--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Sat Dec 10 00:25:20 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/444/zpg-PB/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/444/zpg-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/zpg-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/444/zpg-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2329.15 -2342.16 2 -2329.12 -2339.32 -------------------------------------- TOTAL -2329.13 -2341.52 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/444/zpg-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/zpg-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/444/zpg-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.325907 0.003289 0.223357 0.439625 0.319262 1207.42 1285.00 1.001 r(A<->C){all} 0.131589 0.001361 0.063823 0.205497 0.128520 988.27 1089.63 1.000 r(A<->G){all} 0.398423 0.004494 0.277841 0.535280 0.395721 623.19 697.14 1.000 r(A<->T){all} 0.042734 0.000602 0.000756 0.088180 0.039315 883.37 1060.28 1.000 r(C<->G){all} 0.061263 0.000503 0.019579 0.105591 0.059478 1156.27 1238.34 1.000 r(C<->T){all} 0.315396 0.003081 0.208095 0.423592 0.314097 684.18 779.26 1.000 r(G<->T){all} 0.050596 0.000438 0.011354 0.089464 0.048339 1120.88 1147.28 1.001 pi(A){all} 0.211751 0.000141 0.189340 0.235089 0.211474 1274.34 1387.67 1.001 pi(C){all} 0.267992 0.000158 0.242656 0.291099 0.268020 1213.84 1326.01 1.000 pi(G){all} 0.257018 0.000159 0.233250 0.282260 0.257198 1041.61 1155.35 1.002 pi(T){all} 0.263239 0.000161 0.239110 0.289078 0.263315 1090.33 1091.96 1.000 alpha{1,2} 0.050342 0.001145 0.000169 0.112103 0.045912 1034.95 1170.11 1.000 alpha{3} 2.628889 0.784818 1.170384 4.430223 2.492902 1315.13 1408.07 1.002 pinvar{all} 0.520892 0.004272 0.392716 0.641791 0.526515 1310.63 1358.06 1.001 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -2177.49218 Model 2: PositiveSelection -2177.49218 Model 0: one-ratio -2184.381091 Model 3: discrete -2176.733169 Model 7: beta -2176.885819 Model 8: beta&w>1 -2176.891958 Model 0 vs 1 13.777822000000015 Model 2 vs 1 0.0 Model 8 vs 7 0.012278000000151224
>C1 MYAAVKPLSKYLQFKSVHIYDAIFTLHSKVTVALLLACTFLLSSKQYFGD PIQCFGDKDMDYVHAFCWIYGAYVSDNVTVTPLRNGAAQCRPDAVSKVVP PENRNYITYYQWVVLVLLLESFVFYMPAFLWKIWEGGRLKHLCDDFHKMA VCKDKSRTHLRVLVNYFSSDYKETHFRYFVSYVFCEILNLSISILNFLLL DVFFGGFWGRYRNALLSLYNGDYNQWNIITMAVFPKCAKCEMYKGGPSGS SNIYDYLCLLPLNILNEKIFAFLWIWFILVAMLISLKFLYRLATVLYPGM RLQLLRARARFMPKKHLQVALRNCSFGDWFVLMRVGNNISPELFRKLLEE LYEAQSLIKIPPGADKI >C2 MYAAVKPLSKYLQFKSVHIYDAIFTLHSKVTVALLLACTFLLSSKQYFGD PIQCFGDRDMDYVHAFCWIYGAYVSDNVTVTPLRNGAAQCRPDAVSKVVP PENRNYITYYQWVVLVLLLESFVFYMPAFLWKIWEGGRLKHLCDDFHKMA VCKDKSRTHLRVLVNYFSSDYKETHFRYFVSYVFCEILNLSISILNFLLL DVFFGGFWGRYRDALLSLYNGDYNQWNIITMAVFPKCAKCEMYKGGPSGS SNIYDYLCLLPLNILNEKIFAFLWIWFILVAMLIALKFLYRLATVLYPGM RLQLLRARARFMPKKHLQVALRNCSFGDWFVLMRVGNNISPELFRKLLEE LYAAQSLFKKPPGADEI >C3 MYAAVKPLSKYLQFKSVHIYDAIFTLHSKVTVALLLACTFLLSSKQYFGD PIQCFGDKDMDYVHAFCWIYGAYVSDNVTVAPLKNGAAQCRPDAVSKVVP PESRHYITYYQWVVLVLLLESFVFYLPAFLWKIWEGGRLKHLCDDFHKMA VCKDKSRTQIRVLVKYFSSDYKETHFRYFVSYVFCEILNLSISILNFLLL DVFFGGFWGRYRDALLSLYNGDYNTWNIITMEVFPKCAKCEMYKGGPSGS SNIYDYLCLLPLNILNEKIFAFLWLWFILVAMLVALKFMYRLATVLYPGM RLQLLRARARFMPKTHLQVALRNCSFGDWFVLMRVGNNISPEIFRKLLEE LYEAQSLTKIPPGADEI >C4 MYAAVKPLSKYLQFKSVHIYDAIFTLHSKVTVALLLACTFLLSSKQYFGD PIQCFGDKDMDYVHAFCWIYGAYVSDNVTVAPLRNGAAQCRPDAVSKVVP PENRHYITYYQWVVLVLLLESFVFYLPAFLWKIWEGGRLKHLCDDFHKMA VCKDKSRTHLRVLVNYFSSDYKETHFRYFVSYVFCEILNLSISILNFLLL DVFFGGFWRRYRDALLSLYNGDYNQWNIITMEVFPKCAKCEMYKGGPSGS SNIYDYLCLLPLNILNEKIFAFLWMWFILVAVLVSLKFLYRLATILYPGM RLQLLRARARFMPKAHLQVALRNCSFGDWFVLMRVGNNISPEIFRKLLEE LYEAQSLTKIPPGADEI CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=367 C1 MYAAVKPLSKYLQFKSVHIYDAIFTLHSKVTVALLLACTFLLSSKQYFGD C2 MYAAVKPLSKYLQFKSVHIYDAIFTLHSKVTVALLLACTFLLSSKQYFGD C3 MYAAVKPLSKYLQFKSVHIYDAIFTLHSKVTVALLLACTFLLSSKQYFGD C4 MYAAVKPLSKYLQFKSVHIYDAIFTLHSKVTVALLLACTFLLSSKQYFGD ************************************************** C1 PIQCFGDKDMDYVHAFCWIYGAYVSDNVTVTPLRNGAAQCRPDAVSKVVP C2 PIQCFGDRDMDYVHAFCWIYGAYVSDNVTVTPLRNGAAQCRPDAVSKVVP C3 PIQCFGDKDMDYVHAFCWIYGAYVSDNVTVAPLKNGAAQCRPDAVSKVVP C4 PIQCFGDKDMDYVHAFCWIYGAYVSDNVTVAPLRNGAAQCRPDAVSKVVP *******:**********************:**:**************** C1 PENRNYITYYQWVVLVLLLESFVFYMPAFLWKIWEGGRLKHLCDDFHKMA C2 PENRNYITYYQWVVLVLLLESFVFYMPAFLWKIWEGGRLKHLCDDFHKMA C3 PESRHYITYYQWVVLVLLLESFVFYLPAFLWKIWEGGRLKHLCDDFHKMA C4 PENRHYITYYQWVVLVLLLESFVFYLPAFLWKIWEGGRLKHLCDDFHKMA **.*:********************:************************ C1 VCKDKSRTHLRVLVNYFSSDYKETHFRYFVSYVFCEILNLSISILNFLLL C2 VCKDKSRTHLRVLVNYFSSDYKETHFRYFVSYVFCEILNLSISILNFLLL C3 VCKDKSRTQIRVLVKYFSSDYKETHFRYFVSYVFCEILNLSISILNFLLL C4 VCKDKSRTHLRVLVNYFSSDYKETHFRYFVSYVFCEILNLSISILNFLLL ********::****:*********************************** C1 DVFFGGFWGRYRNALLSLYNGDYNQWNIITMAVFPKCAKCEMYKGGPSGS C2 DVFFGGFWGRYRDALLSLYNGDYNQWNIITMAVFPKCAKCEMYKGGPSGS C3 DVFFGGFWGRYRDALLSLYNGDYNTWNIITMEVFPKCAKCEMYKGGPSGS C4 DVFFGGFWRRYRDALLSLYNGDYNQWNIITMEVFPKCAKCEMYKGGPSGS ******** ***:*********** ****** ****************** C1 SNIYDYLCLLPLNILNEKIFAFLWIWFILVAMLISLKFLYRLATVLYPGM C2 SNIYDYLCLLPLNILNEKIFAFLWIWFILVAMLIALKFLYRLATVLYPGM C3 SNIYDYLCLLPLNILNEKIFAFLWLWFILVAMLVALKFMYRLATVLYPGM C4 SNIYDYLCLLPLNILNEKIFAFLWMWFILVAVLVSLKFLYRLATILYPGM ************************:******:*::***:*****:***** C1 RLQLLRARARFMPKKHLQVALRNCSFGDWFVLMRVGNNISPELFRKLLEE C2 RLQLLRARARFMPKKHLQVALRNCSFGDWFVLMRVGNNISPELFRKLLEE C3 RLQLLRARARFMPKTHLQVALRNCSFGDWFVLMRVGNNISPEIFRKLLEE C4 RLQLLRARARFMPKAHLQVALRNCSFGDWFVLMRVGNNISPEIFRKLLEE ************** ***************************:******* C1 LYEAQSLIKIPPGADKI C2 LYAAQSLFKKPPGADEI C3 LYEAQSLTKIPPGADEI C4 LYEAQSLTKIPPGADEI ** **** * *****:* PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 367 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 367 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4404] Library Relaxation: Multi_proc [72] Relaxation Summary: [4404]--->[4404] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/444/zpg-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.248 Mb, Max= 30.542 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 MYAAVKPLSKYLQFKSVHIYDAIFTLHSKVTVALLLACTFLLSSKQYFGD PIQCFGDKDMDYVHAFCWIYGAYVSDNVTVTPLRNGAAQCRPDAVSKVVP PENRNYITYYQWVVLVLLLESFVFYMPAFLWKIWEGGRLKHLCDDFHKMA VCKDKSRTHLRVLVNYFSSDYKETHFRYFVSYVFCEILNLSISILNFLLL DVFFGGFWGRYRNALLSLYNGDYNQWNIITMAVFPKCAKCEMYKGGPSGS SNIYDYLCLLPLNILNEKIFAFLWIWFILVAMLISLKFLYRLATVLYPGM RLQLLRARARFMPKKHLQVALRNCSFGDWFVLMRVGNNISPELFRKLLEE LYEAQSLIKIPPGADKI >C2 MYAAVKPLSKYLQFKSVHIYDAIFTLHSKVTVALLLACTFLLSSKQYFGD PIQCFGDRDMDYVHAFCWIYGAYVSDNVTVTPLRNGAAQCRPDAVSKVVP PENRNYITYYQWVVLVLLLESFVFYMPAFLWKIWEGGRLKHLCDDFHKMA VCKDKSRTHLRVLVNYFSSDYKETHFRYFVSYVFCEILNLSISILNFLLL DVFFGGFWGRYRDALLSLYNGDYNQWNIITMAVFPKCAKCEMYKGGPSGS SNIYDYLCLLPLNILNEKIFAFLWIWFILVAMLIALKFLYRLATVLYPGM RLQLLRARARFMPKKHLQVALRNCSFGDWFVLMRVGNNISPELFRKLLEE LYAAQSLFKKPPGADEI >C3 MYAAVKPLSKYLQFKSVHIYDAIFTLHSKVTVALLLACTFLLSSKQYFGD PIQCFGDKDMDYVHAFCWIYGAYVSDNVTVAPLKNGAAQCRPDAVSKVVP PESRHYITYYQWVVLVLLLESFVFYLPAFLWKIWEGGRLKHLCDDFHKMA VCKDKSRTQIRVLVKYFSSDYKETHFRYFVSYVFCEILNLSISILNFLLL DVFFGGFWGRYRDALLSLYNGDYNTWNIITMEVFPKCAKCEMYKGGPSGS SNIYDYLCLLPLNILNEKIFAFLWLWFILVAMLVALKFMYRLATVLYPGM RLQLLRARARFMPKTHLQVALRNCSFGDWFVLMRVGNNISPEIFRKLLEE LYEAQSLTKIPPGADEI >C4 MYAAVKPLSKYLQFKSVHIYDAIFTLHSKVTVALLLACTFLLSSKQYFGD PIQCFGDKDMDYVHAFCWIYGAYVSDNVTVAPLRNGAAQCRPDAVSKVVP PENRHYITYYQWVVLVLLLESFVFYLPAFLWKIWEGGRLKHLCDDFHKMA VCKDKSRTHLRVLVNYFSSDYKETHFRYFVSYVFCEILNLSISILNFLLL DVFFGGFWRRYRDALLSLYNGDYNQWNIITMEVFPKCAKCEMYKGGPSGS SNIYDYLCLLPLNILNEKIFAFLWMWFILVAVLVSLKFLYRLATILYPGM RLQLLRARARFMPKAHLQVALRNCSFGDWFVLMRVGNNISPEIFRKLLEE LYEAQSLTKIPPGADEI FORMAT of file /tmp/tmp7495394924733877851aln Not Supported[FATAL:T-COFFEE] >C1 MYAAVKPLSKYLQFKSVHIYDAIFTLHSKVTVALLLACTFLLSSKQYFGD PIQCFGDKDMDYVHAFCWIYGAYVSDNVTVTPLRNGAAQCRPDAVSKVVP PENRNYITYYQWVVLVLLLESFVFYMPAFLWKIWEGGRLKHLCDDFHKMA VCKDKSRTHLRVLVNYFSSDYKETHFRYFVSYVFCEILNLSISILNFLLL DVFFGGFWGRYRNALLSLYNGDYNQWNIITMAVFPKCAKCEMYKGGPSGS SNIYDYLCLLPLNILNEKIFAFLWIWFILVAMLISLKFLYRLATVLYPGM RLQLLRARARFMPKKHLQVALRNCSFGDWFVLMRVGNNISPELFRKLLEE LYEAQSLIKIPPGADKI >C2 MYAAVKPLSKYLQFKSVHIYDAIFTLHSKVTVALLLACTFLLSSKQYFGD PIQCFGDRDMDYVHAFCWIYGAYVSDNVTVTPLRNGAAQCRPDAVSKVVP PENRNYITYYQWVVLVLLLESFVFYMPAFLWKIWEGGRLKHLCDDFHKMA VCKDKSRTHLRVLVNYFSSDYKETHFRYFVSYVFCEILNLSISILNFLLL DVFFGGFWGRYRDALLSLYNGDYNQWNIITMAVFPKCAKCEMYKGGPSGS SNIYDYLCLLPLNILNEKIFAFLWIWFILVAMLIALKFLYRLATVLYPGM RLQLLRARARFMPKKHLQVALRNCSFGDWFVLMRVGNNISPELFRKLLEE LYAAQSLFKKPPGADEI >C3 MYAAVKPLSKYLQFKSVHIYDAIFTLHSKVTVALLLACTFLLSSKQYFGD PIQCFGDKDMDYVHAFCWIYGAYVSDNVTVAPLKNGAAQCRPDAVSKVVP PESRHYITYYQWVVLVLLLESFVFYLPAFLWKIWEGGRLKHLCDDFHKMA VCKDKSRTQIRVLVKYFSSDYKETHFRYFVSYVFCEILNLSISILNFLLL DVFFGGFWGRYRDALLSLYNGDYNTWNIITMEVFPKCAKCEMYKGGPSGS SNIYDYLCLLPLNILNEKIFAFLWLWFILVAMLVALKFMYRLATVLYPGM RLQLLRARARFMPKTHLQVALRNCSFGDWFVLMRVGNNISPEIFRKLLEE LYEAQSLTKIPPGADEI >C4 MYAAVKPLSKYLQFKSVHIYDAIFTLHSKVTVALLLACTFLLSSKQYFGD PIQCFGDKDMDYVHAFCWIYGAYVSDNVTVAPLRNGAAQCRPDAVSKVVP PENRHYITYYQWVVLVLLLESFVFYLPAFLWKIWEGGRLKHLCDDFHKMA VCKDKSRTHLRVLVNYFSSDYKETHFRYFVSYVFCEILNLSISILNFLLL DVFFGGFWRRYRDALLSLYNGDYNQWNIITMEVFPKCAKCEMYKGGPSGS SNIYDYLCLLPLNILNEKIFAFLWMWFILVAVLVSLKFLYRLATILYPGM RLQLLRARARFMPKAHLQVALRNCSFGDWFVLMRVGNNISPEIFRKLLEE LYEAQSLTKIPPGADEI input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:367 S:100 BS:367 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # PW_SEQ_DISTANCES BOT 0 1 98.09 C1 C2 98.09 TOP 1 0 98.09 C2 C1 98.09 BOT 0 2 94.82 C1 C3 94.82 TOP 2 0 94.82 C3 C1 94.82 BOT 0 3 96.19 C1 C4 96.19 TOP 3 0 96.19 C4 C1 96.19 BOT 1 2 94.82 C2 C3 94.82 TOP 2 1 94.82 C3 C2 94.82 BOT 1 3 95.64 C2 C4 95.64 TOP 3 1 95.64 C4 C2 95.64 BOT 2 3 96.46 C3 C4 96.46 TOP 3 2 96.46 C4 C3 96.46 AVG 0 C1 * 96.37 AVG 1 C2 * 96.19 AVG 2 C3 * 95.37 AVG 3 C4 * 96.09 TOT TOT * 96.00 CLUSTAL W (1.83) multiple sequence alignment C1 ATGTACGCAGCTGTTAAACCGCTCTCCAAGTATCTGCAGTTCAAGTCGGT C2 ATGTACGCAGCTGTTAAGCCGCTCTCCAAGTATCTGCAGTTCAAGTCGGT C3 ATGTACGCAGCTGTAAAGCCGCTCTCCAAGTATCTGCAGTTCAAGTCGGT C4 ATGTACGCAGCTGTTAAGCCGCTGTCCAAGTATCTGCAGTTCAAGTCGGT **************:**.***** ************************** C1 GCACATCTACGATGCTATTTTCACGCTGCACTCCAAAGTCACAGTGGCCC C2 GCACATCTACGATGCCATTTTCACGCTGCATTCCAAAGTCACGGTGGCCC C3 GCACATCTACGATGCCATTTTCACGCTGCACTCCAAAGTGACGGTGGCCC C4 GCACATCTACGATGCTATTTTCACGCTGCACTCGAAAGTTACGGTGGCCC *************** ************** ** ***** **.******* C1 TGCTTTTGGCCTGCACATTTTTGCTTTCCTCGAAACAATATTTCGGCGAT C2 TGCTTTTGGCCTGCACATTTTTGCTTTCCTCGAAACAATATTTCGGGGAT C3 TGCTCTTGGCCTGCACCTTTCTGCTTTCCTCGAAACAATATTTCGGGGAT C4 TGCTTCTGGCCTGCACCTTTCTACTTTCCTCGAAACAATATTTCGGGGAT **** **********.*** *.*********************** *** C1 CCCATCCAGTGTTTTGGGGACAAGGATATGGACTACGTGCACGCCTTTTG C2 CCCATCCAGTGTTTTGGGGACAGGGACATGGACTACGTGCACGCCTTTTG C3 CCTATCCAGTGTTTTGGGGACAAGGACATGGACTACGTGCACGCCTTTTG C4 CCTATCCAGTGTTTTGGGGACAAGGACATGGACTACGTGCACGCCTTTTG ** *******************.*** *********************** C1 TTGGATCTACGGGGCCTATGTGAGCGACAATGTGACTGTGACGCCCCTAA C2 CTGGATCTACGGGGCCTATGTGAGCGACAATGTGACAGTGACGCCGCTAA C3 CTGGATCTACGGCGCCTATGTGAGCGACAATGTGACTGTGGCGCCCTTGA C4 CTGGATTTACGGGGCCTATGTGAGCGACAATGTGACTGTGGCGCCCCTGA ***** ***** ***********************:***.**** *.* C1 GGAATGGAGCTGCACAGTGCCGACCAGATGCGGTTAGTAAGGTAGTGCCC C2 GGAATGGCGCTGCACAGTGCCGGCCAGATGCGGTTAGTAAGGTGGTGCCC C3 AAAATGGCGCTGCCCAGTGCCGACCAGATGCTGTAAGTAAGGTGGTGCCA C4 GAAATGGCGCTGCACAGTGCCGACCAGATGCGGTGAGCAAGGTGGTGCCC ..*****.*****.********.******** ** ** *****.*****. C1 CCGGAAAATCGTAACTACATAACCTACTATCAGTGGGTCGTGCTGGTATT C2 CCAGAGAATCGCAACTACATCACCTACTATCAGTGGGTCGTGCTGGTATT C3 CCGGAGAGTCGCCACTACATCACCTACTATCAATGGGTGGTGCTGGTCCT C4 CCGGAAAATCGCCACTACATCACCTACTATCAATGGGTGGTGCTGGTACT **.**.*.*** .*******.***********.***** ********. * C1 GCTGCTCGAGTCGTTTGTGTTTTATATGCCAGCATTTCTCTGGAAGATTT C2 GTTGCTCGAGTCGTTTGTGTTCTATATGCCGGCATTTCTCTGGAAGATTT C3 GCTCCTCGAGTCGTTCGTCTTTTATTTGCCCGCCTTTCTCTGGAAGATTT C4 GCTCCTCGAGTCGTTTGTGTTCTATTTGCCCGCCTTTCTCTGGAAGATTT * * *********** ** ** ***:**** **.**************** C1 GGGAGGGCGGTCGGCTGAAGCATTTGTGCGATGATTTCCACAAGATGGCC C2 GGGAGGGCGGTCGGCTGAAGCATTTGTGCGATGATTTCCACAAGATGGCC C3 GGGAGGGCGGTCGTCTGAAGCACTTGTGCGATGATTTCCACAAGATGGCC C4 GGGAGGGCGGTCGGCTGAAGCATTTGTGCGATGATTTCCACAAGATGGCC ************* ******** *************************** C1 GTTTGCAAGGACAAGAGCAGGACCCATTTGCGCGTACTAGTCAACTACTT C2 GTTTGCAAGGACAAGAGCAGAACTCATTTGCGCGTACTAGTCAACTACTT C3 GTTTGCAAGGACAAGAGCAGGACTCAAATTCGCGTGCTGGTCAAATACTT C4 GTTTGCAAGGACAAGAGCAGGACCCATCTTCGCGTACTGGTCAACTACTT ********************.** **: * *****.**.*****.***** C1 CTCCAGCGATTACAAAGAGACCCACTTCCGCTACTTCGTTAGCTACGTCT C2 CTCCAGCGACTACAAGGAGACCCACTTCCGCTACTTCGTTAGCTACGTCT C3 CTCCAGCGACTACAAGGAGACCCACTTTCGCTACTTTGTCAGCTACGTCT C4 CTCCAGCGACTACAAGGAGACCCACTTCCGCTACTTTGTCAGCTATGTCT ********* *****.*********** ******** ** ***** **** C1 TCTGCGAAATACTCAATTTGAGCATCAGTATTCTAAACTTCCTTCTGTTG C2 TCTGCGAAATACTCAATTTGAGCATCAGTATTCTAAACTTCCTTCTGTTG C3 TTTGTGAGATACTGAACTTGAGCATCAGTATTCTCAACTTTCTTCTATTG C4 TTTGTGAGATACTCAATTTGAGCATCAGTATTCTGAACTTCCTTCTATTG * ** **.***** ** ***************** ***** *****.*** C1 GACGTATTTTTCGGAGGTTTTTGGGGCCGCTACCGTAATGCCTTGCTGTC C2 GACGTATTTTTCGGCGGTTTTTGGGGCCGCTACCGCGATGCCTTGCTGTC C3 GACGTATTTTTCGGCGGTTTTTGGGGCCGCTACCGCGATGCCTTGCTATC C4 GATGTATTTTTCGGCGGTTTTTGGAGACGCTACCGCGATGCCTTGCTATC ** ***********.*********.*.******** .**********.** C1 CCTTTACAATGGCGACTATAACCAGTGGAACATTATAACCATGGCAGTCT C2 CCTTTACAATGGCGACTATAACCAGTGGAACATCATCACCATGGCAGTCT C3 GCTTTACAACGGTGATTATAACACGTGGAACATCATCACCATGGAGGTGT C4 CCTCTACAACGGTGATTATAACCAGTGGAACATCATCACTATGGAGGTCT ** ***** ** ** ******..********* **.** ****..** * C1 TCCCCAAGTGTGCCAAGTGCGAGATGTACAAGGGCGGCCCCAGCGGTTCT C2 TTCCCAAGTGTGCCAAGTGCGAGATGTACAAGGGCGGCCCCAGCGGTTCT C3 TTCCCAAGTGCGCCAAGTGCGAGATGTACAAGGGCGGCCCCAGCGGTTCG C4 TTCCTAAGTGCGCCAAGTGCGAGATGTACAAGGGCGGGCCCAGCGGTTCG * ** ***** ************************** *********** C1 TCCAACATATACGACTACCTTTGCCTGCTGCCCCTGAATATACTGAACGA C2 TCCAACATATACGACTACCTGTGCCTGCTGCCCCTGAATATACTGAACGA C3 TCCAACATATACGACTACCTCTGCCTGCTGCCCCTGAATATACTGAACGA C4 TCCAACATATACGACTACCTCTGCCTGCTGCCCCTGAATATACTAAACGA ******************** ***********************.***** C1 GAAAATCTTCGCCTTCCTGTGGATATGGTTTATACTAGTGGCTATGCTCA C2 GAAAATCTTCGCCTTCCTGTGGATCTGGTTTATACTAGTGGCTATGCTCA C3 GAAGATCTTCGCCTTTCTGTGGCTGTGGTTTATACTGGTGGCCATGCTCG C4 GAAGATCTTCGCCTTCTTGTGGATGTGGTTTATACTAGTGGCTGTGCTCG ***.*********** *****.* ***********.***** .*****. C1 TTTCCCTCAAGTTTCTGTACCGCCTGGCCACCGTTTTGTATCCCGGAATG C2 TTGCCCTCAAGTTTCTGTACCGCCTGGCCACCGTTTTGTATCCCGGAATG C3 TTGCCCTAAAGTTCATGTACCGCCTGGCCACCGTTTTGTATCCCGGCATG C4 TTTCCCTAAAGTTCCTGTACCGCCTGGCCACCATTTTGTATCCGGGAATG ** ****.***** .*****************.********** **.*** C1 CGTCTTCAGTTGCTTCGTGCCAGGGCACGTTTCATGCCCAAGAAGCACTT C2 CGTCTGCAGTTGCTTCGTGCCAGGGCACGTTTCATGCCCAAGAAGCACTT C3 CGCCTGCAGTTGCTGCGAGCCAGGGCACGTTTCATGCCCAAGACGCATCT C4 CGCCTGCAGTTGCTTCGTGCCAGGGCGCGTTTCATGCCCAAGGCGCACTT ** ** ******** **:********.***************..*** * C1 GCAGGTGGCATTGCGCAATTGCAGTTTTGGCGACTGGTTCGTGCTGATGC C2 GCAGGTGGCACTGCGCAATTGCAGTTTCGGCGACTGGTTCGTGCTGATGC C3 GCAGGTGGCACTGCGCAATTGCAGTTTTGGCGACTGGTTCGTGCTGATGC C4 ACAGGTGGCACTGCGCAATTGCAGTTTTGGCGACTGGTTCGTGCTGATGC .********* **************** ********************** C1 GCGTGGGCAACAACATCAGCCCCGAGCTATTCCGTAAGTTGCTGGAGGAG C2 GCGTGGGCAACAACATCAGCCCCGAGCTATTCCGTAAGTTGCTAGAGGAG C3 GCGTGGGCAACAACATCAGCCCCGAGATATTCCGTAAGTTGCTGGAGGAG C4 GCGTGGGCAACAACATCAGCCCCGAAATATTCCGTAAGTTGCTGGAGGAG *************************..****************.****** C1 CTGTACGAAGCTCAGTCCTTGATCAAAATACCGCCAGGAGCGGACAAGAT C2 CTGTACGCAGCTCAGTCCTTGTTCAAAAAACCGCCGGGAGCGGACGAGAT C3 CTTTACGAAGCTCAGTCCTTGACCAAAATACCGCCGGGAGCGGATGAAAT C4 CTTTACGAAGCTCAGTCCTTGACCAAAATACCGCCAGGAGCGGACGAAAT ** ****.*************: *****:******.******** .*.** C1 C C2 C C3 C C4 C * >C1 ATGTACGCAGCTGTTAAACCGCTCTCCAAGTATCTGCAGTTCAAGTCGGT GCACATCTACGATGCTATTTTCACGCTGCACTCCAAAGTCACAGTGGCCC TGCTTTTGGCCTGCACATTTTTGCTTTCCTCGAAACAATATTTCGGCGAT CCCATCCAGTGTTTTGGGGACAAGGATATGGACTACGTGCACGCCTTTTG TTGGATCTACGGGGCCTATGTGAGCGACAATGTGACTGTGACGCCCCTAA GGAATGGAGCTGCACAGTGCCGACCAGATGCGGTTAGTAAGGTAGTGCCC CCGGAAAATCGTAACTACATAACCTACTATCAGTGGGTCGTGCTGGTATT GCTGCTCGAGTCGTTTGTGTTTTATATGCCAGCATTTCTCTGGAAGATTT GGGAGGGCGGTCGGCTGAAGCATTTGTGCGATGATTTCCACAAGATGGCC GTTTGCAAGGACAAGAGCAGGACCCATTTGCGCGTACTAGTCAACTACTT CTCCAGCGATTACAAAGAGACCCACTTCCGCTACTTCGTTAGCTACGTCT TCTGCGAAATACTCAATTTGAGCATCAGTATTCTAAACTTCCTTCTGTTG GACGTATTTTTCGGAGGTTTTTGGGGCCGCTACCGTAATGCCTTGCTGTC CCTTTACAATGGCGACTATAACCAGTGGAACATTATAACCATGGCAGTCT TCCCCAAGTGTGCCAAGTGCGAGATGTACAAGGGCGGCCCCAGCGGTTCT TCCAACATATACGACTACCTTTGCCTGCTGCCCCTGAATATACTGAACGA GAAAATCTTCGCCTTCCTGTGGATATGGTTTATACTAGTGGCTATGCTCA TTTCCCTCAAGTTTCTGTACCGCCTGGCCACCGTTTTGTATCCCGGAATG CGTCTTCAGTTGCTTCGTGCCAGGGCACGTTTCATGCCCAAGAAGCACTT GCAGGTGGCATTGCGCAATTGCAGTTTTGGCGACTGGTTCGTGCTGATGC GCGTGGGCAACAACATCAGCCCCGAGCTATTCCGTAAGTTGCTGGAGGAG CTGTACGAAGCTCAGTCCTTGATCAAAATACCGCCAGGAGCGGACAAGAT C >C2 ATGTACGCAGCTGTTAAGCCGCTCTCCAAGTATCTGCAGTTCAAGTCGGT GCACATCTACGATGCCATTTTCACGCTGCATTCCAAAGTCACGGTGGCCC TGCTTTTGGCCTGCACATTTTTGCTTTCCTCGAAACAATATTTCGGGGAT CCCATCCAGTGTTTTGGGGACAGGGACATGGACTACGTGCACGCCTTTTG CTGGATCTACGGGGCCTATGTGAGCGACAATGTGACAGTGACGCCGCTAA GGAATGGCGCTGCACAGTGCCGGCCAGATGCGGTTAGTAAGGTGGTGCCC CCAGAGAATCGCAACTACATCACCTACTATCAGTGGGTCGTGCTGGTATT GTTGCTCGAGTCGTTTGTGTTCTATATGCCGGCATTTCTCTGGAAGATTT GGGAGGGCGGTCGGCTGAAGCATTTGTGCGATGATTTCCACAAGATGGCC GTTTGCAAGGACAAGAGCAGAACTCATTTGCGCGTACTAGTCAACTACTT CTCCAGCGACTACAAGGAGACCCACTTCCGCTACTTCGTTAGCTACGTCT TCTGCGAAATACTCAATTTGAGCATCAGTATTCTAAACTTCCTTCTGTTG GACGTATTTTTCGGCGGTTTTTGGGGCCGCTACCGCGATGCCTTGCTGTC CCTTTACAATGGCGACTATAACCAGTGGAACATCATCACCATGGCAGTCT TTCCCAAGTGTGCCAAGTGCGAGATGTACAAGGGCGGCCCCAGCGGTTCT TCCAACATATACGACTACCTGTGCCTGCTGCCCCTGAATATACTGAACGA GAAAATCTTCGCCTTCCTGTGGATCTGGTTTATACTAGTGGCTATGCTCA TTGCCCTCAAGTTTCTGTACCGCCTGGCCACCGTTTTGTATCCCGGAATG CGTCTGCAGTTGCTTCGTGCCAGGGCACGTTTCATGCCCAAGAAGCACTT GCAGGTGGCACTGCGCAATTGCAGTTTCGGCGACTGGTTCGTGCTGATGC GCGTGGGCAACAACATCAGCCCCGAGCTATTCCGTAAGTTGCTAGAGGAG CTGTACGCAGCTCAGTCCTTGTTCAAAAAACCGCCGGGAGCGGACGAGAT C >C3 ATGTACGCAGCTGTAAAGCCGCTCTCCAAGTATCTGCAGTTCAAGTCGGT GCACATCTACGATGCCATTTTCACGCTGCACTCCAAAGTGACGGTGGCCC TGCTCTTGGCCTGCACCTTTCTGCTTTCCTCGAAACAATATTTCGGGGAT CCTATCCAGTGTTTTGGGGACAAGGACATGGACTACGTGCACGCCTTTTG CTGGATCTACGGCGCCTATGTGAGCGACAATGTGACTGTGGCGCCCTTGA AAAATGGCGCTGCCCAGTGCCGACCAGATGCTGTAAGTAAGGTGGTGCCA CCGGAGAGTCGCCACTACATCACCTACTATCAATGGGTGGTGCTGGTCCT GCTCCTCGAGTCGTTCGTCTTTTATTTGCCCGCCTTTCTCTGGAAGATTT GGGAGGGCGGTCGTCTGAAGCACTTGTGCGATGATTTCCACAAGATGGCC GTTTGCAAGGACAAGAGCAGGACTCAAATTCGCGTGCTGGTCAAATACTT CTCCAGCGACTACAAGGAGACCCACTTTCGCTACTTTGTCAGCTACGTCT TTTGTGAGATACTGAACTTGAGCATCAGTATTCTCAACTTTCTTCTATTG GACGTATTTTTCGGCGGTTTTTGGGGCCGCTACCGCGATGCCTTGCTATC GCTTTACAACGGTGATTATAACACGTGGAACATCATCACCATGGAGGTGT TTCCCAAGTGCGCCAAGTGCGAGATGTACAAGGGCGGCCCCAGCGGTTCG TCCAACATATACGACTACCTCTGCCTGCTGCCCCTGAATATACTGAACGA GAAGATCTTCGCCTTTCTGTGGCTGTGGTTTATACTGGTGGCCATGCTCG TTGCCCTAAAGTTCATGTACCGCCTGGCCACCGTTTTGTATCCCGGCATG CGCCTGCAGTTGCTGCGAGCCAGGGCACGTTTCATGCCCAAGACGCATCT GCAGGTGGCACTGCGCAATTGCAGTTTTGGCGACTGGTTCGTGCTGATGC GCGTGGGCAACAACATCAGCCCCGAGATATTCCGTAAGTTGCTGGAGGAG CTTTACGAAGCTCAGTCCTTGACCAAAATACCGCCGGGAGCGGATGAAAT C >C4 ATGTACGCAGCTGTTAAGCCGCTGTCCAAGTATCTGCAGTTCAAGTCGGT GCACATCTACGATGCTATTTTCACGCTGCACTCGAAAGTTACGGTGGCCC TGCTTCTGGCCTGCACCTTTCTACTTTCCTCGAAACAATATTTCGGGGAT CCTATCCAGTGTTTTGGGGACAAGGACATGGACTACGTGCACGCCTTTTG CTGGATTTACGGGGCCTATGTGAGCGACAATGTGACTGTGGCGCCCCTGA GAAATGGCGCTGCACAGTGCCGACCAGATGCGGTGAGCAAGGTGGTGCCC CCGGAAAATCGCCACTACATCACCTACTATCAATGGGTGGTGCTGGTACT GCTCCTCGAGTCGTTTGTGTTCTATTTGCCCGCCTTTCTCTGGAAGATTT GGGAGGGCGGTCGGCTGAAGCATTTGTGCGATGATTTCCACAAGATGGCC GTTTGCAAGGACAAGAGCAGGACCCATCTTCGCGTACTGGTCAACTACTT CTCCAGCGACTACAAGGAGACCCACTTCCGCTACTTTGTCAGCTATGTCT TTTGTGAGATACTCAATTTGAGCATCAGTATTCTGAACTTCCTTCTATTG GATGTATTTTTCGGCGGTTTTTGGAGACGCTACCGCGATGCCTTGCTATC CCTCTACAACGGTGATTATAACCAGTGGAACATCATCACTATGGAGGTCT TTCCTAAGTGCGCCAAGTGCGAGATGTACAAGGGCGGGCCCAGCGGTTCG TCCAACATATACGACTACCTCTGCCTGCTGCCCCTGAATATACTAAACGA GAAGATCTTCGCCTTCTTGTGGATGTGGTTTATACTAGTGGCTGTGCTCG TTTCCCTAAAGTTCCTGTACCGCCTGGCCACCATTTTGTATCCGGGAATG CGCCTGCAGTTGCTTCGTGCCAGGGCGCGTTTCATGCCCAAGGCGCACTT ACAGGTGGCACTGCGCAATTGCAGTTTTGGCGACTGGTTCGTGCTGATGC GCGTGGGCAACAACATCAGCCCCGAAATATTCCGTAAGTTGCTGGAGGAG CTTTACGAAGCTCAGTCCTTGACCAAAATACCGCCAGGAGCGGACGAAAT C >C1 MYAAVKPLSKYLQFKSVHIYDAIFTLHSKVTVALLLACTFLLSSKQYFGD PIQCFGDKDMDYVHAFCWIYGAYVSDNVTVTPLRNGAAQCRPDAVSKVVP PENRNYITYYQWVVLVLLLESFVFYMPAFLWKIWEGGRLKHLCDDFHKMA VCKDKSRTHLRVLVNYFSSDYKETHFRYFVSYVFCEILNLSISILNFLLL DVFFGGFWGRYRNALLSLYNGDYNQWNIITMAVFPKCAKCEMYKGGPSGS SNIYDYLCLLPLNILNEKIFAFLWIWFILVAMLISLKFLYRLATVLYPGM RLQLLRARARFMPKKHLQVALRNCSFGDWFVLMRVGNNISPELFRKLLEE LYEAQSLIKIPPGADKI >C2 MYAAVKPLSKYLQFKSVHIYDAIFTLHSKVTVALLLACTFLLSSKQYFGD PIQCFGDRDMDYVHAFCWIYGAYVSDNVTVTPLRNGAAQCRPDAVSKVVP PENRNYITYYQWVVLVLLLESFVFYMPAFLWKIWEGGRLKHLCDDFHKMA VCKDKSRTHLRVLVNYFSSDYKETHFRYFVSYVFCEILNLSISILNFLLL DVFFGGFWGRYRDALLSLYNGDYNQWNIITMAVFPKCAKCEMYKGGPSGS SNIYDYLCLLPLNILNEKIFAFLWIWFILVAMLIALKFLYRLATVLYPGM RLQLLRARARFMPKKHLQVALRNCSFGDWFVLMRVGNNISPELFRKLLEE LYAAQSLFKKPPGADEI >C3 MYAAVKPLSKYLQFKSVHIYDAIFTLHSKVTVALLLACTFLLSSKQYFGD PIQCFGDKDMDYVHAFCWIYGAYVSDNVTVAPLKNGAAQCRPDAVSKVVP PESRHYITYYQWVVLVLLLESFVFYLPAFLWKIWEGGRLKHLCDDFHKMA VCKDKSRTQIRVLVKYFSSDYKETHFRYFVSYVFCEILNLSISILNFLLL DVFFGGFWGRYRDALLSLYNGDYNTWNIITMEVFPKCAKCEMYKGGPSGS SNIYDYLCLLPLNILNEKIFAFLWLWFILVAMLVALKFMYRLATVLYPGM RLQLLRARARFMPKTHLQVALRNCSFGDWFVLMRVGNNISPEIFRKLLEE LYEAQSLTKIPPGADEI >C4 MYAAVKPLSKYLQFKSVHIYDAIFTLHSKVTVALLLACTFLLSSKQYFGD PIQCFGDKDMDYVHAFCWIYGAYVSDNVTVAPLRNGAAQCRPDAVSKVVP PENRHYITYYQWVVLVLLLESFVFYLPAFLWKIWEGGRLKHLCDDFHKMA VCKDKSRTHLRVLVNYFSSDYKETHFRYFVSYVFCEILNLSISILNFLLL DVFFGGFWRRYRDALLSLYNGDYNQWNIITMEVFPKCAKCEMYKGGPSGS SNIYDYLCLLPLNILNEKIFAFLWMWFILVAVLVSLKFLYRLATILYPGM RLQLLRARARFMPKAHLQVALRNCSFGDWFVLMRVGNNISPEIFRKLLEE LYEAQSLTKIPPGADEI MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/444/zpg-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 4 taxa and 1101 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1481329330 Setting output file names to "/opt/ADOPS/444/zpg-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 427749988 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 4566878172 Seed = 976220363 Swapseed = 1481329330 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.35 % Dirichlet(Revmat{all}) 1.35 % Slider(Revmat{all}) 1.35 % Dirichlet(Pi{all}) 1.35 % Slider(Pi{all}) 2.70 % Multiplier(Alpha{1,2}) 2.70 % Multiplier(Alpha{3}) 2.70 % Slider(Pinvar{all}) 13.51 % NNI(Tau{all},V{all}) 13.51 % ParsSPR(Tau{all},V{all}) 40.54 % Multiplier(V{all}) 13.51 % Nodeslider(V{all}) 5.41 % TLMultiplier(V{all}) Division 1 has 23 unique site patterns Division 2 has 13 unique site patterns Division 3 has 52 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2667.477736 -- -26.620141 Chain 2 -- -2678.097830 -- -26.620141 Chain 3 -- -2678.097830 -- -26.620141 Chain 4 -- -2678.097830 -- -26.620141 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2570.547539 -- -26.620141 Chain 2 -- -2570.547539 -- -26.620141 Chain 3 -- -2667.477736 -- -26.620141 Chain 4 -- -2570.547539 -- -26.620141 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2667.478] (-2678.098) (-2678.098) (-2678.098) * [-2570.548] (-2570.548) (-2667.478) (-2570.548) 500 -- [-2364.498] (-2379.364) (-2373.887) (-2380.413) * (-2389.366) (-2375.576) [-2384.898] (-2376.276) -- 0:00:00 1000 -- [-2352.137] (-2380.605) (-2363.947) (-2374.122) * (-2380.372) [-2369.388] (-2368.710) (-2367.141) -- 0:00:00 1500 -- [-2340.641] (-2379.340) (-2347.720) (-2372.568) * (-2361.637) [-2346.057] (-2365.170) (-2347.244) -- 0:00:00 2000 -- (-2344.188) (-2350.619) [-2342.780] (-2361.302) * (-2360.849) [-2344.582] (-2360.384) (-2345.505) -- 0:00:00 2500 -- [-2335.682] (-2344.532) (-2339.498) (-2352.809) * (-2350.765) (-2330.787) (-2350.178) [-2336.971] -- 0:00:00 3000 -- (-2339.272) [-2339.991] (-2335.271) (-2345.277) * (-2343.113) [-2334.549] (-2335.282) (-2338.344) -- 0:00:00 3500 -- (-2335.962) (-2336.627) (-2334.062) [-2335.738] * (-2349.241) (-2329.698) (-2330.438) [-2329.807] -- 0:00:00 4000 -- (-2332.621) [-2333.214] (-2333.988) (-2332.927) * (-2334.224) (-2332.072) (-2338.026) [-2333.846] -- 0:00:00 4500 -- [-2329.292] (-2337.078) (-2333.182) (-2335.797) * (-2343.174) (-2330.831) (-2328.584) [-2335.112] -- 0:03:41 5000 -- (-2334.012) [-2335.902] (-2338.639) (-2332.661) * (-2335.781) [-2334.924] (-2334.344) (-2332.416) -- 0:03:19 Average standard deviation of split frequencies: 0.000000 5500 -- [-2331.948] (-2335.330) (-2333.083) (-2331.698) * (-2329.918) [-2334.114] (-2330.596) (-2331.885) -- 0:03:00 6000 -- (-2329.036) (-2335.544) (-2344.834) [-2328.140] * (-2335.237) (-2330.777) (-2330.983) [-2331.862] -- 0:02:45 6500 -- (-2329.457) [-2337.650] (-2334.294) (-2336.641) * (-2335.180) (-2338.998) (-2333.578) [-2332.063] -- 0:02:32 7000 -- (-2331.324) (-2343.254) (-2335.094) [-2329.933] * [-2332.175] (-2332.271) (-2330.918) (-2330.645) -- 0:02:21 7500 -- [-2333.631] (-2332.628) (-2330.880) (-2337.811) * (-2328.263) (-2332.197) (-2331.761) [-2331.875] -- 0:02:12 8000 -- [-2329.520] (-2328.032) (-2334.256) (-2344.040) * (-2330.855) [-2335.192] (-2332.915) (-2334.709) -- 0:02:04 8500 -- (-2334.744) [-2332.827] (-2333.861) (-2337.597) * (-2330.074) (-2335.220) (-2336.480) [-2328.454] -- 0:01:56 9000 -- [-2332.903] (-2332.612) (-2329.880) (-2339.454) * (-2329.673) (-2331.089) (-2331.487) [-2329.479] -- 0:01:50 9500 -- (-2327.765) (-2337.434) [-2331.148] (-2330.604) * [-2329.627] (-2332.527) (-2333.887) (-2329.809) -- 0:01:44 10000 -- [-2331.696] (-2333.975) (-2332.268) (-2330.727) * (-2328.323) (-2329.136) [-2337.457] (-2333.605) -- 0:01:39 Average standard deviation of split frequencies: 0.000000 10500 -- (-2332.654) [-2329.003] (-2329.658) (-2330.851) * (-2329.495) (-2336.284) [-2326.500] (-2330.598) -- 0:01:34 11000 -- (-2338.426) (-2328.805) (-2331.165) [-2328.393] * (-2326.968) (-2333.705) [-2338.633] (-2332.299) -- 0:02:59 11500 -- (-2337.623) [-2327.857] (-2334.896) (-2328.897) * (-2332.963) [-2332.480] (-2326.211) (-2332.641) -- 0:02:51 12000 -- (-2335.589) (-2331.878) (-2338.943) [-2326.577] * (-2333.958) (-2329.207) [-2330.597] (-2332.952) -- 0:02:44 12500 -- (-2334.195) (-2332.996) [-2332.596] (-2336.612) * (-2334.617) (-2328.294) (-2336.242) [-2332.772] -- 0:02:38 13000 -- (-2332.189) [-2332.399] (-2329.731) (-2326.616) * [-2337.956] (-2332.116) (-2335.460) (-2330.837) -- 0:02:31 13500 -- (-2336.720) (-2333.803) [-2331.199] (-2338.207) * (-2331.407) (-2333.116) (-2334.952) [-2334.425] -- 0:02:26 14000 -- (-2333.765) (-2334.328) [-2331.700] (-2332.792) * (-2331.642) [-2330.224] (-2331.259) (-2329.168) -- 0:02:20 14500 -- (-2332.776) [-2338.758] (-2329.087) (-2332.767) * (-2334.729) (-2337.575) (-2334.320) [-2330.336] -- 0:02:15 15000 -- (-2336.516) (-2334.761) (-2332.669) [-2329.340] * (-2342.099) (-2329.493) (-2329.639) [-2328.437] -- 0:02:11 Average standard deviation of split frequencies: 0.000000 15500 -- (-2330.504) (-2332.876) (-2333.044) [-2330.235] * (-2334.099) (-2328.851) (-2331.800) [-2327.169] -- 0:02:07 16000 -- (-2335.096) (-2333.426) [-2328.437] (-2337.590) * (-2333.252) (-2334.153) [-2330.540] (-2332.201) -- 0:02:03 16500 -- (-2333.859) (-2340.320) (-2329.904) [-2332.292] * (-2331.009) (-2336.964) [-2332.965] (-2331.196) -- 0:01:59 17000 -- (-2333.580) (-2330.094) (-2329.456) [-2334.556] * [-2332.268] (-2339.579) (-2336.981) (-2340.126) -- 0:01:55 17500 -- (-2332.969) [-2334.543] (-2330.604) (-2331.944) * (-2332.816) [-2331.393] (-2331.570) (-2332.566) -- 0:02:48 18000 -- (-2339.545) (-2330.482) (-2334.420) [-2333.296] * (-2330.454) (-2336.000) [-2336.840] (-2336.741) -- 0:02:43 18500 -- (-2330.436) (-2332.784) (-2337.311) [-2330.912] * (-2334.824) [-2331.596] (-2330.891) (-2330.549) -- 0:02:39 19000 -- (-2334.943) [-2336.514] (-2326.940) (-2337.567) * (-2331.223) (-2331.749) (-2335.792) [-2331.265] -- 0:02:34 19500 -- [-2333.410] (-2337.610) (-2332.658) (-2331.410) * (-2331.194) (-2335.959) (-2336.132) [-2331.629] -- 0:02:30 20000 -- (-2338.482) (-2332.828) (-2330.346) [-2326.545] * (-2330.319) [-2331.742] (-2330.889) (-2330.323) -- 0:02:27 Average standard deviation of split frequencies: 0.000000 20500 -- [-2330.855] (-2340.328) (-2336.113) (-2329.093) * (-2325.786) (-2331.350) (-2334.592) [-2327.420] -- 0:02:23 21000 -- (-2334.046) (-2335.673) (-2332.163) [-2328.805] * (-2340.265) [-2333.270] (-2331.331) (-2329.178) -- 0:02:19 21500 -- [-2335.949] (-2334.297) (-2332.446) (-2329.606) * [-2331.435] (-2329.776) (-2334.233) (-2339.628) -- 0:02:16 22000 -- (-2329.273) (-2335.558) (-2330.777) [-2335.338] * (-2330.832) (-2336.453) [-2327.251] (-2328.687) -- 0:02:13 22500 -- [-2331.883] (-2335.398) (-2332.952) (-2333.386) * (-2334.485) [-2330.259] (-2328.446) (-2332.204) -- 0:02:10 23000 -- [-2327.710] (-2333.682) (-2332.715) (-2334.119) * [-2331.747] (-2336.840) (-2325.785) (-2333.310) -- 0:02:07 23500 -- [-2326.940] (-2330.390) (-2331.609) (-2336.494) * (-2330.291) [-2327.022] (-2332.728) (-2342.852) -- 0:02:04 24000 -- (-2327.664) [-2328.048] (-2334.488) (-2330.730) * [-2335.654] (-2331.488) (-2334.150) (-2334.155) -- 0:02:42 24500 -- (-2326.683) [-2329.077] (-2335.076) (-2334.158) * (-2329.181) (-2333.719) [-2334.015] (-2336.631) -- 0:02:39 25000 -- (-2331.534) [-2337.051] (-2331.838) (-2335.458) * (-2334.637) (-2338.554) [-2331.913] (-2341.830) -- 0:02:36 Average standard deviation of split frequencies: 0.000000 25500 -- (-2329.622) [-2330.811] (-2331.445) (-2340.470) * (-2329.075) (-2336.941) (-2330.604) [-2334.097] -- 0:02:32 26000 -- (-2331.693) [-2326.542] (-2333.037) (-2337.710) * (-2333.473) (-2342.118) (-2334.847) [-2337.544] -- 0:02:29 26500 -- [-2334.274] (-2331.333) (-2334.156) (-2337.706) * (-2326.973) (-2341.255) [-2329.025] (-2334.398) -- 0:02:26 27000 -- [-2332.314] (-2331.975) (-2328.752) (-2337.959) * (-2331.094) [-2333.055] (-2333.029) (-2334.237) -- 0:02:24 27500 -- (-2331.241) [-2329.075] (-2333.987) (-2327.739) * (-2335.230) (-2333.195) [-2329.711] (-2335.488) -- 0:02:21 28000 -- (-2331.509) (-2328.747) [-2330.283] (-2336.668) * (-2330.717) [-2339.398] (-2329.694) (-2333.873) -- 0:02:18 28500 -- (-2338.536) [-2327.827] (-2334.475) (-2333.278) * (-2342.292) (-2329.593) (-2339.864) [-2334.459] -- 0:02:16 29000 -- (-2338.480) (-2330.701) [-2334.715] (-2336.218) * (-2333.496) [-2328.565] (-2334.967) (-2330.827) -- 0:02:13 29500 -- [-2336.699] (-2330.743) (-2330.365) (-2331.576) * (-2333.917) (-2331.901) [-2330.134] (-2334.720) -- 0:02:11 30000 -- (-2328.259) (-2333.573) (-2333.941) [-2327.195] * (-2331.318) [-2329.291] (-2331.265) (-2327.235) -- 0:02:09 Average standard deviation of split frequencies: 0.000000 30500 -- [-2328.412] (-2335.664) (-2329.427) (-2335.857) * [-2334.421] (-2333.525) (-2329.549) (-2331.056) -- 0:02:38 31000 -- [-2330.849] (-2331.870) (-2331.083) (-2335.048) * (-2333.521) (-2331.578) (-2328.475) [-2326.680] -- 0:02:36 31500 -- (-2333.792) [-2331.304] (-2329.072) (-2329.931) * (-2333.935) (-2342.381) [-2331.650] (-2333.527) -- 0:02:33 32000 -- (-2334.208) (-2344.187) [-2333.835] (-2332.664) * (-2330.639) [-2332.169] (-2331.681) (-2330.340) -- 0:02:31 32500 -- [-2334.456] (-2334.762) (-2343.020) (-2331.664) * [-2328.726] (-2340.871) (-2331.689) (-2339.254) -- 0:02:28 33000 -- (-2331.840) [-2331.871] (-2335.456) (-2335.265) * (-2335.559) (-2334.400) (-2330.173) [-2332.949] -- 0:02:26 33500 -- (-2335.283) (-2331.977) [-2333.107] (-2335.641) * [-2329.652] (-2327.627) (-2329.962) (-2333.000) -- 0:02:24 34000 -- (-2331.911) [-2331.876] (-2333.249) (-2335.809) * (-2330.998) (-2336.979) [-2330.752] (-2339.470) -- 0:02:22 34500 -- (-2331.184) [-2328.465] (-2330.010) (-2332.932) * (-2344.401) [-2329.573] (-2338.192) (-2332.154) -- 0:02:19 35000 -- (-2336.475) [-2333.258] (-2329.677) (-2333.679) * [-2332.205] (-2334.548) (-2333.478) (-2331.346) -- 0:02:17 Average standard deviation of split frequencies: 0.000000 35500 -- [-2331.824] (-2335.074) (-2335.345) (-2336.297) * (-2331.123) (-2330.854) (-2334.070) [-2328.170] -- 0:02:15 36000 -- [-2328.101] (-2329.375) (-2328.673) (-2333.782) * [-2328.589] (-2335.203) (-2330.996) (-2332.885) -- 0:02:13 36500 -- [-2335.233] (-2329.006) (-2330.315) (-2331.499) * [-2332.993] (-2336.527) (-2335.786) (-2335.747) -- 0:02:11 37000 -- [-2327.348] (-2332.567) (-2331.594) (-2343.090) * (-2330.990) [-2335.407] (-2334.533) (-2332.257) -- 0:02:10 37500 -- (-2331.443) (-2339.927) [-2338.721] (-2342.523) * (-2341.904) (-2335.100) [-2330.096] (-2328.086) -- 0:02:34 38000 -- (-2330.551) (-2332.273) [-2340.144] (-2334.597) * (-2332.500) (-2334.727) (-2336.081) [-2329.159] -- 0:02:31 38500 -- [-2330.175] (-2332.087) (-2334.099) (-2338.603) * (-2335.705) (-2335.201) (-2334.023) [-2331.061] -- 0:02:29 39000 -- [-2328.881] (-2335.169) (-2329.049) (-2338.574) * (-2333.844) (-2338.912) [-2330.406] (-2332.551) -- 0:02:27 39500 -- (-2328.707) [-2333.918] (-2336.151) (-2334.623) * [-2328.518] (-2339.235) (-2331.982) (-2336.145) -- 0:02:25 40000 -- (-2335.033) (-2329.980) (-2329.363) [-2329.538] * (-2332.075) (-2330.828) (-2333.058) [-2333.896] -- 0:02:24 Average standard deviation of split frequencies: 0.000000 40500 -- [-2332.012] (-2338.112) (-2330.582) (-2332.847) * [-2327.628] (-2330.534) (-2336.882) (-2336.162) -- 0:02:22 41000 -- [-2339.013] (-2329.178) (-2339.917) (-2337.632) * [-2328.622] (-2332.762) (-2331.422) (-2330.178) -- 0:02:20 41500 -- (-2336.612) [-2332.501] (-2332.878) (-2341.442) * (-2332.097) (-2340.297) (-2333.776) [-2329.071] -- 0:02:18 42000 -- (-2334.336) [-2329.088] (-2327.953) (-2345.234) * (-2337.258) [-2332.479] (-2335.176) (-2332.065) -- 0:02:16 42500 -- (-2338.012) [-2329.794] (-2330.056) (-2335.671) * [-2334.257] (-2330.729) (-2333.078) (-2338.531) -- 0:02:15 43000 -- [-2334.934] (-2328.223) (-2331.687) (-2339.314) * (-2331.138) (-2335.441) (-2329.947) [-2326.865] -- 0:02:13 43500 -- [-2332.039] (-2333.204) (-2333.520) (-2331.999) * [-2329.694] (-2334.953) (-2331.447) (-2333.416) -- 0:02:11 44000 -- (-2333.518) (-2334.564) [-2331.840] (-2330.784) * (-2334.224) (-2340.555) [-2328.030] (-2335.661) -- 0:02:32 44500 -- (-2333.711) (-2329.572) (-2334.808) [-2327.192] * (-2332.387) (-2334.667) (-2334.219) [-2330.985] -- 0:02:30 45000 -- (-2333.649) [-2329.237] (-2332.145) (-2329.472) * (-2338.879) [-2336.771] (-2330.385) (-2327.481) -- 0:02:28 Average standard deviation of split frequencies: 0.000000 45500 -- (-2334.483) (-2328.004) (-2330.671) [-2334.855] * [-2331.618] (-2339.746) (-2339.117) (-2335.028) -- 0:02:26 46000 -- (-2330.994) (-2328.494) [-2332.369] (-2337.214) * (-2327.556) [-2330.881] (-2331.202) (-2331.514) -- 0:02:25 46500 -- [-2328.022] (-2327.138) (-2324.424) (-2330.092) * (-2332.743) (-2330.715) [-2326.764] (-2334.733) -- 0:02:23 47000 -- [-2334.285] (-2336.138) (-2331.520) (-2342.648) * (-2333.832) (-2331.774) (-2329.000) [-2334.613] -- 0:02:21 47500 -- [-2328.667] (-2332.311) (-2337.980) (-2337.310) * (-2328.105) (-2337.062) [-2331.752] (-2334.459) -- 0:02:20 48000 -- (-2329.706) (-2328.028) [-2330.543] (-2339.070) * [-2326.167] (-2335.796) (-2336.212) (-2333.977) -- 0:02:18 48500 -- [-2331.749] (-2332.755) (-2335.465) (-2335.589) * (-2334.980) (-2334.216) (-2329.543) [-2331.998] -- 0:02:17 49000 -- (-2328.113) (-2339.396) [-2330.774] (-2337.872) * (-2329.998) (-2331.563) [-2333.181] (-2331.309) -- 0:02:15 49500 -- (-2328.959) [-2329.427] (-2335.525) (-2328.180) * [-2330.491] (-2335.825) (-2334.426) (-2328.864) -- 0:02:14 50000 -- [-2333.786] (-2330.856) (-2332.685) (-2333.330) * (-2336.946) (-2325.955) [-2329.915] (-2329.114) -- 0:02:13 Average standard deviation of split frequencies: 0.000000 50500 -- (-2333.927) (-2334.334) [-2330.674] (-2330.073) * [-2331.397] (-2333.277) (-2333.640) (-2332.048) -- 0:02:30 51000 -- (-2332.446) (-2335.019) [-2328.456] (-2331.858) * (-2328.531) (-2331.610) (-2328.569) [-2328.712] -- 0:02:28 51500 -- (-2331.459) (-2332.168) (-2335.121) [-2333.750] * (-2330.960) [-2330.087] (-2335.677) (-2332.658) -- 0:02:27 52000 -- (-2331.913) (-2335.875) (-2332.554) [-2335.412] * (-2329.600) (-2331.335) (-2333.149) [-2331.384] -- 0:02:25 52500 -- (-2330.217) (-2338.658) (-2333.427) [-2332.245] * (-2330.344) [-2331.081] (-2328.310) (-2332.285) -- 0:02:24 53000 -- (-2328.089) (-2337.114) [-2331.570] (-2334.792) * [-2329.437] (-2332.823) (-2333.020) (-2331.493) -- 0:02:22 53500 -- (-2338.725) (-2338.010) [-2328.988] (-2334.997) * (-2332.421) (-2330.768) [-2331.326] (-2334.220) -- 0:02:21 54000 -- (-2339.939) [-2335.174] (-2334.623) (-2340.988) * (-2334.209) (-2331.088) [-2329.065] (-2336.242) -- 0:02:20 54500 -- (-2338.244) (-2330.028) [-2330.240] (-2341.278) * (-2334.156) (-2331.716) [-2335.463] (-2333.029) -- 0:02:18 55000 -- (-2329.071) (-2333.185) [-2332.287] (-2333.774) * (-2333.223) [-2329.714] (-2333.791) (-2329.693) -- 0:02:17 Average standard deviation of split frequencies: 0.000000 55500 -- [-2330.388] (-2327.219) (-2327.107) (-2336.759) * (-2331.703) [-2333.513] (-2331.745) (-2328.378) -- 0:02:16 56000 -- (-2328.089) (-2337.162) [-2338.106] (-2334.516) * (-2334.289) [-2331.687] (-2339.847) (-2331.979) -- 0:02:14 56500 -- [-2328.320] (-2333.567) (-2335.153) (-2333.843) * (-2332.515) [-2329.527] (-2329.235) (-2333.902) -- 0:02:13 57000 -- (-2336.232) [-2336.772] (-2340.047) (-2334.218) * [-2330.755] (-2334.599) (-2331.818) (-2334.612) -- 0:02:28 57500 -- (-2327.967) (-2332.441) [-2330.156] (-2327.490) * [-2329.245] (-2331.872) (-2331.566) (-2333.763) -- 0:02:27 58000 -- (-2334.585) [-2331.288] (-2335.552) (-2330.266) * (-2337.842) [-2329.679] (-2329.091) (-2330.308) -- 0:02:26 58500 -- (-2332.036) (-2341.922) (-2335.214) [-2335.770] * (-2331.925) (-2336.284) (-2328.997) [-2328.717] -- 0:02:24 59000 -- [-2330.931] (-2333.820) (-2334.293) (-2337.346) * (-2329.327) [-2327.070] (-2331.136) (-2333.840) -- 0:02:23 59500 -- [-2333.709] (-2341.381) (-2331.776) (-2334.423) * (-2334.607) [-2328.896] (-2328.810) (-2338.682) -- 0:02:22 60000 -- [-2332.378] (-2334.398) (-2332.762) (-2336.952) * (-2333.136) (-2327.237) [-2328.853] (-2335.068) -- 0:02:21 Average standard deviation of split frequencies: 0.000000 60500 -- (-2336.769) [-2333.433] (-2333.794) (-2336.072) * (-2338.505) (-2335.305) [-2329.611] (-2332.101) -- 0:02:19 61000 -- (-2330.902) (-2332.872) (-2336.322) [-2329.443] * (-2332.737) [-2330.422] (-2332.924) (-2335.612) -- 0:02:18 61500 -- (-2340.341) [-2336.068] (-2332.643) (-2334.138) * (-2331.724) (-2336.216) [-2329.208] (-2329.640) -- 0:02:17 62000 -- (-2325.930) (-2332.153) [-2327.790] (-2332.389) * [-2332.197] (-2330.432) (-2336.506) (-2331.696) -- 0:02:16 62500 -- (-2332.113) (-2336.688) [-2333.663] (-2329.032) * (-2326.280) (-2330.116) [-2329.430] (-2335.724) -- 0:02:15 63000 -- [-2332.013] (-2334.121) (-2352.845) (-2330.389) * (-2333.156) (-2330.616) [-2328.320] (-2333.439) -- 0:02:13 63500 -- [-2331.523] (-2338.308) (-2337.331) (-2332.196) * (-2328.176) (-2333.833) (-2331.866) [-2334.338] -- 0:02:27 64000 -- [-2329.901] (-2334.166) (-2328.542) (-2331.595) * (-2328.639) (-2339.732) (-2335.652) [-2337.135] -- 0:02:26 64500 -- [-2332.936] (-2336.614) (-2331.523) (-2330.214) * (-2332.116) (-2334.177) [-2331.857] (-2336.894) -- 0:02:25 65000 -- (-2328.163) (-2334.490) (-2333.057) [-2326.790] * (-2332.205) (-2331.154) [-2335.681] (-2335.649) -- 0:02:23 Average standard deviation of split frequencies: 0.000000 65500 -- [-2330.204] (-2332.741) (-2331.222) (-2332.121) * (-2330.231) (-2328.817) [-2331.712] (-2339.574) -- 0:02:22 66000 -- (-2334.514) (-2335.853) (-2331.642) [-2331.875] * (-2332.883) [-2330.003] (-2329.991) (-2336.950) -- 0:02:21 66500 -- (-2331.508) (-2338.267) [-2335.858] (-2332.505) * (-2337.259) (-2330.183) (-2327.550) [-2329.656] -- 0:02:20 67000 -- (-2335.731) [-2331.572] (-2330.468) (-2333.840) * (-2338.691) (-2330.861) [-2327.777] (-2333.143) -- 0:02:19 67500 -- (-2336.436) [-2329.155] (-2333.403) (-2329.557) * (-2334.087) (-2331.223) [-2328.830] (-2329.708) -- 0:02:18 68000 -- (-2329.896) (-2332.851) [-2334.865] (-2333.597) * (-2333.237) (-2336.255) (-2325.916) [-2325.999] -- 0:02:17 68500 -- (-2337.876) [-2326.731] (-2336.960) (-2330.066) * [-2332.156] (-2333.280) (-2330.147) (-2328.981) -- 0:02:15 69000 -- (-2331.576) (-2328.774) (-2336.055) [-2330.037] * (-2330.648) (-2335.427) (-2327.715) [-2329.294] -- 0:02:14 69500 -- (-2331.555) (-2330.428) [-2329.925] (-2327.730) * (-2329.206) [-2330.138] (-2333.833) (-2335.970) -- 0:02:13 70000 -- (-2331.248) (-2335.955) (-2329.322) [-2330.490] * (-2336.175) (-2327.658) [-2334.674] (-2328.492) -- 0:02:26 Average standard deviation of split frequencies: 0.000000 70500 -- (-2336.514) (-2329.814) [-2332.246] (-2336.302) * (-2330.068) (-2337.202) (-2331.393) [-2328.120] -- 0:02:25 71000 -- (-2333.356) [-2332.365] (-2331.532) (-2336.207) * [-2335.705] (-2334.857) (-2327.670) (-2331.849) -- 0:02:23 71500 -- [-2336.216] (-2330.568) (-2329.434) (-2335.666) * [-2335.712] (-2335.905) (-2331.055) (-2332.445) -- 0:02:22 72000 -- (-2346.163) (-2327.509) [-2332.437] (-2330.449) * [-2332.962] (-2336.750) (-2328.016) (-2330.732) -- 0:02:21 72500 -- [-2335.290] (-2336.244) (-2336.506) (-2335.605) * (-2329.889) (-2330.482) (-2333.681) [-2334.070] -- 0:02:20 73000 -- (-2333.869) (-2334.528) (-2336.501) [-2335.198] * (-2338.414) [-2329.650] (-2339.018) (-2337.038) -- 0:02:19 73500 -- (-2331.042) (-2339.654) (-2326.663) [-2330.456] * (-2332.442) [-2334.200] (-2328.327) (-2334.340) -- 0:02:18 74000 -- (-2331.774) (-2332.874) (-2339.763) [-2330.783] * (-2337.622) (-2336.461) (-2334.043) [-2334.883] -- 0:02:17 74500 -- [-2336.920] (-2349.972) (-2329.305) (-2333.935) * (-2334.021) (-2332.093) (-2335.769) [-2332.457] -- 0:02:16 75000 -- (-2330.651) (-2336.108) (-2332.290) [-2335.319] * [-2330.916] (-2332.747) (-2332.813) (-2333.302) -- 0:02:15 Average standard deviation of split frequencies: 0.000000 75500 -- (-2332.376) (-2334.749) [-2331.259] (-2342.088) * (-2331.385) [-2330.197] (-2335.395) (-2331.329) -- 0:02:14 76000 -- (-2331.460) [-2335.569] (-2333.065) (-2332.467) * (-2332.445) (-2338.475) (-2335.267) [-2331.915] -- 0:02:13 76500 -- (-2337.707) [-2333.168] (-2333.756) (-2335.786) * (-2327.395) (-2333.710) (-2335.344) [-2332.788] -- 0:02:12 77000 -- (-2327.991) (-2334.177) [-2337.948] (-2333.749) * [-2332.990] (-2330.009) (-2333.180) (-2334.411) -- 0:02:23 77500 -- [-2332.214] (-2332.548) (-2326.933) (-2327.234) * [-2332.046] (-2329.238) (-2337.317) (-2329.122) -- 0:02:22 78000 -- [-2336.766] (-2334.829) (-2337.747) (-2334.036) * (-2336.475) (-2332.935) [-2333.026] (-2329.961) -- 0:02:21 78500 -- (-2331.034) (-2336.749) [-2335.795] (-2336.674) * (-2330.262) (-2327.281) (-2336.973) [-2329.403] -- 0:02:20 79000 -- (-2330.276) (-2332.369) (-2332.826) [-2331.248] * (-2334.958) [-2333.607] (-2334.820) (-2335.633) -- 0:02:19 79500 -- (-2331.113) (-2330.785) [-2333.660] (-2337.906) * (-2331.985) [-2337.222] (-2336.483) (-2332.863) -- 0:02:18 80000 -- (-2328.575) (-2333.782) [-2330.460] (-2332.125) * (-2343.521) (-2333.679) (-2331.965) [-2335.657] -- 0:02:18 Average standard deviation of split frequencies: 0.000000 80500 -- (-2335.932) (-2335.148) (-2333.569) [-2330.673] * (-2346.118) (-2334.980) [-2332.212] (-2334.927) -- 0:02:17 81000 -- (-2325.804) (-2335.752) [-2331.397] (-2338.000) * (-2335.352) (-2333.047) (-2332.478) [-2330.969] -- 0:02:16 81500 -- (-2336.213) (-2330.808) (-2331.864) [-2333.211] * (-2335.376) (-2332.383) [-2331.304] (-2332.749) -- 0:02:15 82000 -- (-2335.133) [-2330.424] (-2336.922) (-2331.835) * (-2335.558) (-2339.512) (-2334.354) [-2329.837] -- 0:02:14 82500 -- (-2340.892) (-2332.828) [-2330.602] (-2332.149) * (-2328.326) (-2335.781) (-2330.548) [-2335.325] -- 0:02:13 83000 -- (-2327.804) (-2337.791) (-2332.153) [-2333.538] * (-2332.150) (-2336.910) [-2336.322] (-2329.149) -- 0:02:12 83500 -- (-2331.806) [-2335.751] (-2335.191) (-2328.986) * (-2335.274) (-2336.222) (-2335.985) [-2332.700] -- 0:02:22 84000 -- (-2333.456) (-2340.774) (-2334.324) [-2332.864] * [-2333.062] (-2334.793) (-2331.616) (-2337.527) -- 0:02:21 84500 -- [-2333.202] (-2341.952) (-2334.810) (-2334.235) * (-2330.156) (-2338.237) [-2334.566] (-2333.582) -- 0:02:20 85000 -- [-2331.566] (-2336.551) (-2334.544) (-2329.628) * (-2334.886) (-2330.643) (-2333.515) [-2334.148] -- 0:02:19 Average standard deviation of split frequencies: 0.000000 85500 -- [-2326.357] (-2330.617) (-2330.538) (-2334.947) * (-2336.122) (-2333.086) (-2327.321) [-2334.578] -- 0:02:19 86000 -- (-2335.416) (-2333.376) (-2328.109) [-2327.480] * (-2331.189) [-2334.954] (-2341.653) (-2337.693) -- 0:02:18 86500 -- (-2339.120) [-2342.742] (-2331.937) (-2332.079) * (-2334.684) (-2337.083) [-2331.532] (-2335.896) -- 0:02:17 87000 -- (-2332.475) (-2340.763) (-2333.993) [-2329.956] * (-2337.797) (-2337.763) [-2331.755] (-2333.980) -- 0:02:16 87500 -- (-2334.008) (-2333.553) [-2331.665] (-2332.896) * [-2332.657] (-2332.387) (-2334.234) (-2330.831) -- 0:02:15 88000 -- (-2326.415) [-2335.840] (-2334.135) (-2329.042) * (-2334.863) (-2329.339) (-2331.279) [-2327.684] -- 0:02:14 88500 -- [-2329.099] (-2332.678) (-2332.912) (-2329.386) * (-2336.332) [-2333.774] (-2336.977) (-2330.889) -- 0:02:13 89000 -- (-2332.237) (-2335.400) (-2339.918) [-2330.820] * (-2339.763) [-2328.223] (-2333.020) (-2334.458) -- 0:02:13 89500 -- (-2331.151) (-2332.580) [-2330.897] (-2332.576) * (-2338.966) [-2330.496] (-2336.786) (-2335.235) -- 0:02:12 90000 -- [-2333.264] (-2328.359) (-2332.488) (-2333.726) * (-2336.184) (-2334.672) (-2335.621) [-2332.376] -- 0:02:11 Average standard deviation of split frequencies: 0.000000 90500 -- (-2329.967) (-2327.483) (-2335.512) [-2328.201] * (-2333.111) [-2333.135] (-2331.917) (-2334.583) -- 0:02:20 91000 -- (-2337.914) [-2338.975] (-2332.407) (-2339.347) * (-2334.887) (-2335.270) [-2330.340] (-2337.607) -- 0:02:19 91500 -- [-2336.664] (-2330.310) (-2327.852) (-2329.793) * (-2331.269) (-2329.618) [-2330.468] (-2337.782) -- 0:02:19 92000 -- (-2334.209) [-2332.644] (-2330.251) (-2329.920) * (-2334.068) (-2329.983) (-2333.970) [-2330.700] -- 0:02:18 92500 -- (-2340.161) (-2333.914) [-2328.715] (-2337.143) * [-2332.384] (-2334.592) (-2330.745) (-2334.224) -- 0:02:17 93000 -- [-2329.719] (-2344.064) (-2328.200) (-2338.238) * (-2330.838) [-2338.527] (-2327.691) (-2330.254) -- 0:02:16 93500 -- [-2338.636] (-2337.035) (-2332.069) (-2335.264) * (-2330.958) (-2337.192) [-2329.782] (-2330.791) -- 0:02:15 94000 -- (-2334.187) [-2335.738] (-2327.991) (-2333.599) * (-2328.049) [-2327.642] (-2334.755) (-2336.575) -- 0:02:14 94500 -- (-2334.245) (-2335.384) (-2329.055) [-2335.310] * (-2328.316) (-2332.264) (-2337.726) [-2332.700] -- 0:02:14 95000 -- (-2329.092) (-2334.573) (-2335.867) [-2333.068] * (-2333.851) (-2336.535) (-2331.276) [-2330.200] -- 0:02:13 Average standard deviation of split frequencies: 0.000000 95500 -- (-2335.953) (-2328.778) [-2333.796] (-2340.512) * (-2335.544) (-2338.433) [-2328.829] (-2326.607) -- 0:02:12 96000 -- (-2328.061) [-2338.407] (-2327.224) (-2337.544) * (-2329.955) (-2338.497) [-2332.279] (-2327.733) -- 0:02:11 96500 -- (-2331.245) (-2327.256) (-2333.011) [-2329.269] * [-2329.047] (-2336.828) (-2327.977) (-2332.159) -- 0:02:20 97000 -- (-2331.163) (-2331.066) [-2329.050] (-2348.713) * (-2332.414) (-2332.799) (-2335.012) [-2330.360] -- 0:02:19 97500 -- (-2332.811) (-2337.349) (-2328.426) [-2330.690] * (-2334.910) (-2328.816) (-2330.747) [-2328.887] -- 0:02:18 98000 -- (-2341.712) (-2330.209) (-2331.723) [-2326.992] * (-2330.066) [-2331.260] (-2331.949) (-2334.019) -- 0:02:18 98500 -- (-2328.139) (-2332.833) (-2337.933) [-2332.300] * (-2328.406) (-2334.857) [-2335.343] (-2332.866) -- 0:02:17 99000 -- (-2330.262) (-2329.129) (-2338.760) [-2336.732] * (-2332.747) (-2332.815) [-2329.000] (-2341.935) -- 0:02:16 99500 -- (-2331.415) [-2331.071] (-2333.597) (-2332.832) * (-2332.229) (-2328.405) [-2332.761] (-2333.062) -- 0:02:15 100000 -- (-2335.242) [-2333.730] (-2329.752) (-2330.710) * (-2334.183) [-2332.177] (-2334.508) (-2331.136) -- 0:02:15 Average standard deviation of split frequencies: 0.000000 100500 -- (-2339.662) [-2328.428] (-2327.692) (-2331.036) * (-2336.913) [-2330.552] (-2334.905) (-2336.615) -- 0:02:14 101000 -- (-2334.250) (-2330.593) [-2327.329] (-2332.292) * (-2329.030) [-2331.119] (-2339.734) (-2335.023) -- 0:02:13 101500 -- (-2328.962) (-2335.017) (-2335.345) [-2335.389] * (-2333.327) (-2333.083) [-2333.713] (-2332.401) -- 0:02:12 102000 -- [-2331.475] (-2328.618) (-2332.127) (-2331.781) * [-2330.630] (-2332.108) (-2344.607) (-2331.931) -- 0:02:12 102500 -- (-2332.191) [-2334.875] (-2332.409) (-2332.885) * (-2340.604) (-2333.766) [-2330.864] (-2336.105) -- 0:02:11 103000 -- (-2334.392) (-2334.138) [-2336.808] (-2334.325) * (-2334.630) (-2329.815) (-2338.430) [-2332.581] -- 0:02:10 103500 -- (-2334.514) [-2329.308] (-2332.493) (-2331.898) * (-2331.230) [-2334.035] (-2331.256) (-2328.197) -- 0:02:18 104000 -- (-2330.562) (-2329.009) [-2330.868] (-2330.020) * (-2336.846) (-2327.271) [-2331.261] (-2336.625) -- 0:02:17 104500 -- [-2329.035] (-2333.733) (-2330.746) (-2332.623) * [-2333.745] (-2332.886) (-2338.833) (-2333.898) -- 0:02:17 105000 -- [-2333.943] (-2330.845) (-2334.742) (-2329.744) * [-2330.360] (-2332.145) (-2327.439) (-2330.248) -- 0:02:16 Average standard deviation of split frequencies: 0.000000 105500 -- (-2332.153) [-2332.121] (-2337.991) (-2332.216) * (-2333.178) [-2331.397] (-2334.041) (-2328.780) -- 0:02:15 106000 -- [-2332.266] (-2331.423) (-2330.089) (-2330.285) * (-2326.272) (-2339.348) [-2329.851] (-2335.329) -- 0:02:14 106500 -- [-2327.905] (-2339.281) (-2334.991) (-2327.763) * (-2333.423) (-2337.590) [-2333.065] (-2337.324) -- 0:02:14 107000 -- (-2339.701) [-2332.789] (-2337.650) (-2334.619) * (-2330.980) (-2339.069) [-2332.254] (-2337.316) -- 0:02:13 107500 -- (-2344.354) [-2332.576] (-2338.717) (-2329.281) * [-2332.871] (-2338.587) (-2333.130) (-2331.097) -- 0:02:12 108000 -- (-2339.854) (-2329.926) (-2336.727) [-2335.221] * (-2336.908) (-2344.760) (-2333.393) [-2333.366] -- 0:02:12 108500 -- [-2332.326] (-2329.456) (-2338.684) (-2331.332) * (-2332.128) (-2348.943) [-2327.075] (-2333.043) -- 0:02:11 109000 -- (-2340.685) [-2334.222] (-2338.856) (-2331.878) * (-2334.660) (-2348.918) [-2331.815] (-2326.826) -- 0:02:10 109500 -- (-2336.569) [-2329.413] (-2341.529) (-2336.743) * (-2337.617) (-2344.364) (-2338.521) [-2331.560] -- 0:02:10 110000 -- (-2335.180) (-2331.004) [-2340.172] (-2333.600) * (-2335.772) (-2331.414) (-2333.567) [-2330.640] -- 0:02:17 Average standard deviation of split frequencies: 0.000000 110500 -- [-2333.480] (-2334.923) (-2336.259) (-2333.883) * (-2340.554) [-2336.166] (-2330.574) (-2335.151) -- 0:02:16 111000 -- (-2342.134) (-2334.462) [-2336.350] (-2331.553) * (-2338.842) (-2337.293) (-2330.211) [-2330.400] -- 0:02:16 111500 -- [-2335.627] (-2341.164) (-2336.748) (-2330.040) * (-2332.888) (-2335.683) [-2328.105] (-2334.508) -- 0:02:15 112000 -- (-2336.324) [-2331.157] (-2336.795) (-2338.817) * (-2334.280) (-2337.971) (-2327.613) [-2332.364] -- 0:02:14 112500 -- (-2333.316) (-2335.121) (-2333.452) [-2334.464] * (-2336.276) (-2337.492) [-2331.347] (-2332.014) -- 0:02:14 113000 -- (-2336.743) (-2335.814) [-2330.653] (-2332.305) * (-2332.369) [-2330.149] (-2333.782) (-2334.415) -- 0:02:13 113500 -- (-2336.507) [-2330.977] (-2336.264) (-2334.787) * [-2331.088] (-2331.871) (-2333.477) (-2334.049) -- 0:02:12 114000 -- (-2332.245) (-2331.924) (-2334.831) [-2332.214] * [-2331.041] (-2334.527) (-2328.623) (-2332.629) -- 0:02:12 114500 -- (-2340.217) (-2327.611) (-2333.212) [-2327.578] * (-2332.012) [-2334.972] (-2334.637) (-2331.009) -- 0:02:11 115000 -- [-2328.979] (-2331.223) (-2333.871) (-2329.895) * [-2330.486] (-2344.990) (-2332.535) (-2333.355) -- 0:02:10 Average standard deviation of split frequencies: 0.000000 115500 -- (-2344.094) [-2334.445] (-2334.488) (-2326.877) * (-2331.988) (-2336.911) [-2330.363] (-2330.099) -- 0:02:10 116000 -- (-2335.181) (-2339.641) [-2332.520] (-2333.485) * (-2338.314) (-2337.127) [-2332.746] (-2331.461) -- 0:02:09 116500 -- (-2330.825) (-2332.573) (-2335.533) [-2336.345] * (-2336.981) (-2337.992) [-2335.686] (-2332.079) -- 0:02:16 117000 -- (-2332.769) [-2328.557] (-2338.083) (-2335.321) * (-2336.785) (-2329.815) (-2334.203) [-2329.848] -- 0:02:15 117500 -- (-2332.777) (-2330.925) (-2333.125) [-2329.125] * (-2331.156) (-2335.206) [-2331.641] (-2330.576) -- 0:02:15 118000 -- [-2333.496] (-2337.871) (-2334.298) (-2329.869) * (-2338.622) (-2333.110) [-2330.767] (-2331.530) -- 0:02:14 118500 -- [-2331.474] (-2331.026) (-2337.104) (-2337.801) * (-2335.994) (-2332.253) (-2329.660) [-2327.629] -- 0:02:13 119000 -- (-2327.076) (-2328.894) (-2331.952) [-2331.428] * (-2341.088) [-2329.890] (-2335.239) (-2327.668) -- 0:02:13 119500 -- (-2329.685) (-2331.092) (-2336.009) [-2331.044] * (-2331.492) [-2328.670] (-2339.641) (-2332.293) -- 0:02:12 120000 -- (-2336.161) [-2332.938] (-2334.677) (-2332.400) * (-2329.902) [-2330.937] (-2336.973) (-2333.485) -- 0:02:12 Average standard deviation of split frequencies: 0.000000 120500 -- [-2333.063] (-2334.568) (-2341.227) (-2329.743) * (-2328.946) (-2331.569) [-2333.229] (-2333.393) -- 0:02:11 121000 -- (-2329.236) (-2332.753) [-2330.196] (-2331.426) * (-2332.738) (-2331.762) [-2333.015] (-2330.876) -- 0:02:10 121500 -- (-2330.495) (-2329.406) [-2329.858] (-2331.788) * (-2334.647) [-2336.374] (-2336.222) (-2338.695) -- 0:02:10 122000 -- (-2336.195) [-2325.390] (-2332.022) (-2335.533) * (-2335.169) [-2332.647] (-2337.387) (-2339.329) -- 0:02:09 122500 -- (-2330.756) (-2330.425) (-2336.120) [-2329.929] * (-2332.591) [-2331.010] (-2332.758) (-2339.384) -- 0:02:08 123000 -- (-2336.516) [-2331.615] (-2329.354) (-2330.862) * (-2332.499) [-2333.933] (-2329.265) (-2333.964) -- 0:02:15 123500 -- (-2328.364) [-2330.151] (-2334.497) (-2334.331) * [-2330.274] (-2333.711) (-2333.092) (-2335.665) -- 0:02:14 124000 -- (-2332.526) (-2331.999) [-2328.284] (-2332.618) * (-2333.861) (-2334.707) [-2331.942] (-2338.002) -- 0:02:14 124500 -- [-2334.751] (-2328.609) (-2337.307) (-2331.028) * (-2331.472) [-2330.972] (-2327.385) (-2345.139) -- 0:02:13 125000 -- (-2333.340) (-2331.055) [-2332.402] (-2333.220) * (-2329.623) (-2330.092) [-2331.501] (-2338.553) -- 0:02:13 Average standard deviation of split frequencies: 0.000000 125500 -- [-2328.501] (-2334.770) (-2338.810) (-2333.498) * (-2337.255) (-2334.361) [-2336.702] (-2340.068) -- 0:02:12 126000 -- (-2332.872) (-2333.516) (-2334.909) [-2332.915] * [-2339.906] (-2337.409) (-2329.570) (-2342.302) -- 0:02:11 126500 -- [-2328.726] (-2336.464) (-2337.615) (-2332.270) * (-2343.076) (-2329.723) [-2331.228] (-2335.727) -- 0:02:11 127000 -- (-2330.175) [-2328.084] (-2329.622) (-2333.635) * [-2334.361] (-2331.137) (-2330.636) (-2332.625) -- 0:02:10 127500 -- [-2330.609] (-2331.669) (-2342.870) (-2335.367) * [-2329.257] (-2328.854) (-2333.278) (-2334.419) -- 0:02:10 128000 -- [-2331.440] (-2342.720) (-2328.991) (-2333.882) * (-2331.661) [-2332.992] (-2332.061) (-2335.572) -- 0:02:09 128500 -- (-2330.954) (-2342.627) (-2328.154) [-2334.115] * (-2327.558) (-2335.715) (-2330.185) [-2335.237] -- 0:02:08 129000 -- (-2331.356) (-2338.323) [-2330.473] (-2342.222) * (-2330.800) [-2333.104] (-2331.949) (-2331.734) -- 0:02:08 129500 -- (-2332.291) (-2336.048) (-2331.492) [-2326.352] * (-2335.082) (-2337.841) (-2331.647) [-2335.719] -- 0:02:14 130000 -- [-2332.121] (-2335.368) (-2332.329) (-2328.367) * (-2333.139) (-2332.666) (-2340.062) [-2335.056] -- 0:02:13 Average standard deviation of split frequencies: 0.000000 130500 -- (-2331.301) (-2333.568) (-2328.486) [-2328.480] * (-2339.847) (-2331.791) [-2334.839] (-2332.685) -- 0:02:13 131000 -- (-2337.008) (-2337.027) [-2330.586] (-2342.758) * (-2336.824) (-2336.884) [-2329.324] (-2336.069) -- 0:02:12 131500 -- (-2330.732) [-2333.088] (-2329.757) (-2334.353) * (-2332.264) [-2338.278] (-2330.815) (-2328.288) -- 0:02:12 132000 -- [-2328.516] (-2331.226) (-2332.681) (-2336.307) * (-2332.619) [-2335.987] (-2329.486) (-2334.949) -- 0:02:11 132500 -- (-2333.681) (-2331.690) (-2331.205) [-2334.604] * (-2334.753) [-2335.807] (-2337.242) (-2331.358) -- 0:02:10 133000 -- (-2332.568) (-2333.555) (-2335.832) [-2332.256] * (-2332.695) (-2337.064) (-2337.038) [-2332.788] -- 0:02:10 133500 -- (-2328.445) [-2333.529] (-2330.471) (-2332.670) * (-2331.144) (-2337.831) (-2335.160) [-2335.288] -- 0:02:09 134000 -- (-2333.459) (-2332.100) [-2333.266] (-2331.249) * [-2327.648] (-2334.631) (-2333.961) (-2332.091) -- 0:02:09 134500 -- [-2332.099] (-2332.389) (-2333.555) (-2335.110) * (-2333.803) [-2334.916] (-2331.742) (-2330.805) -- 0:02:08 135000 -- (-2330.226) (-2329.505) (-2338.082) [-2330.707] * (-2339.168) (-2335.972) [-2330.844] (-2338.033) -- 0:02:08 Average standard deviation of split frequencies: 0.000000 135500 -- (-2327.623) (-2332.496) [-2335.795] (-2332.371) * [-2328.722] (-2332.875) (-2328.298) (-2329.968) -- 0:02:07 136000 -- [-2332.755] (-2338.927) (-2329.651) (-2331.469) * (-2328.930) (-2329.675) [-2326.733] (-2331.277) -- 0:02:13 136500 -- [-2331.604] (-2334.639) (-2329.515) (-2332.017) * (-2332.628) (-2328.730) (-2331.055) [-2331.157] -- 0:02:12 137000 -- (-2336.288) [-2331.801] (-2333.400) (-2329.496) * (-2333.383) [-2329.319] (-2328.681) (-2329.288) -- 0:02:12 137500 -- [-2330.650] (-2332.179) (-2334.610) (-2331.260) * (-2335.389) [-2327.025] (-2329.925) (-2336.712) -- 0:02:11 138000 -- [-2327.061] (-2334.294) (-2326.432) (-2330.706) * (-2338.401) [-2329.273] (-2334.420) (-2333.661) -- 0:02:11 138500 -- (-2328.877) [-2328.441] (-2335.457) (-2330.145) * (-2339.470) [-2330.648] (-2331.335) (-2334.865) -- 0:02:10 139000 -- [-2335.813] (-2335.259) (-2330.365) (-2328.020) * (-2333.442) [-2327.409] (-2325.244) (-2338.817) -- 0:02:10 139500 -- (-2331.113) (-2331.796) (-2333.434) [-2329.808] * [-2335.904] (-2334.766) (-2333.669) (-2329.796) -- 0:02:09 140000 -- (-2337.680) (-2330.223) (-2339.858) [-2326.516] * (-2335.948) (-2332.679) [-2337.130] (-2332.242) -- 0:02:09 Average standard deviation of split frequencies: 0.000000 140500 -- [-2329.983] (-2331.651) (-2332.003) (-2330.519) * (-2336.969) [-2335.239] (-2328.800) (-2332.855) -- 0:02:08 141000 -- [-2329.052] (-2333.170) (-2333.677) (-2330.646) * (-2334.353) [-2331.674] (-2333.383) (-2335.513) -- 0:02:07 141500 -- [-2330.595] (-2330.622) (-2328.759) (-2330.230) * (-2330.170) [-2336.059] (-2333.585) (-2339.281) -- 0:02:07 142000 -- (-2330.622) (-2327.568) (-2331.544) [-2334.537] * [-2335.567] (-2333.215) (-2335.641) (-2333.622) -- 0:02:06 142500 -- [-2336.365] (-2334.397) (-2330.113) (-2331.240) * (-2334.562) (-2339.662) [-2331.797] (-2335.498) -- 0:02:06 143000 -- (-2338.271) [-2333.800] (-2337.320) (-2337.084) * (-2332.257) [-2333.858] (-2330.228) (-2332.324) -- 0:02:11 143500 -- (-2339.419) (-2339.529) [-2331.025] (-2330.654) * [-2336.354] (-2334.926) (-2329.109) (-2333.316) -- 0:02:11 144000 -- (-2342.029) [-2335.403] (-2329.025) (-2333.044) * [-2335.779] (-2334.810) (-2332.280) (-2328.995) -- 0:02:10 144500 -- (-2333.176) (-2334.898) [-2330.664] (-2331.918) * (-2336.852) (-2328.415) [-2329.054] (-2328.865) -- 0:02:10 145000 -- (-2335.046) (-2335.374) [-2337.368] (-2329.857) * (-2332.000) (-2332.741) (-2330.423) [-2328.114] -- 0:02:09 Average standard deviation of split frequencies: 0.000000 145500 -- (-2333.922) (-2333.188) [-2330.491] (-2327.393) * (-2335.915) (-2335.766) [-2328.541] (-2336.588) -- 0:02:09 146000 -- [-2330.399] (-2334.772) (-2334.989) (-2336.024) * (-2333.812) [-2331.068] (-2341.524) (-2335.692) -- 0:02:08 146500 -- (-2330.842) [-2330.026] (-2335.696) (-2332.882) * (-2342.498) (-2335.463) [-2338.244] (-2336.750) -- 0:02:08 147000 -- (-2328.280) (-2333.806) [-2327.318] (-2330.237) * (-2332.143) (-2334.583) (-2338.298) [-2328.660] -- 0:02:07 147500 -- (-2331.403) (-2342.825) (-2331.685) [-2328.953] * (-2331.446) (-2333.407) (-2330.337) [-2331.786] -- 0:02:07 148000 -- [-2329.253] (-2334.326) (-2332.422) (-2331.731) * [-2331.772] (-2332.398) (-2332.025) (-2332.602) -- 0:02:06 148500 -- (-2330.157) [-2328.619] (-2334.677) (-2335.568) * [-2336.537] (-2333.198) (-2330.373) (-2338.734) -- 0:02:06 149000 -- (-2330.231) (-2333.686) (-2330.562) [-2330.512] * (-2333.614) [-2330.362] (-2333.913) (-2340.759) -- 0:02:05 149500 -- [-2328.615] (-2328.469) (-2336.615) (-2336.535) * [-2331.805] (-2333.255) (-2330.856) (-2342.825) -- 0:02:10 150000 -- (-2338.230) (-2333.839) (-2333.590) [-2329.046] * (-2328.920) [-2333.253] (-2336.048) (-2333.836) -- 0:02:10 Average standard deviation of split frequencies: 0.000000 150500 -- (-2335.533) (-2328.351) (-2331.926) [-2329.198] * (-2329.151) (-2334.359) (-2332.572) [-2332.512] -- 0:02:09 151000 -- (-2340.492) (-2329.803) [-2329.587] (-2330.672) * (-2330.413) (-2336.310) [-2335.537] (-2331.353) -- 0:02:09 151500 -- (-2330.393) (-2334.067) (-2331.651) [-2332.863] * (-2331.883) (-2335.240) (-2329.705) [-2330.395] -- 0:02:08 152000 -- [-2333.184] (-2335.458) (-2332.169) (-2329.618) * (-2332.754) (-2332.334) [-2334.768] (-2330.014) -- 0:02:08 152500 -- (-2341.703) (-2330.644) (-2335.311) [-2333.943] * (-2332.863) (-2334.161) [-2335.240] (-2333.559) -- 0:02:07 153000 -- [-2334.588] (-2332.109) (-2333.163) (-2340.644) * [-2329.335] (-2334.826) (-2328.555) (-2341.631) -- 0:02:07 153500 -- (-2338.143) (-2333.416) (-2335.411) [-2329.811] * (-2331.999) [-2333.619] (-2330.738) (-2338.712) -- 0:02:06 154000 -- (-2335.137) (-2334.389) [-2333.061] (-2332.684) * (-2336.026) [-2330.129] (-2331.024) (-2328.328) -- 0:02:06 154500 -- (-2332.195) [-2333.157] (-2335.225) (-2331.809) * (-2335.058) (-2335.077) (-2333.796) [-2333.330] -- 0:02:05 155000 -- [-2330.489] (-2335.703) (-2332.053) (-2328.992) * (-2329.688) (-2335.605) [-2337.352] (-2336.175) -- 0:02:05 Average standard deviation of split frequencies: 0.000000 155500 -- (-2329.377) [-2334.011] (-2330.176) (-2332.460) * [-2329.184] (-2334.181) (-2333.006) (-2328.387) -- 0:02:04 156000 -- [-2326.936] (-2338.682) (-2332.664) (-2328.924) * (-2330.060) [-2336.250] (-2334.013) (-2334.426) -- 0:02:09 156500 -- [-2329.062] (-2339.462) (-2330.637) (-2334.732) * (-2328.427) [-2342.444] (-2331.467) (-2332.139) -- 0:02:09 157000 -- (-2329.874) (-2333.671) (-2327.798) [-2329.694] * (-2327.753) (-2335.467) (-2337.068) [-2331.503] -- 0:02:08 157500 -- (-2329.995) (-2333.838) [-2331.312] (-2335.665) * (-2329.046) (-2334.473) (-2338.023) [-2331.972] -- 0:02:08 158000 -- (-2327.475) [-2332.630] (-2329.464) (-2335.043) * [-2328.857] (-2346.811) (-2340.742) (-2339.555) -- 0:02:07 158500 -- (-2330.181) [-2333.665] (-2335.014) (-2328.201) * (-2329.195) [-2330.994] (-2339.043) (-2332.548) -- 0:02:07 159000 -- [-2328.646] (-2332.028) (-2335.480) (-2332.226) * (-2330.568) (-2334.165) (-2335.958) [-2331.597] -- 0:02:06 159500 -- (-2329.199) [-2330.295] (-2334.204) (-2339.021) * [-2341.783] (-2333.137) (-2340.335) (-2329.707) -- 0:02:06 160000 -- (-2331.552) (-2331.435) [-2334.550] (-2329.826) * (-2330.429) [-2331.803] (-2334.832) (-2330.578) -- 0:02:05 Average standard deviation of split frequencies: 0.000000 160500 -- (-2331.432) (-2334.779) [-2331.947] (-2330.555) * [-2325.419] (-2325.922) (-2335.736) (-2334.721) -- 0:02:05 161000 -- [-2330.916] (-2329.986) (-2331.393) (-2330.548) * (-2332.201) [-2330.883] (-2347.248) (-2328.840) -- 0:02:05 161500 -- (-2341.743) (-2329.940) [-2336.872] (-2331.368) * (-2330.343) (-2333.214) (-2335.642) [-2331.684] -- 0:02:04 162000 -- [-2335.529] (-2329.049) (-2333.559) (-2344.866) * [-2331.107] (-2333.123) (-2339.767) (-2334.682) -- 0:02:04 162500 -- (-2331.427) (-2327.135) [-2330.150] (-2333.453) * [-2332.705] (-2339.126) (-2328.319) (-2338.226) -- 0:02:08 163000 -- [-2329.421] (-2341.773) (-2339.685) (-2330.724) * (-2336.799) (-2335.135) (-2327.924) [-2330.932] -- 0:02:08 163500 -- (-2333.425) (-2343.458) [-2326.637] (-2333.949) * (-2334.454) (-2330.141) [-2325.684] (-2332.647) -- 0:02:07 164000 -- (-2338.752) [-2333.188] (-2329.010) (-2329.629) * (-2332.618) (-2333.343) [-2330.853] (-2330.306) -- 0:02:07 164500 -- (-2334.346) (-2331.155) [-2330.791] (-2328.701) * [-2333.673] (-2332.517) (-2329.531) (-2333.690) -- 0:02:06 165000 -- (-2335.137) [-2330.484] (-2338.202) (-2332.572) * (-2332.646) (-2331.420) (-2333.821) [-2328.582] -- 0:02:06 Average standard deviation of split frequencies: 0.000000 165500 -- (-2333.432) [-2329.559] (-2331.544) (-2332.109) * [-2329.984] (-2331.135) (-2330.993) (-2331.665) -- 0:02:06 166000 -- (-2331.778) (-2331.922) (-2330.348) [-2332.566] * (-2331.044) (-2337.607) [-2339.575] (-2332.995) -- 0:02:05 166500 -- (-2332.748) (-2327.986) [-2331.457] (-2326.047) * (-2332.001) (-2330.964) (-2338.828) [-2336.086] -- 0:02:05 167000 -- (-2334.817) (-2329.901) (-2331.952) [-2328.430] * (-2329.517) (-2331.821) (-2331.305) [-2327.624] -- 0:02:04 167500 -- (-2338.986) [-2330.843] (-2330.055) (-2328.984) * (-2333.446) [-2331.548] (-2333.547) (-2329.414) -- 0:02:04 168000 -- (-2336.301) [-2331.783] (-2330.574) (-2332.138) * (-2335.719) (-2332.163) [-2331.546] (-2328.203) -- 0:02:03 168500 -- (-2332.214) (-2330.673) [-2329.312] (-2332.268) * (-2326.636) (-2331.954) [-2337.909] (-2332.993) -- 0:02:03 169000 -- (-2332.250) (-2332.143) (-2338.620) [-2331.306] * (-2334.558) (-2327.139) [-2330.203] (-2328.390) -- 0:02:07 169500 -- (-2338.142) [-2331.070] (-2337.305) (-2342.017) * (-2330.981) (-2339.008) (-2332.647) [-2333.797] -- 0:02:07 170000 -- (-2330.559) (-2327.428) (-2337.802) [-2328.031] * (-2329.907) (-2334.362) [-2334.425] (-2328.526) -- 0:02:06 Average standard deviation of split frequencies: 0.000000 170500 -- (-2332.621) (-2331.709) (-2337.539) [-2335.665] * [-2335.479] (-2331.093) (-2332.294) (-2338.994) -- 0:02:06 171000 -- (-2330.297) [-2329.680] (-2332.437) (-2334.472) * (-2337.179) (-2326.528) (-2329.688) [-2330.113] -- 0:02:06 171500 -- (-2332.431) (-2332.996) [-2332.980] (-2331.653) * (-2335.535) (-2333.865) [-2328.659] (-2328.551) -- 0:02:05 172000 -- (-2331.420) [-2337.043] (-2341.960) (-2330.056) * (-2332.116) (-2328.781) [-2327.807] (-2330.213) -- 0:02:05 172500 -- [-2330.937] (-2332.009) (-2335.459) (-2330.441) * (-2329.934) (-2336.097) (-2337.241) [-2334.339] -- 0:02:04 173000 -- (-2336.186) (-2328.997) (-2329.213) [-2330.337] * (-2334.431) [-2331.915] (-2346.560) (-2331.178) -- 0:02:04 173500 -- [-2333.183] (-2333.964) (-2328.171) (-2337.388) * (-2333.465) (-2331.471) [-2339.389] (-2329.235) -- 0:02:03 174000 -- (-2330.581) (-2332.642) (-2330.097) [-2333.119] * [-2328.060] (-2331.112) (-2336.862) (-2338.487) -- 0:02:03 174500 -- (-2328.478) (-2328.792) [-2332.606] (-2330.418) * [-2334.377] (-2330.352) (-2334.465) (-2333.321) -- 0:02:02 175000 -- (-2327.319) (-2339.308) [-2330.909] (-2326.386) * [-2331.569] (-2336.999) (-2332.755) (-2337.647) -- 0:02:02 Average standard deviation of split frequencies: 0.000000 175500 -- (-2331.509) (-2333.152) [-2335.666] (-2331.858) * (-2342.223) (-2333.283) (-2327.711) [-2332.595] -- 0:02:06 176000 -- (-2330.962) (-2332.016) (-2334.862) [-2332.810] * (-2332.276) (-2331.841) [-2331.541] (-2333.390) -- 0:02:06 176500 -- (-2335.367) [-2334.129] (-2329.912) (-2334.714) * (-2332.354) [-2333.602] (-2337.260) (-2327.922) -- 0:02:05 177000 -- (-2332.577) [-2329.067] (-2330.802) (-2331.191) * (-2335.085) [-2334.787] (-2335.919) (-2331.991) -- 0:02:05 177500 -- [-2333.177] (-2328.128) (-2334.316) (-2330.104) * [-2331.162] (-2336.366) (-2332.235) (-2332.271) -- 0:02:05 178000 -- (-2335.614) (-2327.946) (-2333.821) [-2331.663] * (-2328.025) [-2340.613] (-2330.913) (-2334.035) -- 0:02:04 178500 -- [-2337.970] (-2335.062) (-2335.221) (-2329.110) * [-2331.064] (-2330.395) (-2333.557) (-2338.993) -- 0:02:04 179000 -- (-2337.635) [-2331.399] (-2337.364) (-2333.809) * (-2334.904) [-2331.781] (-2330.129) (-2336.491) -- 0:02:03 179500 -- (-2341.087) (-2337.545) [-2330.209] (-2327.768) * (-2327.590) (-2333.645) [-2329.975] (-2336.704) -- 0:02:03 180000 -- [-2332.999] (-2332.890) (-2336.796) (-2335.471) * (-2333.487) (-2338.556) (-2329.538) [-2335.251] -- 0:02:02 Average standard deviation of split frequencies: 0.000000 180500 -- [-2331.458] (-2328.517) (-2331.533) (-2331.150) * (-2330.234) [-2337.832] (-2333.673) (-2335.857) -- 0:02:02 181000 -- (-2330.420) [-2332.015] (-2329.548) (-2329.968) * [-2333.905] (-2333.344) (-2331.637) (-2331.793) -- 0:02:02 181500 -- (-2333.056) (-2330.615) (-2333.002) [-2334.787] * (-2329.721) (-2332.049) [-2331.576] (-2336.399) -- 0:02:01 182000 -- (-2334.265) [-2327.638] (-2330.890) (-2329.365) * (-2334.677) (-2332.424) [-2331.934] (-2333.459) -- 0:02:01 182500 -- (-2336.530) [-2330.722] (-2335.057) (-2336.741) * (-2336.387) [-2330.923] (-2336.051) (-2336.756) -- 0:02:05 183000 -- (-2332.175) (-2336.347) (-2333.951) [-2334.452] * (-2330.550) [-2329.644] (-2330.280) (-2336.675) -- 0:02:05 183500 -- (-2332.314) [-2333.748] (-2338.790) (-2329.067) * (-2336.097) [-2326.269] (-2333.265) (-2334.454) -- 0:02:04 184000 -- (-2339.010) (-2333.530) [-2332.101] (-2335.904) * (-2331.551) (-2332.134) [-2336.861] (-2331.396) -- 0:02:04 184500 -- [-2338.913] (-2329.044) (-2340.257) (-2330.783) * (-2329.531) (-2331.206) [-2330.338] (-2335.547) -- 0:02:03 185000 -- (-2328.926) [-2333.731] (-2333.532) (-2331.714) * (-2328.840) [-2327.939] (-2335.264) (-2333.142) -- 0:02:03 Average standard deviation of split frequencies: 0.000000 185500 -- [-2327.305] (-2330.672) (-2332.626) (-2337.218) * (-2331.972) (-2333.691) (-2330.859) [-2329.655] -- 0:02:02 186000 -- (-2332.943) (-2329.638) (-2330.163) [-2325.709] * (-2330.139) (-2327.297) [-2328.846] (-2333.823) -- 0:02:02 186500 -- (-2332.525) (-2335.301) [-2330.941] (-2328.788) * [-2333.523] (-2333.021) (-2327.447) (-2330.384) -- 0:02:02 187000 -- (-2335.814) (-2332.005) (-2325.967) [-2329.723] * (-2339.445) (-2330.239) (-2331.715) [-2334.599] -- 0:02:01 187500 -- [-2333.935] (-2333.081) (-2331.152) (-2327.245) * [-2329.096] (-2328.285) (-2332.891) (-2337.568) -- 0:02:01 188000 -- (-2333.539) (-2334.957) [-2327.031] (-2340.270) * (-2337.705) (-2332.581) [-2330.191] (-2330.526) -- 0:02:00 188500 -- (-2336.357) (-2344.490) (-2330.059) [-2334.344] * (-2335.758) [-2335.566] (-2334.547) (-2334.343) -- 0:02:00 189000 -- (-2327.504) (-2330.550) (-2334.548) [-2331.541] * (-2333.216) (-2330.489) (-2330.508) [-2337.348] -- 0:02:04 189500 -- [-2333.443] (-2330.131) (-2326.500) (-2331.515) * (-2331.527) [-2327.670] (-2332.081) (-2333.886) -- 0:02:04 190000 -- [-2334.245] (-2339.017) (-2331.519) (-2336.636) * (-2328.485) (-2332.016) [-2329.871] (-2334.201) -- 0:02:03 Average standard deviation of split frequencies: 0.000000 190500 -- [-2327.727] (-2332.327) (-2331.416) (-2329.040) * [-2333.584] (-2332.778) (-2334.486) (-2329.831) -- 0:02:03 191000 -- (-2331.562) (-2328.604) [-2337.146] (-2334.124) * (-2335.838) (-2333.735) [-2329.415] (-2330.602) -- 0:02:02 191500 -- (-2330.924) (-2326.862) (-2333.889) [-2326.294] * (-2334.051) (-2339.098) (-2340.009) [-2337.108] -- 0:02:02 192000 -- (-2333.830) [-2329.853] (-2328.812) (-2332.597) * (-2331.650) [-2332.195] (-2339.118) (-2335.199) -- 0:02:02 192500 -- (-2338.732) (-2331.997) [-2326.629] (-2333.657) * (-2331.457) (-2336.718) [-2337.747] (-2331.821) -- 0:02:01 193000 -- (-2330.525) (-2333.223) (-2333.809) [-2334.628] * [-2331.323] (-2337.414) (-2329.733) (-2342.231) -- 0:02:01 193500 -- (-2339.282) (-2332.502) (-2327.670) [-2326.612] * (-2332.245) [-2329.501] (-2328.814) (-2328.294) -- 0:02:00 194000 -- (-2335.543) (-2335.473) [-2328.203] (-2330.728) * (-2332.591) (-2336.113) [-2333.371] (-2333.374) -- 0:02:00 194500 -- (-2331.174) (-2338.387) [-2329.187] (-2328.731) * (-2330.714) (-2329.155) (-2332.623) [-2329.995] -- 0:02:00 195000 -- (-2332.339) [-2334.212] (-2330.573) (-2340.339) * [-2330.724] (-2335.703) (-2335.421) (-2334.566) -- 0:01:59 Average standard deviation of split frequencies: 0.000000 195500 -- (-2329.620) [-2335.355] (-2334.396) (-2337.361) * (-2336.442) (-2329.835) (-2334.170) [-2328.745] -- 0:02:03 196000 -- [-2333.857] (-2335.597) (-2331.199) (-2338.365) * (-2333.075) (-2334.664) (-2332.893) [-2332.144] -- 0:02:03 196500 -- (-2330.170) (-2335.838) [-2331.740] (-2333.591) * (-2333.713) (-2332.443) (-2328.123) [-2338.946] -- 0:02:02 197000 -- (-2329.459) (-2331.708) (-2328.463) [-2335.064] * (-2330.450) [-2328.048] (-2334.276) (-2343.928) -- 0:02:02 197500 -- (-2329.637) (-2329.605) (-2331.637) [-2332.276] * (-2331.276) [-2330.457] (-2328.006) (-2338.159) -- 0:02:01 198000 -- (-2336.877) (-2332.870) [-2337.051] (-2334.544) * (-2332.000) (-2331.499) (-2329.952) [-2332.494] -- 0:02:01 198500 -- (-2341.828) (-2329.922) [-2338.760] (-2332.351) * [-2333.742] (-2328.192) (-2333.392) (-2341.118) -- 0:02:01 199000 -- [-2331.997] (-2332.009) (-2336.094) (-2331.096) * (-2329.903) (-2331.849) (-2330.869) [-2337.457] -- 0:02:00 199500 -- [-2331.073] (-2330.263) (-2329.279) (-2328.434) * (-2343.097) (-2335.980) (-2329.732) [-2330.423] -- 0:02:00 200000 -- (-2336.548) [-2331.312] (-2334.521) (-2331.720) * (-2341.439) (-2334.361) [-2332.334] (-2335.360) -- 0:01:59 Average standard deviation of split frequencies: 0.000000 200500 -- (-2335.151) (-2332.557) (-2328.716) [-2334.777] * (-2336.930) (-2330.323) [-2337.269] (-2331.509) -- 0:01:59 201000 -- [-2331.240] (-2328.743) (-2336.207) (-2334.314) * (-2333.155) (-2332.631) [-2331.252] (-2328.318) -- 0:01:59 201500 -- (-2329.780) (-2333.557) [-2334.872] (-2337.213) * (-2331.667) (-2332.664) [-2330.678] (-2332.090) -- 0:01:58 202000 -- (-2331.966) [-2329.437] (-2334.813) (-2337.053) * (-2331.000) (-2340.714) [-2332.324] (-2334.863) -- 0:02:02 202500 -- [-2334.864] (-2333.114) (-2331.059) (-2330.019) * (-2333.383) (-2339.079) [-2332.586] (-2329.337) -- 0:02:02 203000 -- (-2334.167) (-2334.892) (-2332.458) [-2335.158] * (-2332.164) (-2333.530) (-2334.855) [-2330.409] -- 0:02:01 203500 -- (-2337.941) [-2330.805] (-2333.809) (-2331.120) * (-2335.946) (-2329.671) (-2327.679) [-2329.088] -- 0:02:01 204000 -- (-2335.237) (-2333.568) (-2333.237) [-2334.016] * (-2334.603) (-2332.237) (-2329.761) [-2330.641] -- 0:02:00 204500 -- (-2329.290) (-2331.695) (-2331.812) [-2334.442] * (-2331.630) (-2331.106) (-2330.504) [-2335.906] -- 0:02:00 205000 -- (-2332.390) (-2328.206) [-2329.319] (-2334.170) * (-2339.469) (-2339.126) [-2330.782] (-2335.883) -- 0:02:00 Average standard deviation of split frequencies: 0.000000 205500 -- (-2333.019) (-2333.727) [-2331.528] (-2334.912) * (-2342.897) [-2329.367] (-2332.407) (-2334.845) -- 0:01:59 206000 -- [-2336.678] (-2341.993) (-2333.453) (-2332.540) * (-2334.973) (-2334.347) (-2335.646) [-2327.059] -- 0:01:59 206500 -- (-2329.823) (-2339.731) (-2334.529) [-2332.439] * (-2332.013) (-2334.396) (-2333.643) [-2328.507] -- 0:01:59 207000 -- (-2332.898) (-2334.462) [-2331.534] (-2328.698) * [-2329.900] (-2333.738) (-2332.277) (-2330.090) -- 0:01:58 207500 -- (-2337.585) (-2338.497) (-2332.782) [-2333.307] * (-2330.402) [-2329.341] (-2326.720) (-2333.688) -- 0:01:58 208000 -- [-2336.722] (-2331.848) (-2330.236) (-2334.805) * (-2327.028) (-2329.621) [-2332.010] (-2333.243) -- 0:01:58 208500 -- (-2336.467) (-2334.815) (-2331.193) [-2327.767] * [-2328.940] (-2332.712) (-2332.671) (-2332.363) -- 0:02:01 209000 -- [-2334.256] (-2331.063) (-2335.910) (-2333.764) * (-2338.056) [-2330.318] (-2328.556) (-2333.720) -- 0:02:01 209500 -- (-2331.379) (-2334.354) [-2333.637] (-2334.955) * (-2333.614) [-2333.172] (-2333.369) (-2335.248) -- 0:02:00 210000 -- (-2330.732) (-2332.440) (-2335.076) [-2335.611] * (-2342.627) (-2332.294) [-2331.147] (-2329.996) -- 0:02:00 Average standard deviation of split frequencies: 0.000000 210500 -- (-2331.313) (-2332.435) [-2331.741] (-2333.210) * (-2332.150) [-2327.790] (-2336.954) (-2334.652) -- 0:02:00 211000 -- (-2330.353) (-2334.632) [-2328.985] (-2330.155) * (-2329.851) [-2329.478] (-2332.828) (-2330.205) -- 0:01:59 211500 -- (-2335.704) (-2332.634) (-2334.593) [-2331.349] * (-2333.839) [-2329.673] (-2334.338) (-2332.445) -- 0:01:59 212000 -- (-2340.912) (-2335.181) [-2331.901] (-2329.531) * (-2331.961) (-2336.462) (-2332.994) [-2331.085] -- 0:01:58 212500 -- (-2329.848) (-2329.477) [-2329.301] (-2335.424) * (-2331.092) [-2328.678] (-2333.190) (-2340.059) -- 0:01:58 213000 -- (-2328.820) (-2333.817) (-2336.247) [-2339.676] * (-2331.885) [-2329.891] (-2332.461) (-2333.293) -- 0:01:58 213500 -- (-2330.628) [-2327.486] (-2333.977) (-2332.995) * (-2337.677) (-2332.587) [-2334.203] (-2332.599) -- 0:01:57 214000 -- (-2330.993) (-2334.169) (-2331.160) [-2336.945] * (-2333.060) (-2331.682) (-2332.355) [-2334.170] -- 0:01:57 214500 -- (-2329.363) [-2331.758] (-2328.919) (-2331.325) * [-2332.048] (-2327.278) (-2335.015) (-2335.975) -- 0:01:57 215000 -- [-2326.569] (-2330.464) (-2330.723) (-2334.269) * (-2331.338) [-2329.374] (-2335.884) (-2332.188) -- 0:02:00 Average standard deviation of split frequencies: 0.000000 215500 -- (-2339.028) (-2329.711) [-2326.821] (-2332.213) * (-2330.459) [-2332.026] (-2332.395) (-2338.571) -- 0:02:00 216000 -- (-2345.185) (-2329.081) [-2333.601] (-2331.310) * [-2333.296] (-2337.963) (-2335.536) (-2334.747) -- 0:01:59 216500 -- (-2338.531) (-2329.746) (-2337.363) [-2330.068] * [-2327.425] (-2337.150) (-2341.254) (-2327.288) -- 0:01:59 217000 -- (-2330.365) [-2331.057] (-2330.526) (-2333.221) * (-2333.572) (-2337.365) (-2339.568) [-2330.287] -- 0:01:59 217500 -- (-2334.606) [-2329.988] (-2330.902) (-2340.087) * (-2331.131) (-2334.270) (-2334.704) [-2330.788] -- 0:01:58 218000 -- [-2333.408] (-2333.450) (-2333.210) (-2331.818) * [-2331.053] (-2339.212) (-2329.333) (-2347.742) -- 0:01:58 218500 -- (-2329.587) (-2330.574) [-2327.834] (-2328.541) * (-2334.618) (-2335.785) (-2331.301) [-2334.458] -- 0:01:58 219000 -- [-2330.642] (-2335.220) (-2328.930) (-2331.208) * [-2334.018] (-2334.534) (-2327.465) (-2333.841) -- 0:01:57 219500 -- (-2337.552) [-2332.752] (-2326.552) (-2335.619) * [-2331.215] (-2333.968) (-2330.402) (-2334.810) -- 0:01:57 220000 -- (-2331.911) [-2336.108] (-2329.968) (-2330.056) * (-2327.078) (-2333.295) (-2341.378) [-2335.492] -- 0:01:56 Average standard deviation of split frequencies: 0.000000 220500 -- [-2334.370] (-2330.933) (-2333.906) (-2336.257) * (-2330.108) [-2331.860] (-2332.358) (-2332.193) -- 0:01:56 221000 -- (-2334.743) [-2332.416] (-2336.918) (-2334.622) * (-2328.905) (-2329.244) (-2328.385) [-2331.718] -- 0:01:56 221500 -- (-2334.791) (-2333.002) (-2336.113) [-2328.954] * (-2334.983) [-2331.818] (-2337.216) (-2336.514) -- 0:01:55 222000 -- [-2334.621] (-2331.787) (-2329.647) (-2329.695) * (-2333.005) (-2337.401) [-2336.479] (-2339.450) -- 0:01:59 222500 -- [-2332.558] (-2336.207) (-2334.356) (-2328.483) * (-2337.920) [-2336.101] (-2333.786) (-2331.389) -- 0:01:58 223000 -- (-2327.571) [-2337.671] (-2332.990) (-2335.481) * (-2333.785) [-2335.044] (-2333.010) (-2334.837) -- 0:01:58 223500 -- (-2331.915) [-2331.320] (-2328.709) (-2332.491) * (-2332.210) [-2329.604] (-2332.265) (-2339.229) -- 0:01:58 224000 -- (-2332.221) [-2328.391] (-2331.175) (-2332.667) * [-2332.376] (-2330.805) (-2330.640) (-2343.055) -- 0:01:57 224500 -- (-2332.628) (-2334.052) (-2329.655) [-2334.995] * (-2334.671) (-2333.004) [-2335.131] (-2331.948) -- 0:01:57 225000 -- (-2343.676) (-2332.842) (-2334.371) [-2339.262] * (-2333.020) [-2327.696] (-2341.895) (-2335.810) -- 0:01:57 Average standard deviation of split frequencies: 0.000000 225500 -- (-2334.488) [-2333.873] (-2332.885) (-2341.305) * (-2331.771) (-2328.000) [-2329.316] (-2338.004) -- 0:01:56 226000 -- [-2329.043] (-2331.476) (-2330.602) (-2341.477) * (-2331.130) [-2335.755] (-2330.422) (-2330.051) -- 0:01:56 226500 -- (-2330.228) (-2333.276) (-2328.362) [-2331.749] * (-2332.339) [-2330.254] (-2328.318) (-2336.527) -- 0:01:56 227000 -- (-2330.298) (-2332.080) (-2333.424) [-2328.244] * (-2334.898) (-2331.696) (-2334.350) [-2331.858] -- 0:01:55 227500 -- (-2333.722) [-2331.443] (-2330.820) (-2335.952) * [-2332.828] (-2330.653) (-2337.028) (-2335.270) -- 0:01:55 228000 -- [-2329.358] (-2332.797) (-2336.618) (-2333.061) * (-2334.245) (-2333.056) (-2338.098) [-2330.371] -- 0:01:55 228500 -- (-2332.020) (-2333.421) (-2333.834) [-2330.693] * (-2335.553) [-2329.234] (-2333.419) (-2333.122) -- 0:01:58 229000 -- (-2336.015) [-2334.162] (-2333.953) (-2330.151) * (-2334.031) (-2330.146) (-2332.218) [-2328.488] -- 0:01:57 229500 -- (-2334.290) (-2328.759) [-2337.339] (-2333.240) * (-2332.365) [-2336.545] (-2333.105) (-2328.371) -- 0:01:57 230000 -- (-2333.844) [-2330.764] (-2337.936) (-2335.633) * (-2334.266) (-2335.226) [-2331.051] (-2333.192) -- 0:01:57 Average standard deviation of split frequencies: 0.000000 230500 -- (-2336.237) (-2328.773) [-2340.297] (-2328.799) * (-2332.182) (-2332.873) [-2328.121] (-2327.586) -- 0:01:56 231000 -- (-2333.492) (-2329.257) [-2329.656] (-2330.164) * [-2329.523] (-2335.647) (-2328.032) (-2328.329) -- 0:01:56 231500 -- (-2333.318) (-2331.898) [-2326.560] (-2341.232) * (-2333.365) (-2331.202) [-2333.993] (-2336.239) -- 0:01:56 232000 -- (-2335.209) [-2334.157] (-2331.159) (-2336.366) * [-2331.676] (-2333.179) (-2331.570) (-2337.411) -- 0:01:55 232500 -- [-2331.619] (-2336.175) (-2329.281) (-2342.529) * (-2330.658) (-2332.631) (-2339.387) [-2335.545] -- 0:01:55 233000 -- (-2333.363) (-2333.329) (-2328.547) [-2334.589] * (-2327.621) [-2326.807] (-2331.998) (-2339.280) -- 0:01:55 233500 -- [-2337.560] (-2337.816) (-2332.393) (-2338.079) * [-2330.378] (-2336.027) (-2332.441) (-2336.086) -- 0:01:54 234000 -- (-2343.105) [-2327.962] (-2335.554) (-2332.920) * (-2336.154) [-2335.261] (-2334.158) (-2333.514) -- 0:01:54 234500 -- (-2326.732) (-2327.424) (-2340.800) [-2338.475] * (-2331.683) (-2329.956) [-2327.180] (-2330.161) -- 0:01:54 235000 -- (-2331.577) [-2330.291] (-2331.535) (-2332.701) * (-2334.778) (-2326.136) [-2332.203] (-2330.054) -- 0:01:57 Average standard deviation of split frequencies: 0.000000 235500 -- (-2334.957) [-2329.017] (-2334.779) (-2331.744) * (-2337.330) (-2335.949) [-2329.989] (-2331.989) -- 0:01:56 236000 -- (-2331.933) (-2333.712) (-2333.098) [-2331.707] * (-2330.689) (-2333.393) [-2329.555] (-2332.973) -- 0:01:56 236500 -- (-2331.487) [-2332.569] (-2337.224) (-2336.197) * (-2330.274) (-2329.868) (-2333.471) [-2332.606] -- 0:01:56 237000 -- (-2339.514) (-2334.738) (-2334.075) [-2334.312] * [-2329.403] (-2333.324) (-2335.152) (-2335.754) -- 0:01:55 237500 -- (-2338.079) [-2332.113] (-2331.614) (-2346.586) * (-2337.342) [-2329.516] (-2340.392) (-2340.609) -- 0:01:55 238000 -- (-2330.112) (-2333.854) (-2334.483) [-2328.746] * [-2332.235] (-2328.156) (-2330.674) (-2331.738) -- 0:01:55 238500 -- (-2331.967) (-2332.229) (-2337.118) [-2331.805] * (-2330.815) (-2330.256) [-2333.201] (-2327.773) -- 0:01:54 239000 -- (-2332.025) (-2332.983) (-2334.339) [-2331.501] * (-2333.027) (-2336.542) (-2332.139) [-2331.792] -- 0:01:54 239500 -- (-2332.594) [-2330.123] (-2334.173) (-2332.459) * (-2330.906) (-2332.330) [-2334.439] (-2327.420) -- 0:01:54 240000 -- (-2332.187) (-2330.370) [-2336.863] (-2330.962) * (-2331.754) [-2333.396] (-2337.568) (-2328.305) -- 0:01:53 Average standard deviation of split frequencies: 0.000000 240500 -- (-2330.237) (-2334.461) (-2334.983) [-2331.428] * [-2333.718] (-2339.655) (-2327.973) (-2326.974) -- 0:01:53 241000 -- (-2330.198) [-2332.835] (-2335.769) (-2327.737) * (-2334.232) (-2330.860) [-2336.399] (-2325.973) -- 0:01:53 241500 -- (-2331.206) (-2331.688) (-2333.027) [-2333.576] * (-2333.930) (-2334.040) (-2335.642) [-2331.018] -- 0:01:53 242000 -- (-2329.332) (-2329.772) [-2331.348] (-2335.074) * (-2329.017) [-2331.762] (-2333.654) (-2332.298) -- 0:01:55 242500 -- [-2328.717] (-2329.124) (-2331.158) (-2331.975) * (-2327.010) (-2333.400) [-2327.544] (-2338.029) -- 0:01:55 243000 -- (-2334.704) [-2330.233] (-2332.855) (-2331.261) * [-2328.972] (-2333.496) (-2334.997) (-2334.859) -- 0:01:55 243500 -- (-2341.783) (-2334.375) [-2334.405] (-2338.027) * (-2333.549) (-2330.948) (-2332.812) [-2331.021] -- 0:01:54 244000 -- (-2330.874) (-2334.961) (-2338.431) [-2336.114] * (-2334.975) [-2335.490] (-2329.424) (-2334.806) -- 0:01:54 244500 -- (-2331.096) [-2331.261] (-2331.424) (-2334.323) * (-2334.923) (-2329.858) [-2332.982] (-2336.076) -- 0:01:54 245000 -- [-2337.253] (-2330.840) (-2330.741) (-2332.600) * [-2330.693] (-2332.069) (-2330.682) (-2336.290) -- 0:01:54 Average standard deviation of split frequencies: 0.000000 245500 -- (-2332.117) (-2329.846) (-2328.984) [-2334.965] * (-2331.710) [-2334.109] (-2330.008) (-2333.993) -- 0:01:53 246000 -- (-2329.937) [-2332.135] (-2333.111) (-2333.854) * (-2328.838) (-2331.255) [-2335.205] (-2334.690) -- 0:01:53 246500 -- [-2331.190] (-2330.575) (-2330.177) (-2332.275) * (-2334.782) (-2327.874) (-2336.310) [-2328.917] -- 0:01:53 247000 -- (-2336.780) [-2327.943] (-2327.347) (-2333.829) * [-2333.838] (-2330.516) (-2330.531) (-2334.930) -- 0:01:52 247500 -- (-2328.483) (-2332.929) [-2331.319] (-2335.950) * [-2330.015] (-2330.467) (-2332.212) (-2336.359) -- 0:01:52 248000 -- (-2332.154) [-2331.089] (-2329.736) (-2350.492) * (-2331.207) [-2329.881] (-2329.152) (-2339.448) -- 0:01:52 248500 -- (-2334.141) (-2334.581) [-2330.756] (-2341.239) * (-2331.090) (-2332.565) [-2327.901] (-2331.700) -- 0:01:54 249000 -- [-2337.205] (-2333.360) (-2335.394) (-2331.860) * [-2333.117] (-2337.426) (-2332.237) (-2339.675) -- 0:01:54 249500 -- (-2333.391) (-2331.657) (-2330.834) [-2333.352] * [-2335.342] (-2335.836) (-2332.472) (-2333.479) -- 0:01:54 250000 -- (-2336.613) [-2331.054] (-2335.371) (-2339.034) * (-2328.346) [-2334.667] (-2337.458) (-2328.784) -- 0:01:54 Average standard deviation of split frequencies: 0.000000 250500 -- (-2333.120) (-2333.798) [-2333.772] (-2332.200) * [-2338.914] (-2328.850) (-2335.757) (-2333.303) -- 0:01:53 251000 -- [-2335.999] (-2334.316) (-2332.103) (-2335.317) * (-2330.256) (-2332.863) (-2338.732) [-2333.257] -- 0:01:53 251500 -- (-2331.217) (-2330.657) (-2326.711) [-2335.420] * (-2333.245) [-2336.519] (-2333.360) (-2330.789) -- 0:01:53 252000 -- (-2329.053) (-2343.211) (-2326.165) [-2329.915] * (-2332.034) (-2337.366) [-2330.093] (-2336.526) -- 0:01:52 252500 -- (-2334.554) (-2332.510) (-2333.033) [-2330.764] * [-2327.749] (-2331.986) (-2335.111) (-2337.324) -- 0:01:52 253000 -- [-2331.547] (-2331.126) (-2331.296) (-2334.827) * (-2338.091) (-2329.719) (-2336.480) [-2336.020] -- 0:01:52 253500 -- [-2329.375] (-2332.254) (-2343.213) (-2330.125) * (-2331.728) [-2333.910] (-2334.990) (-2337.190) -- 0:01:51 254000 -- (-2332.645) [-2329.826] (-2329.433) (-2334.992) * (-2340.702) (-2333.406) [-2325.813] (-2337.630) -- 0:01:51 254500 -- (-2331.280) [-2330.349] (-2332.786) (-2332.621) * (-2339.888) (-2330.522) (-2327.253) [-2331.010] -- 0:01:51 255000 -- (-2331.754) (-2329.489) (-2330.901) [-2331.386] * (-2339.227) (-2337.478) (-2334.458) [-2330.778] -- 0:01:53 Average standard deviation of split frequencies: 0.000000 255500 -- [-2330.728] (-2330.354) (-2333.826) (-2329.092) * (-2333.705) (-2336.023) (-2333.480) [-2329.372] -- 0:01:53 256000 -- (-2332.516) (-2333.386) [-2340.260] (-2329.933) * (-2330.842) [-2330.483] (-2334.231) (-2332.790) -- 0:01:53 256500 -- (-2327.298) (-2343.492) (-2344.183) [-2334.945] * (-2329.159) [-2332.605] (-2334.348) (-2335.331) -- 0:01:53 257000 -- [-2331.951] (-2335.464) (-2334.399) (-2337.400) * [-2332.021] (-2327.239) (-2335.429) (-2329.592) -- 0:01:52 257500 -- (-2328.635) [-2336.113] (-2331.635) (-2331.161) * [-2331.278] (-2329.145) (-2330.047) (-2340.162) -- 0:01:52 258000 -- [-2329.499] (-2336.873) (-2333.019) (-2336.371) * (-2333.789) [-2329.910] (-2331.641) (-2334.947) -- 0:01:52 258500 -- [-2339.722] (-2339.787) (-2339.834) (-2332.010) * [-2330.948] (-2334.394) (-2335.632) (-2341.704) -- 0:01:51 259000 -- (-2336.524) (-2337.358) (-2339.590) [-2333.484] * (-2332.459) [-2337.324] (-2339.136) (-2335.412) -- 0:01:51 259500 -- [-2332.811] (-2334.095) (-2334.036) (-2334.548) * (-2335.916) [-2328.906] (-2331.286) (-2333.205) -- 0:01:51 260000 -- (-2335.196) (-2337.951) (-2331.740) [-2326.977] * [-2336.640] (-2334.236) (-2330.464) (-2331.416) -- 0:01:50 Average standard deviation of split frequencies: 0.000000 260500 -- (-2333.080) [-2333.433] (-2330.993) (-2331.321) * (-2334.130) (-2341.080) [-2328.741] (-2330.884) -- 0:01:50 261000 -- (-2335.485) [-2331.894] (-2328.402) (-2328.088) * (-2329.285) (-2340.449) (-2333.148) [-2329.089] -- 0:01:50 261500 -- [-2337.286] (-2332.450) (-2337.505) (-2328.815) * (-2329.919) [-2338.301] (-2327.630) (-2334.400) -- 0:01:52 262000 -- (-2334.099) (-2332.813) [-2334.407] (-2331.926) * (-2330.689) (-2341.720) (-2335.737) [-2333.742] -- 0:01:52 262500 -- (-2333.969) [-2340.490] (-2329.086) (-2337.821) * (-2336.715) [-2334.408] (-2334.936) (-2334.525) -- 0:01:52 263000 -- (-2333.307) [-2337.276] (-2329.756) (-2335.878) * (-2331.222) [-2328.427] (-2330.991) (-2333.582) -- 0:01:52 263500 -- (-2340.082) (-2335.812) (-2329.500) [-2329.194] * (-2330.673) (-2338.411) (-2328.921) [-2333.004] -- 0:01:51 264000 -- (-2331.073) (-2334.869) [-2333.820] (-2328.528) * (-2340.785) (-2329.749) (-2336.280) [-2334.078] -- 0:01:51 264500 -- (-2330.058) (-2330.213) [-2332.289] (-2332.613) * (-2335.053) [-2332.467] (-2328.739) (-2339.685) -- 0:01:51 265000 -- (-2336.100) (-2331.112) [-2330.998] (-2338.162) * [-2327.752] (-2330.295) (-2333.146) (-2335.069) -- 0:01:50 Average standard deviation of split frequencies: 0.000000 265500 -- (-2333.826) (-2335.553) (-2335.372) [-2332.325] * (-2325.406) (-2327.692) (-2333.521) [-2332.033] -- 0:01:50 266000 -- [-2329.732] (-2337.642) (-2339.868) (-2332.973) * (-2329.640) (-2332.368) (-2332.866) [-2335.990] -- 0:01:50 266500 -- (-2331.757) [-2338.223] (-2330.466) (-2333.369) * (-2333.362) [-2331.307] (-2333.401) (-2333.138) -- 0:01:50 267000 -- (-2343.439) (-2338.085) (-2334.925) [-2330.467] * (-2337.203) [-2329.756] (-2341.632) (-2332.276) -- 0:01:49 267500 -- (-2330.903) (-2331.273) (-2332.737) [-2331.834] * (-2342.512) [-2330.252] (-2329.471) (-2330.414) -- 0:01:49 268000 -- (-2330.989) (-2328.687) (-2337.668) [-2329.600] * (-2330.007) (-2332.275) (-2342.034) [-2328.546] -- 0:01:51 268500 -- [-2329.386] (-2336.046) (-2331.812) (-2332.631) * [-2339.093] (-2329.178) (-2338.735) (-2334.666) -- 0:01:51 269000 -- (-2334.623) (-2332.322) (-2332.290) [-2334.714] * (-2332.994) [-2327.514] (-2336.760) (-2330.381) -- 0:01:51 269500 -- (-2334.814) (-2336.471) [-2334.115] (-2334.159) * [-2335.834] (-2328.965) (-2342.003) (-2331.133) -- 0:01:51 270000 -- (-2332.226) (-2337.168) (-2336.833) [-2333.513] * (-2330.056) [-2331.522] (-2333.011) (-2331.090) -- 0:01:50 Average standard deviation of split frequencies: 0.000000 270500 -- (-2330.999) (-2334.374) [-2334.259] (-2332.773) * (-2331.201) (-2328.465) [-2335.092] (-2331.214) -- 0:01:50 271000 -- [-2330.770] (-2331.030) (-2332.236) (-2330.739) * (-2331.762) (-2328.175) [-2331.716] (-2332.393) -- 0:01:50 271500 -- (-2332.883) (-2326.818) [-2333.836] (-2333.207) * (-2332.013) [-2331.491] (-2333.829) (-2328.091) -- 0:01:50 272000 -- (-2334.099) [-2335.492] (-2329.017) (-2330.358) * [-2329.428] (-2341.962) (-2332.894) (-2336.543) -- 0:01:49 272500 -- (-2331.129) (-2332.969) (-2329.111) [-2332.613] * [-2334.256] (-2335.844) (-2327.898) (-2334.025) -- 0:01:49 273000 -- (-2335.526) [-2327.801] (-2337.811) (-2331.354) * [-2336.735] (-2333.972) (-2327.702) (-2331.377) -- 0:01:49 273500 -- (-2330.131) [-2336.209] (-2334.186) (-2329.878) * (-2342.242) [-2334.980] (-2327.764) (-2333.259) -- 0:01:48 274000 -- (-2335.101) [-2338.387] (-2334.924) (-2334.455) * [-2330.408] (-2332.726) (-2332.841) (-2340.473) -- 0:01:48 274500 -- (-2328.365) (-2331.205) [-2330.856] (-2331.082) * (-2335.101) [-2333.525] (-2328.558) (-2339.643) -- 0:01:51 275000 -- (-2328.937) (-2329.986) (-2333.890) [-2336.665] * (-2332.692) (-2332.945) [-2334.551] (-2331.756) -- 0:01:50 Average standard deviation of split frequencies: 0.000000 275500 -- (-2330.954) (-2329.452) [-2330.395] (-2332.485) * (-2339.802) [-2329.797] (-2333.455) (-2330.916) -- 0:01:50 276000 -- (-2333.675) (-2336.377) (-2337.186) [-2329.582] * (-2330.858) (-2341.540) [-2330.607] (-2331.958) -- 0:01:50 276500 -- (-2328.806) (-2332.849) (-2338.351) [-2332.473] * (-2332.438) [-2328.490] (-2331.803) (-2336.339) -- 0:01:49 277000 -- (-2329.448) (-2333.760) (-2331.217) [-2332.483] * (-2328.398) [-2335.277] (-2334.353) (-2334.947) -- 0:01:49 277500 -- (-2331.648) (-2335.967) (-2333.082) [-2331.676] * (-2332.487) [-2338.497] (-2330.290) (-2333.894) -- 0:01:49 278000 -- [-2334.648] (-2333.284) (-2336.831) (-2333.170) * [-2332.295] (-2330.389) (-2334.056) (-2333.193) -- 0:01:49 278500 -- [-2328.889] (-2337.582) (-2330.637) (-2330.578) * (-2340.483) [-2329.329] (-2337.149) (-2333.563) -- 0:01:48 279000 -- (-2332.406) (-2330.892) (-2331.077) [-2329.135] * (-2341.287) (-2330.438) [-2329.618] (-2324.047) -- 0:01:48 279500 -- (-2329.076) [-2330.297] (-2333.287) (-2339.146) * (-2330.681) (-2328.531) [-2330.130] (-2334.579) -- 0:01:48 280000 -- [-2329.777] (-2329.844) (-2331.360) (-2335.565) * (-2332.014) (-2337.099) (-2334.018) [-2337.156] -- 0:01:47 Average standard deviation of split frequencies: 0.000000 280500 -- [-2331.771] (-2339.198) (-2335.490) (-2334.611) * [-2335.733] (-2335.082) (-2327.378) (-2336.918) -- 0:01:47 281000 -- (-2332.873) [-2332.725] (-2328.640) (-2341.834) * (-2336.167) (-2332.464) [-2331.207] (-2329.939) -- 0:01:50 281500 -- (-2337.285) (-2329.563) (-2331.093) [-2332.244] * (-2343.484) (-2331.942) (-2336.029) [-2335.730] -- 0:01:49 282000 -- [-2332.054] (-2331.094) (-2331.117) (-2328.792) * (-2335.261) [-2332.396] (-2332.147) (-2335.973) -- 0:01:49 282500 -- (-2334.427) (-2327.113) [-2329.452] (-2335.026) * (-2332.372) [-2331.658] (-2336.226) (-2330.295) -- 0:01:49 283000 -- (-2332.252) (-2328.610) (-2328.907) [-2333.906] * [-2332.750] (-2331.813) (-2333.479) (-2334.104) -- 0:01:48 283500 -- [-2333.536] (-2334.816) (-2337.324) (-2331.939) * (-2335.671) [-2336.985] (-2332.714) (-2342.081) -- 0:01:48 284000 -- (-2331.857) [-2330.260] (-2334.913) (-2334.958) * (-2332.747) (-2336.278) [-2334.964] (-2326.071) -- 0:01:48 284500 -- (-2335.360) (-2331.682) (-2337.131) [-2327.780] * (-2339.622) (-2327.622) (-2335.035) [-2330.030] -- 0:01:48 285000 -- (-2332.166) (-2329.958) [-2330.756] (-2336.436) * [-2332.322] (-2333.228) (-2333.293) (-2332.719) -- 0:01:47 Average standard deviation of split frequencies: 0.000000 285500 -- (-2331.008) (-2329.705) [-2330.188] (-2333.960) * [-2329.499] (-2327.846) (-2329.511) (-2338.315) -- 0:01:47 286000 -- [-2335.685] (-2339.504) (-2330.048) (-2332.718) * [-2328.998] (-2328.015) (-2334.667) (-2335.280) -- 0:01:47 286500 -- (-2329.225) (-2332.802) [-2328.928] (-2333.041) * (-2329.280) (-2329.968) [-2330.327] (-2337.292) -- 0:01:47 287000 -- (-2327.924) (-2335.038) [-2330.258] (-2333.335) * (-2330.564) (-2336.987) (-2329.644) [-2335.028] -- 0:01:46 287500 -- (-2336.794) [-2335.255] (-2331.851) (-2327.158) * (-2331.402) [-2334.480] (-2336.370) (-2332.284) -- 0:01:46 288000 -- (-2333.863) (-2329.247) (-2330.319) [-2333.526] * (-2334.727) [-2331.896] (-2334.087) (-2333.790) -- 0:01:48 288500 -- (-2333.987) (-2328.820) (-2334.761) [-2328.083] * (-2344.003) (-2333.668) (-2332.554) [-2333.189] -- 0:01:48 289000 -- [-2334.432] (-2330.130) (-2334.407) (-2346.709) * [-2331.508] (-2344.134) (-2337.204) (-2333.715) -- 0:01:48 289500 -- (-2343.377) (-2331.616) [-2337.555] (-2331.934) * (-2340.963) (-2331.281) (-2330.483) [-2332.637] -- 0:01:47 290000 -- (-2333.851) (-2332.580) (-2332.727) [-2330.292] * (-2341.500) (-2336.409) (-2331.869) [-2334.129] -- 0:01:47 Average standard deviation of split frequencies: 0.000000 290500 -- (-2332.521) (-2334.710) [-2329.756] (-2332.629) * (-2334.067) (-2331.055) (-2340.532) [-2330.700] -- 0:01:47 291000 -- (-2332.796) (-2330.887) [-2329.296] (-2333.270) * (-2336.167) (-2338.664) [-2338.809] (-2333.987) -- 0:01:47 291500 -- (-2330.193) [-2332.801] (-2332.661) (-2331.287) * (-2336.550) (-2332.124) (-2340.547) [-2331.940] -- 0:01:46 292000 -- (-2334.130) (-2339.720) (-2334.400) [-2330.876] * [-2333.846] (-2343.488) (-2343.263) (-2331.537) -- 0:01:46 292500 -- [-2331.925] (-2330.651) (-2330.531) (-2344.437) * (-2335.923) (-2331.738) [-2336.910] (-2333.038) -- 0:01:46 293000 -- (-2342.780) [-2337.079] (-2329.030) (-2329.555) * (-2336.297) (-2337.377) (-2336.951) [-2329.780] -- 0:01:46 293500 -- [-2328.506] (-2329.747) (-2328.270) (-2330.932) * (-2344.488) [-2329.387] (-2341.479) (-2333.254) -- 0:01:45 294000 -- [-2332.186] (-2339.177) (-2331.263) (-2337.096) * [-2331.987] (-2331.993) (-2334.849) (-2332.519) -- 0:01:45 294500 -- (-2331.120) (-2335.296) [-2337.945] (-2333.261) * [-2328.660] (-2330.115) (-2335.195) (-2329.379) -- 0:01:47 295000 -- (-2327.309) (-2334.708) (-2331.218) [-2336.120] * (-2336.042) [-2332.410] (-2335.643) (-2336.840) -- 0:01:47 Average standard deviation of split frequencies: 0.000000 295500 -- (-2335.470) (-2335.637) [-2331.489] (-2330.493) * (-2332.806) (-2335.562) [-2330.586] (-2328.810) -- 0:01:47 296000 -- [-2332.674] (-2336.223) (-2335.556) (-2338.176) * (-2334.086) [-2331.610] (-2335.807) (-2332.193) -- 0:01:47 296500 -- (-2336.867) (-2331.523) [-2334.243] (-2333.501) * (-2333.832) (-2337.060) (-2336.151) [-2332.664] -- 0:01:46 297000 -- [-2332.681] (-2329.549) (-2335.443) (-2334.505) * (-2333.297) [-2327.557] (-2333.867) (-2330.016) -- 0:01:46 297500 -- (-2330.660) (-2335.254) (-2334.944) [-2335.815] * [-2334.590] (-2328.897) (-2328.496) (-2332.401) -- 0:01:46 298000 -- [-2334.364] (-2329.946) (-2330.179) (-2329.326) * (-2333.696) (-2327.648) (-2330.747) [-2332.652] -- 0:01:46 298500 -- [-2325.938] (-2332.323) (-2330.912) (-2333.561) * (-2341.096) [-2329.048] (-2330.863) (-2333.617) -- 0:01:45 299000 -- (-2332.162) [-2332.058] (-2329.459) (-2330.687) * (-2331.911) [-2331.830] (-2332.782) (-2331.987) -- 0:01:45 299500 -- (-2329.065) [-2331.034] (-2337.135) (-2333.018) * (-2335.661) [-2332.097] (-2325.548) (-2333.986) -- 0:01:45 300000 -- (-2335.469) (-2331.064) (-2334.059) [-2337.855] * (-2332.652) [-2327.193] (-2331.728) (-2332.446) -- 0:01:44 Average standard deviation of split frequencies: 0.000000 300500 -- [-2329.660] (-2334.008) (-2328.112) (-2334.420) * (-2333.364) (-2330.405) (-2330.037) [-2337.200] -- 0:01:44 301000 -- [-2333.586] (-2335.464) (-2332.461) (-2332.641) * (-2331.888) (-2335.772) [-2326.004] (-2333.679) -- 0:01:46 301500 -- [-2330.436] (-2330.750) (-2341.324) (-2333.891) * (-2342.663) (-2333.731) (-2334.328) [-2334.546] -- 0:01:46 302000 -- (-2329.135) (-2336.513) [-2330.689] (-2333.321) * (-2335.084) (-2330.540) (-2330.702) [-2332.132] -- 0:01:46 302500 -- (-2331.469) (-2329.553) (-2333.275) [-2330.850] * [-2331.027] (-2331.013) (-2337.997) (-2328.527) -- 0:01:46 303000 -- (-2330.781) (-2327.609) [-2331.363] (-2331.954) * (-2337.484) (-2334.519) [-2328.911] (-2334.555) -- 0:01:45 303500 -- (-2339.503) (-2333.997) [-2330.142] (-2341.207) * (-2332.722) (-2333.640) (-2329.081) [-2330.786] -- 0:01:45 304000 -- (-2332.696) (-2339.527) (-2332.934) [-2331.526] * (-2331.599) (-2332.078) (-2332.223) [-2330.947] -- 0:01:45 304500 -- (-2337.067) [-2328.098] (-2332.559) (-2330.837) * (-2329.257) (-2332.048) (-2330.960) [-2326.313] -- 0:01:45 305000 -- (-2327.891) (-2328.651) (-2332.508) [-2332.974] * [-2328.990] (-2336.370) (-2334.332) (-2333.698) -- 0:01:44 Average standard deviation of split frequencies: 0.000000 305500 -- (-2332.234) (-2332.869) (-2334.993) [-2331.044] * (-2334.155) (-2332.911) (-2333.954) [-2335.396] -- 0:01:44 306000 -- (-2335.291) [-2335.872] (-2333.387) (-2328.612) * (-2331.231) (-2328.285) [-2327.811] (-2328.089) -- 0:01:44 306500 -- (-2335.197) (-2336.967) [-2330.117] (-2334.267) * (-2328.367) (-2331.784) (-2333.772) [-2326.022] -- 0:01:44 307000 -- (-2332.286) (-2332.778) (-2331.870) [-2335.490] * (-2332.748) (-2332.165) [-2327.326] (-2334.248) -- 0:01:43 307500 -- (-2330.036) [-2329.428] (-2327.533) (-2327.493) * (-2331.517) (-2328.775) (-2327.067) [-2330.699] -- 0:01:45 308000 -- (-2336.675) [-2330.696] (-2331.209) (-2327.919) * (-2328.401) [-2330.596] (-2333.921) (-2336.142) -- 0:01:45 308500 -- (-2334.182) (-2331.544) [-2329.718] (-2332.392) * (-2336.942) (-2343.778) [-2328.397] (-2333.162) -- 0:01:45 309000 -- (-2338.463) [-2330.335] (-2336.954) (-2329.182) * (-2331.834) (-2333.187) [-2326.861] (-2333.294) -- 0:01:45 309500 -- (-2330.039) [-2325.595] (-2335.566) (-2332.695) * (-2332.002) (-2335.501) [-2334.715] (-2331.060) -- 0:01:44 310000 -- (-2332.355) (-2332.902) (-2340.631) [-2337.531] * (-2337.374) (-2327.778) (-2340.954) [-2336.810] -- 0:01:44 Average standard deviation of split frequencies: 0.000000 310500 -- (-2333.361) [-2329.020] (-2332.821) (-2339.304) * [-2333.010] (-2331.827) (-2331.977) (-2338.061) -- 0:01:44 311000 -- (-2337.133) [-2333.836] (-2336.524) (-2337.760) * [-2328.702] (-2345.383) (-2337.135) (-2329.471) -- 0:01:44 311500 -- (-2333.402) [-2337.184] (-2329.412) (-2337.525) * (-2328.273) (-2327.021) (-2337.725) [-2334.656] -- 0:01:43 312000 -- [-2331.772] (-2333.347) (-2329.999) (-2335.542) * [-2334.442] (-2344.212) (-2332.324) (-2339.048) -- 0:01:43 312500 -- (-2334.708) (-2329.226) [-2330.355] (-2334.800) * [-2336.489] (-2330.280) (-2333.579) (-2331.382) -- 0:01:43 313000 -- (-2331.035) [-2335.747] (-2332.612) (-2336.489) * (-2334.933) (-2331.855) [-2340.016] (-2339.305) -- 0:01:43 313500 -- (-2336.128) [-2339.503] (-2329.119) (-2336.131) * (-2335.525) [-2329.551] (-2333.267) (-2333.409) -- 0:01:42 314000 -- (-2342.321) (-2333.118) [-2332.657] (-2337.113) * (-2326.305) (-2335.465) (-2332.738) [-2331.204] -- 0:01:44 314500 -- (-2335.223) (-2335.413) (-2337.292) [-2331.597] * (-2333.571) [-2332.484] (-2339.606) (-2333.012) -- 0:01:44 315000 -- (-2336.311) [-2333.345] (-2336.171) (-2329.052) * (-2331.556) [-2334.888] (-2329.210) (-2342.111) -- 0:01:44 Average standard deviation of split frequencies: 0.000000 315500 -- [-2333.181] (-2329.993) (-2342.202) (-2334.439) * [-2330.339] (-2332.347) (-2335.483) (-2341.400) -- 0:01:44 316000 -- (-2329.219) (-2332.327) [-2332.115] (-2328.231) * [-2334.125] (-2331.775) (-2332.587) (-2328.384) -- 0:01:43 316500 -- [-2334.436] (-2330.417) (-2336.873) (-2327.721) * (-2334.453) [-2333.705] (-2328.454) (-2331.738) -- 0:01:43 317000 -- [-2330.685] (-2334.347) (-2339.142) (-2336.855) * (-2332.723) (-2332.507) (-2334.670) [-2333.835] -- 0:01:43 317500 -- (-2335.709) [-2329.082] (-2332.792) (-2336.242) * (-2333.099) (-2326.348) [-2329.488] (-2336.718) -- 0:01:43 318000 -- (-2331.895) [-2329.667] (-2333.539) (-2331.634) * [-2332.673] (-2331.852) (-2333.311) (-2335.692) -- 0:01:42 318500 -- (-2330.783) (-2329.698) (-2326.591) [-2338.607] * (-2337.334) [-2329.522] (-2337.564) (-2337.568) -- 0:01:42 319000 -- (-2331.571) [-2329.695] (-2330.338) (-2329.234) * [-2332.787] (-2330.232) (-2335.390) (-2338.205) -- 0:01:42 319500 -- (-2336.464) (-2333.579) [-2334.660] (-2333.991) * (-2333.059) [-2331.616] (-2328.955) (-2343.062) -- 0:01:42 320000 -- (-2331.913) (-2332.263) (-2332.649) [-2332.305] * (-2335.992) (-2329.256) (-2332.765) [-2340.621] -- 0:01:41 Average standard deviation of split frequencies: 0.000000 320500 -- [-2331.914] (-2330.845) (-2329.498) (-2338.190) * (-2336.255) (-2329.440) [-2327.951] (-2331.445) -- 0:01:43 321000 -- [-2328.889] (-2336.997) (-2328.735) (-2336.636) * (-2333.030) [-2328.778] (-2329.553) (-2330.866) -- 0:01:43 321500 -- (-2329.619) (-2332.026) (-2334.698) [-2331.650] * [-2332.554] (-2331.482) (-2342.963) (-2331.345) -- 0:01:43 322000 -- (-2337.957) [-2327.366] (-2335.030) (-2328.357) * (-2329.464) [-2331.094] (-2340.770) (-2329.700) -- 0:01:43 322500 -- (-2334.452) [-2327.436] (-2333.040) (-2334.700) * (-2330.725) (-2330.493) (-2333.220) [-2338.612] -- 0:01:42 323000 -- (-2337.112) (-2331.513) [-2331.975] (-2332.066) * [-2331.768] (-2336.057) (-2330.528) (-2332.764) -- 0:01:42 323500 -- (-2336.133) (-2331.453) [-2329.680] (-2337.189) * (-2332.728) [-2329.094] (-2332.881) (-2333.599) -- 0:01:42 324000 -- (-2328.892) (-2336.630) (-2329.741) [-2335.527] * (-2330.370) (-2335.113) (-2332.255) [-2340.415] -- 0:01:42 324500 -- (-2328.046) (-2338.561) [-2335.731] (-2327.443) * [-2335.559] (-2329.536) (-2331.192) (-2348.195) -- 0:01:42 325000 -- (-2331.880) (-2334.761) [-2336.892] (-2327.039) * (-2333.427) [-2331.638] (-2336.886) (-2347.459) -- 0:01:41 Average standard deviation of split frequencies: 0.000000 325500 -- (-2329.164) (-2334.559) [-2332.084] (-2335.772) * (-2335.423) (-2336.007) [-2330.975] (-2340.168) -- 0:01:41 326000 -- (-2335.641) (-2339.992) (-2331.676) [-2329.009] * (-2335.820) (-2335.364) [-2326.341] (-2336.974) -- 0:01:41 326500 -- [-2332.599] (-2331.581) (-2336.414) (-2329.472) * (-2336.065) [-2329.772] (-2336.905) (-2332.482) -- 0:01:41 327000 -- (-2326.663) [-2329.162] (-2329.911) (-2330.369) * (-2337.297) (-2332.456) [-2334.214] (-2336.565) -- 0:01:42 327500 -- (-2333.168) (-2336.920) [-2328.520] (-2335.783) * (-2327.046) (-2332.939) [-2332.686] (-2332.025) -- 0:01:42 328000 -- (-2332.942) [-2332.306] (-2330.766) (-2334.735) * (-2327.477) (-2329.503) [-2327.579] (-2344.901) -- 0:01:42 328500 -- (-2337.224) [-2334.998] (-2332.937) (-2334.898) * (-2334.981) (-2340.561) [-2326.831] (-2330.895) -- 0:01:42 329000 -- (-2332.759) [-2332.288] (-2330.060) (-2338.856) * (-2331.920) (-2335.626) (-2331.452) [-2330.660] -- 0:01:41 329500 -- (-2330.489) (-2334.246) (-2333.364) [-2333.392] * (-2330.970) (-2331.100) (-2336.209) [-2329.187] -- 0:01:41 330000 -- (-2328.119) (-2331.981) [-2335.205] (-2333.176) * [-2325.425] (-2338.197) (-2331.230) (-2332.955) -- 0:01:41 Average standard deviation of split frequencies: 0.000000 330500 -- (-2332.880) (-2341.137) (-2335.428) [-2332.243] * (-2330.587) [-2330.316] (-2329.625) (-2336.656) -- 0:01:41 331000 -- [-2333.805] (-2333.678) (-2334.255) (-2330.551) * (-2335.979) (-2335.784) [-2335.487] (-2332.725) -- 0:01:41 331500 -- (-2331.509) [-2337.551] (-2329.970) (-2345.004) * [-2331.111] (-2329.197) (-2332.106) (-2335.733) -- 0:01:40 332000 -- [-2331.513] (-2330.765) (-2329.024) (-2338.603) * [-2330.242] (-2336.741) (-2339.812) (-2333.707) -- 0:01:40 332500 -- [-2331.366] (-2341.600) (-2328.694) (-2334.532) * (-2331.895) (-2336.941) [-2334.689] (-2341.806) -- 0:01:40 333000 -- (-2333.111) [-2328.387] (-2334.024) (-2329.166) * (-2331.664) (-2331.735) (-2332.849) [-2329.046] -- 0:01:40 333500 -- (-2331.736) (-2337.480) (-2331.603) [-2329.576] * [-2330.244] (-2331.193) (-2332.219) (-2330.140) -- 0:01:41 334000 -- (-2340.015) [-2333.837] (-2335.321) (-2337.458) * (-2330.427) (-2329.255) (-2333.571) [-2331.458] -- 0:01:41 334500 -- (-2342.551) (-2329.313) (-2332.191) [-2334.243] * (-2338.851) (-2336.277) [-2329.349] (-2333.097) -- 0:01:41 335000 -- (-2340.712) (-2327.305) (-2330.087) [-2330.447] * (-2338.335) (-2336.627) [-2331.211] (-2333.723) -- 0:01:41 Average standard deviation of split frequencies: 0.000000 335500 -- (-2342.311) (-2330.165) (-2328.593) [-2333.917] * (-2333.036) (-2326.536) (-2329.408) [-2327.694] -- 0:01:41 336000 -- (-2332.068) [-2330.252] (-2326.877) (-2339.490) * (-2343.374) (-2329.772) [-2333.664] (-2328.356) -- 0:01:40 336500 -- (-2336.253) (-2332.448) (-2330.288) [-2330.233] * (-2335.822) (-2335.098) (-2328.602) [-2346.105] -- 0:01:40 337000 -- (-2329.797) [-2337.768] (-2336.699) (-2337.048) * [-2334.242] (-2332.966) (-2330.531) (-2336.695) -- 0:01:40 337500 -- (-2335.200) (-2331.337) (-2332.481) [-2328.722] * [-2333.380] (-2336.596) (-2336.546) (-2336.763) -- 0:01:40 338000 -- (-2332.084) (-2336.267) (-2330.476) [-2330.573] * [-2337.620] (-2334.555) (-2329.503) (-2347.384) -- 0:01:39 338500 -- (-2335.533) [-2336.091] (-2330.219) (-2331.638) * (-2330.691) (-2330.424) [-2330.686] (-2330.156) -- 0:01:39 339000 -- [-2332.645] (-2333.245) (-2334.073) (-2330.774) * (-2332.749) (-2331.334) [-2342.320] (-2330.027) -- 0:01:39 339500 -- (-2339.129) [-2330.784] (-2337.245) (-2330.027) * [-2333.163] (-2331.423) (-2331.707) (-2328.368) -- 0:01:39 340000 -- (-2337.696) [-2335.047] (-2335.528) (-2333.756) * (-2336.235) (-2334.847) (-2328.390) [-2327.388] -- 0:01:38 Average standard deviation of split frequencies: 0.000000 340500 -- [-2335.577] (-2331.733) (-2337.373) (-2337.814) * [-2330.434] (-2329.510) (-2332.287) (-2325.461) -- 0:01:40 341000 -- (-2333.591) (-2327.134) (-2340.880) [-2336.499] * (-2334.082) (-2329.497) (-2330.686) [-2328.685] -- 0:01:40 341500 -- [-2331.976] (-2332.939) (-2333.632) (-2341.261) * (-2334.223) (-2326.524) (-2341.209) [-2329.337] -- 0:01:40 342000 -- [-2329.007] (-2328.217) (-2333.195) (-2330.735) * (-2340.781) [-2331.560] (-2337.768) (-2333.427) -- 0:01:40 342500 -- (-2334.096) (-2331.440) (-2329.921) [-2330.142] * (-2328.876) (-2340.880) [-2336.065] (-2335.771) -- 0:01:39 343000 -- (-2337.466) (-2334.698) [-2327.963] (-2331.778) * [-2329.842] (-2331.464) (-2329.847) (-2335.341) -- 0:01:39 343500 -- (-2330.786) (-2329.157) (-2333.429) [-2333.047] * (-2327.015) (-2333.403) (-2332.096) [-2327.322] -- 0:01:39 344000 -- [-2338.060] (-2332.467) (-2337.124) (-2329.185) * (-2339.696) [-2334.280] (-2328.564) (-2332.588) -- 0:01:39 344500 -- (-2336.836) (-2338.733) (-2341.401) [-2332.495] * (-2336.685) [-2335.605] (-2332.820) (-2339.143) -- 0:01:38 345000 -- (-2332.396) (-2332.290) (-2340.970) [-2334.557] * (-2341.929) (-2331.174) (-2329.619) [-2327.678] -- 0:01:38 Average standard deviation of split frequencies: 0.000000 345500 -- [-2331.214] (-2332.777) (-2341.148) (-2336.967) * (-2334.698) (-2326.299) (-2336.310) [-2331.100] -- 0:01:38 346000 -- (-2330.667) (-2332.739) [-2334.029] (-2341.518) * [-2333.749] (-2330.907) (-2328.021) (-2332.686) -- 0:01:38 346500 -- [-2329.526] (-2337.344) (-2332.607) (-2337.637) * [-2328.229] (-2332.365) (-2330.474) (-2332.694) -- 0:01:38 347000 -- (-2331.348) (-2338.397) [-2331.884] (-2337.080) * (-2327.678) (-2330.343) [-2333.967] (-2337.526) -- 0:01:39 347500 -- (-2328.941) (-2333.824) (-2331.201) [-2334.316] * (-2328.536) (-2333.283) (-2331.354) [-2330.729] -- 0:01:39 348000 -- (-2337.750) (-2337.711) [-2337.835] (-2334.779) * (-2330.590) (-2334.588) [-2335.085] (-2333.321) -- 0:01:39 348500 -- [-2337.556] (-2343.151) (-2330.087) (-2339.820) * (-2331.599) (-2333.362) (-2332.858) [-2329.173] -- 0:01:39 349000 -- (-2342.341) [-2332.449] (-2332.069) (-2331.893) * [-2330.829] (-2341.481) (-2332.535) (-2334.136) -- 0:01:38 349500 -- (-2333.756) (-2340.890) [-2330.095] (-2332.825) * (-2332.635) (-2335.793) [-2335.332] (-2333.949) -- 0:01:38 350000 -- (-2327.640) (-2332.232) (-2335.237) [-2330.962] * [-2328.533] (-2331.744) (-2339.552) (-2328.484) -- 0:01:38 Average standard deviation of split frequencies: 0.000000 350500 -- (-2331.405) [-2337.624] (-2333.536) (-2344.143) * (-2340.225) [-2330.337] (-2326.135) (-2330.123) -- 0:01:38 351000 -- (-2332.488) (-2336.524) [-2333.577] (-2340.529) * (-2330.500) (-2328.038) (-2336.285) [-2335.529] -- 0:01:37 351500 -- (-2333.163) (-2330.508) [-2329.908] (-2330.843) * (-2329.680) [-2334.032] (-2331.364) (-2335.094) -- 0:01:37 352000 -- [-2330.112] (-2332.737) (-2332.697) (-2332.034) * (-2331.545) [-2344.985] (-2333.455) (-2332.068) -- 0:01:37 352500 -- (-2332.218) [-2327.845] (-2334.971) (-2336.421) * [-2340.394] (-2337.373) (-2332.670) (-2329.667) -- 0:01:37 353000 -- (-2337.993) (-2330.045) (-2334.223) [-2331.923] * (-2338.993) [-2335.133] (-2334.622) (-2329.864) -- 0:01:37 353500 -- (-2337.124) [-2326.846] (-2330.695) (-2332.744) * (-2332.054) [-2331.334] (-2329.343) (-2332.563) -- 0:01:38 354000 -- [-2329.912] (-2327.919) (-2335.792) (-2327.544) * (-2334.889) (-2335.991) [-2336.106] (-2333.445) -- 0:01:38 354500 -- [-2333.088] (-2340.401) (-2334.690) (-2330.246) * (-2328.950) [-2332.041] (-2335.681) (-2336.667) -- 0:01:38 355000 -- [-2330.985] (-2337.403) (-2342.250) (-2330.419) * (-2335.963) [-2332.191] (-2334.374) (-2338.873) -- 0:01:38 Average standard deviation of split frequencies: 0.000000 355500 -- [-2333.110] (-2331.346) (-2326.939) (-2333.863) * (-2331.090) (-2333.563) (-2329.287) [-2332.882] -- 0:01:37 356000 -- (-2334.665) (-2331.640) (-2331.457) [-2335.174] * (-2331.809) (-2338.884) [-2338.857] (-2339.578) -- 0:01:37 356500 -- (-2337.348) [-2330.560] (-2328.882) (-2328.368) * (-2330.855) (-2335.453) [-2331.015] (-2336.761) -- 0:01:37 357000 -- [-2336.504] (-2331.099) (-2334.092) (-2328.969) * (-2328.696) (-2340.392) (-2336.074) [-2331.886] -- 0:01:37 357500 -- [-2328.503] (-2336.405) (-2330.853) (-2333.367) * (-2327.887) (-2337.257) (-2329.862) [-2330.346] -- 0:01:37 358000 -- (-2333.161) (-2334.805) [-2338.131] (-2341.744) * (-2332.362) (-2334.609) (-2333.549) [-2334.762] -- 0:01:36 358500 -- [-2331.603] (-2329.637) (-2332.959) (-2342.510) * (-2336.832) [-2330.685] (-2333.265) (-2335.100) -- 0:01:36 359000 -- [-2336.181] (-2332.525) (-2331.279) (-2333.129) * (-2332.665) (-2335.606) (-2330.612) [-2328.727] -- 0:01:36 359500 -- (-2333.550) (-2338.417) [-2329.274] (-2330.031) * (-2331.599) (-2332.793) (-2336.246) [-2338.807] -- 0:01:36 360000 -- (-2331.306) [-2336.027] (-2328.431) (-2336.034) * (-2332.549) [-2329.660] (-2328.869) (-2335.200) -- 0:01:35 Average standard deviation of split frequencies: 0.000000 360500 -- [-2328.131] (-2336.591) (-2335.733) (-2333.488) * (-2328.773) [-2329.688] (-2336.059) (-2333.178) -- 0:01:37 361000 -- (-2332.128) [-2338.787] (-2337.743) (-2337.520) * (-2340.756) [-2330.315] (-2329.675) (-2333.143) -- 0:01:37 361500 -- (-2329.135) (-2343.878) (-2330.888) [-2332.504] * (-2333.718) [-2327.497] (-2330.904) (-2332.601) -- 0:01:37 362000 -- (-2330.772) (-2330.244) (-2331.216) [-2331.181] * [-2333.535] (-2327.376) (-2329.242) (-2332.792) -- 0:01:36 362500 -- [-2328.292] (-2331.460) (-2336.094) (-2339.885) * (-2331.259) (-2331.672) (-2332.215) [-2329.758] -- 0:01:36 363000 -- (-2328.470) [-2327.447] (-2330.159) (-2331.700) * (-2337.457) (-2336.413) (-2331.439) [-2331.298] -- 0:01:36 363500 -- (-2337.022) (-2334.325) (-2333.550) [-2329.871] * (-2331.250) (-2330.537) (-2331.430) [-2331.328] -- 0:01:36 364000 -- (-2334.997) [-2333.451] (-2330.713) (-2342.587) * (-2335.248) [-2334.150] (-2338.576) (-2328.332) -- 0:01:36 364500 -- (-2336.152) [-2329.003] (-2333.221) (-2332.518) * (-2333.205) (-2338.255) [-2333.338] (-2330.392) -- 0:01:35 365000 -- (-2331.362) (-2333.369) (-2336.318) [-2337.039] * (-2333.699) (-2330.752) (-2328.984) [-2332.966] -- 0:01:35 Average standard deviation of split frequencies: 0.000000 365500 -- (-2336.115) [-2335.638] (-2330.022) (-2333.909) * (-2333.089) (-2338.073) (-2334.769) [-2329.494] -- 0:01:35 366000 -- (-2331.815) (-2338.350) [-2327.336] (-2333.414) * [-2329.604] (-2332.152) (-2334.635) (-2337.566) -- 0:01:35 366500 -- [-2331.599] (-2327.787) (-2333.748) (-2332.752) * (-2331.243) (-2333.870) (-2334.457) [-2328.541] -- 0:01:35 367000 -- (-2330.021) [-2329.127] (-2337.018) (-2332.515) * [-2325.937] (-2335.388) (-2334.539) (-2332.139) -- 0:01:36 367500 -- (-2328.023) [-2328.916] (-2337.906) (-2332.815) * (-2332.556) [-2326.964] (-2332.601) (-2330.332) -- 0:01:36 368000 -- [-2330.357] (-2329.872) (-2332.385) (-2331.806) * (-2337.342) [-2330.619] (-2337.389) (-2333.527) -- 0:01:36 368500 -- (-2332.058) [-2335.072] (-2331.440) (-2329.308) * (-2335.706) (-2334.600) [-2329.859] (-2331.245) -- 0:01:35 369000 -- (-2333.295) (-2330.043) [-2335.902] (-2329.202) * (-2335.976) (-2331.292) [-2331.463] (-2327.401) -- 0:01:35 369500 -- (-2333.222) (-2337.550) [-2330.507] (-2335.135) * (-2334.552) (-2334.029) (-2333.446) [-2330.808] -- 0:01:35 370000 -- (-2334.969) (-2345.004) [-2334.253] (-2333.281) * (-2334.868) (-2330.374) [-2332.210] (-2328.296) -- 0:01:35 Average standard deviation of split frequencies: 0.000000 370500 -- (-2337.969) [-2330.457] (-2337.023) (-2335.840) * (-2331.281) (-2333.402) (-2339.849) [-2334.883] -- 0:01:35 371000 -- [-2329.795] (-2328.687) (-2339.505) (-2335.124) * (-2337.651) [-2328.827] (-2333.649) (-2330.641) -- 0:01:34 371500 -- [-2334.334] (-2332.520) (-2337.466) (-2335.124) * (-2330.320) (-2328.496) [-2329.000] (-2331.160) -- 0:01:34 372000 -- (-2334.986) [-2333.213] (-2345.017) (-2335.189) * (-2327.110) [-2330.612] (-2331.700) (-2332.628) -- 0:01:34 372500 -- [-2333.495] (-2337.258) (-2337.732) (-2335.170) * (-2338.530) [-2332.055] (-2334.052) (-2338.050) -- 0:01:34 373000 -- (-2332.969) (-2334.264) [-2334.912] (-2331.646) * [-2334.325] (-2334.138) (-2331.134) (-2335.442) -- 0:01:34 373500 -- [-2331.700] (-2330.435) (-2329.662) (-2333.730) * [-2334.800] (-2331.344) (-2329.835) (-2332.648) -- 0:01:35 374000 -- (-2332.808) [-2328.381] (-2331.183) (-2337.592) * (-2330.182) (-2336.004) [-2335.700] (-2330.755) -- 0:01:35 374500 -- [-2332.246] (-2329.797) (-2329.883) (-2331.225) * (-2335.208) [-2331.543] (-2327.332) (-2336.080) -- 0:01:35 375000 -- [-2334.320] (-2327.405) (-2336.071) (-2332.425) * [-2331.069] (-2340.764) (-2331.587) (-2333.880) -- 0:01:35 Average standard deviation of split frequencies: 0.000000 375500 -- [-2333.198] (-2338.063) (-2332.939) (-2333.036) * [-2329.453] (-2330.274) (-2327.218) (-2331.969) -- 0:01:34 376000 -- (-2333.694) (-2335.042) [-2333.466] (-2337.367) * (-2337.828) [-2330.957] (-2331.141) (-2336.134) -- 0:01:34 376500 -- [-2329.819] (-2332.105) (-2330.377) (-2329.586) * (-2332.998) [-2327.069] (-2329.371) (-2331.642) -- 0:01:34 377000 -- [-2328.905] (-2332.861) (-2329.298) (-2338.538) * (-2344.136) (-2333.616) [-2336.535] (-2334.854) -- 0:01:34 377500 -- (-2331.707) (-2337.504) [-2339.789] (-2330.090) * (-2332.954) (-2329.283) (-2337.927) [-2332.643] -- 0:01:33 378000 -- (-2330.990) (-2334.372) [-2334.133] (-2335.757) * [-2331.716] (-2327.137) (-2333.240) (-2337.018) -- 0:01:33 378500 -- (-2333.378) (-2332.040) (-2331.667) [-2328.005] * (-2328.219) (-2334.902) (-2331.142) [-2333.707] -- 0:01:33 379000 -- (-2331.479) [-2339.327] (-2332.801) (-2332.135) * [-2330.191] (-2337.743) (-2327.294) (-2333.102) -- 0:01:33 379500 -- [-2327.300] (-2333.428) (-2332.256) (-2333.380) * (-2330.393) (-2336.511) (-2327.871) [-2333.560] -- 0:01:33 380000 -- (-2337.356) [-2329.101] (-2328.669) (-2330.974) * [-2337.535] (-2351.811) (-2330.636) (-2336.259) -- 0:01:34 Average standard deviation of split frequencies: 0.000000 380500 -- (-2331.505) [-2330.425] (-2331.102) (-2339.185) * (-2333.114) [-2344.309] (-2331.671) (-2330.465) -- 0:01:34 381000 -- (-2333.549) (-2331.836) [-2330.658] (-2332.400) * (-2335.958) (-2337.114) (-2332.848) [-2331.897] -- 0:01:34 381500 -- (-2334.496) (-2330.565) (-2330.222) [-2327.735] * (-2329.228) (-2335.983) (-2341.571) [-2329.687] -- 0:01:34 382000 -- (-2330.849) (-2332.619) (-2328.771) [-2335.609] * (-2327.778) (-2337.667) [-2335.180] (-2330.669) -- 0:01:33 382500 -- [-2325.466] (-2336.318) (-2335.375) (-2335.932) * [-2327.796] (-2331.079) (-2329.834) (-2337.653) -- 0:01:33 383000 -- (-2339.701) (-2334.292) [-2333.378] (-2330.476) * [-2329.982] (-2330.038) (-2330.382) (-2341.534) -- 0:01:33 383500 -- (-2330.287) [-2334.635] (-2330.641) (-2334.743) * (-2332.198) (-2344.835) [-2334.119] (-2338.307) -- 0:01:33 384000 -- (-2331.588) [-2331.918] (-2335.159) (-2334.081) * (-2328.636) (-2345.394) (-2334.275) [-2330.752] -- 0:01:33 384500 -- (-2328.799) (-2330.040) (-2337.264) [-2328.488] * (-2333.001) (-2332.677) [-2333.009] (-2335.290) -- 0:01:32 385000 -- (-2330.638) (-2327.701) (-2332.270) [-2329.031] * (-2334.186) (-2331.076) [-2335.660] (-2335.147) -- 0:01:32 Average standard deviation of split frequencies: 0.000000 385500 -- (-2332.276) (-2337.109) (-2335.182) [-2333.527] * (-2332.365) [-2333.850] (-2337.859) (-2336.970) -- 0:01:32 386000 -- (-2330.408) (-2330.371) [-2335.611] (-2338.579) * [-2330.883] (-2336.552) (-2332.871) (-2336.530) -- 0:01:32 386500 -- [-2333.694] (-2330.345) (-2328.699) (-2334.270) * (-2334.221) [-2331.568] (-2330.511) (-2337.657) -- 0:01:33 387000 -- [-2330.039] (-2333.068) (-2330.632) (-2332.969) * (-2337.143) (-2336.617) [-2339.910] (-2338.429) -- 0:01:33 387500 -- (-2329.567) [-2329.333] (-2331.385) (-2332.470) * (-2335.358) [-2331.956] (-2345.456) (-2334.115) -- 0:01:33 388000 -- (-2331.066) (-2329.191) [-2326.520] (-2334.288) * (-2336.450) (-2336.915) [-2335.379] (-2332.782) -- 0:01:33 388500 -- (-2332.700) [-2329.807] (-2330.688) (-2330.418) * [-2328.312] (-2331.781) (-2333.039) (-2330.278) -- 0:01:32 389000 -- [-2341.313] (-2333.148) (-2342.110) (-2334.779) * (-2332.993) [-2331.826] (-2332.782) (-2334.754) -- 0:01:32 389500 -- [-2334.323] (-2331.209) (-2331.508) (-2330.737) * (-2334.188) [-2329.789] (-2329.378) (-2331.697) -- 0:01:32 390000 -- (-2335.004) [-2328.837] (-2336.577) (-2328.717) * (-2332.824) [-2329.611] (-2337.235) (-2331.827) -- 0:01:32 Average standard deviation of split frequencies: 0.000000 390500 -- (-2335.031) [-2328.115] (-2329.000) (-2334.428) * (-2329.599) (-2327.770) [-2333.376] (-2333.228) -- 0:01:32 391000 -- (-2333.114) (-2328.621) [-2329.433] (-2328.023) * (-2330.895) (-2333.971) [-2331.115] (-2331.446) -- 0:01:31 391500 -- [-2334.552] (-2333.155) (-2328.970) (-2332.209) * (-2333.809) (-2329.493) [-2329.914] (-2328.976) -- 0:01:31 392000 -- (-2336.221) (-2327.297) [-2329.348] (-2334.263) * [-2330.654] (-2328.031) (-2331.297) (-2336.112) -- 0:01:31 392500 -- [-2330.871] (-2332.830) (-2338.978) (-2327.273) * (-2328.108) [-2332.752] (-2332.835) (-2335.682) -- 0:01:31 393000 -- (-2331.909) [-2331.877] (-2332.206) (-2328.953) * [-2329.257] (-2334.877) (-2331.433) (-2340.188) -- 0:01:31 393500 -- (-2332.045) (-2330.147) (-2330.078) [-2331.442] * (-2332.837) [-2329.829] (-2331.876) (-2334.167) -- 0:01:32 394000 -- (-2337.443) (-2333.700) [-2333.861] (-2335.783) * (-2334.938) (-2333.206) [-2333.316] (-2335.736) -- 0:01:32 394500 -- (-2324.667) [-2332.943] (-2332.321) (-2338.878) * (-2332.392) (-2332.329) (-2329.900) [-2331.617] -- 0:01:32 395000 -- [-2332.089] (-2335.091) (-2336.655) (-2330.047) * [-2332.271] (-2335.261) (-2336.375) (-2333.451) -- 0:01:31 Average standard deviation of split frequencies: 0.000000 395500 -- (-2337.591) [-2338.686] (-2334.253) (-2331.227) * (-2331.698) [-2330.523] (-2330.796) (-2334.766) -- 0:01:31 396000 -- (-2332.601) (-2331.108) (-2329.767) [-2333.696] * [-2327.590] (-2336.496) (-2333.198) (-2335.537) -- 0:01:31 396500 -- (-2330.643) [-2333.364] (-2329.922) (-2332.346) * (-2334.777) [-2333.319] (-2328.232) (-2336.394) -- 0:01:31 397000 -- (-2330.846) (-2334.959) [-2331.208] (-2334.454) * (-2332.150) [-2334.331] (-2334.890) (-2335.109) -- 0:01:31 397500 -- [-2331.674] (-2331.378) (-2338.479) (-2336.557) * [-2333.701] (-2331.270) (-2338.872) (-2334.558) -- 0:01:30 398000 -- (-2331.104) [-2338.035] (-2333.466) (-2335.156) * (-2333.560) (-2329.946) (-2331.949) [-2334.644] -- 0:01:30 398500 -- (-2335.566) (-2333.864) (-2332.409) [-2333.264] * (-2327.811) (-2333.426) (-2332.525) [-2331.008] -- 0:01:30 399000 -- (-2336.134) [-2328.764] (-2341.207) (-2333.463) * (-2331.175) [-2333.529] (-2341.999) (-2332.551) -- 0:01:30 399500 -- [-2337.274] (-2335.195) (-2329.548) (-2332.287) * (-2333.374) [-2332.438] (-2339.721) (-2330.269) -- 0:01:30 400000 -- (-2335.507) [-2331.347] (-2330.285) (-2329.850) * (-2338.056) (-2333.049) [-2329.095] (-2332.376) -- 0:01:31 Average standard deviation of split frequencies: 0.000000 400500 -- (-2340.281) [-2330.238] (-2334.669) (-2330.958) * [-2334.891] (-2332.272) (-2330.620) (-2337.702) -- 0:01:31 401000 -- [-2329.275] (-2330.525) (-2330.496) (-2330.751) * [-2326.384] (-2334.733) (-2336.017) (-2329.660) -- 0:01:31 401500 -- (-2332.299) [-2337.553] (-2334.094) (-2330.829) * (-2332.745) [-2332.668] (-2333.686) (-2332.278) -- 0:01:30 402000 -- (-2331.745) (-2333.450) (-2329.597) [-2329.400] * (-2328.864) (-2334.060) (-2332.849) [-2331.210] -- 0:01:30 402500 -- (-2330.206) [-2331.295] (-2332.460) (-2329.493) * (-2330.177) (-2330.785) [-2330.513] (-2336.585) -- 0:01:30 403000 -- (-2329.062) (-2331.071) [-2330.119] (-2340.052) * [-2330.094] (-2330.153) (-2331.781) (-2331.589) -- 0:01:30 403500 -- (-2337.120) (-2334.377) (-2329.336) [-2334.350] * (-2330.369) (-2330.614) (-2327.837) [-2335.833] -- 0:01:30 404000 -- (-2334.324) [-2331.617] (-2336.023) (-2331.184) * (-2329.980) (-2334.568) [-2328.093] (-2332.036) -- 0:01:29 404500 -- (-2334.088) (-2332.443) [-2330.776] (-2336.989) * (-2334.917) (-2337.191) [-2334.335] (-2335.210) -- 0:01:29 405000 -- [-2326.703] (-2327.051) (-2330.599) (-2335.049) * (-2334.372) (-2333.943) (-2334.323) [-2336.648] -- 0:01:29 Average standard deviation of split frequencies: 0.000000 405500 -- (-2332.934) [-2332.896] (-2332.488) (-2334.272) * (-2334.377) (-2329.394) [-2329.524] (-2330.867) -- 0:01:29 406000 -- (-2335.549) (-2330.774) [-2331.723] (-2330.285) * (-2334.005) [-2333.807] (-2335.232) (-2335.593) -- 0:01:29 406500 -- (-2332.062) [-2332.059] (-2335.714) (-2331.397) * (-2340.291) (-2333.577) (-2332.566) [-2332.457] -- 0:01:30 407000 -- [-2332.645] (-2340.049) (-2331.127) (-2329.534) * (-2335.534) (-2333.624) [-2327.644] (-2331.550) -- 0:01:30 407500 -- [-2334.617] (-2336.466) (-2330.250) (-2334.643) * (-2332.539) (-2328.406) (-2331.944) [-2332.792] -- 0:01:30 408000 -- (-2335.000) (-2339.165) (-2336.259) [-2333.130] * [-2330.864] (-2334.267) (-2330.692) (-2329.322) -- 0:01:29 408500 -- [-2334.239] (-2330.246) (-2342.402) (-2331.490) * (-2330.786) (-2336.140) [-2331.745] (-2335.782) -- 0:01:29 409000 -- (-2334.357) (-2328.268) (-2335.156) [-2330.206] * (-2332.359) (-2335.261) (-2331.701) [-2328.794] -- 0:01:29 409500 -- (-2336.830) [-2330.426] (-2335.037) (-2330.590) * [-2327.887] (-2330.154) (-2332.915) (-2337.932) -- 0:01:29 410000 -- (-2330.694) [-2334.032] (-2326.406) (-2332.984) * [-2332.734] (-2334.204) (-2330.333) (-2330.770) -- 0:01:29 Average standard deviation of split frequencies: 0.000000 410500 -- [-2332.118] (-2328.580) (-2328.755) (-2346.008) * [-2336.018] (-2330.140) (-2329.420) (-2345.330) -- 0:01:29 411000 -- (-2336.970) [-2329.237] (-2329.843) (-2336.203) * (-2330.909) [-2331.024] (-2335.356) (-2336.048) -- 0:01:28 411500 -- [-2333.662] (-2335.895) (-2327.759) (-2336.839) * (-2334.033) (-2334.209) (-2334.442) [-2330.061] -- 0:01:28 412000 -- (-2330.282) (-2333.094) (-2327.833) [-2338.822] * (-2336.168) [-2330.052] (-2330.601) (-2332.044) -- 0:01:28 412500 -- (-2337.008) (-2330.516) [-2330.773] (-2334.309) * (-2336.309) (-2332.293) (-2333.041) [-2330.853] -- 0:01:28 413000 -- (-2340.378) (-2328.180) (-2334.209) [-2333.234] * (-2328.619) (-2337.743) (-2340.506) [-2331.535] -- 0:01:29 413500 -- (-2331.095) [-2335.216] (-2334.387) (-2333.143) * (-2331.743) (-2337.717) (-2338.964) [-2327.823] -- 0:01:29 414000 -- (-2328.477) (-2334.487) (-2331.852) [-2327.740] * (-2327.336) (-2328.764) (-2327.868) [-2329.688] -- 0:01:29 414500 -- (-2330.294) [-2330.153] (-2334.699) (-2334.446) * (-2333.415) (-2331.901) [-2326.057] (-2334.005) -- 0:01:28 415000 -- (-2333.465) [-2329.307] (-2335.698) (-2337.440) * (-2333.271) (-2328.387) [-2338.841] (-2331.457) -- 0:01:28 Average standard deviation of split frequencies: 0.000000 415500 -- (-2332.857) (-2326.753) [-2335.190] (-2330.577) * [-2335.851] (-2329.855) (-2332.688) (-2334.901) -- 0:01:28 416000 -- (-2329.416) (-2333.597) (-2333.779) [-2336.645] * (-2329.049) (-2335.740) [-2339.169] (-2339.034) -- 0:01:28 416500 -- [-2332.072] (-2333.964) (-2336.777) (-2338.720) * (-2335.108) [-2333.744] (-2333.105) (-2334.510) -- 0:01:28 417000 -- (-2333.298) (-2332.049) (-2341.166) [-2334.938] * (-2330.367) (-2336.022) (-2334.873) [-2329.357] -- 0:01:28 417500 -- (-2329.563) (-2329.648) (-2330.889) [-2329.431] * [-2336.275] (-2333.333) (-2340.538) (-2332.646) -- 0:01:27 418000 -- (-2332.586) (-2331.916) [-2328.162] (-2329.472) * (-2332.992) [-2333.239] (-2337.285) (-2329.732) -- 0:01:27 418500 -- (-2329.549) (-2334.034) (-2332.194) [-2336.617] * [-2331.443] (-2329.962) (-2341.340) (-2329.251) -- 0:01:27 419000 -- (-2333.488) (-2332.053) [-2330.227] (-2331.818) * (-2334.419) (-2328.441) [-2333.153] (-2338.383) -- 0:01:27 419500 -- (-2330.767) [-2330.628] (-2331.975) (-2336.148) * [-2331.357] (-2330.261) (-2331.217) (-2332.431) -- 0:01:28 420000 -- (-2334.639) (-2328.384) [-2333.451] (-2330.701) * (-2330.454) [-2328.281] (-2333.496) (-2335.579) -- 0:01:28 Average standard deviation of split frequencies: 0.000000 420500 -- (-2331.448) (-2331.218) [-2332.087] (-2331.145) * [-2331.486] (-2328.963) (-2337.378) (-2337.740) -- 0:01:28 421000 -- (-2331.553) [-2331.029] (-2328.342) (-2336.706) * (-2330.903) (-2327.331) (-2333.041) [-2330.223] -- 0:01:28 421500 -- (-2329.592) (-2329.286) [-2332.911] (-2340.944) * [-2333.451] (-2335.980) (-2336.797) (-2330.860) -- 0:01:27 422000 -- (-2329.883) (-2328.953) (-2330.579) [-2328.444] * (-2337.164) (-2331.492) (-2331.105) [-2334.280] -- 0:01:27 422500 -- (-2332.105) (-2329.315) [-2334.238] (-2328.970) * [-2332.316] (-2332.219) (-2338.233) (-2328.680) -- 0:01:27 423000 -- [-2329.575] (-2331.821) (-2333.644) (-2330.704) * (-2338.906) (-2340.432) (-2330.968) [-2334.179] -- 0:01:27 423500 -- (-2330.344) [-2333.851] (-2331.902) (-2332.301) * (-2334.912) (-2337.534) [-2332.121] (-2333.550) -- 0:01:27 424000 -- (-2330.966) (-2333.363) [-2331.312] (-2331.372) * (-2341.350) [-2335.416] (-2335.934) (-2335.196) -- 0:01:26 424500 -- (-2337.842) (-2329.432) (-2328.174) [-2332.215] * (-2331.926) (-2337.760) (-2330.611) [-2333.528] -- 0:01:26 425000 -- (-2333.283) (-2336.818) (-2333.509) [-2332.444] * (-2330.610) (-2337.808) [-2330.584] (-2329.303) -- 0:01:26 Average standard deviation of split frequencies: 0.000000 425500 -- (-2329.171) (-2335.365) (-2335.189) [-2330.618] * [-2333.540] (-2333.047) (-2328.087) (-2325.394) -- 0:01:26 426000 -- (-2328.614) (-2335.088) [-2336.706] (-2330.856) * (-2336.755) (-2339.708) [-2330.836] (-2330.420) -- 0:01:27 426500 -- (-2333.194) (-2338.429) (-2337.824) [-2336.411] * (-2335.163) (-2331.993) [-2330.429] (-2330.063) -- 0:01:27 427000 -- (-2333.511) (-2341.413) (-2333.514) [-2330.296] * [-2331.343] (-2336.259) (-2330.387) (-2332.389) -- 0:01:27 427500 -- [-2336.098] (-2337.015) (-2336.611) (-2334.088) * (-2334.516) [-2332.095] (-2332.547) (-2332.795) -- 0:01:27 428000 -- [-2332.041] (-2331.447) (-2335.536) (-2332.610) * (-2339.239) [-2333.449] (-2329.438) (-2333.669) -- 0:01:26 428500 -- (-2341.951) (-2336.415) [-2333.063] (-2328.974) * (-2348.254) [-2327.613] (-2332.941) (-2342.419) -- 0:01:26 429000 -- (-2330.249) [-2331.614] (-2333.456) (-2338.317) * (-2334.038) [-2329.075] (-2336.578) (-2333.165) -- 0:01:26 429500 -- [-2329.493] (-2335.477) (-2335.802) (-2339.676) * (-2333.610) (-2333.954) (-2336.674) [-2326.253] -- 0:01:26 430000 -- (-2332.204) (-2335.707) [-2335.092] (-2334.220) * (-2329.344) (-2333.219) (-2335.367) [-2330.270] -- 0:01:26 Average standard deviation of split frequencies: 0.000000 430500 -- (-2329.943) (-2333.361) (-2339.665) [-2334.666] * (-2336.550) (-2335.609) [-2328.914] (-2331.242) -- 0:01:25 431000 -- [-2329.156] (-2328.496) (-2330.560) (-2333.623) * (-2337.477) [-2330.960] (-2329.980) (-2330.911) -- 0:01:25 431500 -- (-2332.512) (-2327.666) (-2335.730) [-2330.719] * [-2335.675] (-2331.270) (-2330.203) (-2334.330) -- 0:01:25 432000 -- [-2333.442] (-2331.489) (-2338.557) (-2339.010) * (-2332.446) (-2330.049) [-2332.329] (-2333.339) -- 0:01:25 432500 -- (-2337.571) [-2330.257] (-2328.906) (-2330.609) * (-2331.485) [-2327.462] (-2332.788) (-2330.609) -- 0:01:25 433000 -- (-2332.447) (-2331.338) (-2333.389) [-2336.202] * (-2331.161) [-2334.386] (-2336.925) (-2344.734) -- 0:01:26 433500 -- (-2329.127) (-2329.513) (-2338.504) [-2330.697] * (-2330.999) [-2333.829] (-2342.243) (-2335.111) -- 0:01:26 434000 -- (-2334.972) (-2332.782) (-2328.711) [-2332.424] * [-2330.184] (-2329.355) (-2339.488) (-2334.000) -- 0:01:26 434500 -- (-2331.398) (-2333.516) (-2329.952) [-2328.913] * (-2333.231) (-2334.140) (-2328.902) [-2339.980] -- 0:01:25 435000 -- (-2329.660) (-2334.576) [-2329.894] (-2335.771) * (-2329.295) (-2335.698) [-2327.936] (-2338.906) -- 0:01:25 Average standard deviation of split frequencies: 0.000000 435500 -- (-2328.060) (-2328.452) (-2335.286) [-2330.929] * (-2333.000) (-2340.965) [-2332.465] (-2330.540) -- 0:01:25 436000 -- (-2331.948) (-2328.031) [-2331.108] (-2330.179) * (-2328.473) [-2334.658] (-2327.736) (-2339.019) -- 0:01:25 436500 -- (-2332.008) (-2332.849) (-2328.988) [-2331.569] * (-2332.642) [-2333.319] (-2331.246) (-2334.560) -- 0:01:25 437000 -- (-2333.982) (-2335.134) [-2335.264] (-2331.615) * (-2332.510) (-2332.303) [-2329.313] (-2332.906) -- 0:01:25 437500 -- [-2329.729] (-2329.489) (-2335.875) (-2333.081) * (-2329.236) (-2332.352) [-2332.673] (-2338.496) -- 0:01:24 438000 -- (-2332.815) (-2331.019) (-2335.396) [-2329.892] * [-2334.737] (-2331.435) (-2334.973) (-2339.854) -- 0:01:24 438500 -- (-2339.273) (-2336.709) [-2330.408] (-2334.311) * (-2338.306) (-2342.466) (-2332.749) [-2333.798] -- 0:01:24 439000 -- (-2337.812) (-2328.016) [-2327.037] (-2332.451) * (-2332.228) (-2336.321) (-2328.923) [-2331.556] -- 0:01:24 439500 -- (-2340.726) (-2328.903) (-2327.511) [-2336.991] * (-2336.800) [-2332.756] (-2332.876) (-2330.201) -- 0:01:25 440000 -- (-2332.336) [-2329.475] (-2333.292) (-2336.888) * (-2333.614) (-2336.805) (-2330.591) [-2329.985] -- 0:01:25 Average standard deviation of split frequencies: 0.000000 440500 -- (-2335.251) (-2333.095) [-2328.365] (-2332.653) * (-2332.139) (-2330.521) (-2335.855) [-2329.726] -- 0:01:25 441000 -- (-2337.384) (-2328.918) [-2334.320] (-2328.050) * (-2334.371) (-2332.099) [-2327.910] (-2329.036) -- 0:01:24 441500 -- (-2332.674) (-2328.494) [-2330.265] (-2337.288) * (-2332.053) [-2331.898] (-2335.331) (-2329.382) -- 0:01:24 442000 -- (-2331.443) (-2329.704) (-2335.201) [-2342.804] * (-2331.750) (-2335.576) [-2329.806] (-2340.668) -- 0:01:24 442500 -- (-2330.410) (-2325.843) (-2336.340) [-2331.795] * (-2333.016) (-2332.003) (-2335.162) [-2333.762] -- 0:01:24 443000 -- [-2333.247] (-2336.089) (-2331.753) (-2331.268) * [-2330.504] (-2331.920) (-2336.424) (-2336.169) -- 0:01:24 443500 -- (-2331.128) [-2332.218] (-2337.459) (-2328.101) * (-2335.905) [-2330.099] (-2338.005) (-2340.884) -- 0:01:24 444000 -- (-2329.258) (-2330.918) [-2336.849] (-2328.760) * (-2339.537) [-2334.156] (-2330.652) (-2340.558) -- 0:01:23 444500 -- (-2334.842) (-2337.067) [-2329.602] (-2330.248) * (-2332.543) (-2333.989) (-2338.024) [-2338.951] -- 0:01:23 445000 -- (-2335.929) [-2333.965] (-2329.583) (-2333.478) * (-2337.317) (-2336.719) [-2331.478] (-2342.590) -- 0:01:23 Average standard deviation of split frequencies: 0.000000 445500 -- (-2332.854) [-2333.784] (-2329.595) (-2337.177) * (-2336.678) (-2333.085) [-2330.238] (-2336.178) -- 0:01:23 446000 -- (-2330.588) [-2332.474] (-2333.223) (-2328.876) * (-2331.541) (-2330.318) (-2331.135) [-2330.747] -- 0:01:24 446500 -- (-2331.587) (-2328.820) (-2333.545) [-2334.774] * [-2330.954] (-2334.120) (-2333.106) (-2334.272) -- 0:01:24 447000 -- (-2328.676) [-2335.515] (-2331.117) (-2331.343) * [-2330.497] (-2334.144) (-2336.475) (-2343.973) -- 0:01:24 447500 -- (-2336.045) (-2330.634) (-2334.732) [-2331.014] * (-2337.112) [-2329.219] (-2333.133) (-2334.057) -- 0:01:23 448000 -- (-2336.674) [-2328.848] (-2332.680) (-2335.643) * (-2332.769) (-2331.973) [-2339.985] (-2335.258) -- 0:01:23 448500 -- (-2330.670) [-2332.807] (-2334.165) (-2330.805) * (-2334.052) [-2338.112] (-2339.589) (-2338.874) -- 0:01:23 449000 -- (-2331.151) (-2332.578) (-2337.050) [-2333.158] * (-2335.551) (-2328.758) (-2332.948) [-2331.018] -- 0:01:23 449500 -- (-2335.342) [-2330.625] (-2331.420) (-2328.902) * (-2334.993) [-2334.161] (-2333.021) (-2333.527) -- 0:01:23 450000 -- [-2330.592] (-2332.033) (-2337.219) (-2332.178) * (-2328.514) [-2334.223] (-2349.603) (-2330.877) -- 0:01:23 Average standard deviation of split frequencies: 0.000000 450500 -- (-2334.353) (-2331.197) [-2331.024] (-2337.498) * (-2332.052) [-2330.550] (-2338.491) (-2337.867) -- 0:01:22 451000 -- (-2333.946) [-2332.567] (-2331.797) (-2334.806) * (-2328.793) (-2334.592) (-2338.584) [-2332.867] -- 0:01:22 451500 -- [-2334.398] (-2333.092) (-2340.219) (-2330.153) * (-2336.368) [-2329.700] (-2336.204) (-2329.302) -- 0:01:22 452000 -- [-2328.602] (-2332.394) (-2329.407) (-2335.380) * (-2344.732) (-2333.377) [-2333.849] (-2331.393) -- 0:01:22 452500 -- (-2331.975) (-2341.352) [-2329.200] (-2337.795) * (-2339.877) [-2331.092] (-2343.687) (-2336.718) -- 0:01:23 453000 -- (-2330.966) (-2331.053) (-2332.343) [-2332.013] * (-2337.257) (-2329.786) (-2340.515) [-2327.752] -- 0:01:23 453500 -- (-2331.523) (-2334.961) (-2331.525) [-2331.672] * (-2331.296) [-2330.526] (-2332.480) (-2333.024) -- 0:01:23 454000 -- [-2327.580] (-2331.890) (-2326.044) (-2339.766) * (-2334.035) (-2332.633) [-2331.536] (-2333.221) -- 0:01:22 454500 -- (-2328.210) (-2340.005) (-2328.373) [-2330.037] * (-2334.709) (-2333.973) [-2332.632] (-2335.933) -- 0:01:22 455000 -- [-2329.141] (-2340.168) (-2332.109) (-2336.027) * (-2336.323) [-2338.502] (-2334.007) (-2331.254) -- 0:01:22 Average standard deviation of split frequencies: 0.000000 455500 -- (-2336.556) [-2329.902] (-2333.051) (-2337.368) * (-2333.833) [-2330.048] (-2328.706) (-2339.296) -- 0:01:22 456000 -- [-2334.386] (-2333.061) (-2332.554) (-2338.284) * [-2334.593] (-2343.427) (-2330.829) (-2334.110) -- 0:01:22 456500 -- (-2330.044) (-2335.761) [-2330.338] (-2334.823) * [-2341.608] (-2332.942) (-2332.643) (-2329.354) -- 0:01:22 457000 -- (-2335.753) (-2329.088) [-2337.719] (-2342.004) * (-2334.890) (-2337.573) [-2333.527] (-2329.206) -- 0:01:21 457500 -- (-2331.230) (-2334.924) (-2330.460) [-2338.530] * (-2333.227) (-2335.698) [-2332.718] (-2336.239) -- 0:01:21 458000 -- [-2331.074] (-2335.401) (-2338.098) (-2336.627) * (-2337.097) [-2333.255] (-2326.231) (-2327.103) -- 0:01:21 458500 -- (-2332.380) (-2331.064) (-2332.845) [-2335.990] * (-2334.894) (-2333.792) [-2331.658] (-2329.085) -- 0:01:21 459000 -- (-2329.041) (-2330.131) [-2330.133] (-2344.025) * [-2332.388] (-2335.073) (-2338.129) (-2328.267) -- 0:01:21 459500 -- [-2329.213] (-2330.205) (-2331.892) (-2342.630) * (-2342.628) (-2334.119) (-2331.508) [-2330.756] -- 0:01:22 460000 -- [-2332.448] (-2328.557) (-2334.454) (-2335.813) * (-2333.207) (-2336.853) [-2334.401] (-2337.133) -- 0:01:22 Average standard deviation of split frequencies: 0.000000 460500 -- [-2330.825] (-2332.887) (-2333.012) (-2332.905) * (-2339.277) (-2331.630) (-2331.484) [-2330.719] -- 0:01:22 461000 -- (-2330.682) (-2329.888) [-2332.344] (-2331.054) * (-2340.061) [-2327.568] (-2338.325) (-2330.167) -- 0:01:21 461500 -- (-2340.081) (-2339.005) [-2334.493] (-2336.931) * (-2341.572) (-2336.475) (-2335.297) [-2329.203] -- 0:01:21 462000 -- (-2331.854) (-2330.967) (-2335.672) [-2328.864] * (-2333.501) [-2332.806] (-2331.748) (-2327.922) -- 0:01:21 462500 -- [-2332.590] (-2331.729) (-2332.427) (-2334.380) * (-2333.714) (-2335.852) (-2337.187) [-2333.123] -- 0:01:21 463000 -- [-2329.808] (-2331.332) (-2336.344) (-2331.860) * (-2338.221) [-2327.370] (-2339.381) (-2335.891) -- 0:01:21 463500 -- (-2334.112) [-2334.131] (-2342.961) (-2331.044) * (-2328.783) (-2337.775) (-2337.805) [-2331.949] -- 0:01:21 464000 -- [-2336.911] (-2332.151) (-2339.403) (-2334.952) * (-2340.760) (-2337.203) [-2335.536] (-2331.706) -- 0:01:20 464500 -- [-2335.840] (-2333.720) (-2329.732) (-2333.577) * (-2326.676) (-2333.656) [-2330.488] (-2336.947) -- 0:01:20 465000 -- (-2341.645) (-2337.134) (-2329.236) [-2329.932] * (-2335.286) [-2329.329] (-2339.641) (-2329.919) -- 0:01:20 Average standard deviation of split frequencies: 0.000000 465500 -- (-2337.202) (-2333.097) [-2332.975] (-2329.964) * (-2331.909) (-2334.280) [-2335.114] (-2332.498) -- 0:01:20 466000 -- [-2334.100] (-2330.356) (-2330.218) (-2327.714) * [-2332.127] (-2336.867) (-2329.772) (-2331.529) -- 0:01:21 466500 -- (-2338.795) (-2332.794) (-2336.264) [-2328.283] * (-2336.065) (-2337.463) (-2336.622) [-2338.105] -- 0:01:21 467000 -- (-2337.151) (-2335.314) [-2331.779] (-2334.770) * (-2341.075) (-2335.633) (-2336.971) [-2332.542] -- 0:01:21 467500 -- [-2330.670] (-2332.469) (-2326.608) (-2327.708) * (-2335.279) [-2332.139] (-2333.614) (-2333.400) -- 0:01:20 468000 -- (-2332.987) (-2326.727) (-2331.320) [-2334.413] * [-2332.302] (-2339.582) (-2336.482) (-2333.514) -- 0:01:20 468500 -- [-2334.734] (-2337.318) (-2335.727) (-2335.321) * (-2336.829) (-2341.343) (-2332.201) [-2330.327] -- 0:01:20 469000 -- (-2331.741) (-2343.555) [-2335.394] (-2332.132) * (-2333.858) (-2334.700) (-2334.006) [-2332.122] -- 0:01:20 469500 -- [-2342.128] (-2340.660) (-2335.274) (-2330.605) * (-2332.966) (-2337.229) [-2330.811] (-2336.829) -- 0:01:20 470000 -- (-2340.287) [-2332.146] (-2334.210) (-2330.994) * (-2331.323) [-2326.809] (-2329.626) (-2328.268) -- 0:01:20 Average standard deviation of split frequencies: 0.000000 470500 -- (-2332.396) (-2335.302) (-2330.422) [-2333.810] * (-2330.831) [-2331.275] (-2332.011) (-2332.735) -- 0:01:19 471000 -- (-2334.503) (-2329.040) (-2330.837) [-2332.480] * (-2330.550) (-2329.539) (-2336.313) [-2333.264] -- 0:01:19 471500 -- (-2336.946) [-2332.035] (-2340.737) (-2333.997) * (-2328.293) (-2332.497) (-2335.358) [-2331.235] -- 0:01:19 472000 -- (-2331.666) (-2334.658) (-2334.443) [-2326.664] * (-2333.109) (-2329.922) [-2331.039] (-2332.322) -- 0:01:19 472500 -- (-2338.359) (-2336.085) (-2331.228) [-2334.435] * (-2333.936) (-2331.897) (-2336.171) [-2332.171] -- 0:01:20 473000 -- [-2326.145] (-2332.639) (-2337.967) (-2336.031) * (-2336.054) [-2328.422] (-2332.486) (-2333.000) -- 0:01:20 473500 -- (-2332.539) [-2330.456] (-2336.912) (-2334.508) * (-2328.840) [-2330.658] (-2333.404) (-2330.918) -- 0:01:20 474000 -- [-2332.478] (-2331.363) (-2335.015) (-2331.223) * [-2331.126] (-2334.219) (-2331.103) (-2329.906) -- 0:01:19 474500 -- [-2332.498] (-2330.538) (-2335.567) (-2336.533) * [-2336.599] (-2335.040) (-2334.836) (-2336.450) -- 0:01:19 475000 -- (-2332.504) [-2331.397] (-2333.846) (-2336.706) * (-2332.403) [-2329.860] (-2335.638) (-2332.734) -- 0:01:19 Average standard deviation of split frequencies: 0.000000 475500 -- [-2328.848] (-2330.207) (-2336.548) (-2330.483) * [-2329.767] (-2337.013) (-2331.499) (-2334.534) -- 0:01:19 476000 -- (-2333.696) [-2327.019] (-2332.695) (-2329.030) * [-2338.553] (-2332.762) (-2331.224) (-2336.273) -- 0:01:19 476500 -- (-2328.777) (-2328.077) (-2340.261) [-2329.086] * (-2338.805) (-2335.873) (-2331.308) [-2335.675] -- 0:01:19 477000 -- [-2334.702] (-2329.138) (-2333.047) (-2325.655) * (-2327.541) (-2337.224) (-2333.068) [-2335.714] -- 0:01:18 477500 -- [-2332.197] (-2330.271) (-2334.421) (-2329.157) * (-2338.444) (-2334.257) [-2332.506] (-2337.862) -- 0:01:18 478000 -- (-2338.179) (-2333.777) (-2330.887) [-2330.952] * (-2338.144) (-2340.038) (-2333.044) [-2332.973] -- 0:01:18 478500 -- (-2333.298) (-2333.850) (-2337.060) [-2332.433] * (-2333.838) [-2332.018] (-2333.052) (-2334.073) -- 0:01:18 479000 -- (-2329.786) (-2335.374) (-2328.907) [-2331.404] * (-2338.087) (-2334.453) [-2330.267] (-2333.736) -- 0:01:19 479500 -- [-2327.694] (-2327.530) (-2333.296) (-2337.759) * (-2329.474) (-2333.369) [-2336.242] (-2329.938) -- 0:01:19 480000 -- (-2337.697) (-2329.116) (-2338.825) [-2333.832] * (-2331.429) (-2335.864) (-2330.775) [-2331.930] -- 0:01:19 Average standard deviation of split frequencies: 0.000000 480500 -- (-2332.983) [-2336.676] (-2339.477) (-2334.593) * (-2335.199) (-2332.501) (-2337.724) [-2333.172] -- 0:01:18 481000 -- (-2344.918) (-2333.375) (-2340.596) [-2331.208] * (-2339.327) (-2337.342) (-2330.094) [-2331.378] -- 0:01:18 481500 -- (-2338.050) (-2329.861) (-2332.439) [-2330.141] * (-2333.477) (-2327.716) [-2327.104] (-2332.533) -- 0:01:18 482000 -- [-2337.597] (-2343.420) (-2339.321) (-2330.262) * [-2330.535] (-2329.968) (-2330.303) (-2338.094) -- 0:01:18 482500 -- (-2332.788) (-2332.818) (-2334.720) [-2330.671] * (-2329.387) (-2331.515) (-2328.980) [-2334.339] -- 0:01:18 483000 -- [-2329.650] (-2332.992) (-2330.332) (-2328.643) * [-2327.581] (-2327.263) (-2331.201) (-2334.853) -- 0:01:18 483500 -- (-2333.529) (-2331.568) (-2331.651) [-2330.272] * (-2334.900) (-2330.040) (-2339.690) [-2329.575] -- 0:01:17 484000 -- (-2333.967) (-2327.767) (-2332.248) [-2333.451] * (-2333.559) (-2325.379) (-2333.072) [-2337.579] -- 0:01:17 484500 -- (-2330.171) (-2335.245) (-2329.346) [-2328.737] * (-2333.355) (-2335.906) (-2332.373) [-2334.231] -- 0:01:17 485000 -- [-2326.510] (-2333.932) (-2329.935) (-2332.569) * (-2329.559) (-2330.569) (-2328.558) [-2329.278] -- 0:01:17 Average standard deviation of split frequencies: 0.000000 485500 -- (-2331.925) [-2330.375] (-2335.678) (-2330.353) * (-2332.446) (-2333.318) (-2329.810) [-2331.462] -- 0:01:18 486000 -- [-2328.662] (-2330.527) (-2329.085) (-2327.690) * (-2332.905) (-2335.967) (-2332.118) [-2329.661] -- 0:01:18 486500 -- (-2333.659) (-2337.086) [-2331.441] (-2334.035) * (-2337.898) (-2336.754) [-2330.887] (-2330.430) -- 0:01:18 487000 -- (-2336.948) (-2332.936) (-2334.794) [-2328.157] * (-2331.734) (-2332.009) (-2331.773) [-2331.659] -- 0:01:17 487500 -- [-2335.476] (-2337.235) (-2333.481) (-2330.114) * (-2334.431) (-2330.119) (-2332.625) [-2327.001] -- 0:01:17 488000 -- (-2327.313) [-2331.318] (-2332.221) (-2330.612) * (-2333.975) (-2333.417) (-2327.026) [-2327.707] -- 0:01:17 488500 -- (-2334.582) [-2331.356] (-2331.023) (-2332.648) * (-2327.651) (-2335.133) (-2329.597) [-2332.061] -- 0:01:17 489000 -- [-2329.691] (-2329.571) (-2333.692) (-2327.801) * (-2335.155) [-2333.613] (-2332.841) (-2331.500) -- 0:01:17 489500 -- (-2334.517) [-2334.191] (-2332.655) (-2330.831) * (-2336.631) (-2333.069) (-2327.591) [-2331.026] -- 0:01:17 490000 -- (-2336.467) (-2338.628) [-2332.376] (-2332.276) * [-2335.782] (-2341.166) (-2333.615) (-2333.562) -- 0:01:17 Average standard deviation of split frequencies: 0.000000 490500 -- (-2332.424) (-2338.490) [-2335.840] (-2334.117) * (-2329.588) (-2346.342) [-2326.546] (-2338.602) -- 0:01:16 491000 -- (-2328.370) (-2333.693) [-2335.706] (-2328.739) * [-2329.700] (-2331.691) (-2327.869) (-2341.492) -- 0:01:16 491500 -- [-2334.005] (-2333.472) (-2334.333) (-2337.424) * (-2336.668) (-2330.775) (-2329.390) [-2339.333] -- 0:01:16 492000 -- (-2335.720) (-2330.368) (-2327.613) [-2333.242] * (-2334.748) [-2328.748] (-2330.057) (-2328.839) -- 0:01:16 492500 -- (-2337.327) (-2337.880) (-2333.612) [-2331.743] * (-2334.700) (-2329.397) [-2331.960] (-2327.601) -- 0:01:17 493000 -- (-2338.156) (-2331.751) (-2332.328) [-2335.805] * (-2334.801) (-2331.691) (-2332.001) [-2326.499] -- 0:01:17 493500 -- [-2327.902] (-2333.339) (-2344.014) (-2332.823) * (-2329.997) [-2331.881] (-2330.293) (-2338.371) -- 0:01:16 494000 -- [-2332.400] (-2337.151) (-2333.236) (-2328.796) * (-2339.275) (-2337.605) (-2335.893) [-2331.913] -- 0:01:16 494500 -- (-2329.946) [-2337.630] (-2333.560) (-2331.497) * [-2328.757] (-2342.691) (-2334.899) (-2332.127) -- 0:01:16 495000 -- (-2332.686) (-2330.826) (-2329.516) [-2330.124] * (-2332.872) (-2332.521) [-2334.525] (-2334.729) -- 0:01:16 Average standard deviation of split frequencies: 0.000000 495500 -- [-2330.103] (-2333.662) (-2334.589) (-2327.427) * (-2335.337) (-2333.215) [-2334.791] (-2326.506) -- 0:01:16 496000 -- (-2334.088) (-2328.597) (-2333.947) [-2335.024] * (-2331.099) [-2333.980] (-2341.193) (-2329.283) -- 0:01:16 496500 -- (-2333.354) [-2333.822] (-2332.091) (-2335.447) * (-2330.162) (-2336.332) [-2332.948] (-2329.998) -- 0:01:16 497000 -- (-2330.155) (-2330.557) (-2331.460) [-2333.571] * (-2338.144) (-2331.444) (-2333.656) [-2335.270] -- 0:01:15 497500 -- (-2340.490) [-2328.703] (-2334.857) (-2334.709) * (-2334.220) [-2330.226] (-2331.864) (-2331.960) -- 0:01:15 498000 -- (-2343.961) (-2332.187) [-2331.500] (-2330.309) * (-2329.803) [-2327.603] (-2332.063) (-2335.039) -- 0:01:15 498500 -- (-2331.409) (-2327.306) (-2334.593) [-2331.223] * (-2338.422) (-2330.024) [-2332.736] (-2337.309) -- 0:01:15 499000 -- [-2334.773] (-2329.161) (-2332.712) (-2339.198) * [-2331.443] (-2330.880) (-2331.938) (-2332.669) -- 0:01:16 499500 -- (-2341.585) (-2334.168) (-2330.038) [-2332.705] * (-2326.986) [-2334.012] (-2340.120) (-2335.895) -- 0:01:16 500000 -- (-2338.124) (-2328.611) [-2335.024] (-2332.043) * [-2327.332] (-2334.758) (-2337.258) (-2338.297) -- 0:01:16 Average standard deviation of split frequencies: 0.000000 500500 -- (-2330.664) (-2331.838) (-2333.354) [-2334.579] * (-2341.974) [-2332.208] (-2337.214) (-2332.166) -- 0:01:15 501000 -- [-2334.566] (-2336.445) (-2333.921) (-2329.185) * (-2335.350) (-2329.291) [-2332.892] (-2335.268) -- 0:01:15 501500 -- (-2335.865) [-2333.879] (-2336.543) (-2339.812) * [-2337.064] (-2333.580) (-2326.913) (-2333.809) -- 0:01:15 502000 -- (-2338.465) [-2336.004] (-2327.651) (-2333.415) * [-2330.194] (-2338.435) (-2330.013) (-2331.403) -- 0:01:15 502500 -- (-2331.027) (-2330.474) [-2332.229] (-2331.437) * (-2334.178) (-2332.241) [-2334.918] (-2326.448) -- 0:01:15 503000 -- (-2333.438) (-2337.149) [-2329.523] (-2329.542) * (-2330.824) (-2339.844) (-2330.199) [-2332.134] -- 0:01:15 503500 -- (-2339.429) [-2332.632] (-2331.297) (-2334.973) * [-2329.325] (-2332.759) (-2328.256) (-2332.365) -- 0:01:14 504000 -- (-2331.161) (-2328.434) (-2337.036) [-2329.832] * (-2337.796) [-2330.091] (-2330.538) (-2332.079) -- 0:01:14 504500 -- (-2337.857) [-2327.763] (-2328.473) (-2334.248) * [-2331.718] (-2331.274) (-2331.215) (-2331.097) -- 0:01:14 505000 -- [-2333.744] (-2332.796) (-2328.602) (-2337.033) * [-2331.566] (-2332.003) (-2331.885) (-2334.121) -- 0:01:14 Average standard deviation of split frequencies: 0.000000 505500 -- [-2332.214] (-2329.273) (-2337.697) (-2333.714) * (-2333.375) [-2334.072] (-2335.667) (-2330.755) -- 0:01:15 506000 -- (-2337.596) (-2336.020) [-2332.514] (-2330.490) * (-2334.614) (-2334.634) [-2340.031] (-2334.452) -- 0:01:15 506500 -- (-2330.947) [-2336.782] (-2333.513) (-2329.718) * [-2330.842] (-2337.677) (-2328.193) (-2333.922) -- 0:01:15 507000 -- (-2328.185) (-2334.050) [-2333.032] (-2334.132) * (-2334.757) (-2331.239) [-2328.232] (-2336.648) -- 0:01:14 507500 -- (-2332.713) (-2331.060) (-2333.686) [-2331.777] * (-2338.646) (-2330.160) [-2332.959] (-2341.588) -- 0:01:14 508000 -- (-2332.842) [-2330.342] (-2331.932) (-2334.560) * (-2328.266) (-2326.334) [-2329.457] (-2336.241) -- 0:01:14 508500 -- (-2332.102) (-2330.923) [-2326.265] (-2335.867) * [-2331.374] (-2329.032) (-2332.085) (-2333.356) -- 0:01:14 509000 -- (-2335.300) (-2332.342) (-2326.962) [-2327.795] * (-2332.280) (-2335.033) (-2330.671) [-2341.279] -- 0:01:14 509500 -- (-2332.786) (-2342.229) [-2327.198] (-2332.886) * (-2336.423) [-2330.257] (-2331.067) (-2330.500) -- 0:01:14 510000 -- (-2330.562) [-2332.226] (-2328.605) (-2328.685) * (-2341.840) [-2332.903] (-2340.607) (-2330.738) -- 0:01:13 Average standard deviation of split frequencies: 0.000000 510500 -- (-2333.741) (-2329.132) [-2331.612] (-2335.920) * (-2336.123) [-2330.065] (-2329.298) (-2330.477) -- 0:01:13 511000 -- (-2331.137) (-2330.886) [-2330.867] (-2333.967) * (-2333.519) [-2333.708] (-2335.672) (-2334.010) -- 0:01:13 511500 -- [-2333.258] (-2327.038) (-2333.405) (-2334.974) * (-2331.899) (-2333.620) [-2327.227] (-2330.927) -- 0:01:13 512000 -- (-2331.659) [-2331.752] (-2332.778) (-2340.545) * (-2334.280) [-2330.497] (-2333.306) (-2332.779) -- 0:01:14 512500 -- (-2330.214) [-2334.771] (-2332.743) (-2329.091) * [-2337.679] (-2330.239) (-2332.739) (-2330.941) -- 0:01:14 513000 -- (-2335.234) (-2328.286) [-2328.123] (-2331.336) * (-2338.396) (-2337.411) [-2333.483] (-2330.048) -- 0:01:14 513500 -- (-2338.640) (-2331.714) [-2330.750] (-2333.958) * (-2332.325) (-2333.697) (-2336.391) [-2328.544] -- 0:01:13 514000 -- (-2339.499) (-2335.518) (-2333.322) [-2335.066] * (-2329.561) (-2331.599) [-2328.795] (-2334.025) -- 0:01:13 514500 -- (-2332.862) (-2332.927) (-2335.790) [-2329.448] * (-2335.964) (-2332.489) [-2330.151] (-2337.214) -- 0:01:13 515000 -- [-2336.150] (-2330.924) (-2330.892) (-2329.857) * (-2337.627) [-2333.611] (-2341.651) (-2329.951) -- 0:01:13 Average standard deviation of split frequencies: 0.000000 515500 -- (-2334.104) (-2334.427) [-2331.238] (-2333.297) * [-2331.630] (-2334.898) (-2338.189) (-2341.245) -- 0:01:13 516000 -- [-2332.560] (-2327.875) (-2336.960) (-2332.847) * (-2336.613) (-2332.944) (-2335.979) [-2336.005] -- 0:01:13 516500 -- (-2331.660) (-2328.726) [-2335.160] (-2338.803) * (-2340.388) (-2335.787) (-2344.092) [-2334.236] -- 0:01:13 517000 -- (-2329.263) [-2333.081] (-2334.446) (-2335.788) * (-2345.944) (-2333.639) (-2332.994) [-2330.074] -- 0:01:12 517500 -- (-2333.895) [-2336.658] (-2326.203) (-2341.864) * (-2335.330) (-2333.470) (-2329.949) [-2339.804] -- 0:01:12 518000 -- (-2332.625) [-2330.860] (-2327.696) (-2329.347) * (-2335.966) (-2334.458) [-2327.763] (-2331.409) -- 0:01:12 518500 -- [-2335.455] (-2329.783) (-2333.307) (-2326.200) * [-2339.364] (-2341.628) (-2327.466) (-2337.906) -- 0:01:13 519000 -- (-2328.620) (-2327.830) (-2335.953) [-2332.649] * [-2331.969] (-2331.744) (-2339.109) (-2342.890) -- 0:01:13 519500 -- [-2334.279] (-2331.993) (-2332.637) (-2329.641) * (-2335.924) (-2334.689) [-2336.268] (-2336.124) -- 0:01:13 520000 -- (-2331.933) (-2331.500) (-2334.525) [-2335.523] * [-2330.644] (-2342.569) (-2331.860) (-2332.594) -- 0:01:12 Average standard deviation of split frequencies: 0.000000 520500 -- (-2333.418) [-2332.289] (-2335.698) (-2334.439) * (-2334.753) (-2335.465) [-2338.027] (-2333.467) -- 0:01:12 521000 -- [-2332.612] (-2330.074) (-2337.782) (-2328.428) * (-2335.264) (-2333.989) (-2337.119) [-2325.240] -- 0:01:12 521500 -- (-2329.411) [-2325.747] (-2331.289) (-2332.490) * [-2332.794] (-2331.131) (-2335.717) (-2332.097) -- 0:01:12 522000 -- (-2334.600) (-2334.365) [-2330.350] (-2328.337) * (-2337.082) (-2337.328) [-2334.586] (-2333.784) -- 0:01:12 522500 -- (-2331.571) (-2331.860) [-2330.131] (-2329.294) * (-2329.581) (-2332.974) (-2333.259) [-2331.019] -- 0:01:12 523000 -- (-2342.425) [-2326.519] (-2329.360) (-2336.211) * [-2334.830] (-2329.499) (-2329.214) (-2331.045) -- 0:01:12 523500 -- (-2334.712) (-2329.436) [-2337.532] (-2334.877) * (-2331.145) (-2330.023) (-2335.105) [-2329.728] -- 0:01:11 524000 -- (-2336.226) (-2340.764) (-2336.361) [-2331.636] * [-2332.156] (-2330.322) (-2331.649) (-2332.559) -- 0:01:11 524500 -- [-2329.502] (-2337.568) (-2333.457) (-2331.175) * (-2332.836) (-2328.893) [-2333.709] (-2331.374) -- 0:01:11 525000 -- (-2332.056) (-2341.202) [-2333.650] (-2334.040) * (-2333.556) (-2327.973) (-2328.541) [-2328.192] -- 0:01:11 Average standard deviation of split frequencies: 0.000000 525500 -- (-2330.688) (-2329.029) (-2334.000) [-2327.259] * (-2334.428) [-2328.903] (-2340.880) (-2336.371) -- 0:01:12 526000 -- (-2334.553) [-2328.857] (-2338.901) (-2335.916) * [-2330.206] (-2334.370) (-2333.274) (-2331.411) -- 0:01:12 526500 -- (-2334.264) (-2330.029) (-2336.096) [-2335.526] * (-2325.842) [-2334.143] (-2336.535) (-2339.163) -- 0:01:11 527000 -- (-2330.153) (-2333.501) [-2329.168] (-2334.587) * (-2326.089) (-2327.924) [-2328.944] (-2332.664) -- 0:01:11 527500 -- [-2334.663] (-2331.597) (-2334.888) (-2336.567) * [-2330.755] (-2329.922) (-2336.412) (-2335.661) -- 0:01:11 528000 -- (-2335.725) [-2336.148] (-2335.531) (-2332.202) * (-2333.523) (-2333.760) [-2334.634] (-2328.907) -- 0:01:11 528500 -- (-2332.062) (-2329.984) [-2329.654] (-2331.978) * [-2332.096] (-2333.121) (-2329.257) (-2333.589) -- 0:01:11 529000 -- (-2334.526) (-2336.194) (-2331.626) [-2330.770] * (-2333.944) (-2334.760) (-2334.982) [-2330.686] -- 0:01:11 529500 -- (-2331.029) (-2334.311) (-2332.069) [-2334.570] * (-2329.751) (-2331.469) (-2336.270) [-2326.539] -- 0:01:11 530000 -- (-2334.976) (-2333.384) [-2333.004] (-2328.028) * (-2336.854) (-2334.741) (-2331.003) [-2333.740] -- 0:01:10 Average standard deviation of split frequencies: 0.000000 530500 -- [-2329.722] (-2331.030) (-2326.185) (-2328.613) * (-2329.729) (-2332.889) (-2335.286) [-2333.079] -- 0:01:10 531000 -- (-2330.448) [-2330.051] (-2332.371) (-2330.235) * (-2329.877) (-2327.096) [-2334.019] (-2332.467) -- 0:01:10 531500 -- (-2330.088) (-2332.039) [-2328.651] (-2330.559) * (-2329.090) [-2331.179] (-2334.090) (-2337.013) -- 0:01:10 532000 -- (-2334.375) (-2331.470) [-2332.958] (-2331.794) * (-2328.953) (-2337.114) [-2328.477] (-2335.456) -- 0:01:11 532500 -- (-2336.755) [-2330.066] (-2331.093) (-2333.319) * (-2329.699) [-2328.350] (-2335.370) (-2333.945) -- 0:01:11 533000 -- (-2334.844) [-2329.400] (-2334.500) (-2334.888) * (-2330.528) (-2329.438) (-2331.389) [-2331.598] -- 0:01:10 533500 -- (-2333.625) (-2328.076) (-2332.084) [-2334.074] * (-2334.158) (-2336.903) [-2336.205] (-2340.405) -- 0:01:10 534000 -- (-2337.667) (-2331.630) (-2334.340) [-2333.126] * [-2334.045] (-2330.994) (-2332.444) (-2328.415) -- 0:01:10 534500 -- (-2343.295) [-2331.852] (-2335.045) (-2333.268) * (-2333.498) (-2335.266) [-2331.999] (-2335.428) -- 0:01:10 535000 -- (-2339.078) [-2334.422] (-2333.236) (-2336.057) * (-2339.512) [-2329.718] (-2334.811) (-2335.732) -- 0:01:10 Average standard deviation of split frequencies: 0.000000 535500 -- [-2333.763] (-2333.998) (-2333.758) (-2335.410) * (-2333.277) [-2333.191] (-2329.027) (-2335.000) -- 0:01:10 536000 -- (-2338.801) (-2328.415) [-2331.899] (-2332.942) * (-2329.215) [-2329.509] (-2335.710) (-2334.498) -- 0:01:10 536500 -- [-2338.448] (-2334.228) (-2332.470) (-2330.374) * [-2329.332] (-2331.381) (-2341.643) (-2332.191) -- 0:01:09 537000 -- (-2332.063) [-2330.680] (-2331.376) (-2331.821) * (-2329.482) (-2330.830) (-2332.748) [-2331.376] -- 0:01:09 537500 -- (-2331.620) (-2328.085) [-2338.209] (-2331.362) * (-2337.129) [-2330.801] (-2334.355) (-2329.776) -- 0:01:09 538000 -- (-2329.202) (-2330.033) (-2334.071) [-2328.277] * (-2335.428) (-2335.392) [-2335.316] (-2330.734) -- 0:01:09 538500 -- (-2339.619) (-2331.524) (-2335.223) [-2328.426] * (-2327.456) (-2333.901) [-2332.015] (-2333.617) -- 0:01:10 539000 -- [-2338.876] (-2332.733) (-2329.336) (-2326.473) * (-2338.678) (-2328.528) [-2330.336] (-2331.675) -- 0:01:10 539500 -- (-2335.709) (-2335.421) [-2334.751] (-2330.739) * (-2342.656) [-2332.368] (-2329.069) (-2331.995) -- 0:01:09 540000 -- (-2340.638) (-2332.756) (-2332.512) [-2334.620] * (-2336.920) (-2331.693) [-2338.589] (-2333.110) -- 0:01:09 Average standard deviation of split frequencies: 0.000000 540500 -- [-2331.082] (-2330.244) (-2328.460) (-2333.763) * [-2328.388] (-2329.049) (-2343.089) (-2331.433) -- 0:01:09 541000 -- (-2331.809) [-2333.674] (-2330.713) (-2339.332) * (-2330.437) (-2327.731) [-2333.529] (-2340.261) -- 0:01:09 541500 -- [-2331.943] (-2337.548) (-2332.114) (-2338.378) * (-2334.250) [-2332.895] (-2338.537) (-2332.457) -- 0:01:09 542000 -- [-2330.494] (-2339.901) (-2336.484) (-2328.550) * [-2328.868] (-2335.188) (-2329.859) (-2336.834) -- 0:01:09 542500 -- [-2330.468] (-2334.270) (-2335.113) (-2330.640) * (-2334.645) (-2331.944) [-2332.412] (-2336.737) -- 0:01:09 543000 -- [-2329.814] (-2334.435) (-2334.119) (-2332.281) * (-2332.735) (-2328.846) [-2331.305] (-2327.261) -- 0:01:09 543500 -- (-2330.795) (-2335.678) (-2329.322) [-2331.449] * [-2328.598] (-2330.755) (-2339.618) (-2330.672) -- 0:01:08 544000 -- (-2327.152) [-2338.739] (-2336.264) (-2334.585) * (-2335.341) (-2330.531) (-2335.956) [-2331.910] -- 0:01:08 544500 -- (-2330.896) [-2333.501] (-2340.513) (-2331.265) * (-2330.483) (-2334.321) (-2331.699) [-2334.689] -- 0:01:08 545000 -- [-2331.393] (-2340.925) (-2339.422) (-2331.395) * [-2329.012] (-2330.515) (-2332.017) (-2335.910) -- 0:01:09 Average standard deviation of split frequencies: 0.000000 545500 -- (-2328.411) (-2337.635) (-2346.759) [-2338.089] * [-2333.990] (-2334.254) (-2329.441) (-2332.413) -- 0:01:09 546000 -- (-2327.363) (-2334.512) (-2339.425) [-2330.137] * (-2329.299) [-2332.009] (-2336.641) (-2334.979) -- 0:01:09 546500 -- [-2331.831] (-2333.223) (-2338.521) (-2330.073) * (-2331.607) [-2327.839] (-2334.435) (-2336.149) -- 0:01:08 547000 -- [-2335.753] (-2327.538) (-2331.797) (-2334.276) * (-2330.543) (-2330.500) (-2330.586) [-2329.114] -- 0:01:08 547500 -- [-2333.725] (-2330.844) (-2335.254) (-2333.793) * (-2335.412) [-2332.828] (-2330.396) (-2333.492) -- 0:01:08 548000 -- (-2335.292) [-2334.108] (-2337.729) (-2333.524) * [-2333.266] (-2335.848) (-2328.843) (-2329.961) -- 0:01:08 548500 -- (-2331.522) (-2344.963) [-2335.618] (-2330.812) * (-2331.637) [-2334.992] (-2333.695) (-2325.988) -- 0:01:08 549000 -- (-2336.840) [-2337.066] (-2330.766) (-2339.094) * [-2328.464] (-2337.699) (-2329.205) (-2334.219) -- 0:01:08 549500 -- (-2342.527) [-2330.768] (-2331.715) (-2334.719) * (-2330.335) (-2333.691) (-2336.870) [-2330.574] -- 0:01:08 550000 -- [-2336.981] (-2330.452) (-2336.016) (-2341.947) * (-2330.459) (-2334.213) [-2335.871] (-2337.197) -- 0:01:07 Average standard deviation of split frequencies: 0.000000 550500 -- [-2342.365] (-2334.154) (-2336.451) (-2330.174) * [-2339.276] (-2333.967) (-2329.524) (-2334.590) -- 0:01:07 551000 -- (-2332.494) (-2333.274) (-2328.097) [-2333.238] * (-2332.367) (-2328.353) (-2333.001) [-2331.019] -- 0:01:07 551500 -- (-2336.516) (-2335.632) [-2328.888] (-2334.097) * (-2330.507) (-2330.827) (-2332.804) [-2329.794] -- 0:01:08 552000 -- [-2336.421] (-2333.102) (-2328.949) (-2334.540) * (-2330.911) (-2329.680) (-2337.921) [-2331.700] -- 0:01:08 552500 -- (-2333.524) (-2331.475) (-2335.732) [-2333.502] * (-2330.580) (-2334.453) (-2332.434) [-2329.031] -- 0:01:08 553000 -- (-2332.063) [-2332.121] (-2336.012) (-2334.463) * (-2340.911) (-2330.585) (-2329.376) [-2337.872] -- 0:01:07 553500 -- (-2332.735) [-2330.817] (-2329.660) (-2333.606) * [-2329.249] (-2334.052) (-2332.520) (-2332.065) -- 0:01:07 554000 -- [-2331.367] (-2335.431) (-2332.696) (-2335.312) * (-2337.373) (-2331.182) (-2329.440) [-2335.498] -- 0:01:07 554500 -- (-2334.518) [-2326.858] (-2337.844) (-2335.330) * [-2332.724] (-2328.630) (-2334.241) (-2328.800) -- 0:01:07 555000 -- [-2331.192] (-2335.907) (-2332.876) (-2330.071) * (-2333.246) (-2327.660) [-2333.217] (-2332.458) -- 0:01:07 Average standard deviation of split frequencies: 0.000000 555500 -- (-2335.061) [-2331.990] (-2334.417) (-2334.202) * (-2337.939) [-2336.283] (-2335.792) (-2334.202) -- 0:01:07 556000 -- (-2337.600) (-2339.114) [-2327.892] (-2337.490) * (-2343.746) [-2332.278] (-2335.286) (-2333.832) -- 0:01:07 556500 -- (-2333.138) [-2334.843] (-2336.469) (-2332.308) * (-2341.161) [-2332.924] (-2331.830) (-2341.332) -- 0:01:06 557000 -- (-2328.074) [-2330.837] (-2335.143) (-2332.707) * (-2331.727) [-2330.821] (-2336.186) (-2330.856) -- 0:01:06 557500 -- (-2332.332) [-2333.087] (-2332.942) (-2337.651) * (-2333.101) (-2329.664) (-2329.096) [-2338.600] -- 0:01:06 558000 -- [-2334.071] (-2332.331) (-2333.520) (-2333.577) * [-2329.588] (-2326.241) (-2334.714) (-2339.570) -- 0:01:06 558500 -- (-2338.063) (-2333.369) [-2328.610] (-2330.898) * [-2329.660] (-2333.414) (-2335.008) (-2337.672) -- 0:01:07 559000 -- (-2333.278) (-2334.948) [-2328.410] (-2328.284) * (-2334.384) [-2331.516] (-2331.527) (-2332.360) -- 0:01:07 559500 -- (-2337.483) [-2332.552] (-2330.919) (-2326.849) * (-2333.768) [-2328.796] (-2333.036) (-2331.378) -- 0:01:06 560000 -- (-2335.179) (-2331.313) [-2326.275] (-2335.711) * (-2331.051) (-2330.738) [-2328.158] (-2329.022) -- 0:01:06 Average standard deviation of split frequencies: 0.000000 560500 -- (-2329.442) (-2332.012) [-2330.433] (-2332.440) * (-2333.857) (-2328.512) [-2332.941] (-2332.424) -- 0:01:06 561000 -- (-2328.495) (-2330.634) [-2335.572] (-2336.206) * (-2334.646) (-2332.555) [-2331.193] (-2331.980) -- 0:01:06 561500 -- [-2326.000] (-2333.391) (-2331.902) (-2332.180) * (-2332.621) (-2338.449) [-2335.534] (-2330.707) -- 0:01:06 562000 -- (-2333.684) (-2330.840) [-2327.981] (-2334.731) * [-2332.659] (-2337.423) (-2332.131) (-2332.139) -- 0:01:06 562500 -- (-2334.089) [-2329.315] (-2335.814) (-2332.533) * (-2335.815) (-2331.056) (-2330.057) [-2331.164] -- 0:01:06 563000 -- (-2338.339) (-2329.433) (-2330.738) [-2338.866] * [-2332.561] (-2329.265) (-2330.337) (-2331.747) -- 0:01:05 563500 -- (-2332.554) [-2327.053] (-2337.338) (-2335.199) * [-2335.425] (-2330.062) (-2332.771) (-2335.625) -- 0:01:05 564000 -- (-2335.121) (-2330.499) (-2334.518) [-2332.949] * [-2328.448] (-2333.334) (-2329.873) (-2335.276) -- 0:01:05 564500 -- (-2336.503) (-2330.698) [-2337.186] (-2332.182) * (-2332.784) (-2330.829) [-2330.655] (-2335.308) -- 0:01:05 565000 -- (-2333.151) (-2331.417) [-2331.626] (-2336.384) * (-2333.738) [-2336.184] (-2329.190) (-2339.807) -- 0:01:06 Average standard deviation of split frequencies: 0.000000 565500 -- [-2331.949] (-2332.322) (-2331.076) (-2329.381) * [-2334.094] (-2335.576) (-2331.691) (-2330.490) -- 0:01:06 566000 -- (-2332.488) (-2334.020) (-2327.118) [-2330.799] * (-2333.612) (-2329.073) [-2328.432] (-2333.900) -- 0:01:05 566500 -- (-2329.005) (-2328.672) (-2330.924) [-2329.110] * [-2326.498] (-2332.080) (-2330.060) (-2329.205) -- 0:01:05 567000 -- [-2325.880] (-2330.284) (-2336.707) (-2331.948) * (-2333.856) (-2336.986) [-2336.260] (-2337.449) -- 0:01:05 567500 -- (-2329.444) (-2330.551) (-2334.494) [-2330.404] * [-2334.228] (-2326.697) (-2329.213) (-2331.056) -- 0:01:05 568000 -- (-2334.214) [-2334.574] (-2337.992) (-2333.349) * (-2329.735) (-2330.463) [-2330.704] (-2332.566) -- 0:01:05 568500 -- (-2334.677) (-2331.099) (-2332.605) [-2331.649] * [-2330.275] (-2330.016) (-2327.471) (-2339.865) -- 0:01:05 569000 -- [-2327.255] (-2331.620) (-2346.370) (-2329.066) * [-2332.816] (-2336.623) (-2332.887) (-2334.515) -- 0:01:05 569500 -- (-2333.609) (-2337.889) (-2333.129) [-2333.623] * [-2333.416] (-2330.851) (-2334.365) (-2328.416) -- 0:01:05 570000 -- (-2331.663) (-2337.687) [-2329.473] (-2339.478) * (-2336.321) (-2334.329) [-2333.600] (-2335.827) -- 0:01:04 Average standard deviation of split frequencies: 0.000000 570500 -- (-2327.536) (-2333.860) (-2331.687) [-2331.382] * (-2332.461) (-2334.514) [-2335.284] (-2331.508) -- 0:01:04 571000 -- (-2334.899) (-2332.170) (-2336.115) [-2330.591] * (-2331.111) (-2336.424) (-2330.712) [-2328.898] -- 0:01:04 571500 -- [-2332.871] (-2332.644) (-2333.901) (-2337.188) * (-2335.682) (-2336.269) (-2336.688) [-2333.003] -- 0:01:05 572000 -- (-2334.257) [-2332.419] (-2335.175) (-2331.963) * (-2331.641) (-2334.326) (-2331.665) [-2335.974] -- 0:01:05 572500 -- (-2332.455) [-2329.266] (-2333.631) (-2330.518) * (-2331.091) (-2332.080) (-2338.035) [-2332.952] -- 0:01:04 573000 -- (-2331.101) (-2333.292) (-2340.175) [-2331.928] * (-2336.546) [-2333.647] (-2339.261) (-2330.893) -- 0:01:04 573500 -- (-2335.057) [-2332.247] (-2343.808) (-2333.863) * (-2331.164) (-2333.891) [-2332.239] (-2330.450) -- 0:01:04 574000 -- (-2333.360) (-2337.626) (-2333.269) [-2332.105] * [-2332.873] (-2335.053) (-2336.747) (-2328.750) -- 0:01:04 574500 -- (-2336.853) (-2332.206) (-2326.668) [-2336.196] * (-2330.352) [-2331.485] (-2337.600) (-2331.844) -- 0:01:04 575000 -- [-2333.665] (-2330.376) (-2336.556) (-2340.454) * (-2330.491) (-2329.372) (-2331.702) [-2333.557] -- 0:01:04 Average standard deviation of split frequencies: 0.000000 575500 -- (-2335.402) (-2334.328) (-2337.746) [-2329.501] * (-2330.731) [-2330.130] (-2334.720) (-2335.421) -- 0:01:04 576000 -- (-2336.680) [-2332.379] (-2333.628) (-2331.071) * [-2332.554] (-2336.795) (-2332.415) (-2330.180) -- 0:01:04 576500 -- [-2329.087] (-2333.675) (-2330.371) (-2342.232) * (-2338.217) (-2332.757) [-2331.385] (-2334.059) -- 0:01:03 577000 -- [-2328.758] (-2333.796) (-2329.571) (-2334.828) * [-2334.694] (-2330.471) (-2335.722) (-2344.160) -- 0:01:03 577500 -- (-2330.018) [-2327.521] (-2331.909) (-2336.306) * [-2328.747] (-2336.207) (-2337.875) (-2340.085) -- 0:01:03 578000 -- [-2331.402] (-2327.362) (-2334.077) (-2334.388) * (-2332.923) (-2330.413) [-2334.253] (-2338.466) -- 0:01:04 578500 -- (-2336.629) (-2334.396) (-2332.558) [-2329.046] * (-2336.901) [-2334.845] (-2339.364) (-2340.331) -- 0:01:04 579000 -- (-2337.418) [-2331.441] (-2329.879) (-2340.083) * [-2328.900] (-2336.506) (-2335.593) (-2343.280) -- 0:01:03 579500 -- (-2333.881) [-2329.195] (-2330.984) (-2328.327) * (-2333.017) [-2332.601] (-2339.136) (-2335.045) -- 0:01:03 580000 -- (-2335.934) (-2326.590) (-2329.815) [-2332.549] * (-2329.587) [-2335.411] (-2335.782) (-2332.578) -- 0:01:03 Average standard deviation of split frequencies: 0.000000 580500 -- (-2336.393) (-2337.359) [-2329.897] (-2330.272) * (-2331.147) [-2335.866] (-2329.556) (-2334.203) -- 0:01:03 581000 -- (-2338.128) (-2328.953) [-2329.102] (-2332.820) * (-2330.175) [-2329.171] (-2332.926) (-2334.237) -- 0:01:03 581500 -- (-2338.276) [-2329.172] (-2330.142) (-2330.825) * (-2329.932) (-2333.144) [-2328.172] (-2336.486) -- 0:01:03 582000 -- (-2338.514) (-2327.716) [-2329.123] (-2335.883) * (-2332.771) (-2330.039) [-2330.316] (-2332.743) -- 0:01:03 582500 -- (-2333.322) [-2329.140] (-2334.445) (-2340.541) * [-2340.380] (-2328.602) (-2332.767) (-2330.184) -- 0:01:03 583000 -- (-2332.930) (-2333.702) [-2337.711] (-2331.340) * (-2333.206) (-2333.041) [-2333.145] (-2330.901) -- 0:01:02 583500 -- (-2337.507) (-2333.919) (-2340.555) [-2331.112] * (-2330.672) (-2330.593) (-2334.780) [-2333.383] -- 0:01:02 584000 -- [-2328.641] (-2327.347) (-2331.649) (-2335.546) * [-2330.605] (-2336.276) (-2330.404) (-2333.896) -- 0:01:02 584500 -- [-2335.692] (-2333.133) (-2333.555) (-2332.016) * (-2336.269) (-2329.000) [-2326.580] (-2333.257) -- 0:01:03 585000 -- [-2332.741] (-2332.701) (-2335.869) (-2331.432) * (-2333.812) (-2333.682) [-2329.473] (-2335.383) -- 0:01:03 Average standard deviation of split frequencies: 0.000000 585500 -- (-2335.345) (-2328.516) [-2336.733] (-2341.027) * (-2330.470) (-2335.218) [-2330.081] (-2334.093) -- 0:01:03 586000 -- [-2330.509] (-2333.780) (-2339.768) (-2329.478) * (-2327.077) (-2333.524) (-2335.072) [-2330.115] -- 0:01:02 586500 -- (-2336.749) (-2325.818) (-2337.785) [-2335.027] * (-2329.915) (-2333.365) [-2332.212] (-2335.499) -- 0:01:02 587000 -- [-2333.013] (-2329.087) (-2332.866) (-2327.311) * (-2330.312) (-2333.319) [-2340.269] (-2339.015) -- 0:01:02 587500 -- (-2333.078) (-2330.558) (-2338.246) [-2332.324] * (-2332.350) [-2333.830] (-2342.596) (-2331.390) -- 0:01:02 588000 -- (-2332.134) (-2330.814) (-2333.219) [-2333.652] * (-2335.388) (-2331.655) [-2328.317] (-2331.317) -- 0:01:02 588500 -- (-2335.453) [-2335.537] (-2332.425) (-2329.662) * (-2332.530) (-2331.927) [-2339.767] (-2332.125) -- 0:01:02 589000 -- (-2329.936) (-2330.611) (-2335.245) [-2333.048] * (-2338.433) (-2329.860) (-2336.115) [-2333.553] -- 0:01:02 589500 -- [-2329.559] (-2337.555) (-2332.365) (-2331.120) * [-2329.581] (-2331.109) (-2331.645) (-2332.083) -- 0:01:01 590000 -- [-2327.212] (-2334.506) (-2338.979) (-2328.007) * (-2335.009) (-2333.929) (-2337.846) [-2330.505] -- 0:01:01 Average standard deviation of split frequencies: 0.000000 590500 -- (-2338.310) (-2327.588) (-2333.526) [-2329.266] * (-2334.556) (-2333.309) (-2329.356) [-2332.804] -- 0:01:01 591000 -- [-2337.835] (-2325.561) (-2329.246) (-2329.386) * (-2333.986) (-2332.678) [-2340.489] (-2335.034) -- 0:01:02 591500 -- (-2341.285) (-2331.347) (-2329.119) [-2328.738] * (-2331.003) (-2332.124) (-2331.818) [-2334.392] -- 0:01:02 592000 -- (-2338.142) (-2334.060) (-2331.742) [-2331.638] * (-2335.795) (-2334.453) [-2333.511] (-2329.590) -- 0:01:02 592500 -- (-2338.545) (-2337.828) (-2328.145) [-2329.410] * (-2331.423) [-2338.148] (-2332.945) (-2341.708) -- 0:01:01 593000 -- (-2331.361) (-2335.679) [-2331.670] (-2334.275) * [-2336.945] (-2331.357) (-2335.963) (-2328.684) -- 0:01:01 593500 -- (-2334.135) [-2333.202] (-2328.347) (-2334.291) * (-2340.458) (-2342.771) (-2328.378) [-2334.839] -- 0:01:01 594000 -- (-2333.257) (-2334.988) [-2329.421] (-2335.758) * (-2334.840) [-2330.817] (-2330.660) (-2333.686) -- 0:01:01 594500 -- [-2330.846] (-2332.141) (-2329.496) (-2334.046) * (-2336.821) (-2337.690) [-2333.116] (-2329.654) -- 0:01:01 595000 -- [-2329.368] (-2326.588) (-2340.725) (-2325.809) * (-2339.399) (-2331.762) [-2329.853] (-2326.074) -- 0:01:01 Average standard deviation of split frequencies: 0.000000 595500 -- (-2330.795) (-2328.845) [-2329.372] (-2329.409) * (-2328.027) [-2330.666] (-2341.157) (-2328.765) -- 0:01:01 596000 -- (-2332.187) (-2335.752) [-2334.563] (-2329.202) * [-2331.164] (-2330.316) (-2336.540) (-2328.069) -- 0:01:01 596500 -- (-2336.310) [-2336.519] (-2332.885) (-2332.796) * (-2331.279) (-2330.179) [-2328.003] (-2331.456) -- 0:01:00 597000 -- (-2330.479) (-2333.660) [-2343.852] (-2331.636) * [-2331.644] (-2332.851) (-2329.988) (-2333.366) -- 0:01:00 597500 -- (-2336.819) (-2330.217) (-2334.895) [-2334.320] * (-2330.590) (-2338.035) (-2334.613) [-2335.728] -- 0:01:01 598000 -- (-2331.182) (-2336.803) (-2335.404) [-2329.187] * [-2331.908] (-2332.740) (-2328.414) (-2329.250) -- 0:01:01 598500 -- (-2336.143) (-2332.355) (-2335.039) [-2346.231] * (-2327.731) (-2338.006) [-2334.217] (-2332.937) -- 0:01:01 599000 -- (-2328.501) (-2333.176) [-2326.412] (-2335.208) * (-2338.016) [-2335.354] (-2333.068) (-2331.223) -- 0:01:00 599500 -- (-2333.487) (-2328.923) (-2330.019) [-2327.126] * (-2339.317) (-2332.774) (-2330.803) [-2331.959] -- 0:01:00 600000 -- (-2335.689) [-2330.734] (-2330.986) (-2335.632) * (-2331.703) (-2329.802) (-2333.656) [-2328.538] -- 0:01:00 Average standard deviation of split frequencies: 0.000000 600500 -- (-2330.139) (-2336.178) [-2328.855] (-2332.532) * [-2329.174] (-2330.552) (-2344.754) (-2328.972) -- 0:01:00 601000 -- [-2331.874] (-2338.342) (-2335.502) (-2333.584) * [-2328.429] (-2330.648) (-2332.149) (-2335.137) -- 0:01:00 601500 -- (-2335.461) [-2334.796] (-2332.868) (-2331.283) * (-2329.487) [-2329.160] (-2331.537) (-2333.535) -- 0:01:00 602000 -- (-2331.532) (-2329.416) (-2337.645) [-2332.428] * [-2338.286] (-2338.513) (-2330.536) (-2338.708) -- 0:01:00 602500 -- (-2331.952) (-2331.661) [-2336.645] (-2338.760) * (-2336.163) (-2331.717) (-2330.125) [-2328.447] -- 0:01:00 603000 -- [-2330.216] (-2332.414) (-2333.723) (-2334.229) * (-2329.113) [-2335.633] (-2329.523) (-2341.101) -- 0:00:59 603500 -- (-2331.950) (-2333.002) (-2329.468) [-2333.139] * [-2336.054] (-2335.631) (-2330.326) (-2340.796) -- 0:00:59 604000 -- (-2330.199) [-2330.979] (-2333.947) (-2333.415) * [-2335.992] (-2339.069) (-2328.679) (-2337.158) -- 0:01:00 604500 -- (-2333.889) (-2330.498) (-2331.946) [-2331.777] * (-2336.392) (-2330.683) (-2336.192) [-2329.132] -- 0:01:00 605000 -- (-2336.191) (-2333.425) (-2338.517) [-2333.847] * (-2338.393) (-2334.641) [-2336.003] (-2331.035) -- 0:01:00 Average standard deviation of split frequencies: 0.000000 605500 -- [-2336.527] (-2330.038) (-2335.601) (-2329.461) * [-2337.538] (-2333.751) (-2344.526) (-2333.271) -- 0:00:59 606000 -- (-2337.752) (-2336.762) [-2329.392] (-2329.582) * (-2332.491) [-2328.835] (-2335.236) (-2336.688) -- 0:00:59 606500 -- (-2333.457) (-2329.131) [-2331.735] (-2329.735) * (-2336.357) [-2333.619] (-2343.784) (-2334.256) -- 0:00:59 607000 -- [-2332.807] (-2328.333) (-2331.623) (-2329.888) * (-2333.792) [-2333.366] (-2337.909) (-2334.497) -- 0:00:59 607500 -- (-2331.356) (-2329.831) [-2331.484] (-2339.768) * (-2340.245) [-2330.551] (-2335.558) (-2329.546) -- 0:00:59 608000 -- (-2335.781) (-2330.913) (-2327.136) [-2334.192] * [-2339.438] (-2330.626) (-2335.313) (-2334.236) -- 0:00:59 608500 -- (-2333.070) [-2331.854] (-2330.292) (-2334.758) * (-2330.071) (-2337.728) (-2332.523) [-2331.503] -- 0:00:59 609000 -- (-2332.263) (-2337.230) [-2339.282] (-2332.514) * (-2329.278) [-2332.958] (-2332.154) (-2335.125) -- 0:00:59 609500 -- (-2328.117) (-2332.831) [-2336.720] (-2329.493) * (-2331.950) (-2329.716) (-2334.246) [-2329.786] -- 0:00:58 610000 -- (-2338.381) [-2330.604] (-2331.060) (-2331.246) * (-2328.865) [-2334.896] (-2330.150) (-2333.630) -- 0:00:58 Average standard deviation of split frequencies: 0.000000 610500 -- [-2328.813] (-2329.862) (-2333.274) (-2331.957) * [-2330.381] (-2331.255) (-2333.081) (-2333.581) -- 0:00:58 611000 -- [-2334.506] (-2329.171) (-2332.099) (-2338.139) * [-2330.409] (-2335.347) (-2333.168) (-2339.108) -- 0:00:59 611500 -- (-2332.537) [-2331.451] (-2327.832) (-2334.938) * (-2332.029) (-2331.217) (-2333.225) [-2333.797] -- 0:00:59 612000 -- (-2332.027) (-2340.273) (-2332.301) [-2331.299] * (-2330.563) [-2327.220] (-2332.230) (-2337.393) -- 0:00:58 612500 -- (-2338.812) (-2330.936) [-2332.079] (-2333.379) * (-2332.231) (-2336.945) (-2334.393) [-2338.010] -- 0:00:58 613000 -- (-2337.276) [-2331.052] (-2331.241) (-2333.748) * (-2333.535) [-2331.155] (-2332.594) (-2331.740) -- 0:00:58 613500 -- (-2335.460) (-2339.667) (-2330.484) [-2327.782] * [-2339.629] (-2330.121) (-2329.961) (-2332.070) -- 0:00:58 614000 -- (-2330.029) (-2334.486) [-2331.803] (-2328.790) * (-2341.023) [-2331.408] (-2331.886) (-2337.675) -- 0:00:58 614500 -- (-2326.004) (-2333.587) (-2328.589) [-2328.409] * (-2332.880) (-2331.680) [-2327.828] (-2338.242) -- 0:00:58 615000 -- (-2325.465) (-2334.643) [-2335.133] (-2335.343) * (-2333.652) [-2334.338] (-2330.757) (-2332.411) -- 0:00:58 Average standard deviation of split frequencies: 0.000000 615500 -- (-2330.325) [-2328.575] (-2332.228) (-2335.091) * [-2333.474] (-2329.277) (-2336.482) (-2332.047) -- 0:00:58 616000 -- (-2333.515) (-2326.348) [-2332.856] (-2332.570) * (-2332.899) [-2331.243] (-2331.995) (-2338.008) -- 0:00:57 616500 -- (-2336.766) (-2332.126) (-2336.757) [-2330.957] * (-2331.913) [-2328.835] (-2332.144) (-2332.852) -- 0:00:57 617000 -- (-2337.196) (-2334.546) [-2330.926] (-2330.704) * (-2327.781) (-2329.757) (-2339.252) [-2336.598] -- 0:00:57 617500 -- (-2329.797) (-2356.219) [-2331.203] (-2330.036) * (-2327.685) (-2334.964) (-2333.490) [-2331.856] -- 0:00:58 618000 -- (-2333.387) (-2337.639) (-2336.403) [-2334.269] * (-2334.295) (-2338.009) [-2335.412] (-2332.606) -- 0:00:58 618500 -- (-2341.666) (-2338.052) [-2331.782] (-2336.868) * [-2331.043] (-2333.465) (-2334.794) (-2331.858) -- 0:00:57 619000 -- (-2338.782) (-2331.924) (-2328.791) [-2333.688] * (-2333.792) [-2332.330] (-2339.216) (-2330.465) -- 0:00:57 619500 -- [-2334.778] (-2338.150) (-2334.953) (-2344.945) * (-2337.337) [-2330.300] (-2329.744) (-2334.626) -- 0:00:57 620000 -- (-2336.083) (-2333.900) (-2332.400) [-2334.156] * (-2332.500) (-2330.644) [-2338.299] (-2332.252) -- 0:00:57 Average standard deviation of split frequencies: 0.000000 620500 -- [-2329.588] (-2334.184) (-2331.527) (-2333.260) * [-2333.514] (-2332.462) (-2334.671) (-2333.135) -- 0:00:57 621000 -- (-2334.003) (-2334.531) (-2326.774) [-2330.042] * [-2335.970] (-2336.276) (-2327.784) (-2338.945) -- 0:00:57 621500 -- (-2333.802) (-2333.257) [-2334.841] (-2329.959) * (-2327.678) [-2331.598] (-2329.159) (-2333.185) -- 0:00:57 622000 -- (-2335.100) [-2333.524] (-2332.771) (-2327.616) * [-2328.579] (-2330.069) (-2333.754) (-2336.262) -- 0:00:57 622500 -- (-2333.958) [-2331.422] (-2336.998) (-2331.687) * (-2337.096) (-2333.327) [-2331.342] (-2333.444) -- 0:00:57 623000 -- (-2331.794) [-2329.869] (-2329.014) (-2334.713) * (-2332.706) (-2330.585) (-2335.508) [-2331.450] -- 0:00:56 623500 -- [-2328.737] (-2331.127) (-2335.229) (-2333.768) * (-2332.230) (-2330.544) [-2333.145] (-2332.823) -- 0:00:56 624000 -- (-2335.916) [-2335.521] (-2330.760) (-2336.144) * (-2331.533) (-2335.837) (-2333.671) [-2331.332] -- 0:00:57 624500 -- (-2328.975) [-2329.394] (-2335.792) (-2333.272) * (-2334.818) (-2339.762) (-2334.818) [-2331.086] -- 0:00:57 625000 -- (-2332.531) (-2335.037) (-2330.048) [-2336.800] * (-2324.697) (-2340.129) [-2336.298] (-2336.662) -- 0:00:57 Average standard deviation of split frequencies: 0.000000 625500 -- (-2332.228) (-2333.644) (-2329.406) [-2332.105] * [-2331.308] (-2330.625) (-2334.523) (-2331.266) -- 0:00:56 626000 -- (-2328.548) (-2332.465) (-2329.397) [-2336.233] * (-2327.752) (-2337.020) [-2335.355] (-2330.887) -- 0:00:56 626500 -- (-2330.647) [-2328.121] (-2332.852) (-2337.025) * (-2328.458) (-2329.534) (-2334.222) [-2329.963] -- 0:00:56 627000 -- [-2328.613] (-2335.795) (-2331.868) (-2329.059) * [-2327.057] (-2329.161) (-2332.954) (-2331.059) -- 0:00:56 627500 -- (-2337.959) (-2332.055) [-2333.914] (-2330.023) * (-2337.872) (-2332.279) [-2331.729] (-2330.308) -- 0:00:56 628000 -- (-2332.899) [-2329.234] (-2332.148) (-2331.111) * [-2332.466] (-2336.419) (-2334.731) (-2329.797) -- 0:00:56 628500 -- (-2330.008) (-2334.320) [-2331.145] (-2340.145) * (-2327.768) (-2336.104) (-2332.933) [-2329.592] -- 0:00:56 629000 -- [-2338.831] (-2337.510) (-2332.585) (-2337.498) * (-2331.193) (-2329.391) (-2326.613) [-2329.807] -- 0:00:56 629500 -- (-2333.013) [-2332.153] (-2330.069) (-2332.315) * (-2330.254) (-2334.597) [-2331.725] (-2334.500) -- 0:00:55 630000 -- [-2327.560] (-2330.965) (-2331.887) (-2334.066) * (-2328.994) [-2331.465] (-2338.669) (-2330.638) -- 0:00:55 Average standard deviation of split frequencies: 0.000000 630500 -- (-2333.122) (-2332.580) (-2339.203) [-2332.080] * (-2330.353) [-2337.972] (-2327.712) (-2328.740) -- 0:00:56 631000 -- [-2333.124] (-2334.394) (-2337.006) (-2335.435) * [-2332.136] (-2336.405) (-2326.783) (-2328.104) -- 0:00:56 631500 -- [-2330.339] (-2337.155) (-2338.384) (-2345.311) * [-2329.142] (-2330.859) (-2337.812) (-2328.899) -- 0:00:56 632000 -- [-2332.104] (-2341.497) (-2335.784) (-2332.773) * (-2330.095) (-2340.526) (-2333.966) [-2329.742] -- 0:00:55 632500 -- [-2331.244] (-2334.726) (-2333.433) (-2334.143) * (-2331.553) (-2337.295) [-2331.095] (-2332.583) -- 0:00:55 633000 -- (-2331.154) (-2339.425) (-2330.432) [-2331.887] * (-2333.409) (-2334.624) (-2330.530) [-2330.721] -- 0:00:55 633500 -- [-2329.143] (-2333.443) (-2330.702) (-2327.134) * (-2345.215) [-2330.966] (-2331.111) (-2330.141) -- 0:00:55 634000 -- [-2334.037] (-2330.260) (-2332.848) (-2325.917) * (-2335.616) [-2327.339] (-2331.655) (-2334.487) -- 0:00:55 634500 -- (-2328.669) [-2331.630] (-2333.399) (-2333.685) * (-2336.976) (-2332.349) (-2328.559) [-2332.301] -- 0:00:55 635000 -- [-2332.017] (-2328.321) (-2328.443) (-2334.733) * (-2331.446) (-2334.079) [-2329.094] (-2332.967) -- 0:00:55 Average standard deviation of split frequencies: 0.000000 635500 -- (-2330.676) [-2329.733] (-2332.124) (-2340.009) * [-2335.342] (-2329.025) (-2337.576) (-2331.742) -- 0:00:55 636000 -- (-2332.651) [-2329.474] (-2337.625) (-2335.855) * (-2337.168) (-2330.796) (-2347.243) [-2336.066] -- 0:00:54 636500 -- (-2334.523) (-2332.099) (-2336.146) [-2331.148] * [-2336.773] (-2329.367) (-2336.025) (-2341.806) -- 0:00:54 637000 -- [-2338.280] (-2337.132) (-2333.747) (-2336.735) * (-2330.491) (-2329.538) [-2332.225] (-2335.025) -- 0:00:54 637500 -- (-2335.746) (-2340.519) [-2330.986] (-2334.544) * (-2334.392) [-2329.211] (-2342.209) (-2331.780) -- 0:00:55 638000 -- (-2331.602) (-2337.965) [-2336.645] (-2330.271) * (-2333.014) [-2329.461] (-2340.098) (-2329.909) -- 0:00:55 638500 -- (-2339.610) (-2334.773) [-2330.610] (-2343.469) * (-2335.604) (-2328.004) (-2333.834) [-2333.462] -- 0:00:54 639000 -- (-2341.722) (-2337.572) (-2334.125) [-2338.602] * (-2334.688) (-2329.300) [-2330.495] (-2333.554) -- 0:00:54 639500 -- (-2343.977) (-2338.751) [-2333.406] (-2336.036) * (-2336.624) [-2334.476] (-2335.008) (-2336.458) -- 0:00:54 640000 -- (-2341.051) (-2330.891) [-2335.189] (-2333.481) * (-2332.526) (-2334.098) [-2334.863] (-2331.677) -- 0:00:54 Average standard deviation of split frequencies: 0.000000 640500 -- (-2332.309) (-2327.451) (-2330.773) [-2331.883] * (-2331.811) (-2338.511) [-2332.075] (-2329.893) -- 0:00:54 641000 -- (-2338.378) (-2335.155) (-2329.646) [-2333.283] * (-2334.665) (-2329.268) (-2335.919) [-2332.005] -- 0:00:54 641500 -- (-2332.079) (-2329.365) (-2331.171) [-2335.135] * [-2331.679] (-2331.057) (-2334.285) (-2331.440) -- 0:00:54 642000 -- (-2332.914) [-2332.184] (-2334.012) (-2342.508) * (-2331.937) [-2327.980] (-2332.610) (-2335.431) -- 0:00:54 642500 -- (-2330.447) (-2339.146) [-2332.658] (-2333.026) * (-2334.230) (-2335.033) [-2332.292] (-2331.854) -- 0:00:53 643000 -- (-2346.919) [-2335.841] (-2336.954) (-2340.372) * (-2331.344) (-2335.647) (-2326.357) [-2331.785] -- 0:00:53 643500 -- [-2333.046] (-2330.349) (-2331.150) (-2336.115) * (-2338.103) (-2337.034) [-2330.703] (-2333.174) -- 0:00:53 644000 -- (-2342.212) [-2331.174] (-2333.240) (-2335.620) * (-2328.667) (-2335.418) (-2335.381) [-2326.403] -- 0:00:54 644500 -- (-2342.492) [-2332.294] (-2333.036) (-2333.748) * (-2333.893) [-2332.674] (-2337.227) (-2327.956) -- 0:00:54 645000 -- (-2336.993) (-2329.506) [-2337.523] (-2336.637) * (-2332.920) (-2335.725) (-2334.922) [-2327.479] -- 0:00:53 Average standard deviation of split frequencies: 0.000000 645500 -- (-2334.979) (-2331.933) (-2335.758) [-2330.730] * (-2333.548) [-2328.690] (-2334.294) (-2331.303) -- 0:00:53 646000 -- [-2336.616] (-2332.341) (-2333.118) (-2330.335) * (-2336.993) [-2333.555] (-2335.838) (-2336.824) -- 0:00:53 646500 -- (-2341.578) (-2333.315) (-2334.294) [-2335.473] * [-2329.498] (-2337.992) (-2337.500) (-2334.181) -- 0:00:53 647000 -- [-2329.136] (-2333.696) (-2333.834) (-2329.083) * (-2328.993) (-2332.644) [-2337.892] (-2334.961) -- 0:00:53 647500 -- [-2333.387] (-2334.782) (-2333.196) (-2335.906) * (-2333.571) (-2332.833) [-2332.154] (-2332.121) -- 0:00:53 648000 -- (-2334.823) (-2334.283) (-2331.593) [-2329.642] * (-2327.645) [-2331.484] (-2336.131) (-2334.923) -- 0:00:53 648500 -- (-2328.238) (-2332.589) (-2330.675) [-2333.246] * (-2337.220) [-2333.975] (-2333.164) (-2331.573) -- 0:00:53 649000 -- (-2331.008) [-2332.687] (-2333.385) (-2331.881) * [-2332.664] (-2330.718) (-2331.016) (-2334.415) -- 0:00:53 649500 -- [-2334.218] (-2329.817) (-2336.034) (-2329.703) * (-2332.401) (-2326.210) (-2329.557) [-2326.446] -- 0:00:52 650000 -- (-2328.763) (-2339.161) (-2329.936) [-2337.644] * (-2328.613) (-2341.431) [-2333.234] (-2332.096) -- 0:00:52 Average standard deviation of split frequencies: 0.000000 650500 -- (-2331.123) [-2332.369] (-2329.995) (-2334.829) * [-2334.996] (-2335.957) (-2332.475) (-2335.374) -- 0:00:53 651000 -- (-2332.038) [-2331.625] (-2332.520) (-2333.411) * (-2331.735) (-2332.953) (-2328.016) [-2332.141] -- 0:00:53 651500 -- [-2333.608] (-2331.255) (-2332.392) (-2343.132) * (-2329.573) (-2332.597) [-2334.622] (-2343.445) -- 0:00:52 652000 -- (-2339.744) [-2332.227] (-2333.296) (-2332.938) * (-2332.722) (-2334.059) (-2331.924) [-2331.967] -- 0:00:52 652500 -- (-2335.436) (-2330.680) (-2329.896) [-2333.994] * [-2332.278] (-2327.773) (-2326.634) (-2337.173) -- 0:00:52 653000 -- (-2335.197) [-2334.991] (-2336.779) (-2331.259) * [-2331.597] (-2332.550) (-2329.522) (-2332.202) -- 0:00:52 653500 -- (-2333.147) [-2327.103] (-2339.015) (-2332.801) * (-2333.815) (-2336.744) [-2329.050] (-2332.866) -- 0:00:52 654000 -- (-2336.377) (-2334.980) [-2333.035] (-2330.937) * [-2333.480] (-2334.238) (-2331.980) (-2330.620) -- 0:00:52 654500 -- (-2333.984) (-2337.600) (-2336.884) [-2339.093] * [-2330.203] (-2334.401) (-2334.180) (-2338.871) -- 0:00:52 655000 -- (-2333.052) (-2338.213) (-2339.975) [-2326.090] * [-2331.602] (-2336.340) (-2328.395) (-2330.221) -- 0:00:52 Average standard deviation of split frequencies: 0.000000 655500 -- (-2335.250) (-2332.534) (-2329.543) [-2333.655] * (-2330.733) [-2332.525] (-2337.932) (-2327.793) -- 0:00:52 656000 -- (-2336.704) (-2334.915) (-2329.277) [-2329.631] * (-2329.339) (-2335.582) (-2336.710) [-2329.923] -- 0:00:51 656500 -- (-2334.782) [-2329.030] (-2334.948) (-2330.597) * (-2334.428) [-2336.905] (-2330.430) (-2332.216) -- 0:00:51 657000 -- (-2334.154) (-2331.381) (-2332.931) [-2329.331] * (-2333.595) (-2326.978) (-2337.761) [-2328.621] -- 0:00:52 657500 -- (-2331.104) (-2333.237) [-2332.978] (-2332.525) * [-2333.448] (-2328.666) (-2331.293) (-2331.813) -- 0:00:52 658000 -- (-2333.272) (-2334.151) [-2332.171] (-2333.888) * (-2330.858) (-2345.106) [-2329.600] (-2333.252) -- 0:00:51 658500 -- [-2332.430] (-2334.059) (-2331.248) (-2339.539) * (-2331.687) (-2336.883) [-2330.839] (-2332.651) -- 0:00:51 659000 -- (-2334.715) (-2327.341) (-2330.481) [-2335.117] * (-2328.441) [-2327.525] (-2332.179) (-2326.506) -- 0:00:51 659500 -- (-2331.975) (-2333.356) (-2329.431) [-2331.092] * (-2334.105) (-2337.650) [-2331.588] (-2329.426) -- 0:00:51 660000 -- (-2333.273) (-2331.852) (-2336.972) [-2334.443] * [-2330.243] (-2324.323) (-2331.595) (-2332.772) -- 0:00:51 Average standard deviation of split frequencies: 0.000000 660500 -- (-2333.682) (-2338.659) (-2332.030) [-2326.422] * (-2332.714) (-2328.128) (-2333.953) [-2335.356] -- 0:00:51 661000 -- (-2334.000) (-2333.561) (-2332.082) [-2330.325] * [-2333.823] (-2332.181) (-2332.964) (-2334.203) -- 0:00:51 661500 -- [-2331.344] (-2333.127) (-2328.287) (-2331.722) * (-2333.162) (-2329.507) [-2332.615] (-2331.653) -- 0:00:51 662000 -- [-2333.683] (-2337.154) (-2334.948) (-2329.584) * (-2337.609) [-2335.434] (-2334.447) (-2331.118) -- 0:00:51 662500 -- (-2329.319) (-2336.182) [-2336.416] (-2330.848) * (-2332.542) (-2326.158) (-2340.677) [-2343.243] -- 0:00:50 663000 -- (-2333.453) (-2331.351) [-2330.396] (-2330.425) * (-2339.674) [-2327.545] (-2334.496) (-2334.806) -- 0:00:50 663500 -- (-2335.047) (-2328.141) (-2330.066) [-2332.975] * (-2332.382) (-2328.432) (-2336.130) [-2336.456] -- 0:00:50 664000 -- [-2333.539] (-2336.048) (-2332.633) (-2336.203) * (-2332.062) (-2339.530) [-2335.384] (-2328.979) -- 0:00:51 664500 -- [-2336.040] (-2329.796) (-2335.225) (-2330.251) * [-2332.010] (-2328.083) (-2333.211) (-2337.512) -- 0:00:50 665000 -- [-2330.657] (-2330.001) (-2327.353) (-2336.988) * [-2330.301] (-2332.638) (-2329.446) (-2338.172) -- 0:00:50 Average standard deviation of split frequencies: 0.000000 665500 -- (-2333.944) [-2330.716] (-2341.183) (-2330.915) * (-2332.944) (-2330.342) (-2331.011) [-2332.048] -- 0:00:50 666000 -- (-2342.315) (-2330.921) [-2333.046] (-2334.222) * (-2336.411) [-2331.572] (-2336.182) (-2331.209) -- 0:00:50 666500 -- [-2331.738] (-2335.997) (-2334.672) (-2332.456) * (-2336.706) [-2329.124] (-2332.805) (-2335.983) -- 0:00:50 667000 -- [-2333.973] (-2329.248) (-2331.719) (-2328.403) * (-2328.460) (-2338.196) (-2335.004) [-2328.296] -- 0:00:50 667500 -- (-2334.844) [-2332.642] (-2329.825) (-2329.900) * (-2330.405) (-2336.513) (-2329.467) [-2329.974] -- 0:00:50 668000 -- (-2334.508) (-2330.638) (-2335.048) [-2333.595] * (-2333.702) (-2331.741) (-2331.108) [-2332.412] -- 0:00:50 668500 -- (-2335.700) (-2331.585) [-2328.824] (-2333.938) * (-2329.610) [-2334.583] (-2330.460) (-2337.935) -- 0:00:50 669000 -- (-2328.619) (-2332.369) [-2328.863] (-2330.100) * (-2333.552) (-2333.277) [-2327.654] (-2336.858) -- 0:00:49 669500 -- (-2331.133) (-2333.221) [-2340.704] (-2341.517) * (-2333.323) (-2333.216) [-2335.034] (-2327.262) -- 0:00:49 670000 -- [-2328.106] (-2335.778) (-2336.636) (-2332.808) * (-2329.460) [-2338.654] (-2336.406) (-2330.322) -- 0:00:49 Average standard deviation of split frequencies: 0.000000 670500 -- (-2330.948) (-2340.380) (-2332.171) [-2333.939] * [-2327.415] (-2341.630) (-2336.248) (-2328.947) -- 0:00:50 671000 -- (-2329.771) (-2331.473) [-2332.648] (-2337.421) * [-2330.913] (-2333.649) (-2335.978) (-2331.344) -- 0:00:50 671500 -- [-2331.361] (-2328.371) (-2334.605) (-2337.323) * (-2327.677) (-2331.420) [-2335.844] (-2329.912) -- 0:00:49 672000 -- (-2335.352) (-2330.100) [-2333.391] (-2328.068) * (-2334.431) (-2326.071) (-2334.070) [-2333.839] -- 0:00:49 672500 -- (-2334.339) (-2337.059) [-2329.687] (-2330.075) * (-2331.659) (-2335.693) (-2333.413) [-2332.096] -- 0:00:49 673000 -- (-2333.083) [-2328.560] (-2333.896) (-2330.789) * (-2328.258) [-2336.307] (-2327.745) (-2329.865) -- 0:00:49 673500 -- [-2332.780] (-2332.100) (-2332.833) (-2338.743) * (-2331.973) [-2332.475] (-2332.426) (-2334.660) -- 0:00:49 674000 -- [-2328.688] (-2329.321) (-2339.142) (-2332.055) * [-2336.077] (-2330.525) (-2334.662) (-2331.467) -- 0:00:49 674500 -- [-2331.432] (-2331.008) (-2342.751) (-2332.992) * (-2332.330) (-2329.955) [-2329.605] (-2331.563) -- 0:00:49 675000 -- (-2331.355) (-2330.962) [-2341.722] (-2334.414) * (-2334.838) (-2329.688) [-2328.996] (-2330.579) -- 0:00:49 Average standard deviation of split frequencies: 0.000000 675500 -- (-2334.572) (-2334.095) (-2331.044) [-2334.157] * (-2329.657) (-2329.003) [-2333.012] (-2330.385) -- 0:00:48 676000 -- (-2329.044) (-2333.262) [-2331.118] (-2331.645) * (-2334.018) [-2332.211] (-2332.888) (-2336.030) -- 0:00:48 676500 -- [-2330.209] (-2335.887) (-2330.330) (-2334.632) * (-2332.501) (-2336.153) (-2334.459) [-2333.577] -- 0:00:48 677000 -- (-2335.719) (-2330.806) [-2334.321] (-2329.934) * [-2331.541] (-2334.171) (-2335.830) (-2335.329) -- 0:00:49 677500 -- [-2328.711] (-2329.579) (-2330.932) (-2332.248) * (-2334.783) (-2337.514) (-2337.990) [-2331.220] -- 0:00:49 678000 -- (-2330.561) (-2327.313) [-2330.688] (-2330.721) * (-2332.279) [-2328.682] (-2332.744) (-2334.706) -- 0:00:48 678500 -- (-2333.879) (-2331.745) (-2331.153) [-2330.699] * (-2336.029) [-2330.812] (-2332.292) (-2339.745) -- 0:00:48 679000 -- (-2333.184) (-2329.089) [-2335.028] (-2329.310) * (-2335.810) (-2340.712) (-2331.976) [-2334.499] -- 0:00:48 679500 -- (-2336.456) (-2330.257) [-2335.582] (-2333.473) * [-2333.749] (-2339.738) (-2331.560) (-2335.196) -- 0:00:48 680000 -- (-2335.274) (-2335.609) (-2333.928) [-2331.216] * [-2331.972] (-2331.908) (-2335.631) (-2338.441) -- 0:00:48 Average standard deviation of split frequencies: 0.000000 680500 -- (-2334.724) (-2334.451) (-2336.667) [-2327.624] * (-2332.311) (-2334.070) [-2327.560] (-2333.321) -- 0:00:48 681000 -- [-2334.650] (-2337.414) (-2330.561) (-2331.302) * (-2331.067) (-2330.064) [-2333.267] (-2339.271) -- 0:00:48 681500 -- (-2334.427) (-2332.608) [-2337.520] (-2325.452) * [-2339.115] (-2333.838) (-2332.981) (-2331.169) -- 0:00:48 682000 -- (-2333.189) (-2332.422) (-2332.464) [-2332.612] * (-2328.255) [-2329.063] (-2331.311) (-2333.776) -- 0:00:48 682500 -- (-2334.617) [-2334.974] (-2332.303) (-2337.551) * (-2330.676) [-2333.089] (-2334.367) (-2336.665) -- 0:00:47 683000 -- (-2334.109) (-2331.062) (-2337.757) [-2336.390] * (-2338.827) (-2334.780) (-2333.498) [-2331.329] -- 0:00:47 683500 -- (-2334.350) [-2335.744] (-2335.476) (-2334.413) * (-2337.239) (-2334.306) (-2331.020) [-2329.700] -- 0:00:48 684000 -- (-2332.736) [-2334.389] (-2332.990) (-2342.763) * (-2334.525) (-2331.578) [-2327.734] (-2331.734) -- 0:00:48 684500 -- (-2338.668) (-2336.100) [-2336.883] (-2335.462) * (-2335.654) (-2334.534) [-2333.903] (-2331.523) -- 0:00:47 685000 -- (-2331.952) (-2331.589) (-2329.655) [-2329.511] * (-2338.469) [-2327.493] (-2330.663) (-2332.890) -- 0:00:47 Average standard deviation of split frequencies: 0.000000 685500 -- [-2328.690] (-2333.358) (-2327.783) (-2335.637) * (-2327.524) (-2329.927) [-2331.828] (-2336.821) -- 0:00:47 686000 -- [-2331.548] (-2339.288) (-2333.881) (-2333.008) * (-2325.164) (-2332.881) [-2331.676] (-2333.839) -- 0:00:47 686500 -- (-2332.267) [-2332.074] (-2341.850) (-2332.104) * (-2327.976) (-2332.798) (-2333.597) [-2333.364] -- 0:00:47 687000 -- [-2329.485] (-2331.551) (-2328.780) (-2334.038) * (-2332.705) [-2340.932] (-2330.720) (-2334.098) -- 0:00:47 687500 -- (-2328.029) (-2332.692) [-2334.285] (-2325.708) * (-2333.814) [-2335.527] (-2330.797) (-2332.465) -- 0:00:47 688000 -- (-2337.645) (-2334.821) (-2338.500) [-2332.242] * [-2334.265] (-2336.230) (-2333.135) (-2331.078) -- 0:00:47 688500 -- (-2338.993) (-2335.089) [-2330.421] (-2334.895) * (-2333.856) [-2331.194] (-2334.703) (-2340.238) -- 0:00:47 689000 -- (-2327.915) (-2338.112) [-2333.032] (-2338.193) * (-2334.951) [-2331.614] (-2335.191) (-2338.748) -- 0:00:46 689500 -- (-2333.153) [-2338.332] (-2335.818) (-2337.139) * (-2331.531) [-2331.587] (-2329.836) (-2331.125) -- 0:00:46 690000 -- (-2326.923) (-2341.115) [-2331.112] (-2331.163) * (-2335.191) (-2331.034) (-2334.824) [-2335.744] -- 0:00:46 Average standard deviation of split frequencies: 0.000000 690500 -- (-2329.375) (-2328.960) (-2334.857) [-2337.756] * (-2340.031) [-2327.592] (-2332.944) (-2333.188) -- 0:00:47 691000 -- (-2332.752) (-2331.418) (-2338.423) [-2330.119] * (-2333.591) [-2327.164] (-2329.451) (-2332.218) -- 0:00:46 691500 -- (-2331.184) [-2331.395] (-2332.415) (-2336.211) * (-2336.708) (-2331.422) [-2335.586] (-2336.367) -- 0:00:46 692000 -- (-2332.924) (-2329.935) (-2332.208) [-2326.992] * (-2335.900) (-2330.523) (-2330.206) [-2335.363] -- 0:00:46 692500 -- (-2330.676) (-2339.645) (-2333.205) [-2330.295] * (-2334.018) [-2329.516] (-2335.094) (-2337.416) -- 0:00:46 693000 -- (-2340.514) (-2334.340) (-2333.912) [-2335.883] * (-2333.533) (-2330.911) (-2333.560) [-2332.975] -- 0:00:46 693500 -- (-2326.981) (-2328.246) (-2329.332) [-2331.903] * (-2333.544) (-2336.290) [-2332.448] (-2333.894) -- 0:00:46 694000 -- [-2331.690] (-2328.351) (-2342.766) (-2335.614) * (-2331.839) [-2333.391] (-2331.680) (-2332.032) -- 0:00:46 694500 -- (-2327.279) [-2331.093] (-2336.152) (-2333.347) * (-2334.617) (-2328.461) (-2330.803) [-2331.356] -- 0:00:46 695000 -- [-2327.361] (-2336.923) (-2336.676) (-2334.879) * (-2332.188) (-2332.145) (-2333.028) [-2333.158] -- 0:00:46 Average standard deviation of split frequencies: 0.000000 695500 -- (-2333.407) (-2335.299) (-2334.112) [-2331.923] * [-2327.808] (-2333.265) (-2332.079) (-2341.141) -- 0:00:45 696000 -- (-2335.871) (-2338.080) (-2337.856) [-2331.689] * (-2331.549) (-2332.220) [-2332.315] (-2334.876) -- 0:00:45 696500 -- (-2333.003) (-2336.009) (-2339.547) [-2330.185] * (-2331.476) (-2336.763) [-2334.001] (-2326.698) -- 0:00:45 697000 -- [-2330.442] (-2330.384) (-2336.987) (-2334.194) * (-2335.065) (-2337.350) [-2333.208] (-2329.892) -- 0:00:46 697500 -- [-2329.449] (-2330.242) (-2342.859) (-2328.655) * (-2336.468) [-2330.264] (-2336.185) (-2331.137) -- 0:00:45 698000 -- [-2329.024] (-2330.145) (-2334.376) (-2332.903) * (-2329.526) [-2334.185] (-2334.055) (-2332.259) -- 0:00:45 698500 -- (-2331.077) [-2332.043] (-2334.817) (-2336.166) * (-2327.489) (-2332.226) (-2344.353) [-2330.685] -- 0:00:45 699000 -- (-2332.964) [-2333.321] (-2332.327) (-2334.170) * (-2331.232) (-2332.278) (-2334.002) [-2331.415] -- 0:00:45 699500 -- (-2335.320) (-2330.377) (-2331.881) [-2333.403] * (-2344.692) (-2333.478) (-2331.237) [-2331.191] -- 0:00:45 700000 -- (-2331.287) (-2329.005) (-2336.999) [-2330.021] * (-2339.592) [-2331.777] (-2332.815) (-2327.235) -- 0:00:45 Average standard deviation of split frequencies: 0.000000 700500 -- (-2330.087) (-2332.260) (-2331.219) [-2331.992] * (-2336.967) [-2332.633] (-2331.964) (-2329.159) -- 0:00:45 701000 -- (-2329.873) (-2327.657) (-2326.858) [-2331.857] * (-2333.528) (-2335.713) (-2334.784) [-2335.709] -- 0:00:45 701500 -- (-2331.370) (-2335.965) [-2336.424] (-2332.284) * [-2328.786] (-2338.907) (-2331.882) (-2337.079) -- 0:00:45 702000 -- (-2337.091) (-2344.326) [-2332.733] (-2332.423) * (-2330.924) (-2331.657) [-2330.736] (-2329.418) -- 0:00:44 702500 -- (-2336.009) [-2333.460] (-2338.470) (-2325.518) * (-2333.625) [-2334.492] (-2330.546) (-2333.761) -- 0:00:44 703000 -- [-2337.118] (-2333.906) (-2332.540) (-2338.870) * (-2334.217) (-2332.040) (-2329.679) [-2329.691] -- 0:00:44 703500 -- (-2330.153) (-2335.207) (-2331.172) [-2327.969] * (-2335.480) [-2332.379] (-2329.998) (-2332.242) -- 0:00:45 704000 -- (-2333.471) (-2330.314) [-2330.753] (-2333.052) * (-2332.010) (-2328.388) [-2331.500] (-2332.107) -- 0:00:44 704500 -- (-2332.639) (-2333.079) (-2339.195) [-2334.767] * (-2332.799) [-2337.733] (-2339.713) (-2336.082) -- 0:00:44 705000 -- (-2336.639) (-2333.474) [-2329.777] (-2337.863) * (-2331.167) [-2337.301] (-2333.238) (-2342.101) -- 0:00:44 Average standard deviation of split frequencies: 0.000000 705500 -- (-2333.392) (-2333.480) (-2334.522) [-2334.971] * (-2334.335) (-2335.517) (-2337.726) [-2332.461] -- 0:00:44 706000 -- (-2330.343) [-2337.529] (-2335.134) (-2337.950) * (-2333.546) [-2332.493] (-2332.446) (-2333.408) -- 0:00:44 706500 -- [-2335.501] (-2328.443) (-2332.501) (-2333.966) * [-2332.595] (-2335.885) (-2332.477) (-2328.464) -- 0:00:44 707000 -- [-2337.341] (-2332.469) (-2334.594) (-2329.186) * (-2335.436) [-2332.694] (-2333.556) (-2328.778) -- 0:00:44 707500 -- (-2330.654) [-2333.262] (-2333.440) (-2336.957) * (-2330.770) [-2333.509] (-2337.753) (-2332.107) -- 0:00:44 708000 -- [-2333.153] (-2334.107) (-2329.573) (-2337.964) * (-2343.502) (-2336.236) [-2335.325] (-2332.686) -- 0:00:44 708500 -- (-2332.616) [-2331.037] (-2330.882) (-2340.214) * (-2337.753) (-2332.754) [-2331.091] (-2334.934) -- 0:00:44 709000 -- (-2337.665) [-2328.072] (-2336.542) (-2339.735) * (-2337.477) (-2333.928) [-2331.876] (-2332.280) -- 0:00:43 709500 -- (-2340.129) [-2328.780] (-2335.155) (-2343.192) * [-2331.703] (-2329.840) (-2331.919) (-2331.630) -- 0:00:43 710000 -- (-2340.129) [-2328.328] (-2335.383) (-2334.831) * (-2330.803) [-2333.410] (-2337.055) (-2329.102) -- 0:00:44 Average standard deviation of split frequencies: 0.000000 710500 -- (-2333.862) [-2334.048] (-2329.482) (-2333.785) * (-2333.838) (-2332.185) (-2339.460) [-2331.864] -- 0:00:44 711000 -- (-2338.370) [-2330.507] (-2334.271) (-2331.018) * (-2331.356) [-2331.501] (-2333.335) (-2349.889) -- 0:00:43 711500 -- (-2337.034) (-2330.747) [-2335.685] (-2327.761) * (-2334.643) [-2329.695] (-2329.358) (-2330.592) -- 0:00:43 712000 -- (-2335.069) [-2331.684] (-2327.991) (-2331.776) * (-2334.632) (-2326.888) [-2339.818] (-2329.223) -- 0:00:43 712500 -- (-2332.240) (-2332.741) (-2326.398) [-2335.956] * (-2334.906) (-2331.210) [-2335.576] (-2331.062) -- 0:00:43 713000 -- (-2334.772) (-2331.181) [-2331.016] (-2334.477) * (-2333.554) (-2330.004) [-2338.834] (-2330.105) -- 0:00:43 713500 -- (-2334.034) [-2332.231] (-2336.254) (-2332.643) * (-2335.812) (-2330.493) [-2332.937] (-2332.454) -- 0:00:43 714000 -- (-2331.008) (-2333.505) [-2335.014] (-2329.123) * (-2337.534) [-2334.128] (-2333.216) (-2334.199) -- 0:00:43 714500 -- (-2337.562) [-2330.245] (-2348.009) (-2329.276) * (-2334.558) [-2339.010] (-2331.879) (-2337.915) -- 0:00:43 715000 -- (-2329.603) (-2332.143) (-2337.441) [-2328.114] * (-2333.019) (-2329.371) (-2331.104) [-2326.175] -- 0:00:43 Average standard deviation of split frequencies: 0.000000 715500 -- [-2334.900] (-2331.728) (-2331.036) (-2329.661) * [-2334.073] (-2335.929) (-2331.511) (-2336.675) -- 0:00:42 716000 -- [-2329.508] (-2329.941) (-2339.757) (-2332.792) * (-2333.496) (-2334.228) (-2329.232) [-2327.408] -- 0:00:42 716500 -- [-2334.539] (-2333.049) (-2349.233) (-2334.595) * (-2334.221) (-2327.732) [-2328.646] (-2337.357) -- 0:00:43 717000 -- (-2332.355) (-2331.712) (-2330.408) [-2329.279] * (-2333.789) [-2332.612] (-2330.885) (-2331.134) -- 0:00:43 717500 -- (-2336.133) (-2332.277) (-2333.204) [-2331.903] * (-2331.527) (-2333.684) (-2329.064) [-2339.231] -- 0:00:42 718000 -- [-2332.840] (-2328.880) (-2332.287) (-2326.080) * (-2331.648) [-2328.933] (-2330.676) (-2331.069) -- 0:00:42 718500 -- (-2331.456) [-2332.307] (-2332.566) (-2328.036) * (-2343.869) [-2336.049] (-2331.237) (-2330.914) -- 0:00:42 719000 -- (-2336.460) (-2330.230) [-2329.881] (-2333.767) * (-2338.703) (-2334.064) (-2334.455) [-2329.252] -- 0:00:42 719500 -- [-2329.812] (-2336.052) (-2332.140) (-2335.409) * (-2335.997) (-2332.092) (-2330.063) [-2329.061] -- 0:00:42 720000 -- (-2338.992) (-2329.825) (-2334.680) [-2328.274] * (-2334.704) [-2326.630] (-2335.301) (-2332.281) -- 0:00:42 Average standard deviation of split frequencies: 0.000000 720500 -- (-2332.127) (-2334.625) (-2338.557) [-2333.984] * (-2339.767) (-2333.461) (-2326.564) [-2329.664] -- 0:00:42 721000 -- (-2328.813) (-2337.474) (-2332.684) [-2330.158] * [-2338.963] (-2340.135) (-2335.320) (-2336.659) -- 0:00:42 721500 -- (-2338.554) [-2333.591] (-2331.203) (-2329.188) * (-2330.776) [-2332.659] (-2332.003) (-2331.443) -- 0:00:42 722000 -- [-2333.101] (-2327.833) (-2331.831) (-2333.830) * (-2331.068) (-2332.157) (-2339.716) [-2333.651] -- 0:00:41 722500 -- [-2334.541] (-2333.920) (-2333.429) (-2330.810) * [-2338.521] (-2329.525) (-2331.337) (-2330.750) -- 0:00:41 723000 -- (-2334.083) [-2332.304] (-2334.591) (-2329.573) * (-2336.752) (-2330.225) (-2331.050) [-2330.782] -- 0:00:42 723500 -- (-2333.836) (-2342.126) [-2332.285] (-2333.674) * (-2331.766) (-2332.754) (-2343.120) [-2330.897] -- 0:00:42 724000 -- (-2333.922) (-2333.021) [-2330.305] (-2330.789) * (-2333.449) [-2333.273] (-2331.291) (-2335.225) -- 0:00:41 724500 -- (-2333.900) [-2329.089] (-2334.815) (-2328.332) * (-2333.877) (-2333.311) (-2337.521) [-2334.041] -- 0:00:41 725000 -- (-2336.389) (-2334.361) (-2329.117) [-2333.752] * (-2331.101) [-2329.343] (-2331.790) (-2330.353) -- 0:00:41 Average standard deviation of split frequencies: 0.000000 725500 -- [-2329.827] (-2333.015) (-2329.975) (-2331.160) * [-2335.858] (-2334.803) (-2337.784) (-2332.501) -- 0:00:41 726000 -- [-2336.973] (-2331.333) (-2330.388) (-2329.669) * (-2333.555) (-2333.958) [-2335.610] (-2333.016) -- 0:00:41 726500 -- [-2336.478] (-2329.784) (-2329.716) (-2330.650) * (-2331.943) [-2330.419] (-2331.785) (-2339.693) -- 0:00:41 727000 -- [-2337.949] (-2334.229) (-2337.145) (-2331.780) * [-2330.377] (-2331.505) (-2335.335) (-2340.957) -- 0:00:41 727500 -- (-2335.033) (-2335.705) [-2331.644] (-2332.174) * (-2338.566) [-2327.402] (-2332.176) (-2335.384) -- 0:00:41 728000 -- (-2331.546) (-2334.845) (-2335.263) [-2332.327] * (-2328.696) (-2328.471) [-2336.177] (-2336.343) -- 0:00:41 728500 -- (-2334.927) (-2337.225) [-2329.973] (-2331.427) * (-2332.113) [-2329.224] (-2334.403) (-2333.601) -- 0:00:40 729000 -- [-2329.895] (-2332.266) (-2329.732) (-2326.771) * [-2334.452] (-2333.785) (-2331.739) (-2336.505) -- 0:00:40 729500 -- (-2327.278) (-2337.368) [-2329.093] (-2330.153) * (-2328.993) [-2326.507] (-2340.500) (-2334.006) -- 0:00:41 730000 -- (-2339.523) (-2341.133) [-2326.966] (-2328.435) * (-2335.803) (-2335.108) [-2331.969] (-2334.815) -- 0:00:41 Average standard deviation of split frequencies: 0.000000 730500 -- (-2332.219) [-2331.815] (-2330.523) (-2333.113) * (-2333.670) (-2333.221) (-2337.284) [-2327.479] -- 0:00:40 731000 -- (-2329.250) (-2328.404) [-2330.619] (-2330.822) * (-2335.989) [-2336.341] (-2333.283) (-2335.464) -- 0:00:40 731500 -- (-2333.223) [-2333.622] (-2337.441) (-2330.834) * (-2333.263) [-2334.273] (-2328.497) (-2337.615) -- 0:00:40 732000 -- (-2330.714) [-2335.289] (-2330.551) (-2331.739) * (-2336.580) [-2331.246] (-2332.313) (-2330.970) -- 0:00:40 732500 -- (-2330.501) [-2332.507] (-2332.286) (-2331.778) * (-2330.973) (-2330.819) [-2328.936] (-2331.108) -- 0:00:40 733000 -- (-2341.916) (-2334.815) (-2333.820) [-2331.821] * (-2334.507) (-2334.246) [-2328.187] (-2327.459) -- 0:00:40 733500 -- (-2327.621) [-2329.711] (-2328.868) (-2333.155) * [-2327.933] (-2340.029) (-2333.695) (-2329.206) -- 0:00:40 734000 -- [-2325.492] (-2330.915) (-2331.948) (-2333.266) * (-2331.045) (-2343.591) (-2334.423) [-2330.693] -- 0:00:40 734500 -- [-2332.159] (-2331.801) (-2337.357) (-2330.308) * (-2334.237) (-2335.039) [-2328.123] (-2338.457) -- 0:00:40 735000 -- (-2330.095) (-2329.629) (-2330.489) [-2327.704] * (-2334.497) (-2329.214) [-2329.931] (-2336.663) -- 0:00:40 Average standard deviation of split frequencies: 0.000000 735500 -- (-2338.008) (-2331.852) (-2329.593) [-2329.276] * (-2329.739) (-2331.693) (-2332.981) [-2329.303] -- 0:00:39 736000 -- (-2331.738) (-2329.306) (-2334.261) [-2329.790] * (-2332.914) (-2341.023) (-2336.194) [-2329.616] -- 0:00:40 736500 -- (-2333.433) [-2328.042] (-2338.261) (-2335.370) * (-2329.015) [-2333.050] (-2331.859) (-2334.561) -- 0:00:40 737000 -- (-2328.586) (-2333.002) (-2331.938) [-2329.928] * [-2328.399] (-2332.388) (-2343.424) (-2336.699) -- 0:00:39 737500 -- (-2333.475) (-2330.234) (-2331.015) [-2333.338] * [-2330.249] (-2333.206) (-2334.595) (-2331.456) -- 0:00:39 738000 -- [-2334.494] (-2333.158) (-2341.007) (-2336.364) * (-2334.193) [-2328.033] (-2329.950) (-2332.396) -- 0:00:39 738500 -- (-2329.086) (-2334.987) [-2336.422] (-2336.650) * (-2331.748) [-2330.843] (-2333.268) (-2331.518) -- 0:00:39 739000 -- [-2333.854] (-2331.488) (-2332.315) (-2334.997) * (-2337.145) (-2330.955) [-2331.589] (-2327.596) -- 0:00:39 739500 -- [-2327.394] (-2338.237) (-2332.515) (-2341.625) * (-2330.556) (-2330.150) (-2333.219) [-2331.939] -- 0:00:39 740000 -- [-2328.858] (-2332.539) (-2333.363) (-2337.380) * (-2338.959) (-2331.233) (-2330.709) [-2330.277] -- 0:00:39 Average standard deviation of split frequencies: 0.000000 740500 -- (-2327.189) [-2330.018] (-2335.333) (-2332.544) * [-2332.551] (-2334.734) (-2333.558) (-2336.215) -- 0:00:39 741000 -- [-2328.323] (-2334.081) (-2337.954) (-2330.461) * (-2329.513) [-2327.990] (-2344.888) (-2337.799) -- 0:00:39 741500 -- [-2335.144] (-2334.202) (-2340.996) (-2333.483) * (-2333.785) [-2330.731] (-2344.177) (-2334.042) -- 0:00:39 742000 -- (-2334.081) (-2332.409) [-2333.826] (-2334.102) * (-2335.243) [-2334.364] (-2330.453) (-2329.828) -- 0:00:38 742500 -- (-2325.274) [-2328.058] (-2333.559) (-2332.439) * (-2330.516) (-2326.736) [-2333.225] (-2328.553) -- 0:00:39 743000 -- (-2331.481) (-2331.591) [-2334.174] (-2332.523) * (-2331.254) (-2336.485) (-2336.254) [-2338.866] -- 0:00:39 743500 -- [-2329.053] (-2333.322) (-2333.554) (-2337.677) * (-2329.882) (-2332.330) (-2339.297) [-2338.525] -- 0:00:38 744000 -- (-2327.760) [-2338.109] (-2338.778) (-2337.241) * (-2337.131) (-2336.017) [-2333.807] (-2330.273) -- 0:00:38 744500 -- [-2327.961] (-2334.382) (-2335.620) (-2332.258) * (-2333.359) [-2336.128] (-2331.702) (-2336.392) -- 0:00:38 745000 -- (-2328.523) (-2339.926) [-2335.202] (-2325.026) * [-2328.772] (-2333.439) (-2332.019) (-2337.860) -- 0:00:38 Average standard deviation of split frequencies: 0.000000 745500 -- (-2330.692) (-2338.514) (-2331.881) [-2333.050] * (-2335.157) [-2333.209] (-2337.918) (-2330.964) -- 0:00:38 746000 -- (-2334.530) (-2339.977) (-2333.094) [-2332.796] * (-2326.130) [-2330.611] (-2331.973) (-2328.042) -- 0:00:38 746500 -- (-2346.447) (-2334.226) (-2329.984) [-2334.097] * [-2335.005] (-2331.843) (-2330.083) (-2332.414) -- 0:00:38 747000 -- (-2335.561) (-2331.456) [-2331.193] (-2333.283) * [-2330.800] (-2336.045) (-2334.741) (-2328.839) -- 0:00:38 747500 -- (-2335.006) [-2330.792] (-2328.617) (-2334.406) * (-2333.231) [-2335.424] (-2334.660) (-2332.173) -- 0:00:38 748000 -- (-2330.210) (-2331.504) (-2335.032) [-2334.713] * [-2336.868] (-2334.990) (-2329.977) (-2334.150) -- 0:00:38 748500 -- (-2331.550) (-2330.102) (-2350.165) [-2332.205] * (-2337.294) [-2327.319] (-2331.955) (-2337.687) -- 0:00:37 749000 -- (-2331.033) (-2339.118) [-2332.592] (-2332.847) * (-2333.296) (-2327.168) [-2333.279] (-2331.796) -- 0:00:38 749500 -- (-2331.110) (-2328.225) (-2337.720) [-2328.824] * (-2338.551) [-2327.084] (-2331.649) (-2328.593) -- 0:00:38 750000 -- [-2333.436] (-2334.034) (-2332.988) (-2329.555) * (-2336.884) [-2330.409] (-2330.678) (-2328.153) -- 0:00:38 Average standard deviation of split frequencies: 0.000000 750500 -- (-2342.929) (-2329.984) (-2332.363) [-2331.374] * (-2337.397) (-2329.651) [-2331.796] (-2332.513) -- 0:00:37 751000 -- (-2333.623) (-2328.511) (-2333.336) [-2332.492] * (-2329.209) (-2333.943) [-2332.944] (-2330.827) -- 0:00:37 751500 -- (-2333.873) (-2332.527) [-2331.831] (-2326.451) * (-2328.102) (-2327.988) (-2336.231) [-2331.920] -- 0:00:37 752000 -- (-2333.915) (-2331.970) (-2332.499) [-2332.282] * (-2331.669) (-2333.028) (-2334.213) [-2331.183] -- 0:00:37 752500 -- (-2332.771) [-2333.147] (-2331.548) (-2334.641) * [-2336.257] (-2330.913) (-2332.476) (-2331.189) -- 0:00:37 753000 -- (-2331.548) [-2336.069] (-2334.347) (-2337.446) * (-2330.975) (-2330.908) [-2332.990] (-2328.934) -- 0:00:37 753500 -- (-2330.543) [-2334.495] (-2330.358) (-2334.825) * (-2332.426) (-2334.795) [-2337.978] (-2334.431) -- 0:00:37 754000 -- (-2331.598) (-2336.948) [-2335.975] (-2340.291) * [-2331.401] (-2329.385) (-2333.825) (-2331.928) -- 0:00:37 754500 -- (-2327.812) (-2332.702) [-2333.008] (-2335.788) * (-2330.955) (-2334.940) (-2329.970) [-2329.482] -- 0:00:37 755000 -- (-2330.484) (-2339.014) [-2331.943] (-2336.009) * [-2328.235] (-2334.844) (-2332.943) (-2329.960) -- 0:00:36 Average standard deviation of split frequencies: 0.000000 755500 -- (-2333.872) (-2336.093) (-2338.117) [-2332.210] * (-2331.516) (-2335.325) (-2336.227) [-2328.781] -- 0:00:37 756000 -- (-2333.278) (-2335.192) [-2337.663] (-2334.796) * (-2331.062) [-2329.698] (-2334.470) (-2329.827) -- 0:00:37 756500 -- (-2331.022) [-2329.827] (-2332.676) (-2331.385) * [-2337.078] (-2331.767) (-2342.258) (-2331.060) -- 0:00:37 757000 -- (-2330.167) (-2333.713) (-2334.082) [-2329.585] * (-2331.638) [-2327.505] (-2332.833) (-2330.998) -- 0:00:36 757500 -- (-2345.030) (-2332.326) [-2337.053] (-2331.178) * [-2331.583] (-2334.190) (-2335.524) (-2343.718) -- 0:00:36 758000 -- [-2329.058] (-2329.978) (-2334.689) (-2332.537) * (-2333.073) (-2343.059) [-2326.507] (-2338.058) -- 0:00:36 758500 -- (-2341.429) (-2336.952) (-2333.095) [-2332.310] * (-2337.631) (-2331.130) [-2335.603] (-2332.602) -- 0:00:36 759000 -- (-2332.585) (-2331.554) [-2333.355] (-2334.165) * (-2340.428) (-2333.776) (-2331.968) [-2328.427] -- 0:00:36 759500 -- (-2329.340) [-2328.235] (-2334.410) (-2338.615) * (-2336.246) (-2328.906) (-2335.381) [-2331.806] -- 0:00:36 760000 -- (-2329.255) (-2331.038) (-2334.205) [-2335.505] * (-2338.018) (-2341.883) [-2332.886] (-2339.347) -- 0:00:36 Average standard deviation of split frequencies: 0.000000 760500 -- [-2335.318] (-2330.943) (-2331.116) (-2330.646) * (-2336.682) [-2331.549] (-2336.489) (-2335.701) -- 0:00:36 761000 -- (-2330.846) [-2332.160] (-2335.081) (-2332.587) * (-2335.963) [-2333.886] (-2332.062) (-2334.773) -- 0:00:36 761500 -- [-2336.670] (-2345.011) (-2326.919) (-2331.981) * (-2330.745) (-2330.453) (-2334.443) [-2330.808] -- 0:00:36 762000 -- (-2328.945) (-2334.728) [-2324.544] (-2334.969) * (-2340.223) (-2342.329) [-2328.632] (-2330.632) -- 0:00:36 762500 -- (-2332.992) [-2331.917] (-2333.038) (-2339.824) * (-2339.728) (-2331.681) (-2331.691) [-2334.489] -- 0:00:36 763000 -- (-2337.682) (-2333.093) (-2332.416) [-2331.889] * (-2331.114) (-2333.460) (-2328.346) [-2330.506] -- 0:00:36 763500 -- (-2335.714) (-2331.673) [-2329.094] (-2328.071) * [-2334.915] (-2328.587) (-2336.729) (-2328.903) -- 0:00:35 764000 -- (-2337.170) (-2328.509) [-2331.214] (-2335.867) * (-2331.387) (-2329.136) [-2334.168] (-2334.555) -- 0:00:35 764500 -- (-2336.225) (-2329.888) (-2330.938) [-2330.758] * (-2333.368) (-2333.678) (-2331.274) [-2332.912] -- 0:00:35 765000 -- (-2330.662) (-2335.203) (-2327.724) [-2330.842] * (-2338.836) (-2332.923) (-2341.110) [-2330.007] -- 0:00:35 Average standard deviation of split frequencies: 0.000000 765500 -- (-2337.355) (-2332.032) [-2330.814] (-2334.154) * (-2333.810) [-2326.120] (-2327.645) (-2329.546) -- 0:00:35 766000 -- (-2331.754) [-2333.609] (-2337.563) (-2330.406) * (-2332.260) (-2328.874) (-2329.434) [-2330.597] -- 0:00:35 766500 -- (-2329.907) [-2328.823] (-2338.152) (-2334.445) * (-2338.548) (-2330.200) [-2333.764] (-2331.756) -- 0:00:35 767000 -- (-2327.778) (-2335.324) (-2328.387) [-2336.933] * [-2333.417] (-2332.677) (-2333.708) (-2329.543) -- 0:00:35 767500 -- (-2330.705) (-2329.159) [-2330.995] (-2332.788) * (-2333.548) [-2331.684] (-2335.991) (-2331.636) -- 0:00:35 768000 -- [-2331.028] (-2331.556) (-2342.114) (-2339.821) * (-2340.789) (-2343.694) [-2331.309] (-2326.666) -- 0:00:35 768500 -- (-2327.204) [-2331.018] (-2334.719) (-2333.638) * [-2333.633] (-2335.452) (-2330.016) (-2330.012) -- 0:00:35 769000 -- (-2332.418) (-2338.594) [-2333.690] (-2338.246) * (-2335.000) [-2333.876] (-2333.515) (-2332.656) -- 0:00:35 769500 -- (-2332.421) (-2333.709) [-2337.312] (-2337.745) * (-2328.991) [-2331.085] (-2340.033) (-2331.983) -- 0:00:35 770000 -- [-2329.009] (-2332.593) (-2332.804) (-2334.091) * (-2333.260) (-2335.520) (-2335.671) [-2331.683] -- 0:00:34 Average standard deviation of split frequencies: 0.000000 770500 -- (-2336.554) (-2331.934) [-2332.534] (-2335.680) * (-2333.006) (-2331.853) (-2333.544) [-2333.875] -- 0:00:34 771000 -- (-2332.629) (-2332.443) (-2338.021) [-2333.500] * (-2338.545) (-2332.840) [-2339.311] (-2330.589) -- 0:00:34 771500 -- [-2328.931] (-2331.518) (-2334.584) (-2333.081) * (-2343.081) [-2333.296] (-2337.066) (-2330.851) -- 0:00:34 772000 -- (-2329.709) (-2328.654) [-2331.525] (-2344.221) * (-2346.429) [-2336.393] (-2332.245) (-2329.641) -- 0:00:34 772500 -- (-2329.135) [-2334.187] (-2329.198) (-2338.376) * [-2339.516] (-2339.064) (-2329.808) (-2328.944) -- 0:00:34 773000 -- (-2328.438) [-2337.793] (-2333.413) (-2336.221) * (-2331.284) (-2348.213) (-2327.964) [-2331.643] -- 0:00:34 773500 -- (-2336.183) (-2329.923) (-2334.126) [-2328.797] * (-2333.746) (-2331.774) (-2328.013) [-2334.067] -- 0:00:34 774000 -- (-2333.806) (-2326.355) [-2332.582] (-2327.865) * (-2331.377) [-2332.110] (-2329.372) (-2339.952) -- 0:00:34 774500 -- (-2334.611) [-2330.402] (-2338.518) (-2337.310) * (-2331.503) (-2329.155) [-2332.413] (-2328.926) -- 0:00:34 775000 -- [-2332.575] (-2335.988) (-2335.905) (-2333.747) * (-2332.074) (-2338.806) [-2333.066] (-2342.526) -- 0:00:34 Average standard deviation of split frequencies: 0.000000 775500 -- (-2337.930) [-2330.250] (-2330.605) (-2331.276) * (-2332.629) (-2332.449) [-2330.052] (-2338.068) -- 0:00:34 776000 -- (-2328.460) (-2337.169) [-2334.710] (-2333.218) * (-2333.328) [-2331.899] (-2334.120) (-2332.494) -- 0:00:34 776500 -- [-2331.041] (-2331.503) (-2333.091) (-2335.093) * [-2334.060] (-2337.124) (-2336.235) (-2331.425) -- 0:00:33 777000 -- (-2330.841) (-2335.346) [-2330.445] (-2345.720) * [-2331.641] (-2332.649) (-2335.388) (-2328.992) -- 0:00:33 777500 -- [-2331.121] (-2334.914) (-2329.192) (-2330.098) * (-2332.828) (-2328.679) (-2335.251) [-2331.647] -- 0:00:33 778000 -- (-2337.844) (-2337.626) (-2333.073) [-2335.842] * (-2334.451) [-2328.709] (-2332.344) (-2331.698) -- 0:00:33 778500 -- (-2330.781) [-2331.921] (-2331.331) (-2329.417) * (-2336.637) [-2334.329] (-2335.119) (-2327.210) -- 0:00:33 779000 -- (-2328.699) (-2332.932) [-2328.787] (-2333.053) * (-2328.869) (-2333.513) (-2333.469) [-2336.605] -- 0:00:33 779500 -- [-2332.175] (-2329.582) (-2334.420) (-2337.036) * (-2328.372) [-2330.361] (-2338.631) (-2333.638) -- 0:00:33 780000 -- (-2337.015) [-2336.925] (-2331.973) (-2327.893) * [-2328.708] (-2334.427) (-2334.049) (-2336.149) -- 0:00:33 Average standard deviation of split frequencies: 0.000000 780500 -- (-2341.620) (-2337.363) (-2331.781) [-2331.267] * [-2335.302] (-2331.568) (-2329.797) (-2329.305) -- 0:00:33 781000 -- (-2339.673) (-2330.773) [-2331.549] (-2332.179) * [-2336.557] (-2332.502) (-2328.971) (-2334.287) -- 0:00:33 781500 -- (-2336.887) [-2333.901] (-2334.758) (-2333.957) * (-2331.397) (-2337.354) [-2332.049] (-2331.566) -- 0:00:32 782000 -- (-2328.976) [-2336.610] (-2335.215) (-2344.691) * (-2335.485) (-2331.998) [-2330.073] (-2334.364) -- 0:00:33 782500 -- (-2331.572) (-2333.596) [-2325.824] (-2337.352) * [-2329.151] (-2334.507) (-2329.716) (-2331.075) -- 0:00:33 783000 -- (-2329.502) (-2332.902) [-2337.824] (-2334.357) * (-2329.479) [-2329.493] (-2328.281) (-2338.304) -- 0:00:32 783500 -- (-2332.676) (-2329.507) [-2332.161] (-2333.162) * (-2335.185) (-2328.908) [-2331.246] (-2341.989) -- 0:00:32 784000 -- (-2334.813) (-2334.240) [-2325.747] (-2335.078) * (-2329.220) (-2337.758) (-2328.422) [-2331.148] -- 0:00:32 784500 -- (-2331.211) [-2331.811] (-2331.541) (-2335.933) * [-2330.698] (-2332.795) (-2335.257) (-2339.327) -- 0:00:32 785000 -- (-2338.050) (-2336.336) (-2330.839) [-2333.414] * (-2332.933) (-2333.354) [-2329.221] (-2330.030) -- 0:00:32 Average standard deviation of split frequencies: 0.000000 785500 -- [-2332.398] (-2333.119) (-2334.412) (-2332.490) * (-2338.215) [-2335.666] (-2332.409) (-2335.000) -- 0:00:32 786000 -- (-2338.382) (-2334.524) [-2331.550] (-2338.066) * (-2335.275) (-2335.883) [-2334.499] (-2333.748) -- 0:00:32 786500 -- [-2333.230] (-2325.943) (-2334.352) (-2345.159) * [-2325.768] (-2330.429) (-2334.859) (-2329.998) -- 0:00:32 787000 -- (-2327.753) [-2330.809] (-2332.867) (-2340.787) * (-2339.716) [-2336.844] (-2333.320) (-2331.635) -- 0:00:32 787500 -- [-2330.208] (-2334.073) (-2337.914) (-2334.122) * (-2340.159) (-2339.581) (-2342.808) [-2331.686] -- 0:00:32 788000 -- [-2334.747] (-2330.973) (-2346.748) (-2333.360) * (-2332.881) [-2336.780] (-2340.681) (-2335.562) -- 0:00:32 788500 -- (-2330.107) (-2334.454) (-2338.804) [-2332.102] * (-2333.850) (-2337.111) (-2331.418) [-2331.533] -- 0:00:32 789000 -- [-2332.014] (-2331.146) (-2336.705) (-2329.595) * (-2337.712) (-2339.084) [-2331.330] (-2334.967) -- 0:00:32 789500 -- (-2334.395) [-2334.146] (-2330.414) (-2330.291) * (-2334.168) (-2331.482) (-2335.858) [-2326.662] -- 0:00:31 790000 -- (-2331.620) [-2330.608] (-2334.026) (-2328.286) * [-2329.886] (-2332.568) (-2332.134) (-2330.394) -- 0:00:31 Average standard deviation of split frequencies: 0.000000 790500 -- (-2325.491) (-2333.520) (-2342.367) [-2331.354] * [-2335.292] (-2331.060) (-2327.104) (-2333.896) -- 0:00:31 791000 -- (-2331.830) (-2335.949) (-2333.426) [-2329.221] * [-2331.899] (-2329.087) (-2333.219) (-2338.121) -- 0:00:31 791500 -- (-2336.811) [-2329.849] (-2335.762) (-2331.374) * (-2331.651) (-2330.577) (-2332.503) [-2328.610] -- 0:00:31 792000 -- (-2330.537) [-2335.964] (-2339.082) (-2333.141) * (-2329.497) (-2332.187) (-2331.221) [-2329.747] -- 0:00:31 792500 -- (-2335.713) (-2339.616) [-2330.865] (-2331.536) * (-2329.879) (-2340.979) (-2328.093) [-2336.133] -- 0:00:31 793000 -- (-2328.882) [-2333.208] (-2329.594) (-2334.500) * (-2339.231) (-2332.837) (-2331.205) [-2332.760] -- 0:00:31 793500 -- (-2326.403) [-2336.471] (-2336.623) (-2340.969) * (-2337.309) (-2332.413) [-2330.123] (-2334.244) -- 0:00:31 794000 -- (-2338.180) [-2332.391] (-2342.847) (-2330.476) * (-2333.488) [-2330.251] (-2334.181) (-2332.197) -- 0:00:31 794500 -- (-2330.070) [-2335.316] (-2339.193) (-2329.994) * (-2329.844) [-2335.386] (-2341.124) (-2333.556) -- 0:00:31 795000 -- (-2328.660) (-2333.604) (-2339.803) [-2331.540] * (-2331.737) (-2336.905) [-2334.171] (-2330.457) -- 0:00:31 Average standard deviation of split frequencies: 0.000000 795500 -- (-2328.947) (-2332.230) (-2335.430) [-2336.545] * (-2326.993) [-2331.471] (-2329.888) (-2327.347) -- 0:00:31 796000 -- [-2339.130] (-2328.186) (-2335.115) (-2331.065) * (-2334.674) [-2330.030] (-2327.846) (-2332.167) -- 0:00:31 796500 -- (-2331.727) (-2330.578) [-2335.135] (-2335.746) * [-2333.139] (-2332.814) (-2326.327) (-2337.455) -- 0:00:30 797000 -- (-2327.738) [-2329.621] (-2333.763) (-2335.810) * (-2330.984) (-2330.143) [-2333.427] (-2337.221) -- 0:00:30 797500 -- [-2330.655] (-2335.669) (-2341.156) (-2330.547) * (-2339.316) [-2340.408] (-2332.342) (-2333.895) -- 0:00:30 798000 -- [-2329.706] (-2337.790) (-2331.526) (-2329.627) * (-2341.029) (-2333.650) [-2329.272] (-2328.834) -- 0:00:30 798500 -- [-2345.026] (-2328.561) (-2331.984) (-2334.138) * (-2328.698) (-2332.157) (-2334.682) [-2335.577] -- 0:00:30 799000 -- (-2332.254) [-2333.854] (-2333.997) (-2336.529) * (-2336.193) (-2334.236) [-2335.118] (-2329.966) -- 0:00:30 799500 -- [-2336.208] (-2329.324) (-2330.693) (-2335.168) * [-2332.744] (-2326.737) (-2331.010) (-2334.865) -- 0:00:30 800000 -- (-2331.080) [-2327.315] (-2337.431) (-2329.344) * (-2336.178) (-2330.867) (-2333.160) [-2336.232] -- 0:00:30 Average standard deviation of split frequencies: 0.000000 800500 -- [-2329.206] (-2332.011) (-2337.047) (-2337.328) * (-2337.148) [-2327.666] (-2334.550) (-2337.466) -- 0:00:30 801000 -- (-2331.761) (-2337.842) (-2338.770) [-2335.529] * (-2333.685) (-2332.365) (-2331.567) [-2341.223] -- 0:00:30 801500 -- (-2331.524) (-2329.570) (-2334.055) [-2335.179] * (-2331.178) [-2331.168] (-2330.401) (-2332.237) -- 0:00:29 802000 -- (-2330.341) (-2331.303) (-2338.564) [-2337.103] * (-2335.317) [-2330.111] (-2331.433) (-2337.756) -- 0:00:30 802500 -- [-2335.509] (-2333.321) (-2342.247) (-2327.537) * [-2330.770] (-2333.529) (-2337.491) (-2339.453) -- 0:00:30 803000 -- (-2330.716) (-2333.700) (-2338.459) [-2329.449] * (-2330.868) [-2333.077] (-2333.103) (-2330.191) -- 0:00:29 803500 -- (-2331.019) (-2341.078) [-2336.807] (-2333.134) * (-2335.391) (-2331.103) (-2328.823) [-2333.201] -- 0:00:29 804000 -- (-2337.451) (-2331.311) (-2328.923) [-2331.933] * [-2330.035] (-2338.149) (-2327.213) (-2334.455) -- 0:00:29 804500 -- (-2333.504) (-2330.978) [-2331.420] (-2333.456) * [-2330.066] (-2330.971) (-2331.632) (-2338.655) -- 0:00:29 805000 -- (-2335.862) (-2332.537) [-2328.351] (-2338.145) * [-2332.729] (-2331.674) (-2331.323) (-2336.574) -- 0:00:29 Average standard deviation of split frequencies: 0.000000 805500 -- [-2331.556] (-2331.775) (-2328.373) (-2334.609) * (-2342.299) (-2328.438) (-2344.248) [-2337.647] -- 0:00:29 806000 -- (-2330.825) [-2332.463] (-2328.112) (-2334.528) * (-2335.667) [-2326.609] (-2333.477) (-2332.938) -- 0:00:29 806500 -- (-2329.100) (-2330.392) [-2338.635] (-2337.935) * (-2330.958) (-2330.134) (-2330.550) [-2333.181] -- 0:00:29 807000 -- (-2330.181) (-2331.728) [-2331.161] (-2341.092) * [-2334.605] (-2333.402) (-2330.020) (-2335.963) -- 0:00:29 807500 -- (-2338.429) [-2328.347] (-2329.885) (-2334.504) * [-2331.241] (-2333.197) (-2330.042) (-2334.009) -- 0:00:29 808000 -- (-2331.042) (-2330.884) [-2330.429] (-2334.051) * [-2332.861] (-2335.049) (-2328.690) (-2329.987) -- 0:00:28 808500 -- (-2331.919) [-2329.354] (-2332.946) (-2330.038) * (-2337.131) (-2331.573) (-2336.136) [-2331.339] -- 0:00:29 809000 -- [-2327.746] (-2333.520) (-2334.929) (-2338.859) * (-2333.583) (-2335.691) [-2328.161] (-2335.152) -- 0:00:29 809500 -- (-2332.325) (-2332.762) [-2328.403] (-2332.491) * (-2332.596) [-2327.733] (-2336.076) (-2330.736) -- 0:00:28 810000 -- (-2332.290) [-2329.448] (-2333.417) (-2332.132) * [-2329.808] (-2328.198) (-2332.435) (-2339.718) -- 0:00:28 Average standard deviation of split frequencies: 0.000000 810500 -- [-2330.317] (-2338.645) (-2330.639) (-2331.551) * (-2333.930) (-2336.015) (-2327.647) [-2338.650] -- 0:00:28 811000 -- (-2334.918) [-2334.673] (-2332.699) (-2339.869) * (-2337.759) (-2335.160) [-2333.168] (-2333.466) -- 0:00:28 811500 -- (-2333.686) [-2327.795] (-2334.379) (-2335.997) * [-2331.546] (-2330.574) (-2329.973) (-2330.336) -- 0:00:28 812000 -- (-2333.820) (-2327.168) (-2338.078) [-2337.123] * (-2335.239) [-2328.675] (-2332.387) (-2331.948) -- 0:00:28 812500 -- [-2336.412] (-2331.222) (-2333.529) (-2339.872) * (-2333.311) (-2333.179) [-2333.280] (-2332.262) -- 0:00:28 813000 -- [-2331.320] (-2332.634) (-2332.413) (-2338.735) * (-2335.540) [-2329.241] (-2335.254) (-2341.017) -- 0:00:28 813500 -- (-2335.708) [-2338.316] (-2332.645) (-2331.634) * (-2327.446) (-2344.383) [-2333.931] (-2335.178) -- 0:00:28 814000 -- [-2333.333] (-2338.206) (-2338.383) (-2330.994) * (-2326.836) (-2336.118) (-2328.431) [-2332.582] -- 0:00:28 814500 -- (-2330.609) (-2333.709) [-2335.833] (-2336.504) * [-2327.282] (-2334.892) (-2327.301) (-2329.717) -- 0:00:28 815000 -- (-2333.959) [-2328.289] (-2333.729) (-2334.610) * (-2329.138) (-2330.762) [-2328.915] (-2326.861) -- 0:00:28 Average standard deviation of split frequencies: 0.000000 815500 -- (-2331.525) (-2335.407) [-2330.844] (-2334.690) * (-2328.615) (-2337.981) (-2332.749) [-2333.743] -- 0:00:28 816000 -- (-2336.674) (-2330.750) [-2329.708] (-2342.885) * (-2336.711) (-2335.399) (-2333.086) [-2331.283] -- 0:00:27 816500 -- (-2337.776) (-2332.617) [-2329.740] (-2330.828) * (-2332.364) (-2339.285) [-2332.065] (-2337.895) -- 0:00:27 817000 -- [-2327.450] (-2336.510) (-2331.593) (-2331.540) * (-2329.905) (-2329.445) (-2333.386) [-2333.182] -- 0:00:27 817500 -- (-2330.772) (-2332.451) (-2331.888) [-2334.040] * (-2335.668) (-2334.591) (-2326.605) [-2335.934] -- 0:00:27 818000 -- (-2328.597) (-2329.805) (-2336.926) [-2331.781] * [-2330.935] (-2332.981) (-2330.941) (-2330.693) -- 0:00:27 818500 -- (-2334.480) (-2334.277) (-2333.804) [-2335.055] * (-2331.049) (-2331.033) (-2326.381) [-2330.923] -- 0:00:27 819000 -- (-2328.818) [-2332.292] (-2334.466) (-2332.396) * (-2333.441) (-2335.215) (-2330.233) [-2331.935] -- 0:00:27 819500 -- (-2334.439) [-2329.317] (-2335.968) (-2330.528) * [-2330.610] (-2331.954) (-2330.182) (-2328.979) -- 0:00:27 820000 -- [-2330.383] (-2327.837) (-2331.836) (-2327.503) * [-2335.576] (-2334.729) (-2339.440) (-2332.828) -- 0:00:27 Average standard deviation of split frequencies: 0.000000 820500 -- (-2336.464) [-2330.885] (-2327.252) (-2331.789) * (-2333.127) (-2337.830) (-2337.918) [-2330.586] -- 0:00:27 821000 -- (-2333.466) (-2331.573) [-2336.808] (-2331.019) * (-2345.864) (-2330.011) [-2335.822] (-2333.125) -- 0:00:27 821500 -- (-2333.214) [-2332.057] (-2331.160) (-2330.742) * (-2339.179) (-2337.509) (-2331.816) [-2334.820] -- 0:00:27 822000 -- (-2330.225) (-2330.111) [-2335.172] (-2334.587) * (-2333.094) [-2333.065] (-2335.022) (-2331.249) -- 0:00:27 822500 -- (-2332.321) [-2331.842] (-2334.468) (-2330.514) * (-2341.643) [-2328.976] (-2336.704) (-2341.359) -- 0:00:26 823000 -- [-2331.286] (-2334.987) (-2326.828) (-2341.649) * [-2332.367] (-2330.603) (-2332.168) (-2335.807) -- 0:00:26 823500 -- (-2337.965) (-2335.611) (-2333.709) [-2334.755] * (-2332.388) (-2338.727) [-2333.534] (-2332.679) -- 0:00:26 824000 -- [-2333.631] (-2336.887) (-2332.199) (-2337.494) * (-2337.883) (-2328.578) (-2333.609) [-2337.395] -- 0:00:26 824500 -- (-2336.071) (-2333.757) (-2332.466) [-2330.616] * (-2335.311) (-2329.693) (-2334.554) [-2333.212] -- 0:00:26 825000 -- (-2337.570) (-2334.855) (-2331.190) [-2331.161] * (-2335.213) [-2333.037] (-2333.603) (-2329.892) -- 0:00:26 Average standard deviation of split frequencies: 0.000000 825500 -- (-2331.263) [-2330.478] (-2331.050) (-2334.488) * (-2332.682) (-2335.209) (-2333.931) [-2328.899] -- 0:00:26 826000 -- (-2331.849) [-2333.504] (-2332.689) (-2330.287) * (-2343.456) (-2330.592) (-2333.472) [-2331.900] -- 0:00:26 826500 -- [-2328.207] (-2330.453) (-2334.154) (-2336.965) * (-2331.139) (-2332.867) [-2333.832] (-2329.533) -- 0:00:26 827000 -- (-2331.465) [-2329.901] (-2334.925) (-2336.335) * (-2328.845) [-2329.863] (-2335.646) (-2330.148) -- 0:00:26 827500 -- [-2330.085] (-2330.633) (-2336.170) (-2333.207) * (-2341.199) (-2333.617) (-2329.588) [-2326.947] -- 0:00:26 828000 -- (-2334.576) (-2335.539) (-2329.308) [-2331.091] * (-2332.994) [-2337.281] (-2331.045) (-2333.445) -- 0:00:26 828500 -- (-2334.220) [-2330.950] (-2334.266) (-2328.721) * (-2337.386) (-2334.807) [-2331.088] (-2333.204) -- 0:00:26 829000 -- (-2337.893) (-2332.084) (-2329.317) [-2332.176] * (-2333.160) (-2334.777) [-2333.149] (-2330.018) -- 0:00:25 829500 -- [-2332.478] (-2335.887) (-2334.725) (-2335.214) * (-2329.422) (-2328.895) (-2334.581) [-2328.179] -- 0:00:25 830000 -- [-2329.253] (-2333.108) (-2330.433) (-2337.341) * (-2328.813) (-2339.251) [-2330.657] (-2338.114) -- 0:00:25 Average standard deviation of split frequencies: 0.000000 830500 -- (-2331.049) (-2335.987) [-2336.611] (-2331.961) * (-2327.962) (-2329.409) [-2329.912] (-2338.074) -- 0:00:25 831000 -- [-2331.095] (-2328.874) (-2333.100) (-2334.756) * (-2339.863) [-2328.048] (-2333.693) (-2334.489) -- 0:00:25 831500 -- (-2331.797) (-2334.431) (-2326.894) [-2330.677] * [-2333.000] (-2328.197) (-2341.270) (-2336.663) -- 0:00:25 832000 -- (-2329.924) [-2336.221] (-2331.848) (-2339.627) * [-2331.368] (-2327.926) (-2337.918) (-2338.175) -- 0:00:25 832500 -- (-2332.680) (-2341.833) (-2333.945) [-2330.328] * (-2336.476) (-2333.181) (-2332.546) [-2333.637] -- 0:00:25 833000 -- (-2329.940) (-2340.760) [-2330.844] (-2331.222) * (-2334.456) (-2333.951) [-2333.496] (-2338.975) -- 0:00:25 833500 -- (-2334.205) (-2334.522) (-2327.882) [-2329.369] * (-2342.120) [-2331.670] (-2334.886) (-2332.166) -- 0:00:25 834000 -- (-2328.282) (-2335.434) (-2329.312) [-2326.342] * (-2337.698) (-2329.670) [-2334.046] (-2343.547) -- 0:00:25 834500 -- (-2330.507) (-2348.036) (-2336.055) [-2331.740] * [-2329.137] (-2334.239) (-2332.820) (-2331.761) -- 0:00:24 835000 -- [-2329.114] (-2332.754) (-2338.686) (-2329.947) * (-2333.613) (-2336.012) (-2333.559) [-2334.133] -- 0:00:25 Average standard deviation of split frequencies: 0.000000 835500 -- (-2331.315) (-2329.132) (-2336.821) [-2330.270] * [-2328.312] (-2337.513) (-2338.314) (-2331.975) -- 0:00:25 836000 -- (-2332.707) [-2331.777] (-2333.016) (-2333.998) * [-2329.292] (-2332.096) (-2330.672) (-2334.477) -- 0:00:24 836500 -- (-2329.114) [-2327.269] (-2330.662) (-2340.339) * (-2339.752) [-2329.644] (-2334.973) (-2334.729) -- 0:00:24 837000 -- (-2329.181) (-2336.952) [-2328.885] (-2339.797) * (-2337.217) (-2331.716) [-2327.723] (-2336.936) -- 0:00:24 837500 -- (-2331.130) [-2331.836] (-2329.777) (-2336.215) * (-2332.948) (-2333.694) (-2332.158) [-2329.963] -- 0:00:24 838000 -- (-2335.743) (-2326.563) (-2340.327) [-2331.857] * [-2333.270] (-2331.654) (-2330.572) (-2329.367) -- 0:00:24 838500 -- (-2331.138) [-2333.216] (-2333.987) (-2336.068) * [-2330.828] (-2332.711) (-2332.305) (-2326.571) -- 0:00:24 839000 -- (-2335.566) (-2339.224) [-2339.555] (-2329.897) * [-2331.357] (-2331.141) (-2330.181) (-2336.460) -- 0:00:24 839500 -- (-2333.400) (-2334.041) [-2330.002] (-2327.108) * [-2332.003] (-2328.864) (-2330.973) (-2331.383) -- 0:00:24 840000 -- (-2333.485) (-2335.984) [-2330.329] (-2332.612) * (-2331.678) (-2336.683) (-2339.090) [-2334.413] -- 0:00:24 Average standard deviation of split frequencies: 0.000000 840500 -- [-2333.296] (-2339.873) (-2331.522) (-2326.608) * (-2331.479) [-2329.630] (-2329.588) (-2332.899) -- 0:00:24 841000 -- (-2330.232) (-2337.585) (-2335.991) [-2331.101] * [-2330.863] (-2329.297) (-2332.627) (-2334.608) -- 0:00:24 841500 -- (-2331.791) [-2332.805] (-2334.250) (-2325.533) * [-2332.077] (-2329.759) (-2331.013) (-2338.200) -- 0:00:24 842000 -- (-2329.947) (-2335.299) (-2330.458) [-2328.371] * (-2334.064) (-2334.524) [-2332.791] (-2333.301) -- 0:00:24 842500 -- [-2329.248] (-2330.677) (-2331.223) (-2330.701) * (-2337.655) (-2331.985) [-2329.520] (-2333.084) -- 0:00:23 843000 -- (-2334.459) [-2331.441] (-2335.930) (-2336.142) * [-2331.210] (-2332.706) (-2329.569) (-2339.324) -- 0:00:23 843500 -- (-2333.087) [-2332.618] (-2335.551) (-2332.799) * [-2334.784] (-2335.318) (-2337.694) (-2339.856) -- 0:00:23 844000 -- (-2330.639) (-2334.607) [-2326.509] (-2333.393) * [-2329.701] (-2331.795) (-2332.561) (-2335.011) -- 0:00:23 844500 -- (-2334.217) (-2333.321) (-2337.343) [-2331.593] * [-2331.513] (-2332.949) (-2330.138) (-2329.909) -- 0:00:23 845000 -- (-2341.295) (-2334.973) (-2333.626) [-2332.739] * [-2334.522] (-2340.154) (-2333.401) (-2328.840) -- 0:00:23 Average standard deviation of split frequencies: 0.000000 845500 -- (-2332.945) [-2336.308] (-2332.571) (-2332.020) * (-2329.788) (-2337.905) (-2334.375) [-2328.039] -- 0:00:23 846000 -- [-2326.861] (-2332.545) (-2341.283) (-2332.772) * (-2332.336) (-2332.133) (-2332.515) [-2330.288] -- 0:00:23 846500 -- (-2328.652) (-2334.524) (-2327.794) [-2331.197] * (-2332.349) (-2330.147) [-2335.366] (-2330.431) -- 0:00:23 847000 -- (-2328.902) [-2332.011] (-2328.025) (-2331.823) * (-2331.847) [-2332.498] (-2334.973) (-2333.319) -- 0:00:23 847500 -- (-2330.802) (-2329.772) [-2329.137] (-2329.572) * [-2329.908] (-2329.116) (-2334.952) (-2331.913) -- 0:00:23 848000 -- (-2338.472) (-2328.160) [-2327.982] (-2329.376) * (-2331.935) [-2328.175] (-2341.706) (-2329.389) -- 0:00:23 848500 -- (-2339.575) (-2333.941) (-2331.285) [-2332.602] * [-2335.650] (-2333.450) (-2334.707) (-2329.581) -- 0:00:23 849000 -- [-2330.616] (-2331.437) (-2332.610) (-2332.049) * (-2332.739) (-2327.088) [-2333.925] (-2330.750) -- 0:00:22 849500 -- (-2330.051) [-2328.144] (-2338.026) (-2329.590) * (-2333.747) [-2330.302] (-2334.713) (-2332.292) -- 0:00:22 850000 -- (-2338.034) (-2340.176) (-2342.234) [-2330.705] * (-2340.797) (-2333.331) (-2338.899) [-2332.612] -- 0:00:22 Average standard deviation of split frequencies: 0.000000 850500 -- (-2333.692) (-2327.951) [-2334.525] (-2336.650) * (-2336.180) [-2329.479] (-2336.112) (-2334.376) -- 0:00:22 851000 -- (-2332.824) (-2330.487) (-2341.885) [-2335.076] * (-2331.452) (-2335.869) (-2333.078) [-2329.406] -- 0:00:22 851500 -- (-2334.132) (-2333.857) [-2334.688] (-2338.853) * (-2330.114) [-2330.713] (-2336.113) (-2328.919) -- 0:00:22 852000 -- (-2328.627) (-2328.659) (-2339.132) [-2330.978] * [-2329.670] (-2332.309) (-2327.824) (-2332.640) -- 0:00:22 852500 -- [-2333.912] (-2327.345) (-2332.220) (-2330.360) * (-2334.889) [-2326.171] (-2331.684) (-2331.653) -- 0:00:22 853000 -- (-2332.085) [-2336.852] (-2328.906) (-2334.595) * (-2329.299) (-2331.134) [-2330.147] (-2325.722) -- 0:00:22 853500 -- (-2331.216) [-2328.420] (-2336.243) (-2326.230) * [-2328.265] (-2333.987) (-2337.772) (-2329.815) -- 0:00:22 854000 -- (-2327.908) (-2334.803) [-2334.797] (-2334.341) * [-2334.305] (-2332.553) (-2332.918) (-2331.497) -- 0:00:22 854500 -- [-2328.556] (-2331.574) (-2335.769) (-2335.582) * (-2336.182) (-2341.995) [-2328.953] (-2336.604) -- 0:00:22 855000 -- (-2332.598) (-2329.226) [-2329.651] (-2337.715) * (-2329.021) (-2332.746) [-2330.864] (-2333.127) -- 0:00:22 Average standard deviation of split frequencies: 0.000000 855500 -- (-2335.094) (-2338.125) [-2331.675] (-2332.819) * [-2332.037] (-2331.145) (-2331.566) (-2333.648) -- 0:00:21 856000 -- (-2331.231) [-2338.930] (-2336.087) (-2332.035) * (-2331.142) [-2331.268] (-2337.039) (-2330.644) -- 0:00:21 856500 -- (-2336.890) [-2328.179] (-2336.405) (-2329.710) * (-2335.076) (-2329.706) (-2336.604) [-2329.836] -- 0:00:21 857000 -- [-2332.525] (-2332.915) (-2334.132) (-2330.538) * (-2337.470) (-2331.216) [-2330.627] (-2327.629) -- 0:00:21 857500 -- [-2330.781] (-2331.228) (-2331.851) (-2336.514) * (-2330.897) [-2329.125] (-2342.532) (-2330.808) -- 0:00:21 858000 -- (-2330.026) (-2330.799) [-2330.456] (-2333.234) * (-2333.033) [-2326.728] (-2336.981) (-2337.474) -- 0:00:21 858500 -- (-2330.653) [-2327.939] (-2329.456) (-2332.887) * (-2332.815) (-2331.765) (-2333.451) [-2329.539] -- 0:00:21 859000 -- (-2333.483) [-2329.981] (-2334.105) (-2331.008) * [-2331.624] (-2331.070) (-2333.982) (-2331.611) -- 0:00:21 859500 -- [-2334.320] (-2332.410) (-2334.499) (-2335.290) * (-2334.507) (-2337.247) (-2334.646) [-2333.129] -- 0:00:21 860000 -- [-2340.489] (-2334.069) (-2330.978) (-2332.565) * (-2340.233) (-2331.274) (-2335.017) [-2329.938] -- 0:00:21 Average standard deviation of split frequencies: 0.000000 860500 -- [-2329.269] (-2331.003) (-2331.807) (-2336.519) * (-2330.557) (-2331.077) [-2332.724] (-2329.394) -- 0:00:21 861000 -- (-2330.841) (-2333.263) [-2332.632] (-2333.414) * (-2328.886) (-2335.006) (-2331.316) [-2325.910] -- 0:00:20 861500 -- (-2332.110) (-2327.784) [-2334.039] (-2334.517) * (-2331.578) (-2330.899) (-2329.946) [-2327.718] -- 0:00:21 862000 -- (-2333.015) [-2335.437] (-2330.358) (-2338.274) * [-2330.510] (-2335.655) (-2328.769) (-2335.061) -- 0:00:20 862500 -- (-2334.933) (-2335.292) (-2335.015) [-2329.817] * [-2325.784] (-2334.949) (-2334.942) (-2337.566) -- 0:00:20 863000 -- (-2334.677) (-2329.742) (-2330.762) [-2327.058] * (-2331.175) (-2343.304) [-2332.730] (-2333.167) -- 0:00:20 863500 -- [-2330.575] (-2331.734) (-2335.467) (-2328.292) * (-2328.081) [-2336.926] (-2333.289) (-2339.847) -- 0:00:20 864000 -- (-2333.444) [-2331.593] (-2330.255) (-2333.767) * (-2334.099) [-2329.577] (-2341.993) (-2340.844) -- 0:00:20 864500 -- (-2339.243) [-2333.069] (-2333.752) (-2333.825) * (-2339.075) [-2330.951] (-2333.171) (-2331.283) -- 0:00:20 865000 -- (-2337.653) (-2330.809) (-2333.406) [-2333.103] * (-2334.822) [-2337.677] (-2330.782) (-2330.689) -- 0:00:20 Average standard deviation of split frequencies: 0.000000 865500 -- (-2336.303) (-2328.248) (-2331.795) [-2329.805] * (-2336.295) [-2331.035] (-2337.488) (-2331.274) -- 0:00:20 866000 -- [-2330.657] (-2330.044) (-2337.278) (-2330.879) * (-2335.724) (-2331.687) (-2331.458) [-2332.180] -- 0:00:20 866500 -- [-2329.266] (-2339.730) (-2331.626) (-2328.992) * (-2335.585) (-2336.663) [-2330.843] (-2330.757) -- 0:00:20 867000 -- (-2336.859) (-2331.590) (-2334.139) [-2328.994] * [-2333.914] (-2334.438) (-2334.494) (-2334.645) -- 0:00:20 867500 -- (-2333.213) (-2335.735) [-2331.794] (-2335.327) * (-2332.600) (-2334.187) [-2332.441] (-2343.541) -- 0:00:20 868000 -- (-2329.314) (-2333.903) (-2329.416) [-2328.645] * (-2335.670) (-2335.915) [-2328.541] (-2336.326) -- 0:00:20 868500 -- [-2330.595] (-2338.606) (-2329.271) (-2336.281) * (-2341.465) (-2327.557) (-2335.339) [-2331.194] -- 0:00:19 869000 -- [-2332.205] (-2342.516) (-2333.772) (-2330.431) * [-2331.861] (-2334.365) (-2327.947) (-2333.053) -- 0:00:19 869500 -- (-2335.606) (-2337.926) (-2336.981) [-2330.993] * (-2327.868) [-2327.634] (-2333.215) (-2333.698) -- 0:00:19 870000 -- [-2329.437] (-2336.143) (-2327.824) (-2338.447) * [-2331.222] (-2331.649) (-2329.386) (-2335.585) -- 0:00:19 Average standard deviation of split frequencies: 0.000000 870500 -- (-2336.432) (-2332.561) (-2327.476) [-2330.309] * [-2336.430] (-2335.276) (-2333.646) (-2335.112) -- 0:00:19 871000 -- (-2335.727) (-2335.553) (-2331.120) [-2329.048] * (-2339.057) (-2335.672) (-2340.792) [-2330.334] -- 0:00:19 871500 -- (-2341.670) [-2335.373] (-2331.465) (-2328.809) * (-2332.496) [-2330.680] (-2341.994) (-2330.343) -- 0:00:19 872000 -- [-2340.725] (-2327.971) (-2332.036) (-2337.428) * (-2334.499) (-2340.910) [-2328.597] (-2336.971) -- 0:00:19 872500 -- (-2333.683) (-2329.184) (-2331.885) [-2333.848] * (-2330.725) [-2334.016] (-2331.025) (-2333.499) -- 0:00:19 873000 -- (-2334.338) (-2331.449) [-2337.351] (-2326.457) * [-2333.106] (-2328.724) (-2331.312) (-2333.727) -- 0:00:19 873500 -- (-2329.455) [-2331.231] (-2327.692) (-2334.309) * (-2334.288) (-2330.152) (-2337.641) [-2330.249] -- 0:00:19 874000 -- (-2327.596) [-2330.923] (-2337.113) (-2330.116) * [-2336.205] (-2330.209) (-2334.309) (-2332.774) -- 0:00:19 874500 -- (-2332.192) (-2329.843) [-2338.526] (-2334.196) * (-2332.563) (-2330.572) (-2330.509) [-2331.739] -- 0:00:19 875000 -- [-2330.717] (-2330.461) (-2334.919) (-2334.100) * [-2327.127] (-2332.575) (-2333.960) (-2330.086) -- 0:00:19 Average standard deviation of split frequencies: 0.000000 875500 -- (-2331.661) [-2327.075] (-2335.555) (-2328.884) * (-2326.929) [-2335.120] (-2329.210) (-2329.613) -- 0:00:18 876000 -- (-2334.710) (-2330.035) [-2332.475] (-2332.186) * (-2335.279) [-2330.346] (-2332.960) (-2340.080) -- 0:00:18 876500 -- [-2333.340] (-2333.535) (-2332.754) (-2331.308) * (-2330.599) [-2332.207] (-2336.396) (-2334.977) -- 0:00:18 877000 -- [-2333.116] (-2335.056) (-2329.885) (-2337.092) * [-2329.718] (-2336.541) (-2333.602) (-2332.917) -- 0:00:18 877500 -- (-2334.231) (-2331.237) [-2335.289] (-2332.775) * (-2338.975) (-2332.246) [-2335.724] (-2333.498) -- 0:00:18 878000 -- (-2328.014) (-2334.140) (-2331.935) [-2333.213] * (-2334.328) [-2331.162] (-2329.742) (-2337.792) -- 0:00:18 878500 -- [-2333.066] (-2340.596) (-2334.605) (-2331.567) * (-2333.307) (-2330.788) [-2328.819] (-2334.684) -- 0:00:18 879000 -- (-2333.756) (-2337.367) [-2334.374] (-2328.583) * (-2334.133) (-2330.474) (-2335.360) [-2333.514] -- 0:00:18 879500 -- (-2334.195) (-2333.057) (-2332.932) [-2332.953] * (-2334.380) [-2331.268] (-2328.370) (-2326.700) -- 0:00:18 880000 -- (-2332.485) (-2327.494) [-2329.963] (-2335.140) * (-2336.395) (-2333.132) [-2331.508] (-2332.193) -- 0:00:18 Average standard deviation of split frequencies: 0.000000 880500 -- (-2331.958) (-2331.961) (-2333.388) [-2330.901] * (-2333.905) [-2333.281] (-2331.460) (-2331.994) -- 0:00:18 881000 -- (-2329.439) (-2333.450) [-2332.557] (-2335.795) * (-2330.885) (-2333.745) (-2336.021) [-2330.798] -- 0:00:18 881500 -- (-2329.418) [-2332.864] (-2335.779) (-2334.711) * [-2328.079] (-2338.211) (-2330.771) (-2329.841) -- 0:00:18 882000 -- (-2331.723) (-2336.831) [-2336.938] (-2331.454) * [-2334.941] (-2329.165) (-2336.214) (-2329.255) -- 0:00:17 882500 -- (-2331.342) (-2334.136) [-2335.556] (-2333.304) * (-2332.024) (-2331.821) (-2337.451) [-2333.939] -- 0:00:17 883000 -- (-2331.316) [-2331.868] (-2335.621) (-2334.331) * [-2332.255] (-2339.144) (-2343.186) (-2328.267) -- 0:00:17 883500 -- (-2335.533) (-2328.790) [-2327.970] (-2333.199) * (-2335.370) (-2331.574) [-2328.868] (-2330.085) -- 0:00:17 884000 -- (-2333.535) (-2328.030) (-2335.373) [-2337.106] * (-2339.808) [-2326.079] (-2341.387) (-2334.300) -- 0:00:17 884500 -- [-2327.922] (-2337.477) (-2331.381) (-2333.738) * (-2337.117) (-2328.899) [-2329.571] (-2335.410) -- 0:00:17 885000 -- (-2340.194) (-2333.250) (-2333.719) [-2334.893] * (-2337.926) (-2336.270) (-2332.649) [-2334.629] -- 0:00:17 Average standard deviation of split frequencies: 0.000000 885500 -- (-2334.915) (-2339.293) (-2333.878) [-2329.471] * (-2336.533) (-2333.213) (-2331.118) [-2330.604] -- 0:00:17 886000 -- (-2336.259) (-2353.728) (-2337.804) [-2333.510] * (-2333.683) [-2330.956] (-2333.347) (-2327.171) -- 0:00:17 886500 -- (-2335.790) (-2332.199) (-2336.280) [-2329.691] * (-2338.741) (-2333.939) (-2335.548) [-2332.889] -- 0:00:17 887000 -- (-2332.214) (-2334.408) (-2332.772) [-2326.798] * (-2337.892) (-2335.428) [-2335.249] (-2331.175) -- 0:00:17 887500 -- (-2330.744) (-2329.450) [-2331.599] (-2338.562) * (-2328.856) (-2331.290) (-2331.418) [-2331.192] -- 0:00:17 888000 -- (-2337.825) [-2336.040] (-2336.099) (-2339.646) * (-2333.127) [-2332.904] (-2328.335) (-2335.034) -- 0:00:17 888500 -- (-2327.678) [-2331.325] (-2330.115) (-2330.923) * (-2328.383) [-2328.448] (-2336.583) (-2331.360) -- 0:00:16 889000 -- (-2331.470) (-2334.206) [-2332.443] (-2337.531) * (-2336.517) [-2335.043] (-2330.075) (-2333.277) -- 0:00:16 889500 -- (-2331.834) (-2333.921) [-2334.727] (-2330.903) * [-2331.864] (-2337.122) (-2333.678) (-2335.050) -- 0:00:16 890000 -- [-2331.834] (-2340.732) (-2335.867) (-2336.737) * (-2330.658) [-2333.527] (-2327.682) (-2330.251) -- 0:00:16 Average standard deviation of split frequencies: 0.000000 890500 -- [-2331.802] (-2339.326) (-2331.084) (-2333.958) * (-2333.537) (-2333.169) [-2328.324] (-2332.498) -- 0:00:16 891000 -- (-2333.665) (-2338.604) (-2330.187) [-2330.818] * (-2327.771) (-2330.128) (-2337.091) [-2333.015] -- 0:00:16 891500 -- (-2334.498) (-2338.121) [-2334.724] (-2335.406) * [-2331.103] (-2331.704) (-2334.599) (-2331.627) -- 0:00:16 892000 -- (-2340.162) (-2337.666) (-2336.245) [-2334.733] * [-2332.341] (-2331.200) (-2333.972) (-2331.649) -- 0:00:16 892500 -- [-2334.227] (-2337.356) (-2330.001) (-2334.879) * (-2329.057) (-2332.491) (-2340.790) [-2334.691] -- 0:00:16 893000 -- (-2332.743) (-2333.624) [-2338.137] (-2336.133) * (-2331.857) (-2333.248) (-2331.685) [-2333.256] -- 0:00:16 893500 -- [-2333.368] (-2337.566) (-2335.371) (-2331.374) * (-2327.867) (-2336.299) [-2330.765] (-2334.307) -- 0:00:16 894000 -- (-2333.621) (-2330.928) [-2328.189] (-2331.839) * (-2333.107) [-2333.409] (-2330.117) (-2328.911) -- 0:00:16 894500 -- (-2334.295) [-2335.122] (-2330.594) (-2336.347) * (-2328.582) (-2332.054) [-2330.985] (-2329.729) -- 0:00:16 895000 -- (-2339.866) (-2329.541) [-2328.303] (-2335.569) * (-2332.738) (-2331.480) [-2336.111] (-2334.253) -- 0:00:15 Average standard deviation of split frequencies: 0.000000 895500 -- (-2338.647) (-2336.635) [-2328.279] (-2332.364) * (-2332.696) [-2334.395] (-2334.280) (-2332.847) -- 0:00:15 896000 -- (-2330.140) (-2335.633) [-2329.498] (-2334.529) * (-2326.226) (-2334.196) [-2329.821] (-2339.424) -- 0:00:15 896500 -- (-2330.914) (-2333.769) [-2332.978] (-2339.840) * (-2328.194) (-2336.922) (-2330.625) [-2338.213] -- 0:00:15 897000 -- (-2332.356) (-2325.713) [-2331.327] (-2333.806) * (-2332.091) (-2339.671) (-2335.517) [-2336.635] -- 0:00:15 897500 -- (-2341.113) [-2331.335] (-2333.465) (-2335.649) * (-2329.241) (-2333.439) [-2330.690] (-2338.387) -- 0:00:15 898000 -- (-2332.136) (-2326.862) [-2332.341] (-2337.171) * [-2332.423] (-2335.832) (-2330.721) (-2331.860) -- 0:00:15 898500 -- (-2327.333) (-2338.588) [-2333.533] (-2333.818) * (-2336.004) (-2330.950) [-2336.066] (-2333.745) -- 0:00:15 899000 -- (-2333.732) (-2336.556) [-2332.338] (-2335.157) * (-2331.670) (-2340.478) [-2329.463] (-2338.473) -- 0:00:15 899500 -- (-2330.624) (-2330.549) [-2331.365] (-2328.647) * [-2338.348] (-2337.700) (-2338.046) (-2341.195) -- 0:00:15 900000 -- (-2333.847) (-2332.103) [-2330.551] (-2328.316) * (-2336.685) (-2341.222) [-2337.505] (-2336.387) -- 0:00:15 Average standard deviation of split frequencies: 0.000000 900500 -- (-2334.290) (-2331.222) (-2332.686) [-2329.324] * (-2338.894) (-2329.464) (-2332.477) [-2335.976] -- 0:00:15 901000 -- [-2332.032] (-2337.095) (-2334.099) (-2335.768) * (-2333.284) [-2329.648] (-2330.375) (-2335.487) -- 0:00:15 901500 -- (-2330.151) (-2330.203) [-2332.736] (-2333.284) * [-2331.801] (-2334.447) (-2336.695) (-2333.098) -- 0:00:14 902000 -- [-2335.020] (-2331.278) (-2328.997) (-2333.770) * (-2343.012) [-2330.090] (-2336.187) (-2336.830) -- 0:00:14 902500 -- (-2335.409) (-2330.018) [-2330.253] (-2339.203) * (-2331.840) [-2329.412] (-2340.793) (-2330.247) -- 0:00:14 903000 -- [-2342.314] (-2329.308) (-2331.037) (-2328.622) * [-2333.234] (-2331.805) (-2331.587) (-2332.556) -- 0:00:14 903500 -- (-2331.298) (-2332.336) (-2340.142) [-2330.229] * (-2332.886) (-2329.892) [-2333.957] (-2331.945) -- 0:00:14 904000 -- (-2335.181) (-2328.424) (-2331.660) [-2335.108] * (-2333.801) [-2328.276] (-2330.103) (-2329.280) -- 0:00:14 904500 -- [-2326.202] (-2329.230) (-2335.321) (-2336.302) * (-2331.930) (-2332.044) (-2338.083) [-2330.136] -- 0:00:14 905000 -- (-2337.649) (-2327.763) [-2328.008] (-2334.685) * [-2332.786] (-2334.625) (-2339.271) (-2327.876) -- 0:00:14 Average standard deviation of split frequencies: 0.000000 905500 -- (-2332.080) [-2330.898] (-2328.658) (-2328.561) * (-2337.466) [-2334.281] (-2336.064) (-2339.864) -- 0:00:14 906000 -- (-2338.076) [-2333.588] (-2330.683) (-2331.972) * (-2337.113) [-2328.895] (-2336.229) (-2330.279) -- 0:00:14 906500 -- (-2333.107) (-2333.988) [-2331.913] (-2332.257) * [-2331.652] (-2330.745) (-2334.454) (-2335.890) -- 0:00:14 907000 -- [-2332.255] (-2331.031) (-2331.613) (-2331.433) * (-2330.873) (-2335.543) (-2331.283) [-2331.714] -- 0:00:14 907500 -- (-2335.202) (-2330.878) (-2335.238) [-2338.577] * [-2332.028] (-2330.944) (-2335.321) (-2334.017) -- 0:00:14 908000 -- (-2337.821) (-2335.833) (-2332.127) [-2333.570] * (-2331.999) [-2327.733] (-2330.942) (-2330.821) -- 0:00:13 908500 -- (-2330.469) (-2332.404) [-2326.503] (-2337.830) * (-2331.816) (-2331.777) [-2337.733] (-2336.139) -- 0:00:13 909000 -- [-2331.417] (-2325.080) (-2334.749) (-2337.139) * (-2327.098) [-2329.096] (-2336.203) (-2335.069) -- 0:00:13 909500 -- [-2328.161] (-2331.312) (-2330.914) (-2333.407) * (-2338.427) [-2333.777] (-2331.537) (-2341.905) -- 0:00:13 910000 -- [-2324.637] (-2330.644) (-2333.748) (-2332.561) * (-2335.135) [-2335.400] (-2337.865) (-2330.123) -- 0:00:13 Average standard deviation of split frequencies: 0.000000 910500 -- (-2332.810) [-2330.265] (-2330.180) (-2334.829) * [-2333.264] (-2328.257) (-2337.923) (-2331.047) -- 0:00:13 911000 -- [-2331.645] (-2333.166) (-2329.491) (-2334.249) * (-2335.679) [-2329.072] (-2343.306) (-2337.396) -- 0:00:13 911500 -- [-2328.978] (-2334.836) (-2334.927) (-2332.640) * (-2330.689) (-2332.134) [-2334.307] (-2336.741) -- 0:00:13 912000 -- (-2333.647) [-2331.619] (-2336.763) (-2327.856) * (-2336.906) (-2330.225) (-2331.389) [-2329.844] -- 0:00:13 912500 -- [-2329.984] (-2334.911) (-2337.067) (-2329.943) * [-2335.379] (-2331.903) (-2333.183) (-2330.214) -- 0:00:13 913000 -- (-2333.998) [-2327.991] (-2327.499) (-2334.248) * (-2329.553) (-2337.987) [-2333.106] (-2331.131) -- 0:00:13 913500 -- (-2330.766) (-2334.559) [-2331.252] (-2334.661) * (-2332.123) (-2333.070) (-2335.642) [-2332.625] -- 0:00:13 914000 -- (-2330.480) [-2333.794] (-2332.239) (-2330.563) * (-2332.167) (-2329.800) (-2328.500) [-2334.509] -- 0:00:13 914500 -- (-2335.770) (-2334.772) (-2338.241) [-2331.085] * [-2329.908] (-2332.319) (-2330.742) (-2331.887) -- 0:00:12 915000 -- (-2328.724) (-2333.556) (-2334.836) [-2333.312] * (-2328.646) (-2337.239) (-2334.463) [-2325.550] -- 0:00:12 Average standard deviation of split frequencies: 0.000000 915500 -- (-2333.124) (-2333.479) (-2335.329) [-2332.310] * (-2331.878) (-2340.995) (-2331.569) [-2329.925] -- 0:00:12 916000 -- (-2335.231) (-2333.276) (-2332.620) [-2334.077] * (-2333.459) (-2335.515) (-2337.553) [-2330.302] -- 0:00:12 916500 -- (-2340.207) (-2333.723) [-2333.079] (-2335.510) * [-2338.202] (-2334.439) (-2330.227) (-2338.930) -- 0:00:12 917000 -- [-2329.111] (-2334.727) (-2328.841) (-2328.959) * (-2336.866) (-2337.011) (-2334.306) [-2332.030] -- 0:00:12 917500 -- (-2338.019) (-2339.651) [-2330.767] (-2334.598) * (-2332.645) (-2328.474) [-2330.379] (-2334.475) -- 0:00:12 918000 -- (-2331.601) (-2338.124) [-2330.969] (-2333.543) * (-2328.232) [-2332.601] (-2335.291) (-2333.818) -- 0:00:12 918500 -- (-2333.271) (-2333.883) (-2330.217) [-2329.420] * (-2331.523) (-2331.167) (-2334.290) [-2331.969] -- 0:00:12 919000 -- (-2327.835) (-2331.315) [-2331.854] (-2331.276) * (-2345.798) [-2334.287] (-2332.646) (-2336.197) -- 0:00:12 919500 -- [-2335.701] (-2343.298) (-2333.845) (-2330.461) * (-2330.274) (-2333.501) (-2331.146) [-2331.754] -- 0:00:12 920000 -- (-2330.335) [-2335.493] (-2341.305) (-2335.511) * (-2331.617) (-2332.372) [-2336.386] (-2331.364) -- 0:00:12 Average standard deviation of split frequencies: 0.000000 920500 -- [-2335.411] (-2340.062) (-2337.474) (-2342.229) * [-2332.578] (-2331.225) (-2345.270) (-2329.386) -- 0:00:12 921000 -- (-2332.773) (-2333.967) [-2331.716] (-2328.760) * (-2328.192) (-2332.979) (-2332.997) [-2328.329] -- 0:00:12 921500 -- [-2327.162] (-2333.044) (-2337.673) (-2337.354) * (-2333.179) (-2339.322) [-2337.186] (-2332.596) -- 0:00:11 922000 -- [-2331.109] (-2331.229) (-2331.261) (-2337.871) * [-2340.243] (-2336.880) (-2330.632) (-2335.433) -- 0:00:11 922500 -- [-2330.420] (-2334.269) (-2333.579) (-2332.840) * (-2329.794) [-2338.215] (-2333.923) (-2339.179) -- 0:00:11 923000 -- (-2328.867) (-2334.201) (-2329.668) [-2332.543] * [-2332.228] (-2329.934) (-2336.923) (-2339.015) -- 0:00:11 923500 -- (-2335.507) [-2336.070] (-2333.363) (-2338.110) * (-2335.038) (-2335.133) [-2329.564] (-2338.962) -- 0:00:11 924000 -- (-2337.204) (-2335.402) [-2334.720] (-2333.435) * (-2334.421) (-2330.030) (-2335.126) [-2332.783] -- 0:00:11 924500 -- (-2333.052) (-2331.743) (-2333.907) [-2333.228] * (-2336.436) [-2327.107] (-2333.285) (-2339.684) -- 0:00:11 925000 -- (-2331.076) (-2333.008) (-2336.613) [-2331.992] * [-2330.791] (-2338.479) (-2339.919) (-2330.077) -- 0:00:11 Average standard deviation of split frequencies: 0.000000 925500 -- (-2330.972) [-2331.891] (-2330.371) (-2340.446) * (-2335.617) [-2333.318] (-2331.533) (-2332.604) -- 0:00:11 926000 -- (-2332.442) [-2329.976] (-2331.137) (-2338.471) * (-2331.769) (-2333.200) (-2333.225) [-2333.544] -- 0:00:11 926500 -- (-2341.462) (-2330.635) (-2333.555) [-2330.134] * (-2332.625) (-2332.680) (-2330.850) [-2332.969] -- 0:00:11 927000 -- [-2329.390] (-2334.595) (-2333.383) (-2336.241) * (-2335.027) (-2332.715) [-2333.286] (-2333.558) -- 0:00:11 927500 -- (-2337.939) (-2336.901) (-2334.636) [-2328.666] * (-2337.445) (-2328.511) [-2336.150] (-2334.121) -- 0:00:11 928000 -- (-2333.949) [-2331.229] (-2337.248) (-2327.581) * (-2333.308) (-2325.709) [-2332.633] (-2333.823) -- 0:00:10 928500 -- [-2328.452] (-2336.349) (-2333.116) (-2333.305) * (-2335.281) [-2330.599] (-2329.144) (-2334.494) -- 0:00:10 929000 -- (-2333.755) (-2334.485) [-2335.336] (-2339.178) * [-2336.839] (-2334.659) (-2330.990) (-2337.484) -- 0:00:10 929500 -- (-2328.662) [-2335.653] (-2330.535) (-2338.634) * (-2343.435) [-2334.174] (-2334.568) (-2336.955) -- 0:00:10 930000 -- (-2334.276) (-2331.388) (-2329.301) [-2331.347] * (-2341.227) (-2338.618) (-2336.247) [-2329.658] -- 0:00:10 Average standard deviation of split frequencies: 0.000000 930500 -- [-2333.006] (-2330.221) (-2334.984) (-2332.424) * (-2335.367) (-2335.093) (-2340.016) [-2331.145] -- 0:00:10 931000 -- (-2333.425) (-2335.715) [-2330.767] (-2329.209) * (-2334.977) (-2332.056) [-2332.787] (-2339.760) -- 0:00:10 931500 -- (-2341.308) (-2335.902) (-2330.362) [-2332.572] * (-2337.245) [-2330.029] (-2339.606) (-2327.885) -- 0:00:10 932000 -- [-2330.051] (-2335.992) (-2328.479) (-2337.601) * (-2332.791) (-2344.704) [-2332.660] (-2329.720) -- 0:00:10 932500 -- [-2331.646] (-2338.831) (-2326.889) (-2335.463) * (-2331.160) [-2332.685] (-2329.110) (-2328.427) -- 0:00:10 933000 -- [-2339.224] (-2336.418) (-2336.630) (-2328.385) * [-2332.178] (-2335.701) (-2334.341) (-2335.569) -- 0:00:10 933500 -- (-2334.751) [-2327.607] (-2330.253) (-2334.922) * (-2334.465) (-2335.443) (-2330.264) [-2326.405] -- 0:00:10 934000 -- (-2331.366) (-2332.738) (-2329.376) [-2333.860] * (-2328.524) (-2338.056) (-2333.587) [-2330.948] -- 0:00:10 934500 -- (-2331.147) [-2332.828] (-2331.449) (-2335.113) * (-2328.613) (-2336.783) [-2337.260] (-2327.790) -- 0:00:09 935000 -- (-2336.651) (-2329.127) [-2330.114] (-2331.778) * (-2334.497) [-2330.343] (-2336.898) (-2331.750) -- 0:00:09 Average standard deviation of split frequencies: 0.000000 935500 -- (-2330.587) [-2334.543] (-2329.643) (-2340.516) * (-2330.454) [-2330.002] (-2338.007) (-2334.333) -- 0:00:09 936000 -- (-2331.609) (-2331.734) [-2333.817] (-2338.973) * (-2331.862) (-2336.068) (-2339.852) [-2331.581] -- 0:00:09 936500 -- (-2333.689) (-2329.091) [-2329.587] (-2334.217) * (-2337.201) (-2338.515) [-2332.693] (-2333.002) -- 0:00:09 937000 -- (-2329.841) (-2331.807) [-2335.517] (-2330.779) * (-2333.236) [-2335.506] (-2331.149) (-2328.071) -- 0:00:09 937500 -- [-2337.941] (-2334.140) (-2329.489) (-2331.835) * (-2334.132) (-2334.964) (-2337.140) [-2332.029] -- 0:00:09 938000 -- (-2332.246) (-2331.367) (-2338.487) [-2329.443] * (-2329.166) (-2330.021) [-2328.741] (-2338.145) -- 0:00:09 938500 -- (-2334.343) (-2334.976) (-2340.643) [-2331.628] * [-2331.543] (-2338.238) (-2329.438) (-2342.765) -- 0:00:09 939000 -- (-2342.722) (-2342.092) (-2332.356) [-2333.744] * (-2331.449) [-2334.998] (-2327.497) (-2337.570) -- 0:00:09 939500 -- (-2335.294) (-2338.516) (-2330.083) [-2333.422] * (-2327.618) (-2342.723) (-2333.441) [-2334.318] -- 0:00:09 940000 -- (-2334.962) (-2335.429) (-2330.943) [-2328.788] * (-2334.261) (-2338.006) [-2331.977] (-2328.760) -- 0:00:09 Average standard deviation of split frequencies: 0.000000 940500 -- (-2334.478) (-2330.897) [-2333.724] (-2335.051) * (-2331.132) (-2344.386) [-2328.886] (-2331.502) -- 0:00:09 941000 -- (-2331.910) (-2337.573) (-2340.826) [-2334.605] * (-2329.825) [-2333.918] (-2337.564) (-2346.702) -- 0:00:08 941500 -- (-2329.057) [-2337.178] (-2335.414) (-2337.063) * [-2332.436] (-2328.591) (-2335.074) (-2336.013) -- 0:00:08 942000 -- [-2331.952] (-2331.974) (-2331.554) (-2334.324) * (-2333.844) [-2329.994] (-2333.297) (-2332.829) -- 0:00:08 942500 -- [-2331.940] (-2335.130) (-2328.901) (-2333.238) * (-2326.889) (-2328.852) [-2339.361] (-2333.100) -- 0:00:08 943000 -- (-2337.556) (-2335.334) [-2334.121] (-2327.629) * (-2330.452) (-2338.475) [-2329.069] (-2335.774) -- 0:00:08 943500 -- (-2336.453) (-2336.223) [-2331.836] (-2335.333) * [-2332.440] (-2333.165) (-2334.082) (-2329.085) -- 0:00:08 944000 -- (-2331.893) [-2335.918] (-2329.001) (-2332.044) * (-2340.236) [-2329.914] (-2343.670) (-2334.132) -- 0:00:08 944500 -- (-2333.549) [-2332.400] (-2336.626) (-2336.759) * (-2332.883) [-2333.969] (-2333.342) (-2330.241) -- 0:00:08 945000 -- (-2333.223) (-2331.370) (-2340.955) [-2338.245] * (-2332.256) (-2334.589) (-2334.848) [-2331.510] -- 0:00:08 Average standard deviation of split frequencies: 0.000000 945500 -- (-2334.196) (-2332.902) [-2327.923] (-2332.349) * (-2333.638) [-2334.213] (-2329.660) (-2332.152) -- 0:00:08 946000 -- (-2327.231) (-2332.600) (-2330.455) [-2329.192] * (-2336.154) (-2332.553) (-2331.974) [-2332.996] -- 0:00:08 946500 -- [-2327.599] (-2331.924) (-2333.652) (-2333.533) * (-2336.737) (-2329.063) (-2334.728) [-2330.447] -- 0:00:08 947000 -- [-2332.257] (-2339.419) (-2335.005) (-2331.410) * [-2330.749] (-2333.220) (-2327.328) (-2330.958) -- 0:00:08 947500 -- (-2332.085) (-2337.338) [-2330.994] (-2328.061) * (-2329.867) (-2334.728) [-2328.397] (-2331.164) -- 0:00:07 948000 -- (-2332.572) (-2335.266) (-2332.896) [-2329.901] * (-2335.854) (-2332.228) (-2327.162) [-2331.836] -- 0:00:07 948500 -- (-2333.260) (-2330.018) (-2334.293) [-2331.993] * (-2341.262) [-2327.403] (-2329.071) (-2335.027) -- 0:00:07 949000 -- (-2332.708) (-2331.816) [-2333.327] (-2327.502) * (-2340.908) (-2331.205) [-2328.832] (-2332.284) -- 0:00:07 949500 -- [-2330.171] (-2332.630) (-2338.034) (-2331.921) * (-2331.557) [-2331.704] (-2330.537) (-2333.229) -- 0:00:07 950000 -- (-2337.218) [-2333.273] (-2329.943) (-2329.644) * (-2337.459) (-2330.182) (-2334.590) [-2330.777] -- 0:00:07 Average standard deviation of split frequencies: 0.000000 950500 -- [-2334.505] (-2332.273) (-2328.203) (-2327.381) * [-2335.447] (-2331.882) (-2334.562) (-2331.994) -- 0:00:07 951000 -- (-2332.247) [-2331.121] (-2329.619) (-2338.777) * (-2338.567) (-2328.292) (-2334.920) [-2332.019] -- 0:00:07 951500 -- (-2341.701) (-2337.716) [-2333.527] (-2333.323) * (-2339.469) (-2334.109) (-2332.027) [-2330.478] -- 0:00:07 952000 -- [-2333.462] (-2331.942) (-2331.563) (-2329.696) * (-2339.552) (-2339.125) [-2335.966] (-2335.248) -- 0:00:07 952500 -- (-2330.396) [-2330.925] (-2332.006) (-2332.317) * [-2336.618] (-2329.409) (-2332.457) (-2331.801) -- 0:00:07 953000 -- [-2333.317] (-2331.663) (-2328.243) (-2330.182) * (-2336.308) (-2336.027) (-2335.367) [-2328.795] -- 0:00:07 953500 -- (-2333.641) (-2332.772) [-2329.540] (-2338.485) * (-2332.449) [-2334.264] (-2338.075) (-2333.591) -- 0:00:07 954000 -- (-2333.278) [-2332.314] (-2333.712) (-2330.141) * (-2330.533) [-2334.361] (-2335.655) (-2335.069) -- 0:00:06 954500 -- (-2326.646) (-2336.019) (-2330.756) [-2334.020] * [-2329.987] (-2336.403) (-2336.981) (-2334.315) -- 0:00:06 955000 -- (-2332.306) [-2331.416] (-2337.023) (-2335.594) * (-2336.452) (-2332.446) (-2327.804) [-2325.534] -- 0:00:06 Average standard deviation of split frequencies: 0.000000 955500 -- [-2332.358] (-2330.523) (-2330.502) (-2334.430) * (-2339.906) (-2336.814) [-2329.871] (-2330.199) -- 0:00:06 956000 -- (-2331.397) [-2331.155] (-2330.693) (-2337.057) * (-2331.369) [-2330.975] (-2332.003) (-2338.472) -- 0:00:06 956500 -- (-2327.615) [-2327.494] (-2331.365) (-2335.479) * (-2333.024) (-2330.068) [-2335.819] (-2336.293) -- 0:00:06 957000 -- (-2332.143) (-2332.682) [-2334.146] (-2328.486) * (-2334.167) (-2337.124) [-2330.689] (-2332.415) -- 0:00:06 957500 -- (-2333.211) [-2332.785] (-2334.446) (-2326.567) * (-2330.408) (-2333.633) (-2331.849) [-2335.923] -- 0:00:06 958000 -- (-2329.114) [-2331.395] (-2333.791) (-2335.191) * [-2334.224] (-2334.205) (-2331.677) (-2334.107) -- 0:00:06 958500 -- [-2331.197] (-2331.849) (-2327.025) (-2332.185) * (-2333.443) (-2342.954) [-2331.172] (-2332.070) -- 0:00:06 959000 -- (-2334.893) (-2328.916) [-2330.425] (-2334.342) * (-2332.046) (-2334.510) (-2334.045) [-2331.319] -- 0:00:06 959500 -- (-2338.068) [-2335.315] (-2329.668) (-2330.172) * (-2333.577) (-2335.394) (-2333.201) [-2332.088] -- 0:00:06 960000 -- (-2332.767) [-2329.408] (-2331.657) (-2337.103) * (-2327.634) [-2334.289] (-2332.985) (-2335.201) -- 0:00:06 Average standard deviation of split frequencies: 0.000000 960500 -- [-2334.542] (-2331.755) (-2328.584) (-2327.871) * (-2327.334) (-2326.888) [-2330.445] (-2336.693) -- 0:00:06 961000 -- (-2336.445) [-2332.601] (-2329.367) (-2328.189) * [-2327.837] (-2338.696) (-2333.823) (-2329.897) -- 0:00:05 961500 -- [-2331.561] (-2331.307) (-2327.737) (-2329.164) * (-2335.695) (-2328.479) (-2334.268) [-2331.387] -- 0:00:05 962000 -- (-2338.586) (-2328.850) (-2332.343) [-2330.037] * (-2337.493) (-2331.637) [-2330.225] (-2330.755) -- 0:00:05 962500 -- (-2333.200) (-2331.625) [-2328.674] (-2331.821) * [-2335.201] (-2335.559) (-2334.567) (-2333.185) -- 0:00:05 963000 -- [-2331.164] (-2343.569) (-2337.913) (-2327.779) * (-2334.574) (-2333.110) [-2335.138] (-2331.775) -- 0:00:05 963500 -- (-2332.916) (-2340.849) (-2327.686) [-2328.499] * [-2330.446] (-2331.030) (-2327.859) (-2330.061) -- 0:00:05 964000 -- [-2327.916] (-2337.422) (-2332.373) (-2333.671) * [-2332.449] (-2341.573) (-2333.931) (-2335.688) -- 0:00:05 964500 -- (-2331.366) (-2331.399) (-2327.700) [-2334.844] * (-2333.408) [-2328.152] (-2337.334) (-2336.920) -- 0:00:05 965000 -- (-2332.438) [-2332.355] (-2333.175) (-2330.668) * [-2334.207] (-2332.867) (-2330.180) (-2336.142) -- 0:00:05 Average standard deviation of split frequencies: 0.000000 965500 -- (-2330.676) (-2331.219) [-2331.344] (-2328.114) * (-2333.873) (-2324.964) (-2330.418) [-2326.586] -- 0:00:05 966000 -- (-2333.812) [-2329.476] (-2329.336) (-2332.656) * (-2331.786) [-2332.778] (-2331.371) (-2331.988) -- 0:00:05 966500 -- (-2330.320) [-2327.824] (-2338.090) (-2334.421) * (-2333.078) [-2329.887] (-2334.819) (-2334.401) -- 0:00:05 967000 -- (-2343.171) [-2331.042] (-2332.177) (-2332.931) * (-2333.551) (-2334.773) (-2336.479) [-2327.935] -- 0:00:05 967500 -- (-2328.306) (-2331.693) [-2328.892] (-2339.493) * (-2330.836) (-2332.803) (-2339.039) [-2330.144] -- 0:00:04 968000 -- [-2332.186] (-2328.343) (-2332.560) (-2336.229) * (-2334.195) (-2334.293) [-2330.985] (-2336.303) -- 0:00:04 968500 -- (-2332.962) [-2329.091] (-2333.929) (-2328.274) * (-2333.056) [-2336.345] (-2332.409) (-2337.924) -- 0:00:04 969000 -- [-2331.146] (-2333.177) (-2334.723) (-2332.318) * [-2329.736] (-2340.976) (-2329.878) (-2335.927) -- 0:00:04 969500 -- (-2331.184) [-2333.685] (-2330.997) (-2334.682) * (-2342.018) (-2329.964) [-2329.261] (-2333.225) -- 0:00:04 970000 -- (-2333.591) (-2329.073) [-2331.284] (-2333.669) * (-2332.037) [-2331.446] (-2328.923) (-2337.162) -- 0:00:04 Average standard deviation of split frequencies: 0.000000 970500 -- [-2333.890] (-2331.831) (-2330.323) (-2337.527) * (-2334.490) [-2329.198] (-2329.857) (-2337.497) -- 0:00:04 971000 -- (-2336.387) (-2334.812) [-2336.571] (-2336.658) * (-2333.587) [-2334.945] (-2336.364) (-2330.219) -- 0:00:04 971500 -- [-2328.770] (-2331.107) (-2334.544) (-2337.837) * (-2339.708) [-2335.302] (-2338.566) (-2339.211) -- 0:00:04 972000 -- (-2331.039) [-2327.412] (-2332.356) (-2328.290) * (-2337.482) (-2337.333) [-2334.589] (-2338.231) -- 0:00:04 972500 -- (-2333.437) (-2336.846) [-2334.717] (-2330.527) * [-2330.409] (-2334.589) (-2330.320) (-2330.735) -- 0:00:04 973000 -- (-2336.399) (-2330.371) (-2345.953) [-2333.838] * (-2331.955) (-2332.031) [-2330.116] (-2342.193) -- 0:00:04 973500 -- (-2334.953) [-2333.160] (-2336.520) (-2339.759) * (-2330.528) (-2338.302) (-2333.675) [-2334.910] -- 0:00:04 974000 -- (-2333.381) (-2332.996) (-2339.578) [-2332.185] * (-2334.516) [-2334.392] (-2330.660) (-2340.603) -- 0:00:03 974500 -- (-2330.342) (-2333.938) [-2332.474] (-2329.078) * (-2334.135) (-2331.710) [-2335.319] (-2340.897) -- 0:00:03 975000 -- (-2333.563) [-2329.629] (-2333.481) (-2330.449) * (-2339.407) [-2333.254] (-2336.109) (-2330.138) -- 0:00:03 Average standard deviation of split frequencies: 0.000000 975500 -- [-2334.172] (-2329.613) (-2336.650) (-2330.868) * [-2330.413] (-2337.710) (-2333.488) (-2329.151) -- 0:00:03 976000 -- [-2330.791] (-2332.671) (-2338.274) (-2328.280) * (-2334.485) (-2330.344) (-2335.922) [-2329.113] -- 0:00:03 976500 -- (-2333.348) (-2333.114) [-2331.568] (-2331.315) * [-2332.213] (-2336.044) (-2334.707) (-2333.399) -- 0:00:03 977000 -- (-2331.674) [-2332.786] (-2330.841) (-2333.863) * [-2329.315] (-2336.016) (-2333.089) (-2332.761) -- 0:00:03 977500 -- (-2330.607) (-2341.132) [-2331.583] (-2331.218) * (-2329.779) (-2329.944) (-2340.361) [-2337.125] -- 0:00:03 978000 -- (-2335.061) (-2338.956) [-2328.401] (-2335.494) * (-2331.004) (-2335.389) (-2334.825) [-2337.874] -- 0:00:03 978500 -- (-2331.846) (-2334.761) (-2330.885) [-2330.445] * (-2329.634) (-2333.762) (-2335.296) [-2337.873] -- 0:00:03 979000 -- (-2335.906) [-2329.263] (-2330.247) (-2328.136) * (-2331.943) [-2329.845] (-2334.321) (-2331.620) -- 0:00:03 979500 -- (-2331.142) [-2337.747] (-2335.258) (-2331.195) * (-2333.676) (-2331.068) (-2334.567) [-2333.201] -- 0:00:03 980000 -- (-2329.135) (-2333.456) [-2331.150] (-2332.440) * [-2331.267] (-2330.832) (-2334.057) (-2331.247) -- 0:00:03 Average standard deviation of split frequencies: 0.000000 980500 -- [-2339.721] (-2335.185) (-2331.135) (-2334.250) * (-2332.950) [-2328.381] (-2331.605) (-2336.077) -- 0:00:02 981000 -- [-2338.083] (-2338.727) (-2331.547) (-2340.008) * (-2329.389) [-2328.402] (-2340.884) (-2328.189) -- 0:00:02 981500 -- (-2329.920) [-2335.478] (-2331.295) (-2333.177) * (-2331.238) [-2327.577] (-2330.307) (-2333.324) -- 0:00:02 982000 -- [-2335.845] (-2335.474) (-2329.330) (-2330.031) * (-2330.209) (-2336.111) (-2332.933) [-2333.870] -- 0:00:02 982500 -- (-2336.764) (-2337.125) (-2329.710) [-2331.987] * [-2332.675] (-2346.028) (-2335.804) (-2333.326) -- 0:00:02 983000 -- (-2337.751) [-2333.360] (-2328.764) (-2337.305) * (-2338.034) (-2331.995) [-2327.912] (-2331.673) -- 0:00:02 983500 -- (-2329.050) (-2332.303) (-2334.540) [-2330.861] * (-2340.343) [-2330.701] (-2331.234) (-2333.558) -- 0:00:02 984000 -- (-2334.189) (-2337.662) (-2336.213) [-2328.095] * (-2333.130) (-2334.059) [-2331.305] (-2328.704) -- 0:00:02 984500 -- (-2334.200) (-2336.330) [-2335.108] (-2335.640) * (-2336.168) (-2331.529) [-2338.548] (-2329.064) -- 0:00:02 985000 -- [-2333.420] (-2338.010) (-2330.320) (-2331.275) * (-2336.751) (-2332.480) (-2335.120) [-2336.353] -- 0:00:02 Average standard deviation of split frequencies: 0.000000 985500 -- [-2333.474] (-2337.218) (-2337.558) (-2331.818) * (-2330.584) (-2334.898) [-2331.533] (-2334.724) -- 0:00:02 986000 -- (-2337.108) (-2340.057) [-2329.870] (-2340.181) * (-2333.776) [-2331.137] (-2335.713) (-2328.208) -- 0:00:02 986500 -- (-2332.954) (-2330.619) (-2327.916) [-2329.723] * [-2330.709] (-2336.470) (-2334.212) (-2334.685) -- 0:00:02 987000 -- (-2327.991) (-2333.139) [-2333.984] (-2337.603) * (-2333.509) (-2337.513) (-2336.422) [-2334.509] -- 0:00:01 987500 -- (-2327.895) [-2328.939] (-2338.221) (-2333.093) * (-2333.421) [-2329.754] (-2337.224) (-2334.699) -- 0:00:01 988000 -- (-2329.759) [-2334.591] (-2332.434) (-2330.748) * (-2330.021) (-2330.798) (-2338.441) [-2336.263] -- 0:00:01 988500 -- (-2334.455) (-2337.689) [-2330.293] (-2329.943) * (-2334.593) (-2331.027) [-2338.684] (-2333.780) -- 0:00:01 989000 -- [-2335.822] (-2336.795) (-2331.827) (-2331.182) * [-2331.227] (-2336.357) (-2331.676) (-2333.282) -- 0:00:01 989500 -- (-2335.417) [-2332.967] (-2328.680) (-2337.407) * (-2334.547) [-2331.796] (-2331.733) (-2329.693) -- 0:00:01 990000 -- (-2336.331) [-2331.029] (-2330.135) (-2329.678) * (-2336.212) (-2332.767) [-2332.355] (-2328.340) -- 0:00:01 Average standard deviation of split frequencies: 0.000000 990500 -- (-2328.981) [-2330.690] (-2339.154) (-2328.873) * (-2332.042) [-2328.038] (-2335.888) (-2332.265) -- 0:00:01 991000 -- (-2332.376) [-2333.116] (-2332.887) (-2332.889) * (-2336.323) (-2327.819) (-2330.197) [-2331.206] -- 0:00:01 991500 -- (-2330.287) (-2332.847) (-2328.479) [-2332.609] * [-2332.801] (-2339.527) (-2340.891) (-2329.747) -- 0:00:01 992000 -- (-2334.307) (-2330.340) [-2326.291] (-2329.950) * (-2330.841) (-2334.147) [-2329.983] (-2338.107) -- 0:00:01 992500 -- (-2337.687) (-2329.706) [-2331.256] (-2330.102) * (-2336.250) [-2333.450] (-2330.185) (-2335.033) -- 0:00:01 993000 -- (-2341.015) (-2332.636) [-2329.055] (-2333.462) * (-2331.477) (-2335.352) (-2332.547) [-2332.026] -- 0:00:01 993500 -- (-2330.747) (-2335.707) (-2332.845) [-2327.222] * (-2331.929) (-2332.756) [-2335.540] (-2329.816) -- 0:00:00 994000 -- (-2340.434) (-2332.565) (-2330.007) [-2327.071] * (-2337.595) (-2330.803) (-2330.247) [-2331.490] -- 0:00:00 994500 -- (-2342.881) (-2337.945) (-2338.931) [-2330.328] * [-2330.824] (-2339.593) (-2331.968) (-2333.567) -- 0:00:00 995000 -- [-2337.410] (-2336.127) (-2334.999) (-2335.052) * [-2331.395] (-2338.581) (-2330.402) (-2331.270) -- 0:00:00 Average standard deviation of split frequencies: 0.000000 995500 -- (-2329.837) (-2331.736) [-2349.410] (-2332.959) * [-2329.502] (-2337.450) (-2330.360) (-2330.677) -- 0:00:00 996000 -- [-2331.720] (-2329.633) (-2331.839) (-2330.116) * (-2328.150) [-2329.348] (-2330.259) (-2327.407) -- 0:00:00 996500 -- (-2330.897) [-2330.999] (-2329.897) (-2334.692) * [-2329.531] (-2334.388) (-2334.306) (-2331.467) -- 0:00:00 997000 -- (-2330.828) (-2333.362) (-2336.551) [-2336.183] * (-2332.075) [-2328.821] (-2333.434) (-2338.576) -- 0:00:00 997500 -- (-2332.538) (-2335.548) (-2337.709) [-2332.413] * (-2329.152) [-2332.578] (-2340.929) (-2334.613) -- 0:00:00 998000 -- (-2329.892) [-2330.066] (-2334.355) (-2327.759) * (-2334.751) (-2332.197) (-2327.714) [-2333.132] -- 0:00:00 998500 -- [-2334.439] (-2329.770) (-2330.662) (-2329.545) * (-2332.378) [-2336.333] (-2332.820) (-2343.812) -- 0:00:00 999000 -- [-2342.427] (-2331.378) (-2331.276) (-2330.102) * [-2334.064] (-2333.664) (-2330.417) (-2328.398) -- 0:00:00 999500 -- (-2333.410) (-2332.473) [-2333.424] (-2327.596) * [-2330.466] (-2335.914) (-2327.974) (-2332.909) -- 0:00:00 1000000 -- [-2330.642] (-2328.315) (-2326.403) (-2336.161) * (-2332.829) (-2329.713) (-2335.112) [-2335.732] -- 0:00:00 Average standard deviation of split frequencies: 0.000000 Final log likelihoods and log prior probs for run 1 (stored and calculated): Chain 1 -- -2330.642451 -- 11.346737 Chain 1 -- -2330.642451 -- 11.346737 Chain 2 -- -2328.314951 -- 8.025693 Chain 2 -- -2328.314951 -- 8.025693 Chain 3 -- -2326.402888 -- 7.617591 Chain 3 -- -2326.402888 -- 7.617591 Chain 4 -- -2336.161466 -- 8.383147 Chain 4 -- -2336.161466 -- 8.383147 Final log likelihoods and log prior probs for run 2 (stored and calculated): Chain 1 -- -2332.829368 -- 9.579625 Chain 1 -- -2332.829368 -- 9.579625 Chain 2 -- -2329.713042 -- 7.681745 Chain 2 -- -2329.713042 -- 7.681745 Chain 3 -- -2335.111765 -- 10.528535 Chain 3 -- -2335.111765 -- 10.528535 Chain 4 -- -2335.731713 -- 10.457597 Chain 4 -- -2335.731713 -- 10.457597 Analysis completed in 2 mins 32 seconds Analysis used 152.00 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -2323.06 Likelihood of best state for "cold" chain of run 2 was -2323.16 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 51.0 % ( 39 %) Dirichlet(Revmat{all}) 64.1 % ( 45 %) Slider(Revmat{all}) 25.0 % ( 25 %) Dirichlet(Pi{all}) 26.9 % ( 23 %) Slider(Pi{all}) 57.9 % ( 23 %) Multiplier(Alpha{1,2}) 41.4 % ( 27 %) Multiplier(Alpha{3}) 46.3 % ( 33 %) Slider(Pinvar{all}) 0.0 % ( 0 %) NNI(Tau{all},V{all}) 0.0 % ( 0 %) ParsSPR(Tau{all},V{all}) 25.8 % ( 24 %) Multiplier(V{all}) 25.0 % ( 32 %) Nodeslider(V{all}) 25.9 % ( 19 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 50.8 % ( 35 %) Dirichlet(Revmat{all}) 64.4 % ( 45 %) Slider(Revmat{all}) 24.6 % ( 29 %) Dirichlet(Pi{all}) 26.7 % ( 23 %) Slider(Pi{all}) 58.0 % ( 27 %) Multiplier(Alpha{1,2}) 41.5 % ( 23 %) Multiplier(Alpha{3}) 45.8 % ( 17 %) Slider(Pinvar{all}) 0.0 % ( 0 %) NNI(Tau{all},V{all}) 0.0 % ( 0 %) ParsSPR(Tau{all},V{all}) 25.9 % ( 30 %) Multiplier(V{all}) 25.2 % ( 26 %) Nodeslider(V{all}) 25.7 % ( 24 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.85 0.71 0.60 2 | 166968 0.86 0.73 3 | 166895 166543 0.87 4 | 166507 165991 167096 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.85 0.71 0.59 2 | 167213 0.86 0.73 3 | 166406 166650 0.87 4 | 166692 166190 166849 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /opt/ADOPS/444/zpg-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/444/zpg-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /opt/ADOPS/444/zpg-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -2330.05 | 2 | | | | | | 2 1 2 1 | | 2 | | 2 2 2 1 2 1 1 1 | | 1 2 2 2 1 2 2 1 | | 1 1 2 12 21 1 1 1 1 2 * 2 | | 1 1 1 * 2 12 2 2 1 *2 | | 2 2 1 2 2 1 2 *1 2 * 1 1 1 22| |22 11 1 1 1*2 1 2 12 * 1 21 | | 21 2 1 2 1 2 1 2 1 2 11| |1 1 2 1 2 2 22 1 2 | | 1 2 2 1 2 | | 1 2 1 1 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2333.44 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/444/zpg-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/zpg-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/444/zpg-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2329.15 -2342.16 2 -2329.12 -2339.32 -------------------------------------- TOTAL -2329.13 -2341.52 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/444/zpg-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/zpg-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/444/zpg-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.325907 0.003289 0.223357 0.439625 0.319262 1207.42 1285.00 1.001 r(A<->C){all} 0.131589 0.001361 0.063823 0.205497 0.128520 988.27 1089.63 1.000 r(A<->G){all} 0.398423 0.004494 0.277841 0.535280 0.395721 623.19 697.14 1.000 r(A<->T){all} 0.042734 0.000602 0.000756 0.088180 0.039315 883.37 1060.28 1.000 r(C<->G){all} 0.061263 0.000503 0.019579 0.105591 0.059478 1156.27 1238.34 1.000 r(C<->T){all} 0.315396 0.003081 0.208095 0.423592 0.314097 684.18 779.26 1.000 r(G<->T){all} 0.050596 0.000438 0.011354 0.089464 0.048339 1120.88 1147.28 1.001 pi(A){all} 0.211751 0.000141 0.189340 0.235089 0.211474 1274.34 1387.67 1.001 pi(C){all} 0.267992 0.000158 0.242656 0.291099 0.268020 1213.84 1326.01 1.000 pi(G){all} 0.257018 0.000159 0.233250 0.282260 0.257198 1041.61 1155.35 1.002 pi(T){all} 0.263239 0.000161 0.239110 0.289078 0.263315 1090.33 1091.96 1.000 alpha{1,2} 0.050342 0.001145 0.000169 0.112103 0.045912 1034.95 1170.11 1.000 alpha{3} 2.628889 0.784818 1.170384 4.430223 2.492902 1315.13 1408.07 1.002 pinvar{all} 0.520892 0.004272 0.392716 0.641791 0.526515 1310.63 1358.06 1.001 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/opt/ADOPS/444/zpg-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/444/zpg-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /opt/ADOPS/444/zpg-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/opt/ADOPS/444/zpg-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 Key to taxon bipartitions (saved to file "/opt/ADOPS/444/zpg-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ---------- 1 -- .*** 2 -- .*.. 3 -- ..*. 4 -- ...* 5 -- ..** ---------- Summary statistics for informative taxon bipartitions (saved to file "/opt/ADOPS/444/zpg-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 5 3002 1.000000 0.000000 1.000000 1.000000 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/opt/ADOPS/444/zpg-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------ length{all}[1] 0.039547 0.000144 0.016331 0.061615 0.038326 1.000 2 length{all}[2] 0.029874 0.000111 0.011655 0.051787 0.028781 1.000 2 length{all}[3] 0.103646 0.000794 0.056763 0.159576 0.099347 1.001 2 length{all}[4] 0.038668 0.000206 0.012716 0.067998 0.037178 1.000 2 length{all}[5] 0.114172 0.000920 0.062512 0.175479 0.110521 1.000 2 ------------------------------------------------------------------------------------------ + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.000000 Maximum standard deviation of split frequencies = 0.000000 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.001 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) + | /------------------------------------ C3 (3) \----------------100----------------+ \------------------------------------ C4 (4) Phylogram (based on average branch lengths): /------------- C1 (1) | |---------- C2 (2) + | /---------------------------------- C3 (3) \-------------------------------------+ \------------- C4 (4) |----------------| 0.050 expected changes per site Calculating tree probabilities... Credible sets of trees (1 tree sampled): 99 % credible set contains 1 tree Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.8, March 2014 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8 seq file is not paml/phylip format. Trying nexus format. ns = 4 ls = 1101 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Sequences read.. Counting site patterns.. 0:00 171 patterns at 367 / 367 sites (100.0%), 0:00 Counting codons.. 48 bytes for distance 166896 bytes for conP 23256 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, (3, 4)); MP score: 153 0.081000 0.043699 0.145999 0.133739 0.081239 0.300000 1.300000 ntime & nrate & np: 5 2 7 Bounds (np=7): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 7 lnL0 = -2437.882885 Iterating by ming2 Initial: fx= 2437.882885 x= 0.08100 0.04370 0.14600 0.13374 0.08124 0.30000 1.30000 1 h-m-p 0.0000 0.0023 257.8304 +++YCYCCC 2391.959144 5 0.0015 24 | 0/7 2 h-m-p 0.0004 0.0033 1005.0072 YCYCCC 2352.507354 5 0.0007 42 | 0/7 3 h-m-p 0.0001 0.0005 515.4053 +YYYCCC 2330.783505 5 0.0004 60 | 0/7 4 h-m-p 0.0009 0.0047 220.8871 +YYYCYYYCYC 2272.181470 10 0.0044 84 | 0/7 5 h-m-p 0.0000 0.0000 919.2983 YYYC 2271.707390 3 0.0000 97 | 0/7 6 h-m-p 0.0003 0.0019 26.5258 CCCC 2271.528023 3 0.0005 113 | 0/7 7 h-m-p 0.0051 0.1992 2.3858 ++YCCCC 2269.201074 4 0.0586 132 | 0/7 8 h-m-p 0.0340 0.1702 3.9357 +YYYYCCC 2196.190825 6 0.1300 151 | 0/7 9 h-m-p 0.1267 0.6334 0.3972 CYCCCC 2190.984696 5 0.2289 170 | 0/7 10 h-m-p 0.6735 3.3675 0.0634 CCCC 2187.774035 3 1.1282 193 | 0/7 11 h-m-p 0.2216 1.1081 0.1496 CCCCC 2186.462653 4 0.2827 218 | 0/7 12 h-m-p 1.1779 7.0799 0.0359 YYC 2185.980450 2 0.9098 237 | 0/7 13 h-m-p 0.8390 8.0000 0.0389 ++ 2185.262590 m 8.0000 254 | 0/7 14 h-m-p 1.6000 8.0000 0.0286 CCC 2184.632036 2 1.4373 275 | 0/7 15 h-m-p 0.6631 8.0000 0.0621 +YCC 2184.418047 2 1.8021 296 | 0/7 16 h-m-p 1.6000 8.0000 0.0518 YC 2184.384466 1 1.0484 314 | 0/7 17 h-m-p 1.6000 8.0000 0.0173 YC 2184.381257 1 0.8661 332 | 0/7 18 h-m-p 1.6000 8.0000 0.0032 YC 2184.381095 1 0.9983 350 | 0/7 19 h-m-p 1.6000 8.0000 0.0001 Y 2184.381091 0 0.9083 367 | 0/7 20 h-m-p 1.6000 8.0000 0.0000 C 2184.381091 0 1.9926 384 | 0/7 21 h-m-p 1.6000 8.0000 0.0000 Y 2184.381091 0 1.0864 401 | 0/7 22 h-m-p 1.6000 8.0000 0.0000 --C 2184.381091 0 0.0250 420 Out.. lnL = -2184.381091 421 lfun, 421 eigenQcodon, 2105 P(t) Time used: 0:01 Model 1: NearlyNeutral TREE # 1 (1, 2, (3, 4)); MP score: 153 0.081000 0.043699 0.145999 0.133739 0.081239 1.970813 0.755520 0.234606 ntime & nrate & np: 5 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 8.289714 np = 8 lnL0 = -2238.382759 Iterating by ming2 Initial: fx= 2238.382759 x= 0.08100 0.04370 0.14600 0.13374 0.08124 1.97081 0.75552 0.23461 1 h-m-p 0.0000 0.0015 205.2584 ++++ 2191.502002 m 0.0015 15 | 0/8 2 h-m-p 0.0004 0.0018 48.3182 CCC 2191.032342 2 0.0004 30 | 0/8 3 h-m-p 0.0002 0.0011 71.8462 YYC 2190.779596 2 0.0002 43 | 0/8 4 h-m-p 0.0012 0.0060 11.1620 YCC 2190.725386 2 0.0005 57 | 0/8 5 h-m-p 0.0004 0.0743 13.6327 +++YCYCCCC 2184.412603 6 0.0347 81 | 0/8 6 h-m-p 0.0002 0.0011 399.4085 +YCCC 2180.882898 3 0.0008 98 | 0/8 7 h-m-p 0.0002 0.0010 32.2410 YCCC 2180.770528 3 0.0004 114 | 0/8 8 h-m-p 0.0038 0.1203 3.3589 C 2180.762887 0 0.0009 125 | 0/8 9 h-m-p 0.0024 1.1787 2.3401 +++YCCCCC 2178.443374 5 0.3546 148 | 0/8 10 h-m-p 1.6000 8.0000 0.4512 CYC 2177.911706 2 0.3312 162 | 0/8 11 h-m-p 1.6000 8.0000 0.0092 CC 2177.549288 1 1.3404 183 | 0/8 12 h-m-p 0.8688 8.0000 0.0142 YC 2177.501782 1 1.9495 203 | 0/8 13 h-m-p 0.7883 8.0000 0.0352 CC 2177.492811 1 0.9906 224 | 0/8 14 h-m-p 1.6000 8.0000 0.0074 YC 2177.492192 1 1.0638 244 | 0/8 15 h-m-p 1.6000 8.0000 0.0001 Y 2177.492180 0 1.2398 263 | 0/8 16 h-m-p 1.6000 8.0000 0.0000 Y 2177.492180 0 1.1048 282 | 0/8 17 h-m-p 1.6000 8.0000 0.0000 Y 2177.492180 0 1.1816 301 | 0/8 18 h-m-p 1.6000 8.0000 0.0000 Y 2177.492180 0 0.9253 320 | 0/8 19 h-m-p 1.6000 8.0000 0.0000 -----Y 2177.492180 0 0.0007 344 Out.. lnL = -2177.492180 345 lfun, 1035 eigenQcodon, 3450 P(t) Time used: 0:03 Model 2: PositiveSelection TREE # 1 (1, 2, (3, 4)); MP score: 153 initial w for M2:NSpselection reset. 0.081000 0.043699 0.145999 0.133739 0.081239 2.075607 1.079469 0.409056 0.257593 2.430889 ntime & nrate & np: 5 3 10 Bounds (np=10): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 4.970886 np = 10 lnL0 = -2283.622934 Iterating by ming2 Initial: fx= 2283.622934 x= 0.08100 0.04370 0.14600 0.13374 0.08124 2.07561 1.07947 0.40906 0.25759 2.43089 1 h-m-p 0.0000 0.0030 153.7875 +++++ 2272.072547 m 0.0030 18 | 1/10 2 h-m-p 0.0046 0.1625 84.2012 CCCC 2257.483297 3 0.0057 37 | 1/10 3 h-m-p 0.0008 0.0040 89.9468 +YYCCC 2250.746952 4 0.0029 57 | 1/10 4 h-m-p 0.0020 0.0101 120.4385 CCC 2245.982987 2 0.0022 74 | 1/10 5 h-m-p 0.0111 0.0556 16.5639 CCC 2245.670322 2 0.0025 91 | 1/10 6 h-m-p 0.0055 0.2456 7.6341 ++YYYCCCCC 2240.853353 7 0.0971 117 | 1/10 7 h-m-p 0.0015 0.0077 225.4616 CYCCCC 2236.311929 5 0.0031 139 | 1/10 8 h-m-p 0.2134 1.0671 1.9456 +YYYYYC 2203.643744 5 0.8422 158 | 1/10 9 h-m-p 0.0808 0.4040 2.5833 YCYCCC 2199.538177 5 0.1834 179 | 1/10 10 h-m-p 0.0804 0.8110 5.8903 +YYCCC 2187.488234 4 0.2610 199 | 1/10 11 h-m-p 0.2206 1.1028 2.6361 CCCCC 2184.346185 4 0.2908 220 | 0/10 12 h-m-p 0.0022 0.0109 197.7465 -YC 2184.332458 1 0.0001 235 | 0/10 13 h-m-p 0.0337 3.2873 0.5974 ++CCCCC 2182.010338 4 0.8575 258 | 0/10 14 h-m-p 0.4012 2.7737 1.2768 CCCC 2179.895034 3 0.6627 287 | 0/10 15 h-m-p 0.4363 2.1815 0.5718 CCC 2178.942203 2 0.6766 304 | 0/10 16 h-m-p 0.5276 2.6380 0.5035 CCC 2178.164341 2 0.6962 331 | 0/10 17 h-m-p 0.1377 0.6887 0.8489 ++ 2177.654205 m 0.6887 354 | 1/10 18 h-m-p 0.3323 8.0000 0.5338 YCC 2177.536502 2 0.2118 380 | 1/10 19 h-m-p 1.6000 8.0000 0.0581 YC 2177.494909 1 0.9103 403 | 1/10 20 h-m-p 1.6000 8.0000 0.0193 YC 2177.492757 1 0.8944 426 | 1/10 21 h-m-p 1.6000 8.0000 0.0059 C 2177.492202 0 1.4881 448 | 1/10 22 h-m-p 1.6000 8.0000 0.0012 Y 2177.492180 0 1.0010 470 | 1/10 23 h-m-p 1.6000 8.0000 0.0001 Y 2177.492180 0 1.0390 492 | 1/10 24 h-m-p 1.6000 8.0000 0.0000 Y 2177.492180 0 0.7381 514 | 1/10 25 h-m-p 1.6000 8.0000 0.0000 Y 2177.492180 0 0.7576 536 | 1/10 26 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 1/10 27 h-m-p 0.0160 8.0000 0.0000 -----C 2177.492180 0 0.0000 599 Out.. lnL = -2177.492180 600 lfun, 2400 eigenQcodon, 9000 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2191.542028 S = -2115.301419 -67.188824 Calculating f(w|X), posterior probabilities of site classes. did 10 / 171 patterns 0:06 did 20 / 171 patterns 0:07 did 30 / 171 patterns 0:07 did 40 / 171 patterns 0:07 did 50 / 171 patterns 0:07 did 60 / 171 patterns 0:07 did 70 / 171 patterns 0:07 did 80 / 171 patterns 0:07 did 90 / 171 patterns 0:07 did 100 / 171 patterns 0:07 did 110 / 171 patterns 0:07 did 120 / 171 patterns 0:07 did 130 / 171 patterns 0:07 did 140 / 171 patterns 0:07 did 150 / 171 patterns 0:07 did 160 / 171 patterns 0:07 did 170 / 171 patterns 0:07 did 171 / 171 patterns 0:07 Time used: 0:07 Model 3: discrete TREE # 1 (1, 2, (3, 4)); MP score: 153 0.081000 0.043699 0.145999 0.133739 0.081239 2.075606 0.408838 0.998206 0.029119 0.063283 0.095738 ntime & nrate & np: 5 4 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000 Qfactor_NS = 16.526357 np = 11 lnL0 = -2184.606922 Iterating by ming2 Initial: fx= 2184.606922 x= 0.08100 0.04370 0.14600 0.13374 0.08124 2.07561 0.40884 0.99821 0.02912 0.06328 0.09574 1 h-m-p 0.0000 0.0011 79.7268 ++YCCC 2183.671579 3 0.0003 23 | 0/11 2 h-m-p 0.0001 0.0006 54.5241 ++ 2182.977875 m 0.0006 37 | 1/11 3 h-m-p 0.0007 0.0108 32.0947 CYC 2182.772197 2 0.0007 54 | 1/11 4 h-m-p 0.0005 0.0035 45.6071 ++ 2179.714053 m 0.0035 68 | 2/11 5 h-m-p 0.0003 0.0024 483.8334 CYC 2179.510289 2 0.0001 85 | 2/11 6 h-m-p 0.0035 0.0176 9.2853 YC 2179.474883 1 0.0007 100 | 2/11 7 h-m-p 0.0032 0.6785 1.9773 ++CCCC 2179.222829 3 0.0681 122 | 2/11 8 h-m-p 0.0010 0.0270 129.0650 +CC 2178.201453 1 0.0041 139 | 2/11 9 h-m-p 1.1333 6.1278 0.4686 YCC 2177.274443 2 0.6841 156 | 1/11 10 h-m-p 0.0468 0.6426 6.8574 --YC 2177.267973 1 0.0004 182 | 1/11 11 h-m-p 0.0021 0.1101 1.1776 +++ 2177.021645 m 0.1101 197 | 2/11 12 h-m-p 0.5171 8.0000 0.2507 CCC 2176.883299 2 0.5984 215 | 2/11 13 h-m-p 0.5560 7.2465 0.2698 CC 2176.828887 1 0.2073 240 | 2/11 14 h-m-p 0.2370 8.0000 0.2360 +YYC 2176.782064 2 0.7644 266 | 2/11 15 h-m-p 1.6000 8.0000 0.0675 CCC 2176.742543 2 1.2655 293 | 2/11 16 h-m-p 1.6000 8.0000 0.0279 CC 2176.733307 1 1.4410 318 | 2/11 17 h-m-p 1.6000 8.0000 0.0076 YC 2176.733171 1 0.9426 342 | 2/11 18 h-m-p 1.6000 8.0000 0.0010 Y 2176.733169 0 0.9006 365 | 2/11 19 h-m-p 1.6000 8.0000 0.0001 Y 2176.733169 0 0.9668 388 | 2/11 20 h-m-p 1.6000 8.0000 0.0000 Y 2176.733169 0 1.0121 411 | 2/11 21 h-m-p 1.6000 8.0000 0.0000 C 2176.733169 0 1.6000 434 | 2/11 22 h-m-p 1.6000 8.0000 0.0000 ----C 2176.733169 0 0.0016 461 Out.. lnL = -2176.733169 462 lfun, 1848 eigenQcodon, 6930 P(t) Time used: 0:10 Model 7: beta TREE # 1 (1, 2, (3, 4)); MP score: 153 0.081000 0.043699 0.145999 0.133739 0.081239 2.028129 0.996708 1.805788 ntime & nrate & np: 5 1 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 9.028798 np = 8 lnL0 = -2229.106973 Iterating by ming2 Initial: fx= 2229.106973 x= 0.08100 0.04370 0.14600 0.13374 0.08124 2.02813 0.99671 1.80579 1 h-m-p 0.0000 0.0028 91.1843 ++YCCC 2227.953742 3 0.0003 20 | 0/8 2 h-m-p 0.0004 0.0028 76.7442 +YCCCC 2225.663568 4 0.0010 39 | 0/8 3 h-m-p 0.0002 0.0025 419.1974 + QuantileBeta(0.15, 0.00500, 2.28838) = 1.136607e-160 2000 rounds YCYYYYCC 2186.234174 7 0.0020 61 | 0/8 4 h-m-p 0.0000 0.0002 1127.1998 YCCCCC 2185.133832 5 0.0000 81 | 0/8 5 h-m-p 0.0016 0.0081 26.3283 YCCC 2184.877978 3 0.0009 97 | 0/8 6 h-m-p 0.0006 0.0210 36.9834 +YCCCC 2183.276768 4 0.0047 116 | 0/8 7 h-m-p 0.0013 0.0513 134.4498 YYCCC 2181.283822 4 0.0020 133 | 0/8 8 h-m-p 0.1739 1.5918 1.5467 YCCCC 2179.959971 4 0.3386 151 | 0/8 9 h-m-p 0.6989 8.0000 0.7493 YCCCC 2178.890306 4 0.4330 169 | 0/8 10 h-m-p 1.6000 8.0000 0.1031 CCC 2178.656357 2 1.3295 192 | 0/8 11 h-m-p 1.6000 8.0000 0.0570 YCC 2178.544052 2 2.6947 214 | 0/8 12 h-m-p 0.6401 8.0000 0.2398 ++ 2177.417565 m 8.0000 233 | 0/8 13 h-m-p 0.1294 0.6471 1.0196 CCCCC 2177.336447 4 0.1715 260 | 0/8 14 h-m-p 0.1138 0.5691 0.2999 YYCC 2177.238280 3 0.0810 275 | 0/8 15 h-m-p 0.2682 8.0000 0.0906 +YYC 2176.906398 2 0.9488 297 | 0/8 16 h-m-p 1.6000 8.0000 0.0429 YCC 2176.886683 2 1.1208 319 | 0/8 17 h-m-p 1.6000 8.0000 0.0128 YC 2176.885850 1 0.9375 339 | 0/8 18 h-m-p 1.6000 8.0000 0.0013 Y 2176.885820 0 1.1963 358 | 0/8 19 h-m-p 1.6000 8.0000 0.0002 Y 2176.885819 0 1.1130 377 | 0/8 20 h-m-p 1.6000 8.0000 0.0000 Y 2176.885819 0 1.1169 396 | 0/8 21 h-m-p 1.6000 8.0000 0.0000 Y 2176.885819 0 1.1952 415 | 0/8 22 h-m-p 1.6000 8.0000 0.0000 Y 2176.885819 0 1.6000 434 | 0/8 23 h-m-p 1.6000 8.0000 0.0000 --------------C 2176.885819 0 0.0000 467 Out.. lnL = -2176.885819 468 lfun, 5148 eigenQcodon, 23400 P(t) Time used: 0:19 Model 8: beta&w>1 TREE # 1 (1, 2, (3, 4)); MP score: 153 initial w for M8:NSbetaw>1 reset. 0.081000 0.043699 0.145999 0.133739 0.081239 2.029992 0.900000 0.709770 1.329016 2.821721 ntime & nrate & np: 5 2 10 Bounds (np=10): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 6.555870 np = 10 lnL0 = -2249.011835 Iterating by ming2 Initial: fx= 2249.011835 x= 0.08100 0.04370 0.14600 0.13374 0.08124 2.02999 0.90000 0.70977 1.32902 2.82172 1 h-m-p 0.0000 0.0004 291.1597 +++ 2227.499255 m 0.0004 16 | 1/10 2 h-m-p 0.0006 0.0032 87.6745 +YCYCCC 2220.782865 5 0.0018 38 | 1/10 3 h-m-p 0.0002 0.0009 656.6261 +YYYYYCCC 2191.454946 7 0.0007 61 | 1/10 4 h-m-p 0.0004 0.0018 96.2867 YCC 2190.924871 2 0.0002 77 | 1/10 5 h-m-p 0.0014 0.0192 16.2917 CCCC 2190.630630 3 0.0022 96 | 0/10 6 h-m-p 0.0004 0.0047 103.3646 YCCC 2190.270550 3 0.0002 114 | 0/10 7 h-m-p 0.0010 0.0157 20.0115 +CYC 2189.887682 2 0.0041 131 | 0/10 8 h-m-p 0.0012 0.0062 26.9271 YCCC 2189.598538 3 0.0027 149 | 0/10 9 h-m-p 0.0174 0.3485 4.1758 +++ 2181.634045 m 0.3485 163 | 0/10 10 h-m-p 0.0000 0.0000 3.7389 h-m-p: 0.00000000e+00 0.00000000e+00 3.73889204e+00 2181.634045 .. | 0/10 11 h-m-p 0.0000 0.0012 113.7559 ++YCCC 2179.457778 3 0.0003 193 | 0/10 12 h-m-p 0.0005 0.0025 40.4346 YCCC 2179.207433 3 0.0003 211 | 0/10 13 h-m-p 0.0005 0.0055 28.4257 CCC 2178.994314 2 0.0007 228 | 0/10 14 h-m-p 0.0008 0.0066 26.2293 YCC 2178.913505 2 0.0005 244 | 0/10 15 h-m-p 0.0005 0.0048 25.4720 CCC 2178.819470 2 0.0007 261 | 0/10 16 h-m-p 0.0029 0.0237 6.0484 C 2178.808709 0 0.0007 274 | 0/10 17 h-m-p 0.0007 0.2123 6.4960 +CCC 2178.772450 2 0.0034 292 | 0/10 18 h-m-p 0.0007 0.0409 31.2212 ++YCCCC 2177.450233 4 0.0230 314 | 0/10 19 h-m-p 0.0372 0.1860 0.9352 ++ 2177.320285 m 0.1860 327 | 1/10 20 h-m-p 0.0190 0.2144 1.9229 YC 2177.316903 1 0.0113 351 | 1/10 21 h-m-p 0.1243 8.0000 0.1754 ++YCC 2177.256757 2 1.4258 369 | 1/10 22 h-m-p 0.5534 3.0700 0.4520 YYCCCCC 2177.196909 6 0.6879 401 | 1/10 23 h-m-p 0.5525 2.7623 0.3937 YCCCCC 2177.127088 5 0.7695 432 | 1/10 24 h-m-p 0.2058 1.0288 0.4686 YCYCYC 2177.044206 5 0.3168 461 | 1/10 25 h-m-p 0.7782 3.8911 0.1177 YYC 2177.041121 2 0.5151 485 | 1/10 26 h-m-p 1.6000 8.0000 0.0085 ---------------Y 2177.041121 0 0.0000 522 | 1/10 27 h-m-p 0.0062 3.1243 0.0594 YC 2177.041010 1 0.0146 545 | 1/10 28 h-m-p 1.6000 8.0000 0.0005 ++ 2177.027362 m 8.0000 567 | 1/10 29 h-m-p 0.0728 1.6070 0.0549 ++C 2176.925833 0 1.1570 591 | 1/10 30 h-m-p 0.7506 3.7528 0.0355 YC 2176.903286 1 1.3596 614 | 1/10 31 h-m-p 0.4766 2.3832 0.0350 CC 2176.893229 1 0.6519 638 | 1/10 32 h-m-p 0.6338 3.1689 0.0028 +YC 2176.892124 1 1.6995 662 | 1/10 33 h-m-p 1.6000 8.0000 0.0025 C 2176.891958 0 1.2932 684 | 1/10 34 h-m-p 1.6000 8.0000 0.0003 C 2176.891958 0 0.4969 706 | 1/10 35 h-m-p 1.6000 8.0000 0.0000 ---------Y 2176.891958 0 0.0000 737 Out.. lnL = -2176.891958 738 lfun, 8856 eigenQcodon, 40590 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2196.533309 S = -2116.092137 -71.749614 Calculating f(w|X), posterior probabilities of site classes. did 10 / 171 patterns 0:35 did 20 / 171 patterns 0:35 did 30 / 171 patterns 0:35 did 40 / 171 patterns 0:36 did 50 / 171 patterns 0:36 did 60 / 171 patterns 0:36 did 70 / 171 patterns 0:36 did 80 / 171 patterns 0:36 did 90 / 171 patterns 0:36 did 100 / 171 patterns 0:37 did 110 / 171 patterns 0:37 did 120 / 171 patterns 0:37 did 130 / 171 patterns 0:37 did 140 / 171 patterns 0:37 did 150 / 171 patterns 0:38 did 160 / 171 patterns 0:38 did 170 / 171 patterns 0:38 did 171 / 171 patterns 0:38 Time used: 0:38 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=367 D_melanogaster_zpg-PB MYAAVKPLSKYLQFKSVHIYDAIFTLHSKVTVALLLACTFLLSSKQYFGD D_simulans_zpg-PB MYAAVKPLSKYLQFKSVHIYDAIFTLHSKVTVALLLACTFLLSSKQYFGD D_yakuba_zpg-PB MYAAVKPLSKYLQFKSVHIYDAIFTLHSKVTVALLLACTFLLSSKQYFGD D_erecta_zpg-PB MYAAVKPLSKYLQFKSVHIYDAIFTLHSKVTVALLLACTFLLSSKQYFGD ************************************************** D_melanogaster_zpg-PB PIQCFGDKDMDYVHAFCWIYGAYVSDNVTVTPLRNGAAQCRPDAVSKVVP D_simulans_zpg-PB PIQCFGDRDMDYVHAFCWIYGAYVSDNVTVTPLRNGAAQCRPDAVSKVVP D_yakuba_zpg-PB PIQCFGDKDMDYVHAFCWIYGAYVSDNVTVAPLKNGAAQCRPDAVSKVVP D_erecta_zpg-PB PIQCFGDKDMDYVHAFCWIYGAYVSDNVTVAPLRNGAAQCRPDAVSKVVP *******:**********************:**:**************** D_melanogaster_zpg-PB PENRNYITYYQWVVLVLLLESFVFYMPAFLWKIWEGGRLKHLCDDFHKMA D_simulans_zpg-PB PENRNYITYYQWVVLVLLLESFVFYMPAFLWKIWEGGRLKHLCDDFHKMA D_yakuba_zpg-PB PESRHYITYYQWVVLVLLLESFVFYLPAFLWKIWEGGRLKHLCDDFHKMA D_erecta_zpg-PB PENRHYITYYQWVVLVLLLESFVFYLPAFLWKIWEGGRLKHLCDDFHKMA **.*:********************:************************ D_melanogaster_zpg-PB VCKDKSRTHLRVLVNYFSSDYKETHFRYFVSYVFCEILNLSISILNFLLL D_simulans_zpg-PB VCKDKSRTHLRVLVNYFSSDYKETHFRYFVSYVFCEILNLSISILNFLLL D_yakuba_zpg-PB VCKDKSRTQIRVLVKYFSSDYKETHFRYFVSYVFCEILNLSISILNFLLL D_erecta_zpg-PB VCKDKSRTHLRVLVNYFSSDYKETHFRYFVSYVFCEILNLSISILNFLLL ********::****:*********************************** D_melanogaster_zpg-PB DVFFGGFWGRYRNALLSLYNGDYNQWNIITMAVFPKCAKCEMYKGGPSGS D_simulans_zpg-PB DVFFGGFWGRYRDALLSLYNGDYNQWNIITMAVFPKCAKCEMYKGGPSGS D_yakuba_zpg-PB DVFFGGFWGRYRDALLSLYNGDYNTWNIITMEVFPKCAKCEMYKGGPSGS D_erecta_zpg-PB DVFFGGFWRRYRDALLSLYNGDYNQWNIITMEVFPKCAKCEMYKGGPSGS ******** ***:*********** ****** ****************** D_melanogaster_zpg-PB SNIYDYLCLLPLNILNEKIFAFLWIWFILVAMLISLKFLYRLATVLYPGM D_simulans_zpg-PB SNIYDYLCLLPLNILNEKIFAFLWIWFILVAMLIALKFLYRLATVLYPGM D_yakuba_zpg-PB SNIYDYLCLLPLNILNEKIFAFLWLWFILVAMLVALKFMYRLATVLYPGM D_erecta_zpg-PB SNIYDYLCLLPLNILNEKIFAFLWMWFILVAVLVSLKFLYRLATILYPGM ************************:******:*::***:*****:***** D_melanogaster_zpg-PB RLQLLRARARFMPKKHLQVALRNCSFGDWFVLMRVGNNISPELFRKLLEE D_simulans_zpg-PB RLQLLRARARFMPKKHLQVALRNCSFGDWFVLMRVGNNISPELFRKLLEE D_yakuba_zpg-PB RLQLLRARARFMPKTHLQVALRNCSFGDWFVLMRVGNNISPEIFRKLLEE D_erecta_zpg-PB RLQLLRARARFMPKAHLQVALRNCSFGDWFVLMRVGNNISPEIFRKLLEE ************** ***************************:******* D_melanogaster_zpg-PB LYEAQSLIKIPPGADKI D_simulans_zpg-PB LYAAQSLFKKPPGADEI D_yakuba_zpg-PB LYEAQSLTKIPPGADEI D_erecta_zpg-PB LYEAQSLTKIPPGADEI ** **** * *****:*
>D_melanogaster_zpg-PB ATGTACGCAGCTGTTAAACCGCTCTCCAAGTATCTGCAGTTCAAGTCGGT GCACATCTACGATGCTATTTTCACGCTGCACTCCAAAGTCACAGTGGCCC TGCTTTTGGCCTGCACATTTTTGCTTTCCTCGAAACAATATTTCGGCGAT CCCATCCAGTGTTTTGGGGACAAGGATATGGACTACGTGCACGCCTTTTG TTGGATCTACGGGGCCTATGTGAGCGACAATGTGACTGTGACGCCCCTAA GGAATGGAGCTGCACAGTGCCGACCAGATGCGGTTAGTAAGGTAGTGCCC CCGGAAAATCGTAACTACATAACCTACTATCAGTGGGTCGTGCTGGTATT GCTGCTCGAGTCGTTTGTGTTTTATATGCCAGCATTTCTCTGGAAGATTT GGGAGGGCGGTCGGCTGAAGCATTTGTGCGATGATTTCCACAAGATGGCC GTTTGCAAGGACAAGAGCAGGACCCATTTGCGCGTACTAGTCAACTACTT CTCCAGCGATTACAAAGAGACCCACTTCCGCTACTTCGTTAGCTACGTCT TCTGCGAAATACTCAATTTGAGCATCAGTATTCTAAACTTCCTTCTGTTG GACGTATTTTTCGGAGGTTTTTGGGGCCGCTACCGTAATGCCTTGCTGTC CCTTTACAATGGCGACTATAACCAGTGGAACATTATAACCATGGCAGTCT TCCCCAAGTGTGCCAAGTGCGAGATGTACAAGGGCGGCCCCAGCGGTTCT TCCAACATATACGACTACCTTTGCCTGCTGCCCCTGAATATACTGAACGA GAAAATCTTCGCCTTCCTGTGGATATGGTTTATACTAGTGGCTATGCTCA TTTCCCTCAAGTTTCTGTACCGCCTGGCCACCGTTTTGTATCCCGGAATG CGTCTTCAGTTGCTTCGTGCCAGGGCACGTTTCATGCCCAAGAAGCACTT GCAGGTGGCATTGCGCAATTGCAGTTTTGGCGACTGGTTCGTGCTGATGC GCGTGGGCAACAACATCAGCCCCGAGCTATTCCGTAAGTTGCTGGAGGAG CTGTACGAAGCTCAGTCCTTGATCAAAATACCGCCAGGAGCGGACAAGAT C >D_simulans_zpg-PB ATGTACGCAGCTGTTAAGCCGCTCTCCAAGTATCTGCAGTTCAAGTCGGT GCACATCTACGATGCCATTTTCACGCTGCATTCCAAAGTCACGGTGGCCC TGCTTTTGGCCTGCACATTTTTGCTTTCCTCGAAACAATATTTCGGGGAT CCCATCCAGTGTTTTGGGGACAGGGACATGGACTACGTGCACGCCTTTTG CTGGATCTACGGGGCCTATGTGAGCGACAATGTGACAGTGACGCCGCTAA GGAATGGCGCTGCACAGTGCCGGCCAGATGCGGTTAGTAAGGTGGTGCCC CCAGAGAATCGCAACTACATCACCTACTATCAGTGGGTCGTGCTGGTATT GTTGCTCGAGTCGTTTGTGTTCTATATGCCGGCATTTCTCTGGAAGATTT GGGAGGGCGGTCGGCTGAAGCATTTGTGCGATGATTTCCACAAGATGGCC GTTTGCAAGGACAAGAGCAGAACTCATTTGCGCGTACTAGTCAACTACTT CTCCAGCGACTACAAGGAGACCCACTTCCGCTACTTCGTTAGCTACGTCT TCTGCGAAATACTCAATTTGAGCATCAGTATTCTAAACTTCCTTCTGTTG GACGTATTTTTCGGCGGTTTTTGGGGCCGCTACCGCGATGCCTTGCTGTC CCTTTACAATGGCGACTATAACCAGTGGAACATCATCACCATGGCAGTCT TTCCCAAGTGTGCCAAGTGCGAGATGTACAAGGGCGGCCCCAGCGGTTCT TCCAACATATACGACTACCTGTGCCTGCTGCCCCTGAATATACTGAACGA GAAAATCTTCGCCTTCCTGTGGATCTGGTTTATACTAGTGGCTATGCTCA TTGCCCTCAAGTTTCTGTACCGCCTGGCCACCGTTTTGTATCCCGGAATG CGTCTGCAGTTGCTTCGTGCCAGGGCACGTTTCATGCCCAAGAAGCACTT GCAGGTGGCACTGCGCAATTGCAGTTTCGGCGACTGGTTCGTGCTGATGC GCGTGGGCAACAACATCAGCCCCGAGCTATTCCGTAAGTTGCTAGAGGAG CTGTACGCAGCTCAGTCCTTGTTCAAAAAACCGCCGGGAGCGGACGAGAT C >D_yakuba_zpg-PB ATGTACGCAGCTGTAAAGCCGCTCTCCAAGTATCTGCAGTTCAAGTCGGT GCACATCTACGATGCCATTTTCACGCTGCACTCCAAAGTGACGGTGGCCC TGCTCTTGGCCTGCACCTTTCTGCTTTCCTCGAAACAATATTTCGGGGAT CCTATCCAGTGTTTTGGGGACAAGGACATGGACTACGTGCACGCCTTTTG CTGGATCTACGGCGCCTATGTGAGCGACAATGTGACTGTGGCGCCCTTGA AAAATGGCGCTGCCCAGTGCCGACCAGATGCTGTAAGTAAGGTGGTGCCA CCGGAGAGTCGCCACTACATCACCTACTATCAATGGGTGGTGCTGGTCCT GCTCCTCGAGTCGTTCGTCTTTTATTTGCCCGCCTTTCTCTGGAAGATTT GGGAGGGCGGTCGTCTGAAGCACTTGTGCGATGATTTCCACAAGATGGCC GTTTGCAAGGACAAGAGCAGGACTCAAATTCGCGTGCTGGTCAAATACTT CTCCAGCGACTACAAGGAGACCCACTTTCGCTACTTTGTCAGCTACGTCT TTTGTGAGATACTGAACTTGAGCATCAGTATTCTCAACTTTCTTCTATTG GACGTATTTTTCGGCGGTTTTTGGGGCCGCTACCGCGATGCCTTGCTATC GCTTTACAACGGTGATTATAACACGTGGAACATCATCACCATGGAGGTGT TTCCCAAGTGCGCCAAGTGCGAGATGTACAAGGGCGGCCCCAGCGGTTCG TCCAACATATACGACTACCTCTGCCTGCTGCCCCTGAATATACTGAACGA GAAGATCTTCGCCTTTCTGTGGCTGTGGTTTATACTGGTGGCCATGCTCG TTGCCCTAAAGTTCATGTACCGCCTGGCCACCGTTTTGTATCCCGGCATG CGCCTGCAGTTGCTGCGAGCCAGGGCACGTTTCATGCCCAAGACGCATCT GCAGGTGGCACTGCGCAATTGCAGTTTTGGCGACTGGTTCGTGCTGATGC GCGTGGGCAACAACATCAGCCCCGAGATATTCCGTAAGTTGCTGGAGGAG CTTTACGAAGCTCAGTCCTTGACCAAAATACCGCCGGGAGCGGATGAAAT C >D_erecta_zpg-PB ATGTACGCAGCTGTTAAGCCGCTGTCCAAGTATCTGCAGTTCAAGTCGGT GCACATCTACGATGCTATTTTCACGCTGCACTCGAAAGTTACGGTGGCCC TGCTTCTGGCCTGCACCTTTCTACTTTCCTCGAAACAATATTTCGGGGAT CCTATCCAGTGTTTTGGGGACAAGGACATGGACTACGTGCACGCCTTTTG CTGGATTTACGGGGCCTATGTGAGCGACAATGTGACTGTGGCGCCCCTGA GAAATGGCGCTGCACAGTGCCGACCAGATGCGGTGAGCAAGGTGGTGCCC CCGGAAAATCGCCACTACATCACCTACTATCAATGGGTGGTGCTGGTACT GCTCCTCGAGTCGTTTGTGTTCTATTTGCCCGCCTTTCTCTGGAAGATTT GGGAGGGCGGTCGGCTGAAGCATTTGTGCGATGATTTCCACAAGATGGCC GTTTGCAAGGACAAGAGCAGGACCCATCTTCGCGTACTGGTCAACTACTT CTCCAGCGACTACAAGGAGACCCACTTCCGCTACTTTGTCAGCTATGTCT TTTGTGAGATACTCAATTTGAGCATCAGTATTCTGAACTTCCTTCTATTG GATGTATTTTTCGGCGGTTTTTGGAGACGCTACCGCGATGCCTTGCTATC CCTCTACAACGGTGATTATAACCAGTGGAACATCATCACTATGGAGGTCT TTCCTAAGTGCGCCAAGTGCGAGATGTACAAGGGCGGGCCCAGCGGTTCG TCCAACATATACGACTACCTCTGCCTGCTGCCCCTGAATATACTAAACGA GAAGATCTTCGCCTTCTTGTGGATGTGGTTTATACTAGTGGCTGTGCTCG TTTCCCTAAAGTTCCTGTACCGCCTGGCCACCATTTTGTATCCGGGAATG CGCCTGCAGTTGCTTCGTGCCAGGGCGCGTTTCATGCCCAAGGCGCACTT ACAGGTGGCACTGCGCAATTGCAGTTTTGGCGACTGGTTCGTGCTGATGC GCGTGGGCAACAACATCAGCCCCGAAATATTCCGTAAGTTGCTGGAGGAG CTTTACGAAGCTCAGTCCTTGACCAAAATACCGCCAGGAGCGGACGAAAT C
>D_melanogaster_zpg-PB MYAAVKPLSKYLQFKSVHIYDAIFTLHSKVTVALLLACTFLLSSKQYFGD PIQCFGDKDMDYVHAFCWIYGAYVSDNVTVTPLRNGAAQCRPDAVSKVVP PENRNYITYYQWVVLVLLLESFVFYMPAFLWKIWEGGRLKHLCDDFHKMA VCKDKSRTHLRVLVNYFSSDYKETHFRYFVSYVFCEILNLSISILNFLLL DVFFGGFWGRYRNALLSLYNGDYNQWNIITMAVFPKCAKCEMYKGGPSGS SNIYDYLCLLPLNILNEKIFAFLWIWFILVAMLISLKFLYRLATVLYPGM RLQLLRARARFMPKKHLQVALRNCSFGDWFVLMRVGNNISPELFRKLLEE LYEAQSLIKIPPGADKI >D_simulans_zpg-PB MYAAVKPLSKYLQFKSVHIYDAIFTLHSKVTVALLLACTFLLSSKQYFGD PIQCFGDRDMDYVHAFCWIYGAYVSDNVTVTPLRNGAAQCRPDAVSKVVP PENRNYITYYQWVVLVLLLESFVFYMPAFLWKIWEGGRLKHLCDDFHKMA VCKDKSRTHLRVLVNYFSSDYKETHFRYFVSYVFCEILNLSISILNFLLL DVFFGGFWGRYRDALLSLYNGDYNQWNIITMAVFPKCAKCEMYKGGPSGS SNIYDYLCLLPLNILNEKIFAFLWIWFILVAMLIALKFLYRLATVLYPGM RLQLLRARARFMPKKHLQVALRNCSFGDWFVLMRVGNNISPELFRKLLEE LYAAQSLFKKPPGADEI >D_yakuba_zpg-PB MYAAVKPLSKYLQFKSVHIYDAIFTLHSKVTVALLLACTFLLSSKQYFGD PIQCFGDKDMDYVHAFCWIYGAYVSDNVTVAPLKNGAAQCRPDAVSKVVP PESRHYITYYQWVVLVLLLESFVFYLPAFLWKIWEGGRLKHLCDDFHKMA VCKDKSRTQIRVLVKYFSSDYKETHFRYFVSYVFCEILNLSISILNFLLL DVFFGGFWGRYRDALLSLYNGDYNTWNIITMEVFPKCAKCEMYKGGPSGS SNIYDYLCLLPLNILNEKIFAFLWLWFILVAMLVALKFMYRLATVLYPGM RLQLLRARARFMPKTHLQVALRNCSFGDWFVLMRVGNNISPEIFRKLLEE LYEAQSLTKIPPGADEI >D_erecta_zpg-PB MYAAVKPLSKYLQFKSVHIYDAIFTLHSKVTVALLLACTFLLSSKQYFGD PIQCFGDKDMDYVHAFCWIYGAYVSDNVTVAPLRNGAAQCRPDAVSKVVP PENRHYITYYQWVVLVLLLESFVFYLPAFLWKIWEGGRLKHLCDDFHKMA VCKDKSRTHLRVLVNYFSSDYKETHFRYFVSYVFCEILNLSISILNFLLL DVFFGGFWRRYRDALLSLYNGDYNQWNIITMEVFPKCAKCEMYKGGPSGS SNIYDYLCLLPLNILNEKIFAFLWMWFILVAVLVSLKFLYRLATILYPGM RLQLLRARARFMPKAHLQVALRNCSFGDWFVLMRVGNNISPEIFRKLLEE LYEAQSLTKIPPGADEI
#NEXUS [ID: 4566878172] begin taxa; dimensions ntax=4; taxlabels D_melanogaster_zpg-PB D_simulans_zpg-PB D_yakuba_zpg-PB D_erecta_zpg-PB ; end; begin trees; translate 1 D_melanogaster_zpg-PB, 2 D_simulans_zpg-PB, 3 D_yakuba_zpg-PB, 4 D_erecta_zpg-PB ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.03832634,2:0.02878059,(3:0.09934661,4:0.03717763)1.000:0.1105209); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.03832634,2:0.02878059,(3:0.09934661,4:0.03717763):0.1105209); end;
Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/444/zpg-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/zpg-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/444/zpg-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2329.15 -2342.16 2 -2329.12 -2339.32 -------------------------------------- TOTAL -2329.13 -2341.52 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/444/zpg-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/zpg-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/444/zpg-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.325907 0.003289 0.223357 0.439625 0.319262 1207.42 1285.00 1.001 r(A<->C){all} 0.131589 0.001361 0.063823 0.205497 0.128520 988.27 1089.63 1.000 r(A<->G){all} 0.398423 0.004494 0.277841 0.535280 0.395721 623.19 697.14 1.000 r(A<->T){all} 0.042734 0.000602 0.000756 0.088180 0.039315 883.37 1060.28 1.000 r(C<->G){all} 0.061263 0.000503 0.019579 0.105591 0.059478 1156.27 1238.34 1.000 r(C<->T){all} 0.315396 0.003081 0.208095 0.423592 0.314097 684.18 779.26 1.000 r(G<->T){all} 0.050596 0.000438 0.011354 0.089464 0.048339 1120.88 1147.28 1.001 pi(A){all} 0.211751 0.000141 0.189340 0.235089 0.211474 1274.34 1387.67 1.001 pi(C){all} 0.267992 0.000158 0.242656 0.291099 0.268020 1213.84 1326.01 1.000 pi(G){all} 0.257018 0.000159 0.233250 0.282260 0.257198 1041.61 1155.35 1.002 pi(T){all} 0.263239 0.000161 0.239110 0.289078 0.263315 1090.33 1091.96 1.000 alpha{1,2} 0.050342 0.001145 0.000169 0.112103 0.045912 1034.95 1170.11 1.000 alpha{3} 2.628889 0.784818 1.170384 4.430223 2.492902 1315.13 1408.07 1.002 pinvar{all} 0.520892 0.004272 0.392716 0.641791 0.526515 1310.63 1358.06 1.001 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/444/zpg-PB/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio for branches, Codon frequency model: F3x4 Site-class models: ns = 4 ls = 367 Codon usage in sequences ------------------------------------------------------------------------------------------------------ Phe TTT 11 10 15 12 | Ser TCT 1 1 0 0 | Tyr TAT 7 7 7 8 | Cys TGT 3 2 2 2 TTC 16 18 12 15 | TCC 8 7 6 7 | TAC 17 17 17 16 | TGC 8 9 9 9 Leu TTA 0 0 0 1 | TCA 0 0 0 0 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0 TTG 14 14 11 10 | TCG 3 3 5 5 | TAG 0 0 0 0 | Trp TGG 9 9 9 9 ------------------------------------------------------------------------------------------------------ Leu CTT 7 5 4 6 | Pro CCT 0 0 1 2 | His CAT 2 3 1 2 | Arg CGT 6 4 3 3 CTC 6 6 8 7 | CCC 9 8 8 7 | CAC 6 5 7 7 | CGC 6 8 9 9 CTA 5 6 3 6 | CCA 3 2 2 2 | Gln CAA 1 1 3 2 | CGA 1 0 2 1 CTG 18 19 23 20 | CCG 3 5 4 4 | CAG 8 8 6 7 | CGG 1 2 0 1 ------------------------------------------------------------------------------------------------------ Ile ATT 5 4 4 5 | Thr ACT 1 1 2 2 | Asn AAT 8 7 4 6 | Ser AGT 3 3 4 2 ATC 8 11 10 9 | ACC 5 4 6 6 | AAC 9 9 9 9 | AGC 7 7 7 8 ATA 8 4 6 6 | ACA 2 2 0 0 | Lys AAA 6 5 5 3 | Arg AGA 0 1 0 2 Met ATG 10 10 10 9 | ACG 2 3 4 2 | AAG 17 17 18 18 | AGG 3 3 2 2 ------------------------------------------------------------------------------------------------------ Val GTT 5 5 3 4 | Ala GCT 5 4 4 5 | Asp GAT 7 6 8 8 | Gly GGT 3 3 4 4 GTC 5 5 5 4 | GCC 10 12 15 11 | GAC 9 11 9 9 | GGC 8 9 10 6 GTA 4 3 3 3 | GCA 6 7 3 3 | Glu GAA 3 1 2 4 | GGA 4 2 1 2 GTG 13 14 17 17 | GCG 2 2 2 5 | GAG 8 10 11 9 | GGG 2 3 2 4 ------------------------------------------------------------------------------------------------------ Codon position x base (3x4) table for each sequence. #1: D_melanogaster_zpg-PB position 1: T:0.26431 C:0.22343 A:0.25613 G:0.25613 position 2: T:0.36785 C:0.16349 A:0.29428 G:0.17439 position 3: T:0.20163 C:0.37330 A:0.11717 G:0.30790 Average T:0.27793 C:0.25341 A:0.22252 G:0.24614 #2: D_simulans_zpg-PB position 1: T:0.26431 C:0.22343 A:0.24796 G:0.26431 position 2: T:0.36512 C:0.16621 A:0.29155 G:0.17711 position 3: T:0.17711 C:0.39782 A:0.09264 G:0.33243 Average T:0.26885 C:0.26249 A:0.21072 G:0.25795 #3: D_yakuba_zpg-PB position 1: T:0.25341 C:0.22888 A:0.24796 G:0.26975 position 2: T:0.36512 C:0.16894 A:0.29155 G:0.17439 position 3: T:0.17984 C:0.40054 A:0.08174 G:0.33787 Average T:0.26612 C:0.26612 A:0.20708 G:0.26067 #4: D_erecta_zpg-PB position 1: T:0.25613 C:0.23433 A:0.24251 G:0.26703 position 2: T:0.36512 C:0.16621 A:0.29428 G:0.17439 position 3: T:0.19346 C:0.37875 A:0.09537 G:0.33243 Average T:0.27157 C:0.25976 A:0.21072 G:0.25795 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 48 | Ser S TCT 2 | Tyr Y TAT 29 | Cys C TGT 9 TTC 61 | TCC 28 | TAC 67 | TGC 35 Leu L TTA 1 | TCA 0 | *** * TAA 0 | *** * TGA 0 TTG 49 | TCG 16 | TAG 0 | Trp W TGG 36 ------------------------------------------------------------------------------ Leu L CTT 22 | Pro P CCT 3 | His H CAT 8 | Arg R CGT 16 CTC 27 | CCC 32 | CAC 25 | CGC 32 CTA 20 | CCA 9 | Gln Q CAA 7 | CGA 4 CTG 80 | CCG 16 | CAG 29 | CGG 4 ------------------------------------------------------------------------------ Ile I ATT 18 | Thr T ACT 6 | Asn N AAT 25 | Ser S AGT 12 ATC 38 | ACC 21 | AAC 36 | AGC 29 ATA 24 | ACA 4 | Lys K AAA 19 | Arg R AGA 3 Met M ATG 39 | ACG 11 | AAG 70 | AGG 10 ------------------------------------------------------------------------------ Val V GTT 17 | Ala A GCT 18 | Asp D GAT 29 | Gly G GGT 14 GTC 19 | GCC 48 | GAC 38 | GGC 33 GTA 13 | GCA 19 | Glu E GAA 10 | GGA 9 GTG 61 | GCG 11 | GAG 38 | GGG 11 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.25954 C:0.22752 A:0.24864 G:0.26431 position 2: T:0.36580 C:0.16621 A:0.29292 G:0.17507 position 3: T:0.18801 C:0.38760 A:0.09673 G:0.32766 Average T:0.27112 C:0.26045 A:0.21276 G:0.25568 Nei & Gojobori 1986. dN/dS (dN, dS) (Note: This matrix is not used in later ML. analysis. Use runmode = -2 for ML pairwise comparison.) D_melanogaster_zpg-PB D_simulans_zpg-PB 0.0536 (0.0083 0.1544) D_yakuba_zpg-PB 0.0570 (0.0258 0.4522) 0.0778 (0.0282 0.3625) D_erecta_zpg-PB 0.0533 (0.0197 0.3694) 0.0757 (0.0246 0.3246) 0.0683 (0.0173 0.2535) Model 0: one-ratio TREE # 1: (1, 2, (3, 4)); MP score: 153 lnL(ntime: 5 np: 7): -2184.381091 +0.000000 5..1 5..2 5..6 6..3 6..4 0.066343 0.057237 0.151391 0.142846 0.073806 1.970813 0.058239 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.49162 (1: 0.066343, 2: 0.057237, (3: 0.142846, 4: 0.073806): 0.151391); (D_melanogaster_zpg-PB: 0.066343, D_simulans_zpg-PB: 0.057237, (D_yakuba_zpg-PB: 0.142846, D_erecta_zpg-PB: 0.073806): 0.151391); Detailed output identifying parameters kappa (ts/tv) = 1.97081 omega (dN/dS) = 0.05824 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 5..1 0.066 859.0 242.0 0.0582 0.0049 0.0834 4.2 20.2 5..2 0.057 859.0 242.0 0.0582 0.0042 0.0719 3.6 17.4 5..6 0.151 859.0 242.0 0.0582 0.0111 0.1903 9.5 46.0 6..3 0.143 859.0 242.0 0.0582 0.0105 0.1795 9.0 43.4 6..4 0.074 859.0 242.0 0.0582 0.0054 0.0928 4.6 22.4 tree length for dN: 0.0360 tree length for dS: 0.6179 Time used: 0:01 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, (3, 4)); MP score: 153 lnL(ntime: 5 np: 8): -2177.492180 +0.000000 5..1 5..2 5..6 6..3 6..4 0.068231 0.058316 0.156926 0.148888 0.076027 2.075607 0.931554 0.015392 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.50839 (1: 0.068231, 2: 0.058316, (3: 0.148888, 4: 0.076027): 0.156926); (D_melanogaster_zpg-PB: 0.068231, D_simulans_zpg-PB: 0.058316, (D_yakuba_zpg-PB: 0.148888, D_erecta_zpg-PB: 0.076027): 0.156926); Detailed output identifying parameters kappa (ts/tv) = 2.07561 dN/dS (w) for site classes (K=2) p: 0.93155 0.06845 w: 0.01539 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 5..1 0.068 856.6 244.4 0.0828 0.0066 0.0794 5.6 19.4 5..2 0.058 856.6 244.4 0.0828 0.0056 0.0679 4.8 16.6 5..6 0.157 856.6 244.4 0.0828 0.0151 0.1826 13.0 44.6 6..3 0.149 856.6 244.4 0.0828 0.0143 0.1733 12.3 42.4 6..4 0.076 856.6 244.4 0.0828 0.0073 0.0885 6.3 21.6 Time used: 0:03 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, (3, 4)); MP score: 153 lnL(ntime: 5 np: 10): -2177.492180 +0.000000 5..1 5..2 5..6 6..3 6..4 0.068231 0.058316 0.156926 0.148888 0.076027 2.075606 0.931554 0.055934 0.015392 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.50839 (1: 0.068231, 2: 0.058316, (3: 0.148888, 4: 0.076027): 0.156926); (D_melanogaster_zpg-PB: 0.068231, D_simulans_zpg-PB: 0.058316, (D_yakuba_zpg-PB: 0.148888, D_erecta_zpg-PB: 0.076027): 0.156926); Detailed output identifying parameters kappa (ts/tv) = 2.07561 dN/dS (w) for site classes (K=3) p: 0.93155 0.05593 0.01251 w: 0.01539 1.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 5..1 0.068 856.6 244.4 0.0828 0.0066 0.0794 5.6 19.4 5..2 0.058 856.6 244.4 0.0828 0.0056 0.0679 4.8 16.6 5..6 0.157 856.6 244.4 0.0828 0.0151 0.1826 13.0 44.6 6..3 0.149 856.6 244.4 0.0828 0.0143 0.1733 12.3 42.4 6..4 0.076 856.6 244.4 0.0828 0.0073 0.0885 6.3 21.6 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_zpg-PB) Pr(w>1) post mean +- SE for w 225 Q 0.539 1.299 +- 0.599 275 I 0.508 1.259 +- 0.610 315 K 0.541 1.301 +- 0.595 The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 w2: 0.853 0.119 0.019 0.005 0.002 0.001 0.000 0.000 0.000 0.000 Posterior for p0-p1 (see the ternary graph) 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000 sum of density on p0-p1 = 1.000000 Time used: 0:07 Model 3: discrete (3 categories) TREE # 1: (1, 2, (3, 4)); MP score: 153 lnL(ntime: 5 np: 11): -2176.733169 +0.000000 5..1 5..2 5..6 6..3 6..4 0.067659 0.058091 0.156097 0.147669 0.075589 2.028129 0.509062 0.360315 0.000001 0.000001 0.551985 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.50510 (1: 0.067659, 2: 0.058091, (3: 0.147669, 4: 0.075589): 0.156097); (D_melanogaster_zpg-PB: 0.067659, D_simulans_zpg-PB: 0.058091, (D_yakuba_zpg-PB: 0.147669, D_erecta_zpg-PB: 0.075589): 0.156097); Detailed output identifying parameters kappa (ts/tv) = 2.02813 dN/dS (w) for site classes (K=3) p: 0.50906 0.36031 0.13062 w: 0.00000 0.00000 0.55198 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 5..1 0.068 857.7 243.3 0.0721 0.0059 0.0814 5.0 19.8 5..2 0.058 857.7 243.3 0.0721 0.0050 0.0699 4.3 17.0 5..6 0.156 857.7 243.3 0.0721 0.0135 0.1877 11.6 45.7 6..3 0.148 857.7 243.3 0.0721 0.0128 0.1776 11.0 43.2 6..4 0.076 857.7 243.3 0.0721 0.0066 0.0909 5.6 22.1 Naive Empirical Bayes (NEB) analysis Time used: 0:10 Model 7: beta (10 categories) TREE # 1: (1, 2, (3, 4)); MP score: 153 lnL(ntime: 5 np: 8): -2176.885819 +0.000000 5..1 5..2 5..6 6..3 6..4 0.067573 0.057983 0.155846 0.147514 0.075460 2.029992 0.040893 0.516071 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.50438 (1: 0.067573, 2: 0.057983, (3: 0.147514, 4: 0.075460): 0.155846); (D_melanogaster_zpg-PB: 0.067573, D_simulans_zpg-PB: 0.057983, (D_yakuba_zpg-PB: 0.147514, D_erecta_zpg-PB: 0.075460): 0.155846); Detailed output identifying parameters kappa (ts/tv) = 2.02999 Parameters in M7 (beta): p = 0.04089 q = 0.51607 dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00009 0.00307 0.06367 0.65192 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 5..1 0.068 857.6 243.4 0.0719 0.0058 0.0813 5.0 19.8 5..2 0.058 857.6 243.4 0.0719 0.0050 0.0698 4.3 17.0 5..6 0.156 857.6 243.4 0.0719 0.0135 0.1875 11.6 45.6 6..3 0.148 857.6 243.4 0.0719 0.0128 0.1775 10.9 43.2 6..4 0.075 857.6 243.4 0.0719 0.0065 0.0908 5.6 22.1 Time used: 0:19 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, (3, 4)); MP score: 153 lnL(ntime: 5 np: 10): -2176.891958 +0.000000 5..1 5..2 5..6 6..3 6..4 0.067589 0.057983 0.155720 0.147407 0.075507 2.003173 0.997729 0.042994 0.557763 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.50421 (1: 0.067589, 2: 0.057983, (3: 0.147407, 4: 0.075507): 0.155720); (D_melanogaster_zpg-PB: 0.067589, D_simulans_zpg-PB: 0.057983, (D_yakuba_zpg-PB: 0.147407, D_erecta_zpg-PB: 0.075507): 0.155720); Detailed output identifying parameters kappa (ts/tv) = 2.00317 Parameters in M8 (beta&w>1): p0 = 0.99773 p = 0.04299 q = 0.55776 (p1 = 0.00227) w = 1.00000 dN/dS (w) for site classes (K=11) p: 0.09977 0.09977 0.09977 0.09977 0.09977 0.09977 0.09977 0.09977 0.09977 0.09977 0.00227 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00013 0.00364 0.06510 0.62241 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 5..1 0.068 858.3 242.7 0.0712 0.0058 0.0816 5.0 19.8 5..2 0.058 858.3 242.7 0.0712 0.0050 0.0700 4.3 17.0 5..6 0.156 858.3 242.7 0.0712 0.0134 0.1881 11.5 45.7 6..3 0.147 858.3 242.7 0.0712 0.0127 0.1780 10.9 43.2 6..4 0.076 858.3 242.7 0.0712 0.0065 0.0912 5.6 22.1 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_zpg-PB) Pr(w>1) post mean +- SE for w 160 L 0.539 0.968 +- 0.721 225 Q 0.647 1.165 +- 0.607 275 I 0.600 1.105 +- 0.623 285 S 0.572 1.067 +- 0.626 315 K 0.653 1.172 +- 0.605 358 I 0.547 1.035 +- 0.629 The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000 p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 q : 0.000 0.000 0.000 0.000 0.000 0.002 0.019 0.085 0.262 0.632 ws: 0.941 0.053 0.005 0.001 0.000 0.000 0.000 0.000 0.000 0.000 Time used: 0:38
Model 1: NearlyNeutral -2177.49218 Model 2: PositiveSelection -2177.49218 Model 0: one-ratio -2184.381091 Model 3: discrete -2176.733169 Model 7: beta -2176.885819 Model 8: beta&w>1 -2176.891958 Model 0 vs 1 13.777822000000015 Model 2 vs 1 0.0 Model 8 vs 7 0.012278000000151224