0.126326, (2: 0.048925, 3: 0.033589): 0.030587);
(D_melanogaster_CG13022-PB: 0.098895, (D_yakuba_CG13022-PB: 0.106042, D_erecta_CG13022-PB: 0.125292): 0.126326, (D_sechellia_CG13022-PB: 0.048925, D_simulans_CG13022-PB: 0.033589): 0.030587);
Detailed output identifying parameters
kappa (ts/tv) = 1.59223
Parameters in M7 (beta):
p = 0.00776 q = 0.01658
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00227 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.099 448.0 143.0 0.3002 0.0211 0.0702 9.4 10.0
6..7 0.126 448.0 143.0 0.3002 0.0269 0.0897 12.1 12.8
7..4 0.106 448.0 143.0 0.3002 0.0226 0.0753 10.1 10.8
7..5 0.125 448.0 143.0 0.3002 0.0267 0.0889 12.0 12.7
6..8 0.031 448.0 143.0 0.3002 0.0065 0.0217 2.9 3.1
8..2 0.049 448.0 143.0 0.3002 0.0104 0.0347 4.7 5.0
8..3 0.034 448.0 143.0 0.3002 0.0072 0.0238 3.2 3.4
Time used: 0:44
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 95
lnL(ntime: 7 np: 12): -1325.723554 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.103782 0.143068 0.118589 0.137288 0.037325 0.053228 0.036198 1.705140 0.976321 0.187667 0.554097 9.622957
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.62948
(1: 0.103782, (4: 0.118589, 5: 0.137288): 0.143068, (2: 0.053228, 3: 0.036198): 0.037325);
(D_melanogaster_CG13022-PB: 0.103782, (D_yakuba_CG13022-PB: 0.118589, D_erecta_CG13022-PB: 0.137288): 0.143068, (D_sechellia_CG13022-PB: 0.053228, D_simulans_CG13022-PB: 0.036198): 0.037325);
Detailed output identifying parameters
kappa (ts/tv) = 1.70514
Parameters in M8 (beta&w>1):
p0 = 0.97632 p = 0.18767 q = 0.55410
(p1 = 0.02368) w = 9.62296
dN/dS (w) for site classes (K=11)
p: 0.09763 0.09763 0.09763 0.09763 0.09763 0.09763 0.09763 0.09763 0.09763 0.09763 0.02368
w: 0.00000 0.00011 0.00161 0.00962 0.03632 0.10307 0.23700 0.45482 0.72938 0.95725 9.62296
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.104 446.3 144.7 0.4748 0.0272 0.0573 12.1 8.3
6..7 0.143 446.3 144.7 0.4748 0.0375 0.0790 16.7 11.4
7..4 0.119 446.3 144.7 0.4748 0.0311 0.0655 13.9 9.5
7..5 0.137 446.3 144.7 0.4748 0.0360 0.0758 16.1 11.0
6..8 0.037 446.3 144.7 0.4748 0.0098 0.0206 4.4 3.0
8..2 0.053 446.3 144.7 0.4748 0.0140 0.0294 6.2 4.3
8..3 0.036 446.3 144.7 0.4748 0.0095 0.0200 4.2 2.9
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG13022-PB)
Pr(w>1) post mean +- SE for w
5 F 0.965* 9.320
43 K 0.990* 9.532
91 A 0.962* 9.288
95 L 0.979* 9.437
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG13022-PB)
Pr(w>1) post mean +- SE for w
5 F 0.988* 6.716 +- 2.122
10 I 0.554 3.875 +- 3.260
43 K 0.995** 6.757 +- 2.070
91 A 0.987* 6.709 +- 2.130
95 L 0.988* 6.721 +- 2.123
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.009 0.990
p : 0.187 0.440 0.289 0.073 0.010 0.001 0.000 0.000 0.000 0.000
q : 0.000 0.066 0.072 0.049 0.079 0.113 0.133 0.148 0.163 0.178
ws: 0.001 0.014 0.061 0.136 0.175 0.173 0.149 0.121 0.095 0.075
Time used: 1:08
Model 1: NearlyNeutral -1332.932331
Model 2: PositiveSelection -1325.865209
Model 0: one-ratio -1348.683768
Model 3: discrete -1325.609963
Model 7: beta -1332.973292
Model 8: beta&w>1 -1325.723554
Model 0 vs 1 31.502874000000247
Model 2 vs 1 14.134243999999853
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG13022-PB)
Pr(w>1) post mean +- SE for w
5 F 0.946 9.424
43 K 0.983* 9.752
91 A 0.941 9.374
95 L 0.970* 9.631
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG13022-PB)
Pr(w>1) post mean +- SE for w
5 F 0.966* 7.298 +- 2.324
43 K 0.986* 7.429 +- 2.164
91 A 0.963* 7.276 +- 2.350
95 L 0.973* 7.354 +- 2.271
Model 8 vs 7 14.499475999999959
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG13022-PB)
Pr(w>1) post mean +- SE for w
5 F 0.965* 9.320
43 K 0.990* 9.532
91 A 0.962* 9.288
95 L 0.979* 9.437
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG13022-PB)
Pr(w>1) post mean +- SE for w
5 F 0.988* 6.716 +- 2.122
10 I 0.554 3.875 +- 3.260
43 K 0.995** 6.757 +- 2.070
91 A 0.987* 6.709 +- 2.130
95 L 0.988* 6.721 +- 2.123
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
