--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Tue Nov 29 19:53:34 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/53/CG12194-PC/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/53/CG12194-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/53/CG12194-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/53/CG12194-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -4827.17         -4842.37
2      -4827.70         -4841.45
--------------------------------------
TOTAL    -4827.40         -4842.01
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/53/CG12194-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/53/CG12194-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/53/CG12194-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         1.009666    0.004869    0.882290    1.150972    1.007473   1385.41   1443.20    1.001
r(A<->C){all}   0.082766    0.000246    0.053143    0.113856    0.082198   1077.31   1097.76    1.000
r(A<->G){all}   0.264741    0.000810    0.211733    0.323147    0.263117    797.95    917.73    1.001
r(A<->T){all}   0.140484    0.000538    0.097388    0.185679    0.139277    875.88    897.04    1.000
r(C<->G){all}   0.056015    0.000087    0.038534    0.074374    0.055378   1236.07   1266.96    1.000
r(C<->T){all}   0.406877    0.000916    0.346600    0.464719    0.407222    792.66    841.09    1.001
r(G<->T){all}   0.049118    0.000115    0.028963    0.070468    0.048326   1069.93   1155.45    1.000
pi(A){all}      0.178201    0.000090    0.159072    0.196709    0.178170   1148.19   1160.20    1.000
pi(C){all}      0.286875    0.000118    0.266401    0.309038    0.286405   1185.21   1259.47    1.000
pi(G){all}      0.280038    0.000131    0.257278    0.302385    0.280013   1166.08   1203.55    1.000
pi(T){all}      0.254887    0.000111    0.234275    0.275318    0.254940   1195.50   1247.23    1.000
alpha{1,2}      0.113447    0.000144    0.090188    0.136680    0.112694   1267.69   1310.70    1.000
alpha{3}        4.398844    1.129425    2.603992    6.628529    4.277575   1380.55   1392.30    1.001
pinvar{all}     0.350210    0.001352    0.279828    0.423037    0.351212   1393.80   1447.40    1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-4503.85929
Model 2: PositiveSelection	-4503.859299
Model 0: one-ratio	-4515.959193
Model 3: discrete	-4494.077247
Model 7: beta	-4494.155623
Model 8: beta&w>1	-4494.157711


Model 0 vs 1	24.199805999998716

Model 2 vs 1	1.799999881768599E-5

Model 8 vs 7	0.00417600000037055
>C1
MSREERKPIVSSSSSSTCSSSDDEVHPVVRRRSTRDTELAGHQKDAGCCD
PTSTPHRFLALLFMCLLGFGSYFCYDNPGALQDVFQKELQLSSTEFTLIY
SIYSWPNIVLCFVGGFLIDRVFGIRLGTIIYMLIVLVGQLIFATGGVLGH
FWLMIVGRFVFGIGAESLAVAQNSYAVLWFKGKEINMVFGLQLSVARFGS
TVNFWIMQPLYGYVSKSYSGYKGLGVALFLASSTCVMSLVCTLILGWMDK
RAERILKRNNNPGGELAKLSDIVTFKLDFWMVSVVCVAYYVAIFPFVALG
QAFFVSNFHMTPDEANTVNSIVYLISAIASPLFGFVIDKVGRNVTWVFCA
TISTLLAHFLLTFTHLDPYIGMSIMGLSYSMLAASLWPLVSLIVPEYQLG
TAYGFCQSVQNLGLAVVTIAAGIIVDSSGGSHFWLQVFFMSFLLVSLLAT
CAIWAYNRKHQGNLNMSPAQRATYHTSMYVNIESS
>C2
MSREERKPIVSSSSSSTCSSGDDEVHPVVRRRSTRDTELAGHQKDAGCCD
PTSTPHRFLALLFMCLLGFGSYFCYDNPGALQDVFQKELQLSSTEFTLIY
SIYSWPNIVLCFVGGFLIDRVFGIRLGTIIYMLIVLVGQLIFATGGVLGH
FWLMIVGRFVFGIGAESLAVAQNSYAVLWFKGKEINMVFGLQLSVARFGS
TVNFWIMQPLYGYVSKSYSGYKGLGVALFLASSTCVMSLVCTLILGWMDK
RAERILKRNNNPGGELAKLSDIVTFKLDFWMVSVVCVAYYVAIFPFVALG
QAFFISNFHMTPDEANTVNSIVYLISAIASPLFGFVIDKVGRNVTWVFCA
TISTLLAHFLLTFTHLDPYIGMSIMGLSYSMLAASLWPLVSLIVPEYQLG
TAYGFCQSVQNLGLAVVTIAAGIIVDSSGGSHFWLQVFFMSFLLVSLLAT
CAIWAYNRKHQGNLNMSPAQRATYHTSMYVNIESS
>C3
MSREERKPIVSSSSSSTCSSGDDEVHPVVRRRSTRDTELAGHQKDAGCCD
PTSTPHRFLALLFMCLLGFGSYFCYDNPGALQDVFQKELQLSSTEFTLIY
SIYSWPNIVLCFVGGFLIDRVFGIRLGTIIYMLIVLVGQLIFATGGVLGH
FWLMIVGRFVFGIGAESLAVAQNSYAVLWFKGKEINMVFGLQLSVARFGS
TVNFWIMQPLYGYVSKSYSGYKGLGVALFLASSTCVMSLVCTLILGWMDK
RAERILKRNNNPGGELAKLSDIVTFKLDFWMVSVVCVAYYVAIFPFVALG
QAFFISNFHMTPDEANTVNSIVYLISAIASPLFGFVIDKVGRNVTWVFCA
TISTLLAHFLLTFTHLDPYIGMSIMGLSYSMLAASLWPLVSLIVPEYQLG
TAYGFCQSVQNLGLAVVTIAAGIIVDSSGGSHFWLQVFFMSFLLVSLLAT
CAIWAYNRKHQGNLNMSPAQRATYHTSMYVNIESS
>C4
MSREERKPIVSSPSSSTCSSGDDEVHPVVRRRSARDTELAGHQKDAGCCD
PTSTPHRFLALLFMCLLGFGSYFCYDNPGALQDVFQKELQLSSTEFTLIY
SIYSWPNIVLCFVGGFLIDRVFGIRLGTIIYMLIVLVGQLIFATGGVLGH
FWLMILGRFVFGIGAESLAVAQNSYAVLWFKGKEINMVFGLQLSVARFGS
TVNFWIMQPLYGYVSKSYSGYKGLGVALFLASSTCVMSLICTLILGWMDK
RAERILKRNNNPGGELAKLSDIVTFKLDFWMVSVVCVAYYVAIFPFVALG
QAFFVSKFHMTPDEANTVNSIVYLISAIASPLFGFVIDKVGRNVTWVFCA
TISTLLGHFLLTFTQLDPYIGMSIMGLSYSMLAASLWPLVSLIVPEYQLG
TAYGFCQSVQNLGLAVVTIAAGIIVDSSGGSHFWLQIFFMFFLLVSLLAT
CAIWAYNRKHQGNLNMSPAQRATYHTSMYVNIESS
>C5
MSREERKPIVSSPSSSTCSSGDDEVHPVVRRRSTRDTELAGHQKDPGCCD
PTSTPHRFLALLFMCLLGFGSYFCYDNPGALQDVFQKELQLSSTEFTLIY
SIYSWPNIVLCFVGGFLIDRVFGIRLGTIIYMLIVLVGQLIFATGGVLGH
FWLMILGRFVFGIGAESLAVAQNSYAVLWFKGKEINMVFGLQLSVARFGS
TVNFWIMQPLYGYVSKSYTGYKGLGVALFLASSTCVMSLVCTLILGWMDK
RAERILKRNNNPGGELAKLSDIVTFKFDFWMVSVVCVAYYLAIFPFVALG
QAFFVSKFHMTPDEANTVNSIVYLISAIASPLFGFVIDKVGRNVTWVFCA
TIFTLLGHFLLTFTDLDPYIGMSIMGLSYSMLAASLWPLVSLIVPEYQLG
TAYGFCQSVQNLGLAVVTIAAGIIVDSSGGSHFWLQIFFMSFLLVSLLAT
CAIWAYNRKHQGNLNMSPAQRATYHTSMYVNIDSS
>C6
MSREERKPIVDTSNSSSCSSGDDEVHPVVRRRSARDTELAGPQKDAGCCD
PSSTPHRFLALLFMCLLGFGSYFCYDNPGALQDVFQKELDLSSTEFTLIY
SIYSWPNIVLCFVGGFLIDRVFGIRLGTIIYMLIVLVGQLIFATGGVLGH
FWLMIVGRFVFGIGAESLAVAQNSYAVLWFKGKELNMVFGLQLSVARFGS
TVNFWIMQPLYGYVSKSYSGYKGLGVALFLASSTCVMSLICTLILGWMDK
RAERILKRNNNPGGEIAKLSDIVTFKLDFWMVSVVCVAYYVAIFPFVALG
QAFFVSNFHMTPDEANTVNSIVYLISAIASPLFGFIIDKVGRNVTWVFCA
TISTLLAHCLLTFTHWDPYIAMSIMGLSYSMLAASLWPLVSLIVPEYQLG
TAYGFCQSVQNLGLAVVTIAAGIIVDSSGGSHFWLQIFFMFFLLISLLAT
CAIWAYNRKHQGNLNMSPAQRATYHTSMYVNIESS
>C7
MSREERKPIVDTSNSSSCSSGDDEVHPVVRRRSARDTELAASQKDAGCCD
PSSTPHRFLALLFMCLLGFGSYFCYDNPGALQDVFQKELDLSSTEFTLIY
SIYSWPNIVLCFVGGFLIDRVFGIRLGTIIYMLIVLVGQLIFATGGVLGH
FWLMIVGRFVFGIGAESLAVAQNSYAVLWFKGKELNMVFGLQLSVARFGS
TVNFWIMQPLYGYVSKSYSGYKGLGVALFLASSTCVMSLICTLILGWMDK
RAERILKRNNNPGGEIAKLSDIVTFKLDFWMVSVVCVAYYVAIFPFVALG
QAFFVSNFHMTPDEANTVNSIVYLISAIASPLFGFVIDKVGRNVTWVFCA
TISTLLAHLLLTFTHWDPYIGMSIMGLSYSMLAASLWPLVSLIVPEYQLG
TAYGFCQSVQNLGLAVVTIAAGIIVDSSGGSHFWLQIFFMFFLLISLLAT
CAIWAYNRKHQGNLNMSPAQRSTYHTSMYVNIESS
>C8
MSREERKPIVDTSNSSSSSSGDDEVHPVVRRRSTRDTVLAGPQKDAGCCD
PSSTPHRFLALLFMCLLGFGSYFCYDNPGALQDVFQKELDLSSTEFTLIY
SIYSWPNIVLCFVGGFLIDRVFGIRLGTIIYMLIVLVGQLIFATGGVLGH
FWLMIVGRFVFGIGAESLAVAQNSYAVLWFKGKELNMVFGLQLSVARFGS
TVNFWIMQPLYGYVSKSYSGYKGLGVALFLASSTCVMSLICTLILGWMDK
RAERILKRNNNPGGEIAKLSDIVTFKLDFWMVSVVCVAYYVAIFPFVALG
QAFFVSNFHMTPDEANTVNSIVYLISAIASPLFGFVIDKVGRNVTWVFCA
TISTLLAHFLLTFTHWDPYIGMSIMGLSYSMLAASLWPLVSLIVPEYQLG
TAYGFCQSVQNLGLAVVTIAAGIIVDSSGGSHFWLQIFFMFFLLISLLAT
CAIWAYNRKHQGNLNMSPAQRATYHTSMYVNIESS
>C9
MSREERKPIVETSNSSSCSSGDEEVHPVVRRRSTRDTELSGSQKDAGCCD
PSSTPHRFLALLFMCLLGFGSYFCYDNPGALQDVFQKELDLSSTEFTLIY
SIYSWPNIVLCFVGGFLIDRVFGIRLGTIIYMLIVLVGQLIFATGGVLGH
FWLMIVGRFIFGIGAESLAVAQNSYAVLWFKGKELNMVFGLQLSVARFGS
TVNFWIMQPLYGYVSKSYSGYKGLGVALFLASSTCVMSLVCTLILGWMDK
RAERILKRNNNPGGEIAKLSDIVTFKLDFWMVSVVCVAYYVAIFPFVALG
QAFFVSNFHMTPDEANTVNSIVYLISAIASPLFGFIIDKVGRNVTWVFCA
TISTLVAHFLLTFTHWDPYIGMSIMGLSYSMLAASLWPLVSLIVPEYQLG
TAYGFCQSVQNLGLAVVTIAAGIIVDSSGGSHFWLQLFFMFFLLISLLAT
CAIWAYNRKHQGNLNMSPAQRATYHTSMYVNIESS
>C10
MSREERKPIVDTSNSSSCSSGDDEVHPVVRRRSTRDTELAGPQKDTGCCD
PSSTPHRFLALLFMCLLGFGSYFCYDNPGALQDVFQKELDLSSTEFTLIY
SIYSWPNIVLCFVGGFLIDRVFGIRLGTIIYMLIVLVGQLIFATGGVLGH
FWLMIVGRFVFGIGAESLAVAQNSYAVLWFKGKELNMVFGLQLSVARFGS
TVNFWIMQPLYGYVSKSYSGYKGLGVALFLASSTCVMSLICTLILGWMDK
RAERILKRNNNPGGEIAKLSDIVTFKLDFWMVSVVCVAYYVAIFPFVALG
QAFFMSNFHMTADEANTVNSIVYLISAIASPLFGFIIDKVGRNVTWVFCA
TISTLVAHFLLTFTHWDPYIGMTIMGLSYSMLAASLWPLVSLIVPEYQLG
TAYGFCQSVQNLGLAVVTIAAGIIVDSSGGSHFWLQIFFMVFLLISLLAT
CAIWAYNRKHQGNLNMSPAQRATYHTSMYVNIESS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=10, Len=485 

C1              MSREERKPIVSSSSSSTCSSSDDEVHPVVRRRSTRDTELAGHQKDAGCCD
C2              MSREERKPIVSSSSSSTCSSGDDEVHPVVRRRSTRDTELAGHQKDAGCCD
C3              MSREERKPIVSSSSSSTCSSGDDEVHPVVRRRSTRDTELAGHQKDAGCCD
C4              MSREERKPIVSSPSSSTCSSGDDEVHPVVRRRSARDTELAGHQKDAGCCD
C5              MSREERKPIVSSPSSSTCSSGDDEVHPVVRRRSTRDTELAGHQKDPGCCD
C6              MSREERKPIVDTSNSSSCSSGDDEVHPVVRRRSARDTELAGPQKDAGCCD
C7              MSREERKPIVDTSNSSSCSSGDDEVHPVVRRRSARDTELAASQKDAGCCD
C8              MSREERKPIVDTSNSSSSSSGDDEVHPVVRRRSTRDTVLAGPQKDAGCCD
C9              MSREERKPIVETSNSSSCSSGDEEVHPVVRRRSTRDTELSGSQKDAGCCD
C10             MSREERKPIVDTSNSSSCSSGDDEVHPVVRRRSTRDTELAGPQKDTGCCD
                **********.:..**:.**.*:**********:*** *:. ***.****

C1              PTSTPHRFLALLFMCLLGFGSYFCYDNPGALQDVFQKELQLSSTEFTLIY
C2              PTSTPHRFLALLFMCLLGFGSYFCYDNPGALQDVFQKELQLSSTEFTLIY
C3              PTSTPHRFLALLFMCLLGFGSYFCYDNPGALQDVFQKELQLSSTEFTLIY
C4              PTSTPHRFLALLFMCLLGFGSYFCYDNPGALQDVFQKELQLSSTEFTLIY
C5              PTSTPHRFLALLFMCLLGFGSYFCYDNPGALQDVFQKELQLSSTEFTLIY
C6              PSSTPHRFLALLFMCLLGFGSYFCYDNPGALQDVFQKELDLSSTEFTLIY
C7              PSSTPHRFLALLFMCLLGFGSYFCYDNPGALQDVFQKELDLSSTEFTLIY
C8              PSSTPHRFLALLFMCLLGFGSYFCYDNPGALQDVFQKELDLSSTEFTLIY
C9              PSSTPHRFLALLFMCLLGFGSYFCYDNPGALQDVFQKELDLSSTEFTLIY
C10             PSSTPHRFLALLFMCLLGFGSYFCYDNPGALQDVFQKELDLSSTEFTLIY
                *:*************************************:**********

C1              SIYSWPNIVLCFVGGFLIDRVFGIRLGTIIYMLIVLVGQLIFATGGVLGH
C2              SIYSWPNIVLCFVGGFLIDRVFGIRLGTIIYMLIVLVGQLIFATGGVLGH
C3              SIYSWPNIVLCFVGGFLIDRVFGIRLGTIIYMLIVLVGQLIFATGGVLGH
C4              SIYSWPNIVLCFVGGFLIDRVFGIRLGTIIYMLIVLVGQLIFATGGVLGH
C5              SIYSWPNIVLCFVGGFLIDRVFGIRLGTIIYMLIVLVGQLIFATGGVLGH
C6              SIYSWPNIVLCFVGGFLIDRVFGIRLGTIIYMLIVLVGQLIFATGGVLGH
C7              SIYSWPNIVLCFVGGFLIDRVFGIRLGTIIYMLIVLVGQLIFATGGVLGH
C8              SIYSWPNIVLCFVGGFLIDRVFGIRLGTIIYMLIVLVGQLIFATGGVLGH
C9              SIYSWPNIVLCFVGGFLIDRVFGIRLGTIIYMLIVLVGQLIFATGGVLGH
C10             SIYSWPNIVLCFVGGFLIDRVFGIRLGTIIYMLIVLVGQLIFATGGVLGH
                **************************************************

C1              FWLMIVGRFVFGIGAESLAVAQNSYAVLWFKGKEINMVFGLQLSVARFGS
C2              FWLMIVGRFVFGIGAESLAVAQNSYAVLWFKGKEINMVFGLQLSVARFGS
C3              FWLMIVGRFVFGIGAESLAVAQNSYAVLWFKGKEINMVFGLQLSVARFGS
C4              FWLMILGRFVFGIGAESLAVAQNSYAVLWFKGKEINMVFGLQLSVARFGS
C5              FWLMILGRFVFGIGAESLAVAQNSYAVLWFKGKEINMVFGLQLSVARFGS
C6              FWLMIVGRFVFGIGAESLAVAQNSYAVLWFKGKELNMVFGLQLSVARFGS
C7              FWLMIVGRFVFGIGAESLAVAQNSYAVLWFKGKELNMVFGLQLSVARFGS
C8              FWLMIVGRFVFGIGAESLAVAQNSYAVLWFKGKELNMVFGLQLSVARFGS
C9              FWLMIVGRFIFGIGAESLAVAQNSYAVLWFKGKELNMVFGLQLSVARFGS
C10             FWLMIVGRFVFGIGAESLAVAQNSYAVLWFKGKELNMVFGLQLSVARFGS
                *****:***:************************:***************

C1              TVNFWIMQPLYGYVSKSYSGYKGLGVALFLASSTCVMSLVCTLILGWMDK
C2              TVNFWIMQPLYGYVSKSYSGYKGLGVALFLASSTCVMSLVCTLILGWMDK
C3              TVNFWIMQPLYGYVSKSYSGYKGLGVALFLASSTCVMSLVCTLILGWMDK
C4              TVNFWIMQPLYGYVSKSYSGYKGLGVALFLASSTCVMSLICTLILGWMDK
C5              TVNFWIMQPLYGYVSKSYTGYKGLGVALFLASSTCVMSLVCTLILGWMDK
C6              TVNFWIMQPLYGYVSKSYSGYKGLGVALFLASSTCVMSLICTLILGWMDK
C7              TVNFWIMQPLYGYVSKSYSGYKGLGVALFLASSTCVMSLICTLILGWMDK
C8              TVNFWIMQPLYGYVSKSYSGYKGLGVALFLASSTCVMSLICTLILGWMDK
C9              TVNFWIMQPLYGYVSKSYSGYKGLGVALFLASSTCVMSLVCTLILGWMDK
C10             TVNFWIMQPLYGYVSKSYSGYKGLGVALFLASSTCVMSLICTLILGWMDK
                ******************:********************:**********

C1              RAERILKRNNNPGGELAKLSDIVTFKLDFWMVSVVCVAYYVAIFPFVALG
C2              RAERILKRNNNPGGELAKLSDIVTFKLDFWMVSVVCVAYYVAIFPFVALG
C3              RAERILKRNNNPGGELAKLSDIVTFKLDFWMVSVVCVAYYVAIFPFVALG
C4              RAERILKRNNNPGGELAKLSDIVTFKLDFWMVSVVCVAYYVAIFPFVALG
C5              RAERILKRNNNPGGELAKLSDIVTFKFDFWMVSVVCVAYYLAIFPFVALG
C6              RAERILKRNNNPGGEIAKLSDIVTFKLDFWMVSVVCVAYYVAIFPFVALG
C7              RAERILKRNNNPGGEIAKLSDIVTFKLDFWMVSVVCVAYYVAIFPFVALG
C8              RAERILKRNNNPGGEIAKLSDIVTFKLDFWMVSVVCVAYYVAIFPFVALG
C9              RAERILKRNNNPGGEIAKLSDIVTFKLDFWMVSVVCVAYYVAIFPFVALG
C10             RAERILKRNNNPGGEIAKLSDIVTFKLDFWMVSVVCVAYYVAIFPFVALG
                ***************:**********:*************:*********

C1              QAFFVSNFHMTPDEANTVNSIVYLISAIASPLFGFVIDKVGRNVTWVFCA
C2              QAFFISNFHMTPDEANTVNSIVYLISAIASPLFGFVIDKVGRNVTWVFCA
C3              QAFFISNFHMTPDEANTVNSIVYLISAIASPLFGFVIDKVGRNVTWVFCA
C4              QAFFVSKFHMTPDEANTVNSIVYLISAIASPLFGFVIDKVGRNVTWVFCA
C5              QAFFVSKFHMTPDEANTVNSIVYLISAIASPLFGFVIDKVGRNVTWVFCA
C6              QAFFVSNFHMTPDEANTVNSIVYLISAIASPLFGFIIDKVGRNVTWVFCA
C7              QAFFVSNFHMTPDEANTVNSIVYLISAIASPLFGFVIDKVGRNVTWVFCA
C8              QAFFVSNFHMTPDEANTVNSIVYLISAIASPLFGFVIDKVGRNVTWVFCA
C9              QAFFVSNFHMTPDEANTVNSIVYLISAIASPLFGFIIDKVGRNVTWVFCA
C10             QAFFMSNFHMTADEANTVNSIVYLISAIASPLFGFIIDKVGRNVTWVFCA
                ****:*:****.***********************:**************

C1              TISTLLAHFLLTFTHLDPYIGMSIMGLSYSMLAASLWPLVSLIVPEYQLG
C2              TISTLLAHFLLTFTHLDPYIGMSIMGLSYSMLAASLWPLVSLIVPEYQLG
C3              TISTLLAHFLLTFTHLDPYIGMSIMGLSYSMLAASLWPLVSLIVPEYQLG
C4              TISTLLGHFLLTFTQLDPYIGMSIMGLSYSMLAASLWPLVSLIVPEYQLG
C5              TIFTLLGHFLLTFTDLDPYIGMSIMGLSYSMLAASLWPLVSLIVPEYQLG
C6              TISTLLAHCLLTFTHWDPYIAMSIMGLSYSMLAASLWPLVSLIVPEYQLG
C7              TISTLLAHLLLTFTHWDPYIGMSIMGLSYSMLAASLWPLVSLIVPEYQLG
C8              TISTLLAHFLLTFTHWDPYIGMSIMGLSYSMLAASLWPLVSLIVPEYQLG
C9              TISTLVAHFLLTFTHWDPYIGMSIMGLSYSMLAASLWPLVSLIVPEYQLG
C10             TISTLVAHFLLTFTHWDPYIGMTIMGLSYSMLAASLWPLVSLIVPEYQLG
                ** **:.* *****. ****.*:***************************

C1              TAYGFCQSVQNLGLAVVTIAAGIIVDSSGGSHFWLQVFFMSFLLVSLLAT
C2              TAYGFCQSVQNLGLAVVTIAAGIIVDSSGGSHFWLQVFFMSFLLVSLLAT
C3              TAYGFCQSVQNLGLAVVTIAAGIIVDSSGGSHFWLQVFFMSFLLVSLLAT
C4              TAYGFCQSVQNLGLAVVTIAAGIIVDSSGGSHFWLQIFFMFFLLVSLLAT
C5              TAYGFCQSVQNLGLAVVTIAAGIIVDSSGGSHFWLQIFFMSFLLVSLLAT
C6              TAYGFCQSVQNLGLAVVTIAAGIIVDSSGGSHFWLQIFFMFFLLISLLAT
C7              TAYGFCQSVQNLGLAVVTIAAGIIVDSSGGSHFWLQIFFMFFLLISLLAT
C8              TAYGFCQSVQNLGLAVVTIAAGIIVDSSGGSHFWLQIFFMFFLLISLLAT
C9              TAYGFCQSVQNLGLAVVTIAAGIIVDSSGGSHFWLQLFFMFFLLISLLAT
C10             TAYGFCQSVQNLGLAVVTIAAGIIVDSSGGSHFWLQIFFMVFLLISLLAT
                ************************************:*** ***:*****

C1              CAIWAYNRKHQGNLNMSPAQRATYHTSMYVNIESS
C2              CAIWAYNRKHQGNLNMSPAQRATYHTSMYVNIESS
C3              CAIWAYNRKHQGNLNMSPAQRATYHTSMYVNIESS
C4              CAIWAYNRKHQGNLNMSPAQRATYHTSMYVNIESS
C5              CAIWAYNRKHQGNLNMSPAQRATYHTSMYVNIDSS
C6              CAIWAYNRKHQGNLNMSPAQRATYHTSMYVNIESS
C7              CAIWAYNRKHQGNLNMSPAQRSTYHTSMYVNIESS
C8              CAIWAYNRKHQGNLNMSPAQRATYHTSMYVNIESS
C9              CAIWAYNRKHQGNLNMSPAQRATYHTSMYVNIESS
C10             CAIWAYNRKHQGNLNMSPAQRATYHTSMYVNIESS
                *********************:**********:**




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  485 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  485 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  485 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  485 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  485 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  485 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  485 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  485 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  485 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  485 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  485 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  485 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  485 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  485 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  485 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  485 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  485 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  485 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  485 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  485 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  485 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  485 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  485 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/53/CG12194-PC/batch/allfiles/tcoffee/input.fasta.prot.fast